BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22336_g1_i1 len=2455 path=[2373:0-151 4723:152-252 @2525@!:253-1000
3273:1001-1005 3278:1006-1230 3503:1231-2454]

Length=2455
                                                                      Score     E

ref|XP_009792802.1|  PREDICTED: uncharacterized protein LOC104239780    610   0.0      
ref|XP_009610936.1|  PREDICTED: uncharacterized protein LOC104104533    598   0.0      
ref|XP_009591704.1|  PREDICTED: uncharacterized protein LOC104088...    594   0.0      
ref|XP_009802246.1|  PREDICTED: uncharacterized protein LOC104247...    586   0.0      
ref|XP_006340829.1|  PREDICTED: uncharacterized protein LOC102592062    582   0.0      
ref|XP_004234515.1|  PREDICTED: uncharacterized protein LOC101265...    578   0.0      
ref|XP_004232557.1|  PREDICTED: uncharacterized protein LOC101254858    574   0.0      
ref|XP_006343336.1|  PREDICTED: uncharacterized protein LOC102605...    570   0.0      
ref|XP_006343335.1|  PREDICTED: uncharacterized protein LOC102605...    566   0.0      
ref|XP_009591705.1|  PREDICTED: uncharacterized protein LOC104088...    552   0.0      
ref|XP_009802248.1|  PREDICTED: uncharacterized protein LOC104247...    546   2e-180   
ref|XP_010649309.1|  PREDICTED: uncharacterized protein LOC104879172    528   5e-173   
ref|XP_010317682.1|  PREDICTED: uncharacterized protein LOC101265...    524   4e-171   
ref|XP_007046524.1|  Polynucleotide adenylyltransferase family pr...    513   6e-167   
ref|XP_002521705.1|  poly(A) polymerase, putative                       509   5e-166   Ricinus communis
ref|XP_008242074.1|  PREDICTED: uncharacterized protein LOC103340431    505   4e-164   
ref|XP_007202880.1|  hypothetical protein PRUPE_ppa015787mg             503   1e-163   
emb|CDP01805.1|  unnamed protein product                                495   1e-163   
gb|KHG16993.1|  putative poly (A) polymerase                            496   2e-160   
ref|XP_006467069.1|  PREDICTED: uncharacterized protein LOC102627987    493   9e-160   
gb|KDO71447.1|  hypothetical protein CISIN_1g005593mg                   490   2e-158   
ref|XP_006425301.1|  hypothetical protein CICLE_v10025049mg             489   4e-158   
gb|KDO71445.1|  hypothetical protein CISIN_1g005593mg                   487   2e-157   
gb|KDO71446.1|  hypothetical protein CISIN_1g005593mg                   484   2e-156   
ref|XP_010266171.1|  PREDICTED: uncharacterized protein LOC104603752    485   5e-156   
ref|XP_009337105.1|  PREDICTED: uncharacterized protein LOC103929612    483   4e-155   
ref|XP_009344668.1|  PREDICTED: uncharacterized protein LOC103936543    481   2e-154   
ref|XP_009350727.1|  PREDICTED: uncharacterized protein LOC103942263    480   3e-154   
ref|XP_008448487.1|  PREDICTED: putative CCA tRNA nucleotidyltran...    469   2e-152   
gb|KGN55614.1|  hypothetical protein Csa_3G002350                       476   8e-152   
ref|XP_004146209.1|  PREDICTED: uncharacterized protein LOC101212579    476   2e-151   
ref|XP_011079124.1|  PREDICTED: uncharacterized protein LOC105162718    467   1e-150   
ref|XP_004287737.1|  PREDICTED: uncharacterized protein LOC101302293    469   3e-150   
ref|XP_008392492.1|  PREDICTED: uncharacterized protein LOC103454675    469   6e-150   
ref|XP_010531003.1|  PREDICTED: uncharacterized protein LOC104807432    466   3e-149   
ref|XP_004159755.1|  PREDICTED: uncharacterized LOC101212579            462   2e-148   
ref|XP_008789358.1|  PREDICTED: uncharacterized protein LOC103706875    449   9e-145   
ref|XP_003516528.1|  PREDICTED: uncharacterized protein LOC100794882    445   7e-141   
ref|XP_011022149.1|  PREDICTED: uncharacterized protein LOC105124023    447   4e-140   
ref|XP_010918240.1|  PREDICTED: uncharacterized protein LOC105042652    437   6e-140   
ref|XP_010029591.1|  PREDICTED: uncharacterized protein LOC104419...    442   1e-139   
ref|XP_002307206.2|  hypothetical protein POPTR_0005s10310g             445   4e-139   Populus trichocarpa [western balsam poplar]
ref|XP_010029590.1|  PREDICTED: uncharacterized protein LOC104419...    437   1e-137   
gb|KFK42256.1|  hypothetical protein AALP_AA2G231700                    431   1e-134   
ref|XP_010679948.1|  PREDICTED: uncharacterized protein LOC104895...    429   3e-134   
ref|XP_007157989.1|  hypothetical protein PHAVU_002G115200g             428   5e-134   
ref|XP_003612324.1|  Poly(A) polymerase                                 423   9e-133   
gb|AES95282.2|  tRNA nucleotidyltransferase/poly(A) polymerase          422   3e-132   
ref|NP_179349.2|  polynucleotide adenylyltransferase family protein     423   7e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299875.1|  hypothetical protein CARUB_v10016083mg             421   7e-131   
ref|XP_002884069.1|  polynucleotide adenylyltransferase family pr...    417   1e-129   
ref|XP_009150783.1|  PREDICTED: uncharacterized protein LOC103874114    414   2e-128   
ref|XP_009413056.1|  PREDICTED: uncharacterized protein LOC103994446    404   2e-127   
emb|CDY29183.1|  BnaA06g25740D                                          409   5e-127   
emb|CDY54365.1|  BnaC03g74530D                                          409   1e-126   
ref|XP_004512255.1|  PREDICTED: uncharacterized protein LOC101494...    412   1e-126   
ref|XP_010679949.1|  PREDICTED: uncharacterized protein LOC104895...    398   4e-126   
ref|XP_004512256.1|  PREDICTED: uncharacterized protein LOC101494...    410   6e-126   
gb|KHN35967.1|  Putative poly(A) polymerase                             405   8e-126   
ref|XP_010467537.1|  PREDICTED: uncharacterized protein LOC104747583    405   7e-125   
ref|XP_006409281.1|  hypothetical protein EUTSA_v10022570mg             405   9e-125   
ref|XP_003562137.1|  PREDICTED: uncharacterized protein LOC100829983    385   8e-120   
ref|XP_006828719.1|  hypothetical protein AMTR_s00001p00028400          382   7e-119   
gb|EEC74451.1|  hypothetical protein OsI_09859                          379   3e-117   Oryza sativa Indica Group [Indian rice]
ref|NP_001048863.1|  Os03g0131400                                       378   4e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649333.1|  PREDICTED: uncharacterized protein LOC102707...    374   5e-116   
tpg|DAA43182.1|  TPA: hypothetical protein ZEAMMB73_451476              374   1e-115   
emb|CBI38416.3|  unnamed protein product                                360   1e-114   
ref|XP_004985839.1|  PREDICTED: uncharacterized protein LOC101779480    367   3e-113   
ref|XP_006649334.1|  PREDICTED: uncharacterized protein LOC102707...    363   4e-112   
tpg|DAA43183.1|  TPA: hypothetical protein ZEAMMB73_451476              357   3e-110   
gb|KDP43752.1|  hypothetical protein JCGZ_22379                         360   3e-109   
ref|XP_010249182.1|  PREDICTED: uncharacterized protein LOC104591829    356   5e-109   
ref|XP_002266814.1|  PREDICTED: uncharacterized protein LOC100259...    343   3e-104   Vitis vinifera
ref|XP_006649335.1|  PREDICTED: uncharacterized protein LOC102707...    340   1e-103   
ref|XP_002890760.1|  polynucleotide adenylyltransferase family pr...    341   3e-103   
ref|XP_008352413.1|  PREDICTED: CCA tRNA nucleotidyltransferase 1...    334   3e-103   
ref|XP_002304649.1|  polynucleotide adenylyltransferase family pr...    340   3e-103   Populus trichocarpa [western balsam poplar]
ref|XP_010682660.1|  PREDICTED: uncharacterized protein LOC104897475    341   3e-103   
ref|NP_001077613.1|  polynucleotide adenylyltransferase family pr...    338   5e-103   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973924.1|  polynucleotide adenylyltransferase family protein     338   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478164.1|  PREDICTED: uncharacterized protein LOC104757145    339   2e-102   
ref|XP_006844503.1|  hypothetical protein AMTR_s00016p00133200          337   3e-102   
ref|XP_010029592.1|  PREDICTED: uncharacterized protein LOC104419...    340   5e-102   
ref|NP_174130.2|  polynucleotide adenylyltransferase family protein     338   6e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011020858.1|  PREDICTED: uncharacterized protein LOC105123...    336   1e-101   
ref|XP_011020856.1|  PREDICTED: uncharacterized protein LOC105123...    336   1e-101   
emb|CDY60479.1|  BnaCnng36340D                                          337   1e-101   
ref|XP_010499302.1|  PREDICTED: uncharacterized protein LOC104776...    337   1e-101   
ref|XP_006307190.1|  hypothetical protein CARUB_v10008782mg             336   2e-101   
ref|XP_009113704.1|  PREDICTED: uncharacterized protein LOC103838989    335   3e-101   
gb|KDP22554.1|  hypothetical protein JCGZ_26385                         335   3e-101   
ref|XP_010460579.1|  PREDICTED: uncharacterized protein LOC104741415    335   7e-101   
ref|XP_006436931.1|  hypothetical protein CICLE_v10031219mg             332   3e-100   
gb|EPS60978.1|  hypothetical protein M569_13823                         329   4e-100   
ref|XP_009604520.1|  PREDICTED: uncharacterized protein LOC104099...    330   3e-99    
ref|XP_009779993.1|  PREDICTED: putative CCA tRNA nucleotidyltran...    330   3e-99    
ref|XP_007038104.1|  Polynucleotide adenylyltransferase family pr...    330   4e-99    
ref|XP_006415699.1|  hypothetical protein EUTSA_v10007307mg             330   6e-99    
ref|XP_010656776.1|  PREDICTED: uncharacterized protein LOC100259...    325   1e-98    
ref|XP_006361913.1|  PREDICTED: uncharacterized protein LOC102603...    326   4e-98    
ref|XP_006361912.1|  PREDICTED: uncharacterized protein LOC102603...    326   1e-97    
ref|XP_010929642.1|  PREDICTED: uncharacterized protein LOC105051...    326   2e-97    
ref|XP_006485116.1|  PREDICTED: uncharacterized protein LOC102608...    325   2e-97    
ref|XP_008454134.1|  PREDICTED: uncharacterized protein LOC103494...    325   3e-97    
ref|XP_008239544.1|  PREDICTED: uncharacterized protein LOC103338135    325   3e-97    
ref|XP_010066437.1|  PREDICTED: uncharacterized protein LOC104453...    324   8e-97    
ref|XP_009779994.1|  PREDICTED: uncharacterized protein LOC104229...    323   1e-96    
ref|XP_011042946.1|  PREDICTED: uncharacterized protein LOC105138540    322   1e-96    
ref|XP_009604528.1|  PREDICTED: uncharacterized protein LOC104099...    323   1e-96    
ref|XP_010113247.1|  Poly(A) polymerase                                 330   1e-96    
gb|KCW64326.1|  hypothetical protein EUGRSUZ_G01958                     323   2e-96    
ref|XP_007209947.1|  hypothetical protein PRUPE_ppa004759mg             321   2e-96    
ref|XP_011013323.1|  PREDICTED: uncharacterized protein LOC105117373    322   3e-96    
emb|CDO98660.1|  unnamed protein product                                322   3e-96    
ref|XP_009790370.1|  PREDICTED: uncharacterized protein LOC104237...    321   5e-96    
ref|XP_004228444.1|  PREDICTED: putative CCA tRNA nucleotidyltran...    321   5e-96    
gb|KEH35694.1|  tRNA nucleotidyltransferase/poly(A) polymerase          322   7e-96    
ref|XP_009790371.1|  PREDICTED: uncharacterized protein LOC104237...    320   8e-96    
gb|KEH35695.1|  tRNA nucleotidyltransferase/poly(A) polymerase          320   1e-95    
ref|XP_009607914.1|  PREDICTED: uncharacterized protein LOC104102...    320   1e-95    
ref|XP_006436933.1|  hypothetical protein CICLE_v10031219mg             317   2e-95    
ref|XP_004157007.1|  PREDICTED: poly(A) polymerase-like                 318   7e-95    
ref|XP_002318161.2|  polynucleotide adenylyltransferase family pr...    317   1e-94    Populus trichocarpa [western balsam poplar]
ref|XP_004152154.1|  PREDICTED: poly(A) polymerase-like                 318   1e-94    
ref|XP_009390835.1|  PREDICTED: uncharacterized protein LOC103977130    318   2e-94    
ref|XP_008791060.1|  PREDICTED: uncharacterized protein LOC103708071    317   3e-94    
gb|KHG14471.1|  Poly (A) polymerase                                     317   3e-94    
ref|XP_010499303.1|  PREDICTED: uncharacterized protein LOC104776...    316   6e-94    
ref|XP_011073135.1|  PREDICTED: uncharacterized protein LOC105158182    315   8e-94    
ref|XP_006361914.1|  PREDICTED: uncharacterized protein LOC102603...    312   1e-93    
ref|XP_004503795.1|  PREDICTED: poly(A) polymerase-like                 315   1e-93    
gb|AET05044.2|  tRNA nucleotidyltransferase/poly(A) polymerase          315   1e-93    
ref|XP_002511109.1|  poly(A) polymerase, putative                       315   2e-93    Ricinus communis
ref|XP_008464383.1|  PREDICTED: uncharacterized protein LOC103502...    313   4e-93    
gb|AAG51472.1|AC069471_3  hypothetical protein                          311   8e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010678332.1|  PREDICTED: uncharacterized protein LOC104893895    313   2e-92    
gb|KEH20978.1|  tRNA nucleotidyltransferase/poly(A) polymerase          308   8e-92    
gb|KGN63445.1|  hypothetical protein Csa_1G000690                       309   2e-91    
ref|XP_004161378.1|  PREDICTED: poly(A) polymerase-like                 310   5e-91    
ref|XP_004501740.1|  PREDICTED: CCA-adding enzyme-like                  308   6e-91    
ref|XP_004297502.1|  PREDICTED: uncharacterized protein LOC101314744    305   5e-90    
gb|EMT05038.1|  Putative poly(A) polymerase                             304   1e-89    
ref|NP_001168693.1|  hypothetical protein                               305   1e-89    Zea mays [maize]
tpg|DAA38070.1|  TPA: hypothetical protein ZEAMMB73_877949              302   1e-89    
ref|XP_006436932.1|  hypothetical protein CICLE_v10031219mg             297   4e-89    
ref|XP_009607919.1|  PREDICTED: uncharacterized protein LOC104102...    301   5e-89    
ref|XP_010239840.1|  PREDICTED: uncharacterized protein LOC100821667    301   2e-88    
ref|XP_006584696.1|  PREDICTED: uncharacterized protein LOC100801...    300   2e-88    
ref|XP_002321741.1|  polynucleotide adenylyltransferase family pr...    299   5e-88    Populus trichocarpa [western balsam poplar]
ref|XP_007159981.1|  hypothetical protein PHAVU_002G283000g             300   8e-88    
ref|XP_003532392.2|  PREDICTED: uncharacterized protein LOC100801...    300   9e-88    
ref|XP_008374181.1|  PREDICTED: uncharacterized protein LOC103437...    299   1e-87    
ref|XP_003630568.1|  Poly(A) polymerase                                 300   1e-87    
ref|XP_008374180.1|  PREDICTED: uncharacterized protein LOC103437...    299   1e-87    
ref|NP_001052662.1|  Os04g0395900                                       299   2e-87    Oryza sativa Japonica Group [Japonica rice]
gb|EAY93937.1|  hypothetical protein OsI_15711                          299   2e-87    Oryza sativa Indica Group [Indian rice]
ref|XP_004975447.1|  PREDICTED: uncharacterized protein LOC101786112    298   2e-87    
ref|XP_008454136.1|  PREDICTED: uncharacterized protein LOC103494...    298   3e-87    
ref|XP_002872067.1|  polynucleotide adenylyltransferase family pr...    298   3e-87    
gb|KHN17469.1|  Poly(A) polymerase                                      298   6e-87    
ref|XP_004138025.1|  PREDICTED: poly(A) polymerase-like                 294   8e-87    
ref|NP_197758.2|  polynucleotide adenylyltransferase family protein     296   9e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550754.1|  PREDICTED: uncharacterized protein LOC104821535    296   1e-86    
ref|XP_011002101.1|  PREDICTED: uncharacterized protein LOC105109...    296   1e-86    
ref|XP_010109202.1|  Poly(A) polymerase                                 295   2e-86    
gb|AAL67117.1|  AT5g23690/MQM1_4                                        295   3e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008668345.1|  PREDICTED: hypothetical protein isoform X1         296   4e-86    
ref|XP_002447721.1|  hypothetical protein SORBIDRAFT_06g014480          295   6e-86    Sorghum bicolor [broomcorn]
ref|XP_004235296.1|  PREDICTED: uncharacterized protein LOC101251...    293   9e-86    
ref|XP_009368790.1|  PREDICTED: uncharacterized protein LOC103958...    293   9e-86    
ref|XP_010421177.1|  PREDICTED: uncharacterized protein LOC104706666    293   2e-85    
ref|XP_011002102.1|  PREDICTED: uncharacterized protein LOC105109...    291   2e-85    
ref|XP_010538159.1|  PREDICTED: uncharacterized protein LOC104812...    293   3e-85    
ref|XP_009368789.1|  PREDICTED: uncharacterized protein LOC103958...    292   4e-85    
ref|XP_006578722.1|  PREDICTED: CCA tRNA nucleotidyltransferase 1...    285   2e-84    
ref|XP_010454656.1|  PREDICTED: uncharacterized protein LOC104736383    290   3e-84    
ref|XP_007137889.1|  hypothetical protein PHAVU_009G164400g             287   4e-84    
dbj|BAC41875.1|  putative poly(A) polymerase                            290   7e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493491.1|  PREDICTED: uncharacterized protein LOC104770...    288   1e-83    
ref|XP_010503525.1|  PREDICTED: uncharacterized protein LOC104780704    288   1e-83    
ref|XP_010515211.1|  PREDICTED: uncharacterized protein LOC104791106    287   2e-83    
ref|XP_006287492.1|  hypothetical protein CARUB_v10000701mg             287   3e-83    
ref|XP_009607901.1|  PREDICTED: uncharacterized protein LOC104102...    283   5e-82    
ref|XP_009607910.1|  PREDICTED: uncharacterized protein LOC104102...    283   7e-82    
ref|XP_006652226.1|  PREDICTED: CCA tRNA nucleotidyltransferase 1...    281   1e-81    
ref|XP_010318327.1|  PREDICTED: uncharacterized protein LOC101251...    280   3e-81    
gb|EYU29621.1|  hypothetical protein MIMGU_mgv1a0199721mg               273   3e-81    
ref|XP_006404213.1|  hypothetical protein EUTSA_v10010292mg             281   3e-81    
ref|XP_010426382.1|  PREDICTED: uncharacterized protein LOC104711381    280   6e-81    
ref|XP_010493490.1|  PREDICTED: uncharacterized protein LOC104770...    281   6e-81    
ref|XP_002875928.1|  predicted protein                                  283   7e-81    
ref|XP_006290905.1|  hypothetical protein CARUB_v10017016mg             279   2e-80    
gb|KHN16874.1|  Poly(A) polymerase                                      279   3e-80    
ref|XP_006363976.1|  PREDICTED: uncharacterized protein LOC102596961    278   4e-80    
gb|KFK34184.1|  hypothetical protein AALP_AA5G111500                    278   5e-80    
gb|KFK27655.1|  hypothetical protein AALP_AA8G411400                    279   5e-80    
ref|XP_010929643.1|  PREDICTED: uncharacterized protein LOC105051...    277   1e-79    
emb|CDX80381.1|  BnaC07g30630D                                          276   3e-79    
emb|CDX88043.1|  BnaA06g26340D                                          273   3e-78    
ref|XP_009604533.1|  PREDICTED: uncharacterized protein LOC104099...    271   1e-77    
ref|XP_009779995.1|  PREDICTED: uncharacterized protein LOC104229...    271   1e-77    
ref|XP_009150898.1|  PREDICTED: uncharacterized protein LOC103874237    272   2e-77    
gb|EMS57997.1|  putative poly(A) polymerase                             267   3e-76    
ref|NP_190452.1|  polynucleotide adenylyltransferase domain and R...    276   4e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006580624.1|  PREDICTED: CCA tRNA nucleotidyltransferase 1...    263   5e-76    
ref|XP_006580623.1|  PREDICTED: CCA tRNA nucleotidyltransferase 1...    261   2e-75    
gb|KDO44047.1|  hypothetical protein CISIN_1g014947mg                   261   8e-75    
gb|EPS62980.1|  hypothetical protein M569_11807                         260   2e-74    
gb|KHN31267.1|  Putative poly(A) polymerase                             261   3e-74    
gb|KDO44048.1|  hypothetical protein CISIN_1g014947mg                   256   6e-74    
ref|XP_010066436.1|  PREDICTED: uncharacterized protein LOC104453...    262   6e-74    
ref|XP_010066435.1|  PREDICTED: uncharacterized protein LOC104453...    262   7e-74    
ref|XP_008464384.1|  PREDICTED: uncharacterized protein LOC103502...    259   1e-73    
ref|XP_010100048.1|  putative poly(A) polymerase                        248   4e-69    
dbj|BAA97232.1|  unnamed protein product                                245   3e-68    Arabidopsis thaliana [mouse-ear cress]
gb|EMS63215.1|  putative poly(A) polymerase                             240   2e-67    
gb|EYU32917.1|  hypothetical protein MIMGU_mgv1a007724mg                236   4e-66    
gb|KDO44049.1|  hypothetical protein CISIN_1g014947mg                   228   2e-64    
gb|KHN23951.1|  Poly(A) polymerase                                      230   5e-64    
ref|XP_001759217.1|  predicted protein                                  231   3e-62    
gb|EEE60916.1|  hypothetical protein OsJ_14629                          228   2e-61    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ92580.1|  predicted protein                                      219   1e-60    
emb|CAN80033.1|  hypothetical protein VITISV_007071                     225   2e-59    Vitis vinifera
dbj|BAJ87006.1|  predicted protein                                      217   3e-59    
gb|KDO71448.1|  hypothetical protein CISIN_1g005593mg                   214   2e-57    
gb|ADN33864.1|  poly(A) polymerase                                      209   4e-56    
ref|XP_010490382.1|  PREDICTED: uncharacterized protein LOC104768153    204   3e-54    
ref|XP_009607925.1|  PREDICTED: uncharacterized protein LOC104102...    202   1e-53    
emb|CCI55441.1|  PH01B031C15.24                                         198   2e-50    
tpg|DAA43184.1|  TPA: hypothetical protein ZEAMMB73_451476              185   1e-49    
gb|AAD32915.1|  putative poly(A) polymerase                             174   1e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_005844969.1|  hypothetical protein CHLNCDRAFT_58740              181   6e-44    
gb|KEH20979.1|  tRNA nucleotidyltransferase/poly(A) polymerase          171   7e-44    
ref|NP_001183670.1|  uncharacterized protein LOC100502264               159   8e-41    
gb|KHN41830.1|  hypothetical protein glysoja_003570                     159   4e-40    
ref|XP_006409278.1|  hypothetical protein EUTSA_v10022674mg             164   7e-40    
ref|XP_010463896.1|  PREDICTED: uncharacterized protein LOC104744...    158   5e-39    
ref|XP_010463895.1|  PREDICTED: pentatricopeptide repeat-containi...    159   2e-38    
tpg|DAA38071.1|  TPA: hypothetical protein ZEAMMB73_877949              155   7e-38    
ref|XP_010463894.1|  PREDICTED: pentatricopeptide repeat-containi...    158   2e-37    
ref|WP_038089618.1|  poly(A) polymerase                                 149   4e-35    
gb|EPP34871.1|  poly(A) polymerase family protein                       149   4e-35    
ref|WP_032125128.1|  poly(A) polymerase                                 149   4e-35    
dbj|BAP55861.1|  poly(A) polymerase                                     149   7e-35    
ref|WP_016352934.1|  poly(A) polymerase                                 149   7e-35    
ref|WP_021119631.1|  MULTISPECIES: poly(A) polymerase family protein    148   8e-35    
gb|KFZ90448.1|  poly(A) polymerase                                      149   1e-34    
ref|WP_008733349.1|  poly(A) polymerase                                 148   2e-34    
gb|KHD05926.1|  hypothetical protein OT06_44810                         147   2e-34    
ref|WP_013032134.1|  poly(A) polymerase                                 146   3e-34    
ref|WP_039359621.1|  poly(A) polymerase                                 145   6e-34    
ref|WP_011175857.1|  poly(A) polymerase                                 145   7e-34    
ref|WP_009205225.1|  poly(A) polymerase                                 145   9e-34    
gb|EKD53652.1|  hypothetical protein ACD_60C00162G0007                  145   1e-33    
ref|WP_036307246.1|  poly(A) polymerase                                 145   1e-33    
ref|WP_038049600.1|  hypothetical protein                               144   1e-33    
ref|WP_002710368.1|  poly(A) polymerase                                 145   1e-33    
gb|ESS72631.1|  poly(A) polymerase I                                    145   1e-33    
ref|WP_020559307.1|  hypothetical protein                               145   1e-33    
gb|KDA53496.1|  hypothetical protein EG19_04620                         144   2e-33    
ref|WP_032092947.1|  poly(A) polymerase                                 145   3e-33    
ref|WP_035406519.1|  poly(A) polymerase                                 144   3e-33    
ref|WP_013219809.1|  poly(A) polymerase                                 143   3e-33    
ref|XP_011002103.1|  PREDICTED: uncharacterized protein LOC105109...    144   4e-33    
ref|WP_012196711.1|  poly(A) polymerase I                               144   5e-33    
ref|WP_006340332.1|  poly(A) polymerase                                 142   6e-33    
ref|WP_011847697.1|  poly(A) polymerase I                               143   7e-33    
ref|WP_036499724.1|  poly(A) polymerase                                 142   7e-33    
ref|WP_002811529.1|  poly(A) polymerase                                 142   8e-33    
ref|WP_016209265.1|  poly(A) polymerase family protein                  142   1e-32    
ref|WP_039648411.1|  poly(A) polymerase                                 142   1e-32    
ref|WP_005374672.1|  poly(A) polymerase                                 142   1e-32    
ref|WP_031430088.1|  poly(A) polymerase                                 142   1e-32    
gb|EPN05406.1|  poly(A) polymerase                                      138   1e-32    
ref|WP_003457234.1|  Poly(A) polymerase                                 142   1e-32    
ref|WP_038501701.1|  PcnB                                               141   2e-32    
ref|WP_012586871.1|  poly(A) polymerase I                               142   2e-32    
ref|WP_006082969.1|  poly(A) polymerase I                               142   2e-32    
ref|XP_008337933.1|  PREDICTED: uncharacterized protein LOC103401009    140   3e-32    
ref|WP_017378095.1|  hypothetical protein                               141   3e-32    
ref|WP_010487594.1|  poly(A) polymerase                                 141   4e-32    
ref|WP_014147170.1|  poly(A) polymerase                                 141   4e-32    
emb|CDZ79552.1|  Poly(A) polymerase I precursor                         140   4e-32    
ref|WP_003185502.1|  poly(A) polymerase                                 140   4e-32    
ref|WP_020159136.1|  poly(A) polymerase                                 140   4e-32    
ref|WP_021489316.1|  poly(A) polymerase                                 140   4e-32    
ref|WP_017675313.1|  poly(A) polymerase                                 140   4e-32    
ref|WP_027900342.1|  poly(A) polymerase                                 140   4e-32    
ref|WP_036252233.1|  poly(A) polymerase                                 140   4e-32    
ref|WP_018293146.1|  poly(A) polymerase                                 140   4e-32    
ref|WP_004513899.1|  poly(A) polymerase                                 140   4e-32    
ref|WP_023533153.1|  poly(A) polymerase family protein                  140   5e-32    
ref|WP_038441450.1|  poly(A) polymerase                                 140   5e-32    
ref|WP_013333880.1|  poly(A) polymerase                                 140   5e-32    
ref|WP_016494747.1|  poly(A) polymerase                                 140   6e-32    
ref|WP_011271806.1|  poly(A) polymerase                                 140   6e-32    
gb|EGH31817.1|  poly(A) polymerase                                      138   7e-32    
ref|WP_013181513.1|  poly(A) polymerase                                 139   7e-32    
gb|EGC71690.1|  poly(A) polymerase                                      139   7e-32    
ref|WP_016783423.1|  poly(A) polymerase                                 140   7e-32    
ref|WP_026596299.1|  poly(A) polymerase                                 139   7e-32    
ref|WP_026138560.1|  poly(A) polymerase                                 140   7e-32    
ref|WP_019825948.1|  poly(A) polymerase                                 140   8e-32    
ref|WP_013648886.1|  poly(A) polymerase                                 140   8e-32    
ref|WP_019410384.1|  poly(A) polymerase                                 140   8e-32    
ref|WP_038018905.1|  hypothetical protein                               140   8e-32    
ref|WP_013712178.1|  poly(A) polymerase                                 139   9e-32    
ref|WP_032827418.1|  poly(A) polymerase                                 140   9e-32    
ref|WP_032822462.1|  poly(A) polymerase                                 140   9e-32    
ref|WP_026037775.1|  poly(A) polymerase                                 139   1e-31    
ref|WP_021756843.1|  poly A polymerase                                  139   1e-31    
ref|WP_013790067.1|  poly(A) polymerase                                 139   1e-31    
ref|WP_032827504.1|  poly(A) polymerase                                 139   1e-31    
ref|WP_024010726.1|  poly A polymerase                                  139   1e-31    
ref|WP_021441862.1|  poly(A) polymerase                                 139   1e-31    
ref|WP_032803852.1|  poly(A) polymerase                                 140   1e-31    
ref|WP_036292625.1|  poly(A) polymerase                                 139   1e-31    
ref|WP_019868403.1|  poly(A) polymerase                                 139   1e-31    
ref|WP_013967482.1|  poly(A) polymerase                                 139   1e-31    
gb|EIF41216.1|  polynucleotide adenylyltransferase                      139   1e-31    
gb|EIJ29285.1|  polynucleotide adenylyltransferase                      139   1e-31    
ref|WP_020396712.1|  hypothetical protein                               139   1e-31    
ref|WP_028630032.1|  poly(A) polymerase                                 139   1e-31    
ref|WP_003439661.1|  MULTISPECIES: poly(A) polymerase                   139   1e-31    
emb|CDF99368.1|  Putative PolyA polymerase                              140   1e-31    
ref|WP_014269177.1|  poly(A) polymerase                                 139   1e-31    
ref|WP_032624982.1|  poly(A) polymerase                                 139   1e-31    
ref|WP_020296491.1|  poly(A) polymerase                                 139   1e-31    
gb|ERS91324.1|  poly(A) polymerase                                      139   1e-31    
ref|WP_024639809.1|  poly(A) polymerase                                 139   1e-31    
gb|EPN64336.1|  poly(A) polymerase                                      138   1e-31    
ref|WP_031217654.1|  poly(A) polymerase                                 139   1e-31    
ref|WP_027906014.1|  poly(A) polymerase                                 139   1e-31    
ref|WP_022966349.1|  poly(A) polymerase                                 139   1e-31    
ref|WP_032826576.1|  poly(A) polymerase                                 139   1e-31    
gb|EIJ73823.1|  poly(A) polymerase                                      139   2e-31    
gb|EKD74135.1|  hypothetical protein ACD_45C00063G0006                  139   2e-31    
ref|WP_010892214.1|  poly(A) polymerase                                 138   2e-31    
gb|KEZ73131.1|  poly(A) polymerase                                      138   2e-31    
ref|WP_027909098.1|  poly(A) polymerase                                 139   2e-31    
ref|WP_029298948.1|  MULTISPECIES: poly(A) polymerase                   139   2e-31    
ref|WP_038446003.1|  poly(A) polymerase                                 139   2e-31    
ref|WP_005578565.1|  poly(A) polymerase                                 139   2e-31    
gb|EGT75271.1|  Putative polyA polymerase                               139   2e-31    
ref|WP_032828073.1|  poly(A) polymerase                                 138   2e-31    
ref|WP_026130186.1|  poly(A) polymerase                                 139   2e-31    
ref|WP_035416994.1|  poly(A) polymerase                                 138   2e-31    
ref|WP_012054791.1|  poly(A) polymerase                                 138   2e-31    
ref|WP_011126264.1|  poly(A) polymerase                                 138   2e-31    
ref|WP_010883599.1|  poly(A) polymerase                                 138   2e-31    
ref|WP_021020590.1|  poly(A) polymerase I                               138   2e-31    
ref|WP_035685231.1|  poly(A) polymerase                                 139   2e-31    
ref|WP_013029083.1|  poly(A) polymerase                                 138   2e-31    
ref|WP_032825641.1|  poly(A) polymerase                                 138   3e-31    
ref|WP_017936859.1|  poly(A) polymerase                                 138   3e-31    
ref|WP_014707449.1|  poly(A) polymerase                                 138   3e-31    
ref|WP_005762589.1|  poly(A) polymerase                                 139   3e-31    
ref|WP_005643458.1|  poly(A) polymerase                                 138   3e-31    
gb|EGT78308.1|  Putative polyA polymerase                               138   3e-31    
ref|WP_008486933.1|  poly(A) polymerase I                               138   3e-31    
ref|WP_032826762.1|  poly(A) polymerase                                 138   3e-31    
ref|WP_007924654.1|  poly(A) polymerase                                 138   3e-31    
gb|EPN46860.1|  poly(A) polymerase                                      137   3e-31    
ref|WP_011457776.1|  poly(A) polymerase                                 137   3e-31    
gb|EEW78802.1|  polyA polymerase                                        138   3e-31    
ref|WP_015718489.1|  poly(A) polymerase                                 138   3e-31    
gb|KIC73880.1|  putative poly(A) polymerase                             137   4e-31    
ref|WP_027915399.1|  MULTISPECIES: poly(A) polymerase                   138   4e-31    
ref|WP_032827143.1|  poly(A) polymerase                                 137   4e-31    
ref|WP_010943862.1|  poly(A) polymerase                                 138   4e-31    
ref|WP_025805358.1|  poly(A) polymerase                                 138   4e-31    
ref|WP_011266660.1|  poly(A) polymerase                                 138   4e-31    
ref|WP_019740913.1|  poly(A) polymerase                                 138   4e-31    
ref|WP_002552057.1|  poly(A) polymerase                                 138   4e-31    
ref|WP_005732362.1|  poly(A) polymerase                                 138   4e-31    
ref|WP_005745518.1|  poly(A) polymerase                                 138   4e-31    
gb|EHO47047.1|  polynucleotide adenylyltransferase                      138   4e-31    
ref|WP_039386078.1|  poly(A) polymerase                                 137   4e-31    
ref|WP_027597539.1|  poly(A) polymerase                                 138   4e-31    
ref|WP_009045657.1|  poly(A) polymerase                                 138   4e-31    
ref|WP_003345072.1|  poly(A) polymerase                                 138   4e-31    
gb|KIG22435.1|  poly(A) polymerase                                      137   4e-31    
ref|WP_032831535.1|  poly(A) polymerase                                 137   4e-31    
ref|WP_005667983.1|  poly(A) polymerase                                 137   4e-31    
ref|WP_024641214.1|  poly(A) polymerase                                 137   4e-31    
gb|EEW76631.1|  polyA polymerase                                        138   4e-31    
gb|EGT79551.1|  Putative polyA polymerase                               138   4e-31    
ref|WP_024651887.1|  poly(A) polymerase                                 137   4e-31    
ref|WP_011167752.1|  poly(A) polymerase                                 138   4e-31    
ref|WP_032824198.1|  poly(A) polymerase                                 137   4e-31    
gb|KGS15685.1|  poly(A) polymerase                                      137   4e-31    
emb|CDI01228.1|  poly(A) polymerase I                                   137   4e-31    
ref|WP_021035544.1|  polyA polymerase                                   138   4e-31    
ref|WP_022952637.1|  poly(A) polymerase                                 137   4e-31    
ref|WP_038178161.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_024679975.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_024678755.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_010868929.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_003382274.1|  MULTISPECIES: poly(A) polymerase                   137   5e-31    
ref|WP_005770514.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_034613075.1|  poly(A) polymerase                                 138   5e-31    
ref|WP_032803538.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_027148861.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_007251697.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_009050896.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_013525420.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_004667376.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_023969378.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_033701566.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_014550610.1|  poly(A) polymerase                                 137   5e-31    
ref|WP_006891831.1|  poly(A) polymerase                                 137   5e-31    
gb|EEB58591.1|  Poly(A) polymerase                                      137   5e-31    
ref|WP_023365814.1|  hypothetical protein                               137   5e-31    
ref|WP_024298852.1|  poly(A) polymerase                                 137   6e-31    
ref|WP_005436113.1|  poly(A) polymerase                                 137   6e-31    
ref|WP_014326544.1|  poly(A) polymerase                                 137   6e-31    
gb|AIB45494.1|  Poly(A) polymerase                                      137   6e-31    
ref|WP_005663234.1|  poly(A) polymerase                                 137   6e-31    
ref|WP_005556695.1|  poly(A) polymerase                                 137   6e-31    
ref|WP_005630217.1|  poly(A) polymerase                                 137   6e-31    
ref|WP_030130361.1|  poly(A) polymerase                                 137   6e-31    
ref|WP_013527232.1|  MULTISPECIES: poly(A) polymerase                   137   6e-31    
ref|WP_005687517.1|  poly(A) polymerase                                 137   6e-31    
ref|WP_020798592.1|  MULTISPECIES: poly(A) polymerase                   137   6e-31    
gb|EGF17089.1|  polyA polymerase family protein                         137   6e-31    
ref|WP_012234352.1|  Poly(A) polymerase                                 136   6e-31    
ref|WP_005657742.1|  poly(A) polymerase                                 137   6e-31    
ref|WP_017734147.1|  poly(A) polymerase                                 137   6e-31    
ref|WP_028006343.1|  poly(A) polymerase                                 137   7e-31    
gb|EPP31237.1|  poly(A) polymerase family protein                       136   7e-31    
ref|WP_009833017.1|  poly(A) polymerase                                 137   7e-31    
ref|WP_005652558.1|  poly(A) polymerase                                 137   7e-31    
ref|WP_027617889.1|  poly(A) polymerase                                 137   7e-31    
ref|WP_025007566.1|  poly(A) polymerase                                 136   8e-31    
ref|WP_014944588.1|  poly(A) polymerase                                 136   8e-31    
ref|WP_024618747.1|  poly(A) polymerase                                 137   8e-31    
ref|WP_011006746.1|  poly(A) polymerase                                 136   8e-31    
ref|WP_005761226.1|  poly(A) polymerase                                 137   8e-31    
ref|WP_021700404.1|  poly(A) polymerase                                 137   8e-31    
ref|WP_014518423.1|  poly(A) polymerase                                 136   8e-31    
ref|WP_035460750.1|  poly(A) polymerase                                 137   8e-31    
gb|EPJ27068.1|  poly(A) polymerase family protein                       136   8e-31    
ref|WP_010547972.1|  poly(A) polymerase                                 136   9e-31    
emb|CDF97437.1|  Poly(A) polymerase                                     137   9e-31    
ref|WP_018609287.1|  poly(A) polymerase                                 137   9e-31    
ref|WP_030140240.1|  poly(A) polymerase                                 137   9e-31    
ref|WP_003205647.1|  MULTISPECIES: poly(A) polymerase                   136   1e-30    
ref|WP_011097317.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_014943971.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_028237088.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_016419047.1|  poly(A) polymerase                                 136   1e-30    
gb|AHL35960.1|  poly(A) polymerase                                      136   1e-30    
ref|WP_014340240.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_005672259.1|  poly(A) polymerase                                 137   1e-30    
ref|WP_020734128.1|  hypothetical protein                               135   1e-30    
ref|WP_006344369.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_031437587.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_028461490.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_016966492.1|  poly(A) polymerase family protein                  136   1e-30    
ref|WP_033036534.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_024779593.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_025131273.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_008068509.1|  MULTISPECIES: poly(A) polymerase                   136   1e-30    
ref|WP_037001528.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_017133069.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_027595010.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_014946857.1|  poly(A) polymerase                                 135   1e-30    
ref|WP_010231231.1|  poly(A) polymerase                                 135   1e-30    
ref|WP_015372961.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_006343453.1|  poly(A) polymerase                                 135   1e-30    
ref|WP_033151482.1|  poly(A) polymerase                                 135   1e-30    
emb|CDM25472.1|  Poly(A) polymerase                                     136   1e-30    
ref|WP_003235008.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_032108737.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_005575210.1|  hypothetical protein                               133   1e-30    
ref|WP_027965827.1|  poly(A) polymerase                                 136   1e-30    
gb|EJN29373.1|  poly(A) polymerase                                      137   1e-30    
ref|WP_024669650.1|  poly(A) polymerase                                 136   1e-30    
ref|WP_024690395.1|  poly(A) polymerase                                 136   1e-30    
gb|EGI04984.1|  poly(A) polymerase                                      136   1e-30    
ref|WP_014754471.1|  poly(A) polymerase                                 135   2e-30    
ref|WP_011788192.1|  MULTISPECIES: poly(A) polymerase I                 136   2e-30    
ref|WP_021784787.1|  MULTISPECIES: poly(A) polymerase                   136   2e-30    
ref|WP_026285723.1|  poly(A) polymerase                                 136   2e-30    
ref|WP_012019566.1|  poly(A) polymerase                                 136   2e-30    
ref|WP_027159701.1|  poly(A) polymerase                                 136   2e-30    
ref|WP_003244643.1|  poly(A) polymerase                                 136   2e-30    
ref|WP_007159710.1|  MULTISPECIES: poly(A) polymerase                   136   2e-30    
gb|AHN72193.1|  poly(A) polymerase, putative                            136   2e-30    
ref|WP_014611263.1|  poly(A) polymerase I                               136   2e-30    
ref|WP_027917671.1|  poly(A) polymerase                                 135   2e-30    
ref|WP_005553345.1|  poly(A) polymerase                                 136   2e-30    
ref|WP_017478579.1|  poly(A) polymerase                                 136   2e-30    
ref|WP_010174368.1|  poly(A) polymerase                                 136   2e-30    
ref|WP_014946203.1|  poly(A) polymerase                                 135   2e-30    
ref|WP_024646912.1|  poly(A) polymerase                                 135   2e-30    
ref|WP_003176121.1|  poly(A) polymerase                                 135   2e-30    
ref|WP_032879455.1|  poly(A) polymerase                                 135   2e-30    
gb|AHG42665.1|  poly(A) polymerase                                      135   2e-30    



>ref|XP_009792802.1| PREDICTED: uncharacterized protein LOC104239780 [Nicotiana sylvestris]
Length=749

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/606 (57%), Positives = 430/606 (71%), Gaps = 27/606 (4%)
 Frame = +2

Query  251   LQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVL  430
              QK+  T + D  +     D  +DS  + G+I+FS WRKLD+R+FGI+ SRI  S W+VL
Sbjct  23    FQKYKHTFSQDRRRRRHPADMGSDSVVETGEIDFSKWRKLDSRNFGISSSRIPASPWIVL  82

Query  431   NVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVH  610
              VL+ +GF+AYLVGGCVRDLILNRIPKDFDVITTARL++I++ F RAEIVGRRFPICRVH
Sbjct  83    KVLQSQGFEAYLVGGCVRDLILNRIPKDFDVITTARLSQIRRHFDRAEIVGRRFPICRVH  142

Query  611   IRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDP  790
             ++GSVVEVSSFDTVA +    KR+  F+P+MPKG  + D I W+NS+HRDFT+NSLF+DP
Sbjct  143   VKGSVVEVSSFDTVAKQ--TGKREELFIPKMPKGFYKKDFILWKNSMHRDFTVNSLFFDP  200

Query  791   FVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIW  970
              V +IYDYA+AM D+KS +LRTLIPA LSFE+DCAR+LRGLRLAARLK SFS + E A+ 
Sbjct  201   SVNRIYDYADAMVDLKSLQLRTLIPAHLSFEQDCARMLRGLRLAARLKLSFSKDIENAMH  260

Query  971   KLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSS  1150
             KLS S+M LDKSRLMMEVNYMLSYGAA PSL LLQ+YN+LE+LLPFHAA+LTQQ++KQ  
Sbjct  261   KLSSSIMKLDKSRLMMEVNYMLSYGAAEPSLSLLQRYNILEMLLPFHAAHLTQQSNKQLG  320

Query  1151  DTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNW  1327
             ++S MLMKLFSSLDQLV+C RP+ +SLWVALLAFHL L+  PQ   VVLT ASV+YH NW
Sbjct  321   ESSAMLMKLFSSLDQLVTCGRPSHDSLWVALLAFHLALITKPQQAFVVLTFASVLYHGNW  380

Query  1328  KQGVEFARQHVKAASLYVPEISDSDG-SMSEDELAKRVENMAVQV----NMLTDADNLRE  1492
             K+GV+FA++H  AA++Y PEISDS G S S+DELA RV  +AV V    ++LTD D+LR+
Sbjct  381   KEGVKFAKRHSDAAAIYAPEISDSQGSSTSDDELADRVTELAVLVKNSLDILTDKDSLRD  440

Query  1493  VTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAH  1672
               SKF GS  SGLVFVS KM K   VE +F IL  DVTSL  +  S KI           
Sbjct  441   AMSKFPGSPCSGLVFVSKKMGKG--VEVIFDILVEDVTSLKTRRNSFKIDYTLL------  492

Query  1673  KKGNGIAHETRFLLSKIILDTlglggvileegeSKKRNS--EYDEIDGLQEVKENSHSQM  1846
               G G   ETRF+L +IILDT+  G +   E    ++++  + D    + + +EN    +
Sbjct  493   --GKGQMRETRFVLGQIILDTIAPGIIPGGEVIKNEKHTLVKVDAQSSVDDPRENIGGNV  550

Query  1847  EMKQEDYNLC---NISPMGGEFEPARAKKRKSTHTSSSLSEEGAVTKHKKSADEQTAFDH  2017
             E+K+  +  C   N      E +  R +KRK     S   EE  VTK +KS   Q +   
Sbjct  551   ELKKRKFQ-CEDDNQPTASYEIKHNRTEKRKLIQKGSFALEE-VVTKKQKSVIAQQS--K  606

Query  2018  SKCLQK  2035
             SK ++K
Sbjct  607   SKAVEK  612



>ref|XP_009610936.1| PREDICTED: uncharacterized protein LOC104104533 [Nicotiana tomentosiformis]
Length=767

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/640 (53%), Positives = 443/640 (69%), Gaps = 36/640 (6%)
 Frame = +2

Query  248   LLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVV  427
             + QK+  T + D  + +   D  + S  + G+I+FS WRKLD+R+FGI+ SRI  S W+V
Sbjct  22    VFQKYKHTFSKDRRRRQHPADMGSGSVVETGEIDFSKWRKLDSRNFGISSSRIPASPWIV  81

Query  428   LNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRV  607
             L VL+ +GF+AYLVGGCVRDLILNRIPKDFDVITTARL++I++ F+RAEIVGRRFPICRV
Sbjct  82    LKVLQSEGFEAYLVGGCVRDLILNRIPKDFDVITTARLSQIRRHFHRAEIVGRRFPICRV  141

Query  608   HIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYD  787
             H++GS+VEVSSFDTVA +    KR+   +P+MPKG ++ D I W+NS+HRDFT+NSLF+D
Sbjct  142   HVKGSIVEVSSFDTVAKQ--TGKREELSIPKMPKGFHQKDFILWKNSIHRDFTVNSLFFD  199

Query  788   PFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAI  967
             P + +IYDYA+AM D+KS +LRTL+PA LSFE+DCAR+LRGLRLAARLK SFS + E A+
Sbjct  200   PSMNRIYDYADAMVDLKSLQLRTLVPANLSFEQDCARMLRGLRLAARLKLSFSKDIEIAM  259

Query  968   WKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQS  1147
              KLS S+M LDKSRLMMEVNYMLSYGAA PSL LLQ+YN+L++LLPFHAA+LTQQ++K+ 
Sbjct  260   HKLSSSIMKLDKSRLMMEVNYMLSYGAAEPSLSLLQRYNILDMLLPFHAAHLTQQSNKKL  319

Query  1148  SDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRN  1324
              ++S MLMKLFSSLDQLV+C RP+ +SLWVALLAFHL L+  PQ   VVLT ASV+YH N
Sbjct  320   GESSAMLMKLFSSLDQLVTCGRPSHDSLWVALLAFHLALITKPQQAFVVLTFASVLYHGN  379

Query  1325  WKQGVEFARQHVKAASLYVPEISDSDGSM-SEDELAKRVENMAVQV----NMLTDADNLR  1489
             WK+GV+FA++H  AA++Y PEISDS GS  S+DELA+RV  +AV V    ++L D D+LR
Sbjct  380   WKEGVKFAKRHSDAAAIYTPEISDSQGSFTSDDELAERVTELAVLVQNSLDILNDKDSLR  439

Query  1490  EVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTA  1669
             E  SKF GS  SGLVFVS KM K   VE +F IL  DVTSL  +  S +I          
Sbjct  440   EAMSKFIGSPCSGLVFVSKKMGKS--VEVIFDILVEDVTSLKTRRNSFEIDYTLL-----  492

Query  1670  HKKGNGIAHETRFLLSKIILDTlglggvileegeSKKRNS--EYDEIDGLQEVKENSHSQ  1843
                G G   ETRF++ ++ILDT+  G +   E     +++  + D    + +  EN    
Sbjct  493   ---GKGQMRETRFVIGQVILDTIAPGVIPGGEVIKNDKHTLVKVDAQSSVDDTGENIGGN  549

Query  1844  MEMKQEDYNLC---NISPMGGEFEPARAKKRKSTHTSSSLSEEGAVTKHK---------K  1987
             +E+K+  +  C   N      E    RA+KRK     S   EE A  K K         K
Sbjct  550   VELKKRKFR-CEDDNQPTANYEINHNRAEKRKLIQKGSFALEEVATKKQKSVIAQQSKDK  608

Query  1988  SADEQTAFDHSKCL-QKVHES-ATKHKKSVDES-EFTQRE  2098
             + ++Q   ++++ L QK+    AT  KK+  E  E +Q E
Sbjct  609   AVEKQDLIEYNESLNQKLDNGDATNKKKAKGEHVELSQDE  648



>ref|XP_009591704.1| PREDICTED: uncharacterized protein LOC104088689 isoform X1 [Nicotiana 
tomentosiformis]
Length=746

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/663 (51%), Positives = 438/663 (66%), Gaps = 50/663 (8%)
 Frame = +2

Query  251   LQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVL  430
             LQKF  T A    Q + + +   +S  + G+I+FS WRKLD+R+FGI+ S I PS+WVVL
Sbjct  23    LQKFKHTFAEYESQSQVSANTGTESVIETGQIDFSKWRKLDSRNFGISRSMIPPSAWVVL  82

Query  431   NVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVH  610
              +L+ +GF+AYLVGGCVRDLILNRIPKDFD+IT ARL +IKKQF R++IVG+RFPICRVH
Sbjct  83    KILQSEGFEAYLVGGCVRDLILNRIPKDFDIITNARLPQIKKQFRRSQIVGQRFPICRVH  142

Query  611   IRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDP  790
             ++GSV+EVSSFDTVA   +  K +  FVP+MPKGC++ D + W+NS+HRDFTINSLF++P
Sbjct  143   VKGSVIEVSSFDTVAKNAE--KEEELFVPKMPKGCDQKDFVLWKNSMHRDFTINSLFFNP  200

Query  791   FVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIW  970
              V +IYDY NAM D++S KLRTL+PA LSF EDCARILRGLRLAARL  SF+ E E  + 
Sbjct  201   LVNRIYDYVNAMQDLRSLKLRTLVPAHLSFGEDCARILRGLRLAARLSLSFTKEIEDWMD  260

Query  971   KLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSS  1150
             + S S+MSL K+R+ ME+NYM+SYGAA PSL LLQ+YN+LE++LPFH AYL QQA +QS 
Sbjct  261   EFSSSIMSLSKARIRMELNYMMSYGAAAPSLSLLQRYNILEIVLPFHGAYLAQQACEQSG  320

Query  1151  DTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNW  1327
             D+S MLMKLFSSLDQ V+C +P+ +S+WVALLAFHL L+ +PQ  LV+LT ASV+YH NW
Sbjct  321   DSSVMLMKLFSSLDQFVTCGQPSHDSVWVALLAFHLALITHPQHALVILTFASVLYHGNW  380

Query  1328  KQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQV----NMLTDADNLREV  1495
             K+GV+FA +H +AA++Y PE+ DS  S+S+DELA+RV  +AVQV    N+LTD D+L E 
Sbjct  381   KEGVKFAEKHSEAAAVYAPEVYDSQVSISDDELAERVAQLAVQVQKSINILTDGDSLLEA  440

Query  1496  TSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHK  1675
              SKF G+  SGLVFVS +M K   VE +F IL   VTS      + KI   S        
Sbjct  441   LSKFPGAPCSGLVFVSMRMGKD--VELMFDILVKGVTSFKTSKKNFKIDYNSL-------  491

Query  1676  KGNGIAHETRFLLSKIILDTlglggvileegeSKKRNSEYDEIDGLQE---VKENSHSQM  1846
              G G  HETRFLL K+ILDT+  G     E    +++    E DG QE    +E  H  +
Sbjct  492   -GKGHVHETRFLLGKVILDTIVPGVSTGVEVIEAEKHVLL-EGDGRQEEDVSQETFHGNV  549

Query  1847  EMKQEDYNLCNISPMGGEFEPA--RAKKRKSTHTSSSLSEEGAVTKHKKSADEQTAFDHS  2020
             E+ + +Y   + S +   +E    R +K+K      S   E    K K  A E++     
Sbjct  550   ELMKPEYVSEDDSELDENYELQHNRTEKQKLNQKGCSDLVEAVTKKQKIIAAERS-----  604

Query  2021  KCLQKVHESATKHKKSVDESEFTQRESSEELVKRKLNSHPKSLGADDMVEHKKSKKTLFD  2200
                    E A K +  +D+++F  RE                L   D V  KK K T   
Sbjct  605   ------EEMALKKQDLIDDTDFLSRE----------------LDRGDTVTRKKIKGTRTQ  642

Query  2201  LFK  2209
             LFK
Sbjct  643   LFK  645



>ref|XP_009802246.1| PREDICTED: uncharacterized protein LOC104247821 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009802247.1| PREDICTED: uncharacterized protein LOC104247821 isoform X1 [Nicotiana 
sylvestris]
Length=746

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/663 (51%), Positives = 441/663 (67%), Gaps = 50/663 (8%)
 Frame = +2

Query  251   LQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVL  430
             LQKF  T      Q + + +   +S  + G+++FS WRKLD+R+FGIT S I PS+WVVL
Sbjct  23    LQKFKHTFVEYESQSQVSANTGTESVIEAGQLDFSKWRKLDSRNFGITRSMIPPSAWVVL  82

Query  431   NVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVH  610
              +L+ +GF+AYLVGGCVRDLILNRIPKDFD+IT A+L +IKKQF+R++IVG+RFPICRVH
Sbjct  83    KILQSEGFEAYLVGGCVRDLILNRIPKDFDIITNAKLPQIKKQFHRSQIVGQRFPICRVH  142

Query  611   IRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDP  790
             ++GSV+EVSSFDTVA   +  K +  FVP+MPKGC++ D I W+NS+HRDFTINSLF++P
Sbjct  143   VKGSVIEVSSFDTVAKNAE--KEEEIFVPKMPKGCDQKDFILWKNSMHRDFTINSLFFNP  200

Query  791   FVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIW  970
              + +IYDY NAM D++S KLRTL+P  LSF EDCARILRGLRLAARL  SF+ E E  + 
Sbjct  201   LMNRIYDYVNAMQDLRSLKLRTLVPTHLSFGEDCARILRGLRLAARLNLSFTKEIEDWMD  260

Query  971   KLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSS  1150
             + S S+MSL K+R+ ME+NYM+SYGAA PSL LLQ+YN+LE++ PFH AYL QQA KQ  
Sbjct  261   EFSSSIMSLSKARIRMELNYMMSYGAAAPSLSLLQRYNILEIVFPFHGAYLAQQACKQLG  320

Query  1151  DTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNW  1327
             D+S MLMKLFSSLDQ V+C +P+ +S+WVALLAFHL L+ +PQ  LV+L  ASV+YH NW
Sbjct  321   DSSVMLMKLFSSLDQFVTCGQPSHDSVWVALLAFHLALITHPQHALVILIFASVLYHGNW  380

Query  1328  KQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQV----NMLTDADNLREV  1495
             K+GV+FA +H +AA++YVPE+SDS  S+S+DELA+RV  +AVQV    N+LTD D+L E 
Sbjct  381   KEGVKFAEKHSEAAAVYVPEVSDSQVSISDDELAERVAQLAVQVQKSINILTDGDSLLEA  440

Query  1496  TSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHK  1675
              SKF G+  SGLVFVS +M K   VE +F IL  DVTS      + KI   S        
Sbjct  441   MSKFPGAPCSGLVFVSMRMGKD--VELMFDILVKDVTSFKTSKKNFKIDYDSL-------  491

Query  1676  KGNGIAHETRFLLSKIILDTlglggvileegeSKKRNSEYDEIDGLQE---VKENSHSQM  1846
              G G   ETRFLL K+ILDT+  G     E    +++    E DG QE    +E  H  +
Sbjct  492   -GKGHVCETRFLLGKVILDTIVPGVSTGVEVIEAEKHVLL-ESDGQQEEDTSQETFHGNV  549

Query  1847  EMKQEDYNLCNISPMGGEFEPA--RAKKRKSTHTSSSLSEEGAVTKHKKSADEQTAFDHS  2020
             E+ + +Y   + S +   +E    R +K+K      S   E AVTK +K      A +HS
Sbjct  550   ELMKPEYVSEDNSDLDENYELQHNRIEKQKLNQKGCSDLVE-AVTKKQKI----VAAEHS  604

Query  2021  KCLQKVHESATKHKKSVDESEFTQRESSEELVKRKLNSHPKSLGADDMVEHKKSKKTLFD  2200
             +      E A K +  +D+++F  +E                L   D V  KK K T   
Sbjct  605   E------EMALKKQDLIDDTDFLSQE----------------LDRGDTVTKKKIKGTRTQ  642

Query  2201  LFK  2209
             LFK
Sbjct  643   LFK  645



>ref|XP_006340829.1| PREDICTED: uncharacterized protein LOC102592062 [Solanum tuberosum]
Length=724

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/736 (48%), Positives = 465/736 (63%), Gaps = 82/736 (11%)
 Frame = +2

Query  182   PAILLSSVEQFVEQLVTALLMSLLQKFNQ-TSAGDGIQLESTTDRAADSNFQPGKIEFSN  358
             P  LLS  + F+          + QKFN  T + D  + + + +  + S    G+I+FS 
Sbjct  10    PNFLLSRFKAFL----------VFQKFNHNTYSKDKHREQHSANMGSGSVVDAGEIDFSK  59

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             WRKL +R FGI+ S I   +W VL  L+  GF+AYLVGGCVRDLILN+IPKDFDVITTAR
Sbjct  60    WRKLYSRDFGISNSLIPAYAWTVLKSLQSGGFEAYLVGGCVRDLILNKIPKDFDVITTAR  119

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L +IK++F+RA IVGRRFPICRVH+ GS+VEVSSFDT A     +++ +  VP+MPK  +
Sbjct  120   LPQIKRRFHRAIIVGRRFPICRVHVNGSIVEVSSFDTRAKPTGASEKLS--VPKMPKKFH  177

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D I W++S+HRDFT+NSLF+DP V  IYDYA+A+ D+KS +LRTL+PAQLSFEEDCAR
Sbjct  178   QKDFILWKDSMHRDFTVNSLFFDPSVNTIYDYADAIVDLKSLQLRTLVPAQLSFEEDCAR  237

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRG+RLAARLK SFS E E A+ KLSPS+M L+KSRLMMEVNYMLSYGAA PSL LLQ+
Sbjct  238   ILRGMRLAARLKLSFSKEIEIAMHKLSPSIMILNKSRLMMEVNYMLSYGAAEPSLSLLQR  297

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             Y++LE+LLPFHAA+L QQ++KQ S++S MLMKLFSSLDQLV+C+RP+ +SLWVALLAFHL
Sbjct  298   YSILEMLLPFHAAHLAQQSNKQLSESSVMLMKLFSSLDQLVTCDRPSHDSLWVALLAFHL  357

Query  1256  TLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKR  1435
              L+ +PQ   VVLT ASV+YH NWK+GV FAR+H  AAS+Y PEISDS GS+S+DEL +R
Sbjct  358   ALITDPQGAFVVLTFASVLYHGNWKEGVNFARRHSDAASIYAPEISDSQGSISDDELVER  417

Query  1436  VENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDV  1603
             V  +AV V    ++LTD D+L+E  SKF GS  SGLVFVS  M K  VVE +F +L  DV
Sbjct  418   VTELAVLVQNSLDILTDKDSLQEAMSKFPGSPCSGLVFVSKNMRK--VVEVIFDVLIGDV  475

Query  1604  TSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDTlg---------lggvi  1756
              SL  +  S +I             G G   ETRF+L K+ILDT+          +   +
Sbjct  476   RSLKTRRNSFEIDYTL--------LGKGQTRETRFVLGKVILDTIAPGVIPGSEVMKHTL  527

Query  1757  leegeSKKRNSEYDEIDGLQEVKE-----------NSHSQMEMKQEDYNLCNISPMGGEF  1903
             ++      +N+  + +DG  ++K+           N+ S+++  +++     I+    E 
Sbjct  528   VKVDAQLSKNAPKENMDGNVKLKKRKFACEDDNQPNASSEIKHNRDEKLNTVIAKQSKEK  587

Query  1904  EPAR---------------AKKRKSTHTSSSLSEEGA----------VTKHKKSAD----  1996
                +                 K+KS    S L + G           V  HKK       
Sbjct  588   AVEKHDNESLSQKLDNGDAVTKKKSKGEQSELPQNGTRMVLEAMKHPVPSHKKEQKGGNK  647

Query  1997  -EQTAFDHSKCLQKVHESAT----KHKKSVDESEFTQRESSEELVKRKLNSHPKSLGADD  2161
              +QT+ +H K +  V   AT    K K+  D S+  + E SE L  RK +     L +D+
Sbjct  648   YQQTSANHLKLIHNVDNGATTKQHKLKEKRDSSQEQKEEKSESLHSRKHDLKGGKLASDE  707

Query  2162  MVEHKKSKKTLFDLFK  2209
               + K   +TL DLF+
Sbjct  708   KSKPKAGNQTLSDLFR  723



>ref|XP_004234515.1| PREDICTED: uncharacterized protein LOC101265314 isoform X1 [Solanum 
lycopersicum]
Length=769

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/504 (61%), Positives = 375/504 (74%), Gaps = 17/504 (3%)
 Frame = +2

Query  239   LMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSS  418
             L+  LQKF  T A    + + +TD   +S  + G+I+FS WRKLD+R+FGI+ S I PS 
Sbjct  40    LVYYLQKFKHTFAECDRESQVSTDSGNESVVEAGQIDFSKWRKLDSRNFGISRSMIPPSP  99

Query  419   WVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPI  598
              VVL +L  +GF+AYLVGGCVRDLILNRIPKDFD+IT ARL +IKKQF R EIVGR FPI
Sbjct  100   QVVLKILHGEGFEAYLVGGCVRDLILNRIPKDFDIITNARLRQIKKQFRRCEIVGRIFPI  159

Query  599   CRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSL  778
             CRVH++GS+VEVSSFDTVA   +  K +   VP +PKGC E D I W NS+HRDFTINSL
Sbjct  160   CRVHVKGSIVEVSSFDTVAKHAE--KEEAPLVPEIPKGCPEKDFILWNNSMHRDFTINSL  217

Query  779   FYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETE  958
             F++PF  +IYDYANAM D++S KLRTL+PA LSF ED ARILRGLRLAARL  SF+ E E
Sbjct  218   FFNPFANRIYDYANAMQDLRSLKLRTLVPAHLSFGEDSARILRGLRLAARLNLSFTKEIE  277

Query  959   TAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQAD  1138
              A+ +LS ++MSL KSR+MME+NYM+SYGAA PSL LLQ+YN+LE++LPFH  YLTQQA 
Sbjct  278   DAMHELSSAIMSLSKSRIMMELNYMMSYGAAEPSLSLLQRYNILEIVLPFHGTYLTQQAS  337

Query  1139  KQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMY  1315
             KQS  +S MLMKLFSSLDQLVSC +P+ +S+WVALLAFH+ L+ +PQ   V+LT ASV+Y
Sbjct  338   KQSGKSSVMLMKLFSSLDQLVSCGQPSHDSVWVALLAFHMALITHPQHVFVILTFASVLY  397

Query  1316  HRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQV----NMLTDADN  1483
             H NWK+ V+FA +H + A++Y PE+SDS GS+SEDELAK+V  +AVQV    N+L D D+
Sbjct  398   HANWKEAVKFAEKHSEDAAVYGPELSDSHGSISEDELAKKVAQLAVQVQKSINILADRDS  457

Query  1484  LREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKG  1663
             L E  SKF G+  SGLVFVSNKM +   VE +F IL  DVTSL  +    +I   S    
Sbjct  458   LLEAMSKFPGAPCSGLVFVSNKMGR--TVELMFDILVKDVTSLKTRKDVYRIDYISL---  512

Query  1664  TAHKKGNGIAHETRFLLSKIILDT  1735
                  G G   ETRFLL K+ILDT
Sbjct  513   -----GKGNMCETRFLLGKVILDT  531



>ref|XP_004232557.1| PREDICTED: uncharacterized protein LOC101254858 [Solanum lycopersicum]
Length=810

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/501 (61%), Positives = 376/501 (75%), Gaps = 18/501 (4%)
 Frame = +2

Query  251   LQKFNQTSAGDGIQLES-TTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVV  427
              QKFN  +       E  + +  + S    G+I+FS WRKL +R FGI+ S I   +W V
Sbjct  20    FQKFNHNTYSKAKYREQHSANMGSGSLVDTGEIDFSKWRKLYSREFGISNSMIPAYAWTV  79

Query  428   LNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRV  607
             L  L+  GF+AYLVGGCVRDLILN+IPKDFDVITTARL +IK+ F+RA I+GRRFPICRV
Sbjct  80    LKGLQSGGFEAYLVGGCVRDLILNKIPKDFDVITTARLPQIKRCFHRAIIIGRRFPICRV  139

Query  608   HIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYD  787
             HI+GS+VEVSSFDT A    E+K+    +P+MPK  ++ D I W++S+HRDFT+NSLF+D
Sbjct  140   HIKGSIVEVSSFDTKAKPIGESKKLP--IPKMPKKFHQKDFILWKDSMHRDFTVNSLFFD  197

Query  788   PFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAI  967
             P V  IYDYANA+ D+KS +LRTL+PA LSFEEDCARILRGLRLAARLK SFS E E A+
Sbjct  198   PSVNTIYDYANAIVDLKSLQLRTLVPAHLSFEEDCARILRGLRLAARLKLSFSKEIEIAM  257

Query  968   WKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQS  1147
              KLS S+M L+KSRLMMEVNYMLSYGAA PSL LLQ+YN+L +LLPFHAA+L QQ++KQ 
Sbjct  258   HKLSSSIMILNKSRLMMEVNYMLSYGAAEPSLSLLQRYNILGMLLPFHAAHLAQQSNKQL  317

Query  1148  SDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRN  1324
             S++S MLMKLFSSLDQLV+C+RP+ +SLWVALLAFHL L+N+PQ   VVLT ASV+YH +
Sbjct  318   SESSVMLMKLFSSLDQLVTCDRPSHDSLWVALLAFHLALINDPQGAFVVLTFASVLYHGD  377

Query  1325  WKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQV----NMLTDADNLRE  1492
             WK+GV+FAR+H  AAS+YVPEISDS GS+S+DEL +RV  +AV V    ++LTD D+L+E
Sbjct  378   WKEGVKFARRHSDAASIYVPEISDSQGSISDDELVERVTELAVLVQNSLDILTDKDSLQE  437

Query  1493  VTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAH  1672
               SKF GS  SGLVFVS  M K  VVE +F +LT DV SL  +  S +I           
Sbjct  438   AMSKFPGSPCSGLVFVSKNMRK--VVEVIFDVLTEDVRSLKTRRNSFEIDYTLL------  489

Query  1673  KKGNGIAHETRFLLSKIILDT  1735
               G G   ETRF+L K+ILDT
Sbjct  490   --GKGQTRETRFVLGKVILDT  508



>ref|XP_006343336.1| PREDICTED: uncharacterized protein LOC102605830 isoform X2 [Solanum 
tuberosum]
Length=767

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/501 (60%), Positives = 371/501 (74%), Gaps = 18/501 (4%)
 Frame = +2

Query  251   LQKFNQ-TSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVV  427
             LQKF Q T A    + + + D   +S  + G+I+FS WRKLD+R+FGI+ S I PS  VV
Sbjct  44    LQKFKQHTFAECERESQVSADSGIESVVEAGQIDFSKWRKLDSRNFGISRSMIPPSPRVV  103

Query  428   LNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRV  607
             L +L  +GF+AYLVGGCVRDLILNRIPKDFD+IT A L +IKKQF R EIVGR FPICRV
Sbjct  104   LKILHGEGFEAYLVGGCVRDLILNRIPKDFDIITNATLRQIKKQFRRCEIVGRIFPICRV  163

Query  608   HIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYD  787
             H++GS+VEVSSFDTVA   +  K +   VP+MPKGC E D I W NS+HRDFTINSLF++
Sbjct  164   HVKGSIVEVSSFDTVAKHAE--KEEAPLVPKMPKGCPEKDFILWNNSMHRDFTINSLFFN  221

Query  788   PFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAI  967
             PFV +IYDYANAM D++S KLRTL+PA LSF EDCARILRGLRLAARL  SF+ E E A+
Sbjct  222   PFVNRIYDYANAMQDLRSLKLRTLVPAHLSFGEDCARILRGLRLAARLNLSFTKEIEDAM  281

Query  968   WKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQS  1147
              +LS ++MSL  SR+MME+NYM+SYGAA PSL LLQ+YN+LE++LPFH  YLTQQA KQ 
Sbjct  282   HELSSAIMSLSNSRIMMELNYMMSYGAAEPSLSLLQRYNILEIVLPFHGTYLTQQASKQL  341

Query  1148  SDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRN  1324
               +S MLMKLFSSLDQ V+C +P+ +S+WVALL FH+ L+ +PQ   V+LT ASV+YH N
Sbjct  342   GKSSVMLMKLFSSLDQSVTCGQPSHDSVWVALLVFHMALITHPQHVFVILTFASVLYHAN  401

Query  1325  WKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQV----NMLTDADNLRE  1492
             WK+ V+FA +H + A++Y PE SDS GS+SEDELAK+V  +AVQV    N+LTD D+L E
Sbjct  402   WKEAVKFAEKHSEDAAVYGPEFSDSQGSISEDELAKKVAQLAVQVQKSINILTDRDSLLE  461

Query  1493  VTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAH  1672
               SKF G+  SGLVFVSNKM +   VE +F IL  DVTSL  +    +I   S       
Sbjct  462   AMSKFPGAPCSGLVFVSNKMGR--AVELMFDILVKDVTSLKTRKDVYRIDYVSL------  513

Query  1673  KKGNGIAHETRFLLSKIILDT  1735
               G G   ETRFLL K+ILDT
Sbjct  514   --GKGNMCETRFLLGKVILDT  532



>ref|XP_006343335.1| PREDICTED: uncharacterized protein LOC102605830 isoform X1 [Solanum 
tuberosum]
Length=771

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/483 (61%), Positives = 362/483 (75%), Gaps = 17/483 (4%)
 Frame = +2

Query  302   TTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCV  481
             + D   +S  + G+I+FS WRKLD+R+FGI+ S I PS  VVL +L  +GF+AYLVGGCV
Sbjct  66    SADSGIESVVEAGQIDFSKWRKLDSRNFGISRSMIPPSPRVVLKILHGEGFEAYLVGGCV  125

Query  482   RDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANK  661
             RDLILNRIPKDFD+IT A L +IKKQF R EIVGR FPICRVH++GS+VEVSSFDTVA  
Sbjct  126   RDLILNRIPKDFDIITNATLRQIKKQFRRCEIVGRIFPICRVHVKGSIVEVSSFDTVAKH  185

Query  662   GDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKS  841
              +  K +   VP+MPKGC E D I W NS+HRDFTINSLF++PFV +IYDYANAM D++S
Sbjct  186   AE--KEEAPLVPKMPKGCPEKDFILWNNSMHRDFTINSLFFNPFVNRIYDYANAMQDLRS  243

Query  842   QKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMME  1021
              KLRTL+PA LSF EDCARILRGLRLAARL  SF+ E E A+ +LS ++MSL  SR+MME
Sbjct  244   LKLRTLVPAHLSFGEDCARILRGLRLAARLNLSFTKEIEDAMHELSSAIMSLSNSRIMME  303

Query  1022  VNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLV  1198
             +NYM+SYGAA PSL LLQ+YN+LE++LPFH  YLTQQA KQ   +S MLMKLFSSLDQ V
Sbjct  304   LNYMMSYGAAEPSLSLLQRYNILEIVLPFHGTYLTQQASKQLGKSSVMLMKLFSSLDQSV  363

Query  1199  SCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLY  1378
             +C +P+ +S+WVALL FH+ L+ +PQ   V+LT ASV+YH NWK+ V+FA +H + A++Y
Sbjct  364   TCGQPSHDSVWVALLVFHMALITHPQHVFVILTFASVLYHANWKEAVKFAEKHSEDAAVY  423

Query  1379  VPEISDSDGSMSEDELAKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSN  1546
              PE SDS GS+SEDELAK+V  +AVQV    N+LTD D+L E  SKF G+  SGLVFVSN
Sbjct  424   GPEFSDSQGSISEDELAKKVAQLAVQVQKSINILTDRDSLLEAMSKFPGAPCSGLVFVSN  483

Query  1547  KMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKII  1726
             KM +   VE +F IL  DVTSL  +    +I   S         G G   ETRFLL K+I
Sbjct  484   KMGR--AVELMFDILVKDVTSLKTRKDVYRIDYVS--------LGKGNMCETRFLLGKVI  533

Query  1727  LDT  1735
             LDT
Sbjct  534   LDT  536



>ref|XP_009591705.1| PREDICTED: uncharacterized protein LOC104088689 isoform X2 [Nicotiana 
tomentosiformis]
Length=674

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/612 (52%), Positives = 406/612 (66%), Gaps = 50/612 (8%)
 Frame = +2

Query  404   ISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVG  583
             I PS+WVVL +L+ +GF+AYLVGGCVRDLILNRIPKDFD+IT ARL +IKKQF R++IVG
Sbjct  2     IPPSAWVVLKILQSEGFEAYLVGGCVRDLILNRIPKDFDIITNARLPQIKKQFRRSQIVG  61

Query  584   RRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDF  763
             +RFPICRVH++GSV+EVSSFDTVA   +  K +  FVP+MPKGC++ D + W+NS+HRDF
Sbjct  62    QRFPICRVHVKGSVIEVSSFDTVAKNAE--KEEELFVPKMPKGCDQKDFVLWKNSMHRDF  119

Query  764   TINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSF  943
             TINSLF++P V +IYDY NAM D++S KLRTL+PA LSF EDCARILRGLRLAARL  SF
Sbjct  120   TINSLFFNPLVNRIYDYVNAMQDLRSLKLRTLVPAHLSFGEDCARILRGLRLAARLSLSF  179

Query  944   SMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYL  1123
             + E E  + + S S+MSL K+R+ ME+NYM+SYGAA PSL LLQ+YN+LE++LPFH AYL
Sbjct  180   TKEIEDWMDEFSSSIMSLSKARIRMELNYMMSYGAAAPSLSLLQRYNILEIVLPFHGAYL  239

Query  1124  TQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTL  1300
              QQA +QS D+S MLMKLFSSLDQ V+C +P+ +S+WVALLAFHL L+ +PQ  LV+LT 
Sbjct  240   AQQACEQSGDSSVMLMKLFSSLDQFVTCGQPSHDSVWVALLAFHLALITHPQHALVILTF  299

Query  1301  ASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQV----NML  1468
             ASV+YH NWK+GV+FA +H +AA++Y PE+ DS  S+S+DELA+RV  +AVQV    N+L
Sbjct  300   ASVLYHGNWKEGVKFAEKHSEAAAVYAPEVYDSQVSISDDELAERVAQLAVQVQKSINIL  359

Query  1469  TDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNP  1648
             TD D+L E  SKF G+  SGLVFVS +M K   VE +F IL   VTS      + KI   
Sbjct  360   TDGDSLLEALSKFPGAPCSGLVFVSMRMGKD--VELMFDILVKGVTSFKTSKKNFKIDYN  417

Query  1649  SPQKGTAHKKGNGIAHETRFLLSKIILDTlglggvileegeSKKRNSEYDEIDGLQE---  1819
             S         G G  HETRFLL K+ILDT+  G     E    +++    E DG QE   
Sbjct  418   SL--------GKGHVHETRFLLGKVILDTIVPGVSTGVEVIEAEKHVLL-EGDGRQEEDV  468

Query  1820  VKENSHSQMEMKQEDYNLCNISPMGGEFEPA--RAKKRKSTHTSSSLSEEGAVTKHKKSA  1993
              +E  H  +E+ + +Y   + S +   +E    R +K+K      S   E    K K  A
Sbjct  469   SQETFHGNVELMKPEYVSEDDSELDENYELQHNRTEKQKLNQKGCSDLVEAVTKKQKIIA  528

Query  1994  DEQTAFDHSKCLQKVHESATKHKKSVDESEFTQRESSEELVKRKLNSHPKSLGADDMVEH  2173
              E++            E A K +  +D+++F  RE                L   D V  
Sbjct  529   AERS-----------EEMALKKQDLIDDTDFLSRE----------------LDRGDTVTR  561

Query  2174  KKSKKTLFDLFK  2209
             KK K T   LFK
Sbjct  562   KKIKGTRTQLFK  573



>ref|XP_009802248.1| PREDICTED: uncharacterized protein LOC104247821 isoform X2 [Nicotiana 
sylvestris]
Length=674

 Score =   546 bits (1407),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 318/612 (52%), Positives = 410/612 (67%), Gaps = 50/612 (8%)
 Frame = +2

Query  404   ISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVG  583
             I PS+WVVL +L+ +GF+AYLVGGCVRDLILNRIPKDFD+IT A+L +IKKQF+R++IVG
Sbjct  2     IPPSAWVVLKILQSEGFEAYLVGGCVRDLILNRIPKDFDIITNAKLPQIKKQFHRSQIVG  61

Query  584   RRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDF  763
             +RFPICRVH++GSV+EVSSFDTVA   +  K +  FVP+MPKGC++ D I W+NS+HRDF
Sbjct  62    QRFPICRVHVKGSVIEVSSFDTVAKNAE--KEEEIFVPKMPKGCDQKDFILWKNSMHRDF  119

Query  764   TINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSF  943
             TINSLF++P + +IYDY NAM D++S KLRTL+P  LSF EDCARILRGLRLAARL  SF
Sbjct  120   TINSLFFNPLMNRIYDYVNAMQDLRSLKLRTLVPTHLSFGEDCARILRGLRLAARLNLSF  179

Query  944   SMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYL  1123
             + E E  + + S S+MSL K+R+ ME+NYM+SYGAA PSL LLQ+YN+LE++ PFH AYL
Sbjct  180   TKEIEDWMDEFSSSIMSLSKARIRMELNYMMSYGAAAPSLSLLQRYNILEIVFPFHGAYL  239

Query  1124  TQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTL  1300
              QQA KQ  D+S MLMKLFSSLDQ V+C +P+ +S+WVALLAFHL L+ +PQ  LV+L  
Sbjct  240   AQQACKQLGDSSVMLMKLFSSLDQFVTCGQPSHDSVWVALLAFHLALITHPQHALVILIF  299

Query  1301  ASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQV----NML  1468
             ASV+YH NWK+GV+FA +H +AA++YVPE+SDS  S+S+DELA+RV  +AVQV    N+L
Sbjct  300   ASVLYHGNWKEGVKFAEKHSEAAAVYVPEVSDSQVSISDDELAERVAQLAVQVQKSINIL  359

Query  1469  TDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNP  1648
             TD D+L E  SKF G+  SGLVFVS +M K   VE +F IL  DVTS      + KI   
Sbjct  360   TDGDSLLEAMSKFPGAPCSGLVFVSMRMGKD--VELMFDILVKDVTSFKTSKKNFKIDYD  417

Query  1649  SPQKGTAHKKGNGIAHETRFLLSKIILDTlglggvileegeSKKRNSEYDEIDGLQE---  1819
             S         G G   ETRFLL K+ILDT+  G     E    +++    E DG QE   
Sbjct  418   SL--------GKGHVCETRFLLGKVILDTIVPGVSTGVEVIEAEKHVLL-ESDGQQEEDT  468

Query  1820  VKENSHSQMEMKQEDYNLCNISPMGGEFEPA--RAKKRKSTHTSSSLSEEGAVTKHKKSA  1993
              +E  H  +E+ + +Y   + S +   +E    R +K+K      S   E AVTK +K  
Sbjct  469   SQETFHGNVELMKPEYVSEDNSDLDENYELQHNRIEKQKLNQKGCSDLVE-AVTKKQKI-  526

Query  1994  DEQTAFDHSKCLQKVHESATKHKKSVDESEFTQRESSEELVKRKLNSHPKSLGADDMVEH  2173
                 A +HS+      E A K +  +D+++F  +E                L   D V  
Sbjct  527   ---VAAEHSE------EMALKKQDLIDDTDFLSQE----------------LDRGDTVTK  561

Query  2174  KKSKKTLFDLFK  2209
             KK K T   LFK
Sbjct  562   KKIKGTRTQLFK  573



>ref|XP_010649309.1| PREDICTED: uncharacterized protein LOC104879172 [Vitis vinifera]
Length=688

 Score =   528 bits (1359),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 291/524 (56%), Positives = 369/524 (70%), Gaps = 22/524 (4%)
 Frame = +2

Query  185   AILLSSVEQFVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQP--GKIEFSN  358
             A+ L +   FV + + AL    LQ+F+      G+Q +   D  +DSN  P   +I+ S 
Sbjct  2     ALTLKASNGFVSR-IRALFK--LQRFSHAIVDGGLQPQFHRDMGSDSNSIPEQCQIDMSK  58

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KLD+R FGIT S IS  SWVVL +L+++GF+AYLVGGCVRDLILN+ PKDFDVITTA+
Sbjct  59    WKKLDSRTFGITRSMISSPSWVVLKLLQREGFEAYLVGGCVRDLILNKTPKDFDVITTAK  118

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L +IKK+F RA+IVGRRFPICRVH++GSV+EVSSF+TVA  G+E K K SF  +MP GC+
Sbjct  119   LKQIKKRFRRAQIVGRRFPICRVHVKGSVIEVSSFETVAKHGEE-KEKVSF-SQMPSGCD  176

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             ESD  RWRN +HRDFTINSLF+DPFV +IYDYAN M D++S KLRTLIPAQLSF+EDCAR
Sbjct  177   ESDFNRWRNCMHRDFTINSLFFDPFVNKIYDYANGMKDLRSLKLRTLIPAQLSFKEDCAR  236

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             +LRGLR+AARL  SFS ETETAI  L+ SV SLDKSR+M+E+NYMLSYG+A PSLCLL +
Sbjct  237   MLRGLRIAARLGLSFSRETETAIRSLASSVKSLDKSRIMLELNYMLSYGSAKPSLCLLWR  296

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTSML-MKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             +NLL++LLPFH AYL QQA + S+  SM+ MKLF +LD+LV+C+RP   SLWV LLAFH+
Sbjct  297   FNLLDILLPFHGAYLAQQATEPSAQHSMMFMKLFFNLDKLVTCDRPCDCSLWVGLLAFHM  356

Query  1256  TLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKR  1435
              LVN PQ   VV TL+SV+YH  W +GV+FAR+H  A   + PEI     S S++ELA+R
Sbjct  357   ALVNKPQDASVVWTLSSVLYHGKWTEGVKFARKHALAPISFSPEILVECDSKSDEELAER  416

Query  1436  VENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDV  1603
             V  +A  V       T   +L    S +     SGLVFV  +M ++  V  +F +L N +
Sbjct  417   VSELASLVQDCAIFSTKTGDLSASMSDYPDYPCSGLVFVQKRMAER--VAHIFNVLVNGI  474

Query  1604  TSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              S  E   S +I          +  G G   ETRF+L K+I+DT
Sbjct  475   ESYKEGRESPEID--------YYLLGKGDLRETRFVLGKVIMDT  510



>ref|XP_010317682.1| PREDICTED: uncharacterized protein LOC101265314 isoform X2 [Solanum 
lycopersicum]
Length=732

 Score =   524 bits (1350),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 275/434 (63%), Positives = 331/434 (76%), Gaps = 17/434 (4%)
 Frame = +2

Query  449   GFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVV  628
             GF+AYLVGGCVRDLILNRIPKDFD+IT ARL +IKKQF R EIVGR FPICRVH++GS+V
Sbjct  73    GFEAYLVGGCVRDLILNRIPKDFDIITNARLRQIKKQFRRCEIVGRIFPICRVHVKGSIV  132

Query  629   EVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIY  808
             EVSSFDTVA   +  K +   VP +PKGC E D I W NS+HRDFTINSLF++PF  +IY
Sbjct  133   EVSSFDTVAKHAE--KEEAPLVPEIPKGCPEKDFILWNNSMHRDFTINSLFFNPFANRIY  190

Query  809   DYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSV  988
             DYANAM D++S KLRTL+PA LSF ED ARILRGLRLAARL  SF+ E E A+ +LS ++
Sbjct  191   DYANAMQDLRSLKLRTLVPAHLSFGEDSARILRGLRLAARLNLSFTKEIEDAMHELSSAI  250

Query  989   MSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-ML  1165
             MSL KSR+MME+NYM+SYGAA PSL LLQ+YN+LE++LPFH  YLTQQA KQS  +S ML
Sbjct  251   MSLSKSRIMMELNYMMSYGAAEPSLSLLQRYNILEIVLPFHGTYLTQQASKQSGKSSVML  310

Query  1166  MKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEF  1345
             MKLFSSLDQLVSC +P+ +S+WVALLAFH+ L+ +PQ   V+LT ASV+YH NWK+ V+F
Sbjct  311   MKLFSSLDQLVSCGQPSHDSVWVALLAFHMALITHPQHVFVILTFASVLYHANWKEAVKF  370

Query  1346  ARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQV----NMLTDADNLREVTSKFSG  1513
             A +H + A++Y PE+SDS GS+SEDELAK+V  +AVQV    N+L D D+L E  SKF G
Sbjct  371   AEKHSEDAAVYGPELSDSHGSISEDELAKKVAQLAVQVQKSINILADRDSLLEAMSKFPG  430

Query  1514  SSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIA  1693
             +  SGLVFVSNKM +   VE +F IL  DVTSL  +    +I   S         G G  
Sbjct  431   APCSGLVFVSNKMGR--TVELMFDILVKDVTSLKTRKDVYRIDYISL--------GKGNM  480

Query  1694  HETRFLLSKIILDT  1735
              ETRFLL K+ILDT
Sbjct  481   CETRFLLGKVILDT  494



>ref|XP_007046524.1| Polynucleotide adenylyltransferase family protein, putative [Theobroma 
cacao]
 gb|EOX90681.1| Polynucleotide adenylyltransferase family protein, putative [Theobroma 
cacao]
Length=714

 Score =   513 bits (1321),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 308/646 (48%), Positives = 421/646 (65%), Gaps = 40/646 (6%)
 Frame = +2

Query  185   AILLSSVEQFVEQLVTALLMSL--LQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSN  358
             AILL S     +  +++ L SL   ++  QT    G Q E  ++ A   N     I+ S 
Sbjct  2     AILLRS-----KTFLSSRLKSLPRFERCKQTLGERGFQAELYSEMAPAPNPVLHPIDTSK  56

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+ A   GITGS IS  SW+VLN L+K+GF+AYLVGGCVRDL+L RIPKDFDVITTA 
Sbjct  57    WKKIQASKVGITGSMISLPSWIVLNTLRKEGFEAYLVGGCVRDLLLKRIPKDFDVITTAN  116

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L +IKK+F+RAEIVGRRFPICRVHI+G V+EVSSF+TVA K DE K K +    +P GC+
Sbjct  117   LKQIKKKFHRAEIVGRRFPICRVHIKGFVIEVSSFETVA-KHDEDKAK-ALSSLIPNGCD  174

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D+IRWRNS++RDFTINSLF+DPF ++IYDY + M+D+KS KL+T+IPA LSF+EDCAR
Sbjct  175   EKDLIRWRNSMNRDFTINSLFFDPFTFKIYDYNSGMSDLKSLKLQTIIPAHLSFQEDCAR  234

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRGLR+AARL  SFS +TE+A+  LS S+  LDK RLM+E+NYMLSYGAA  S+ LLQ+
Sbjct  235   ILRGLRIAARLGLSFSKDTESAMHNLSSSIEGLDKFRLMLELNYMLSYGAAESSIYLLQR  294

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLT  1258
             +NLL +LLPF AAY+  Q  K + ++ MLMKLF +LD+LVSC+ PA  SLW+ LL FHL 
Sbjct  295   FNLLNILLPFQAAYINHQ--KSTQNSMMLMKLFFNLDKLVSCDHPADSSLWIGLLIFHLA  352

Query  1259  LVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRV  1438
             L+NNPQ  LVV T ASV+YH  WK+GVEF+R+H K    +VPEIS    + S+++LAK V
Sbjct  353   LLNNPQDALVVWTFASVLYHGKWKEGVEFSREHTKVGVKFVPEISGFSETKSDEDLAKEV  412

Query  1439  ENMA--VQ--VNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVT  1606
                A  VQ  V  LT+  +L E  S++S S  SGLVFV  K  +     ++F ++ +D+ 
Sbjct  413   SQFASLVQDSVCALTETSSLFESMSRYSFSPCSGLVFVPKKTARD--AAKIFDLMVDDIE  470

Query  1607  SLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDTlglggvileegeSKKRN  1786
             S          Q  SP     H  G G   ETR++L KIIL+T+  G +      +   N
Sbjct  471   SFVNGR-----QRESPGI-NYHLLGKGDPRETRYVLGKIILETMKDGRLGEGTRIA---N  521

Query  1787  SEYDEIDGLQEVKENSHSQMEMKQEDYNLCNISPMGGEFEPARAKKRKSTHTSSSLSEEG  1966
              E D +      K  +++Q+ +K++   + ++  +  E +    KK+KS  ++ ++SE  
Sbjct  522   GEKDHLQPKVIEKNLANNQLPLKKDKKRVPSL--LNPEAKQGLPKKQKSVDSNHNISELY  579

Query  1967  AVTKHKKSADEQTAFDHSKCLQKVHESATKHKKSVDESEFTQRESS  2104
             A  K++ + +E              + A KH+K V+  +F+++E+S
Sbjct  580   AAIKNQLAKEE------------FQDLAKKHQKLVEAYKFSEQETS  613



>ref|XP_002521705.1| poly(A) polymerase, putative [Ricinus communis]
 gb|EEF40692.1| poly(A) polymerase, putative [Ricinus communis]
Length=675

 Score =   509 bits (1311),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 299/592 (51%), Positives = 383/592 (65%), Gaps = 38/592 (6%)
 Frame = +2

Query  242   MSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSW  421
             ++ LQ+FN  S  +   L      +   + Q   I+ S W+K++A   GI  S I PS W
Sbjct  18    LTTLQRFNH-SLIEQTPLYPRMISSDSKDQQSTVIDISKWKKINASAVGIKRSMIPPSPW  76

Query  422   VVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPIC  601
             +VL +L  KGF+AYLVGGCVRDL+LNRIPKDFDVITTA+L ++KKQF+R EIVGRRFPIC
Sbjct  77    LVLKILHNKGFEAYLVGGCVRDLLLNRIPKDFDVITTAKLKQVKKQFHRCEIVGRRFPIC  136

Query  602   RVHIRGSVVEVSSFDTVA--NKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINS  775
             RVH++GSVVEVSSF+TVA  N+G E       + + P GCN  D IRWRNS+HRDFTINS
Sbjct  137   RVHVKGSVVEVSSFETVAQHNEGKE----EVLISQKPSGCNGRDFIRWRNSMHRDFTINS  192

Query  776   LFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMET  955
             LF+DPF+ QI+DYAN MAD+   KLRT+IPA+LSF+EDCARILRGLR+A RL  S S +T
Sbjct  193   LFFDPFMNQIFDYANGMADLSFLKLRTVIPARLSFQEDCARILRGLRIAGRLGLSISKDT  252

Query  956   ETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA  1135
             E+AI KLS SV SLDK+R+MME+NYMLSYGAA  ++ LLQ++NLLE+ LPFHAAYL+QQA
Sbjct  253   ESAIRKLSSSVKSLDKARIMMELNYMLSYGAAESTIYLLQRFNLLELFLPFHAAYLSQQA  312

Query  1136  DKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVM  1312
              +  S  S MLMKLF +LD LVSC+RP   SLWV LLAFH  LV NPQ  LV    ASV+
Sbjct  313   GETFSLGSVMLMKLFFNLDTLVSCDRPCTSSLWVGLLAFHQALVTNPQDALVSWVFASVL  372

Query  1313  YHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMA--VQ--VNMLTDAD  1480
             YH  WK GVEFAR++ K    + PEIS      S++ELA+ V ++A  VQ  V+ L D D
Sbjct  373   YHGKWKDGVEFARENAKMQVKFAPEISGFSEFKSDEELAEEVSHLASLVQDSVDALMDTD  432

Query  1481  NLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQK  1660
              L +  S+F  +S SGLVFVS K+     V ++F +L +DV S   +  S  I       
Sbjct  433   TLAQSMSRFGVTSSSGLVFVSKKIAND--VAQLFNVLVDDVESYKTERESFMID------  484

Query  1661  GTAHKKGNGIAHETRFLLSKIILDTlglggvileegeSKKRNSEYDEIDGLQEVKENSHS  1840
                +  G G  HETRF+L K+IL+TL  G           +  E  E DG + ++E   S
Sbjct  485   --YYLLGKGNQHETRFVLGKVILETLSGGLT---------KGVEVAE-DGPKVIEEKHDS  532

Query  1841  QMEMKQEDY------NLCNISPMGGEFEPARAKKRKSTHTSSSLSEEGAVTK  1978
             ++    +DY       +  +SP+  E    +   ++    + S  EE   TK
Sbjct  533   KLSDLVKDYMVEWKEEIPVLSPLDHEHSQKKTGNKRKLVMTKSFYEEKVATK  584



>ref|XP_008242074.1| PREDICTED: uncharacterized protein LOC103340431 [Prunus mume]
Length=689

 Score =   505 bits (1300),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 268/470 (57%), Positives = 339/470 (72%), Gaps = 20/470 (4%)
 Frame = +2

Query  344   IEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDV  523
             I+ S W+KLD+R+ GI  S +S  SW+VL +L+ +GF+AYLVGGCVRDLIL RIPKDFDV
Sbjct  8     IDMSKWKKLDSRNLGIKPSMVSQPSWIVLKILQSEGFEAYLVGGCVRDLILKRIPKDFDV  67

Query  524   ITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRM  703
             ITTA L +IKKQFYRAEIVGRRFPICRV ++GSV+EVSSF+TVA       +K +  P  
Sbjct  68    ITTANLKQIKKQFYRAEIVGRRFPICRVRVKGSVIEVSSFETVAKHAG---KKEADSPCR  124

Query  704   PKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFE  883
             P GC++ D IRWRNS+HRDFTINSLF+DPF  +IYDYAN MAD++S KLRTL  A+LSFE
Sbjct  125   PPGCDKKDFIRWRNSMHRDFTINSLFFDPFANKIYDYANGMADLRSLKLRTLGSAKLSFE  184

Query  884   EDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSL  1063
             EDCARILRGLR+AARL  S S ETETA+ +LS S++ LDKSR+MME+NYMLSYGAA PS 
Sbjct  185   EDCARILRGLRIAARLSLSISKETETAMHRLSSSILKLDKSRIMMELNYMLSYGAAEPSF  244

Query  1064  CLLQKYNLLEVLLPFHAAYLTQQAD--KQSSDTSMLMKLFSSLDQLVSCERPARESLWVA  1237
             CLL +++LL++LLPFHAAY  QQ+   K +  ++ML KLFSSLD+++SC+RP+  +LWV 
Sbjct  245   CLLWRFDLLKILLPFHAAYFDQQSKNMKTAQSSTMLTKLFSSLDKVLSCDRPSESTLWVG  304

Query  1238  LLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSE  1417
             LLAFHL LVNNPQ  LVVLT ASV+YH  W+ GV+F+R + +    YVPEI  S    S+
Sbjct  305   LLAFHLALVNNPQDALVVLTFASVLYHEEWEDGVKFSRDNAEGIVNYVPEILCSSEFKSD  364

Query  1418  DELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFG  1585
              ELAK V  +A      ++ LT  ++L E  S++     SGLVFV  KM ++  V E+F 
Sbjct  365   KELAKEVSQLASFVLDSISTLTATESLIESMSRYPLFPCSGLVFVPKKMAEE--VAEIFK  422

Query  1586  ILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              L N + S N+   S +I          H  G G   E RF++ K+IL+T
Sbjct  423   GLVN-IKSYNKGRKSFQID--------YHLLGKGYLSEVRFVIGKVILET  463



>ref|XP_007202880.1| hypothetical protein PRUPE_ppa015787mg, partial [Prunus persica]
 gb|EMJ04079.1| hypothetical protein PRUPE_ppa015787mg, partial [Prunus persica]
Length=669

 Score =   503 bits (1295),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 266/470 (57%), Positives = 339/470 (72%), Gaps = 20/470 (4%)
 Frame = +2

Query  344   IEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDV  523
             I+ S W+KLD+R+ GI  S +S  SW+VL +L+ +GF+AYLVGGCVRDLIL RIPKDFDV
Sbjct  2     IDTSKWKKLDSRNLGIKPSMVSQPSWIVLKILQSEGFEAYLVGGCVRDLILKRIPKDFDV  61

Query  524   ITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRM  703
             ITTA L +IK+QFYRAEIVGRRFPICRVH++GSV+EVSSF+TVA       +K +  P  
Sbjct  62    ITTANLKQIKRQFYRAEIVGRRFPICRVHVKGSVIEVSSFETVAKHAG---KKEADSPCR  118

Query  704   PKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFE  883
             P GC++ D IRWRNS+HRDFTINSLF+DPF  +IYDYAN M D++S KLRTL  A+LSFE
Sbjct  119   PPGCDKKDFIRWRNSMHRDFTINSLFFDPFANKIYDYANGMVDLRSLKLRTLGSAKLSFE  178

Query  884   EDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSL  1063
             EDCARILRGLR+AARL  S S ETETA+ +LS S++ LDKSR+MME+NYMLSYGAA PS 
Sbjct  179   EDCARILRGLRIAARLSLSISKETETAMHRLSSSILKLDKSRIMMELNYMLSYGAAEPSF  238

Query  1064  CLLQKYNLLEVLLPFHAAYLTQQAD--KQSSDTSMLMKLFSSLDQLVSCERPARESLWVA  1237
             CLL +++LL++LLP HAAY  +Q+   K +  ++MLMKLFSSLD++VSC+RP+  +LWV 
Sbjct  239   CLLWRFDLLKILLPLHAAYFDRQSKNMKTAQSSTMLMKLFSSLDKVVSCDRPSESTLWVG  298

Query  1238  LLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSE  1417
             LLAFHL LVNNPQ  LVVLT ASV+YH  W++GV+F+R + +    YVPEI  S    S+
Sbjct  299   LLAFHLALVNNPQDALVVLTFASVLYHEEWEEGVKFSRDNAEGIVNYVPEILCSSEFKSD  358

Query  1418  DELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFG  1585
               LAK V  +A      ++ LT  ++L E  S++     SGLVFV  KM ++  V E+F 
Sbjct  359   KVLAKEVSQLASFVLDSISALTATESLIESMSRYPVFPCSGLVFVPKKMAEE--VAEIFK  416

Query  1586  ILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              L N + S N+   S +I          H  G G   E RF++ K+IL+T
Sbjct  417   GLVN-IKSYNKGRKSFQID--------YHSLGKGYLSEVRFVIGKVILET  457



>emb|CDP01805.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   495 bits (1274),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 257/445 (58%), Positives = 331/445 (74%), Gaps = 18/445 (4%)
 Frame = +2

Query  212   FVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGI  391
             F+ +L T L     Q FN T           T+      F+ G+IEFS WRKLDAR  GI
Sbjct  14    FLSRLKTLLT---FQNFNHT----------LTEMCPPPVFERGEIEFSKWRKLDARKMGI  60

Query  392   TGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRA  571
               S I  S W+VL +LK +GF+AY VGGCVRDL+LNR+PKDFDVIT+A L +++K+F+R+
Sbjct  61    NQSMIPMSPWIVLKILKNEGFEAYFVGGCVRDLVLNRVPKDFDVITSAALTQVRKKFHRS  120

Query  572   EIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSL  751
              I+GRRFPIC+V+I+GSVVEVSSF T A   D    K S V ++PKGC++ D+ RWRN +
Sbjct  121   MIIGRRFPICQVNIKGSVVEVSSFQTGAQHNDGKDGKFS-VSQLPKGCDKKDLARWRNCM  179

Query  752   HRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarl  931
             HRDFT+NSLF+DPFV +IYDYA+A++D+K  KLRTLIPA+LSFEEDCARILR LRLAARL
Sbjct  180   HRDFTVNSLFFDPFVNKIYDYADALSDLKLSKLRTLIPAKLSFEEDCARILRALRLAARL  239

Query  932   KFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFH  1111
               SFS +TE+AI KLS S++SL KSR++ME+NYMLSYGAA PSL LL++++LLE+LLP  
Sbjct  240   GLSFSEDTESAIHKLSSSILSLAKSRILMELNYMLSYGAAEPSLSLLRRFHLLEILLPLQ  299

Query  1112  AAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVV  1291
              A+LTQQA       SMLMKLFS+LD+LVSC+RPA  SLWVA+LAFHL L++NPQ  LVV
Sbjct  300   EAHLTQQAHISGQRPSMLMKLFSNLDKLVSCDRPADSSLWVAILAFHLALISNPQHPLVV  359

Query  1292  LTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQVN---  1462
             LT+ASV++H  W++GV+FARQH +   +Y+PEI+    S+S+DELA +V  +AVQV    
Sbjct  360   LTVASVLFHGKWEEGVKFARQHAQEVQIYIPEIASCSDSISDDELADKVSELAVQVQNSV  419

Query  1463  -MLTDADNLREVTSKFSGSSHSGLV  1534
               L++A+ L +  +KF      GLV
Sbjct  420   CFLSEAEILLKEMAKFPAFECPGLV  444



>gb|KHG16993.1| putative poly (A) polymerase [Gossypium arboreum]
Length=706

 Score =   496 bits (1276),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 271/499 (54%), Positives = 349/499 (70%), Gaps = 18/499 (4%)
 Frame = +2

Query  254   QKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLN  433
             Q+ N T    G+Q E  +  A   N     I+ S W+K+ A   GI+ S IS  SW+VL 
Sbjct  24    QRCNHTLGERGLQAELYSGMAPAPNPALRPIDTSKWKKIQASKVGISLSMISYPSWIVLK  83

Query  434   VLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHI  613
             +L K GF+AYLVGGCVRDL+LNR PKDFDVITTA L +I+K+F+RAEI+G+RFPICRVHI
Sbjct  84    ILHKGGFEAYLVGGCVRDLLLNRTPKDFDVITTANLKQIRKKFHRAEIIGKRFPICRVHI  143

Query  614   RGSVVEVSSFDTVA-NKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDP  790
             +GS++EVSSF+TVA +  D+ K  +S +P++   C+E D+IRWRNS +RDFTINSLF+DP
Sbjct  144   KGSIIEVSSFETVARHDADKEKALSSLLPKI---CDEKDLIRWRNSRNRDFTINSLFFDP  200

Query  791   FVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIW  970
             F   IYDY   M+D+KS KLRTLIPA LSF+EDC RILRGLR+AARL  SFS +TE A++
Sbjct  201   FTCNIYDYNGGMSDLKSLKLRTLIPAHLSFQEDCGRILRGLRIAARLCLSFSKDTERAMY  260

Query  971   KLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSS  1150
              LS S+  LDK RLM+EVNYMLSYGAAV S+CLLQ++NLL +LLPF AAY++Q   + + 
Sbjct  261   DLSASIGGLDKFRLMLEVNYMLSYGAAVQSICLLQRFNLLNILLPFQAAYISQH--RATK  318

Query  1151  DTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWK  1330
             ++ MLMKLF +LD+LVSC+ PA  S+WV LL FHL LVNNPQ  LV+ T ASV+YH NWK
Sbjct  319   NSMMLMKLFFNLDKLVSCDHPADSSIWVGLLMFHLALVNNPQDALVIWTFASVLYHGNWK  378

Query  1331  QGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMA--VQ--VNMLTDADNLREVT  1498
             +GVEFAR++ K    +VPEIS+   + S+++LAK V   A  VQ  V +LT+  NL E  
Sbjct  379   EGVEFAREYTKLEVKFVPEISEFSETKSDEDLAKEVAQFASLVQDSVGVLTETSNLFESM  438

Query  1499  SKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKK  1678
             S++  S  SGLVFV     K     ++F ++  D+ S       +     SP+    H  
Sbjct  439   SRYPFSPCSGLVFVPKITAKNTA--KLFDLMVEDIRSFINGRGRM-----SPEI-NFHLL  490

Query  1679  GNGIAHETRFLLSKIILDT  1735
             G G   ETRF+L KIIL+T
Sbjct  491   GIGDPCETRFVLGKIILET  509



>ref|XP_006467069.1| PREDICTED: uncharacterized protein LOC102627987 [Citrus sinensis]
Length=689

 Score =   493 bits (1270),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 267/518 (52%), Positives = 360/518 (69%), Gaps = 30/518 (6%)
 Frame = +2

Query  185   AILLSSVEQFVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWR  364
             AILL + ++ + +L +   + L Q+FN T       LE    R   S+    +++ SNW+
Sbjct  2     AILLQAKDRLLSRLKSLTKIQLKQRFNHT-------LEPQMCREMCSDSFNQEVDVSNWK  54

Query  365   KLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLN  544
              +D+R+ GIT + I   SWVVL +LK +GF+AYLVGGCVRDL+L R+PKDFDVITTA L 
Sbjct  55    TVDSRNLGITRAMIPQPSWVVLKILKSQGFQAYLVGGCVRDLLLRRVPKDFDVITTANLK  114

Query  545   EIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNES  724
             +I++QF+R+EI+GRRFPICRVHI+GSV+EVSSF+TVA  G+   ++   + ++P GC+E 
Sbjct  115   QIRRQFHRSEIIGRRFPICRVHIKGSVIEVSSFETVAKHGE--GKETVLLSQIPYGCDEI  172

Query  725   DVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCaril  904
             D++RWRNS+HRDFTINSLF+DPF+ +IYDYAN ++D++  KLRTLIPA LSF EDCARIL
Sbjct  173   DLVRWRNSIHRDFTINSLFFDPFLNKIYDYANGISDLRCLKLRTLIPAYLSFTEDCARIL  232

Query  905   rglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYN  1084
             RGLR+AARL  SF  + +TA+  LS S+  LDKSR+MME+NYMLSYGAA  S+CLL++YN
Sbjct  233   RGLRIAARLGLSFCKDIDTAMHSLSSSIERLDKSRIMMELNYMLSYGAAESSICLLRRYN  292

Query  1085  LLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTL  1261
             LL++LLPFHAAYL QQA K +++   MLM+LF +LD+LVSC+RPA  +LWV LL+FH  L
Sbjct  293   LLKILLPFHAAYLDQQAGKITAENPMMLMRLFFNLDKLVSCDRPADYTLWVGLLSFHQAL  352

Query  1262  VNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVE  1441
             V++PQ   VV   ASV+YH  WK+GV+FAR H K    +VPEIS      S+++LA +V 
Sbjct  353   VSDPQDAFVVWVFASVLYHGKWKEGVKFARDHAKEPVKFVPEISGFSEIESDEQLAVKVT  412

Query  1442  NMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEK  1621
              +A+ V      D + ++T      + SG VFVS K+ +   V+++F +L N + S N  
Sbjct  413   ELALSVQ-----DCVNDLT-----KASSGYVFVSKKIERN--VQQIFDVLVNSIESYNSG  460

Query  1622  SCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               S  I             G G   ETRF+L KIIL T
Sbjct  461   KRSHIID--------YDMLGKGNLVETRFVLGKIILKT  490



>gb|KDO71447.1| hypothetical protein CISIN_1g005593mg [Citrus sinensis]
Length=689

 Score =   490 bits (1262),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 266/518 (51%), Positives = 359/518 (69%), Gaps = 30/518 (6%)
 Frame = +2

Query  185   AILLSSVEQFVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWR  364
             AILL + ++ + +L +   + L Q+FN T       LE    R   S+    +++ SNW+
Sbjct  2     AILLQAKDRLLSRLKSLTKIQLKQRFNHT-------LEPQMCREMCSDSFNQEVDVSNWK  54

Query  365   KLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLN  544
              +D+R+ GIT + I   SWVVL +LK +GF+AYLVGGCVRDL+L R+PKDFDVITTA L 
Sbjct  55    TVDSRNLGITRAMIPQPSWVVLKILKSQGFQAYLVGGCVRDLLLRRVPKDFDVITTANLK  114

Query  545   EIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNES  724
             +I++QF+R+EI+GRRFPICRVHI+GSV+EVSSF+TVA  G+   ++   + ++P GC+E 
Sbjct  115   QIRRQFHRSEIIGRRFPICRVHIKGSVIEVSSFETVAKHGE--GKETVLLSQIPYGCDEI  172

Query  725   DVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCaril  904
             D++RWRNS+HRDFTINSLF+DPF+ +IYDYAN ++D++  KLRTLIPA LSF EDCARIL
Sbjct  173   DLVRWRNSIHRDFTINSLFFDPFLNKIYDYANGISDLRCLKLRTLIPAYLSFTEDCARIL  232

Query  905   rglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYN  1084
             RGLR+AARL  SF  + +TA+  LS S+  LDKSR+MME+NYMLSYGAA  S+CLL++YN
Sbjct  233   RGLRIAARLGLSFCKDIDTAMHSLSSSIERLDKSRIMMELNYMLSYGAAESSICLLRRYN  292

Query  1085  LLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTL  1261
             LL++LLPFHAAYL QQA K +++   MLM+LF +LD+LVSC+RPA  +LWV LL+FH  L
Sbjct  293   LLKILLPFHAAYLDQQAGKITAENPMMLMRLFFNLDKLVSCDRPADYTLWVGLLSFHQAL  352

Query  1262  VNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVE  1441
             V++PQ   VV   ASV+YH  WK+GV+FAR   K    +VPEIS      S+++LA +V 
Sbjct  353   VSDPQDAFVVWVFASVLYHGKWKEGVKFARDRAKEPVKFVPEISGFSEIESDEQLAVKVT  412

Query  1442  NMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEK  1621
              +A+ V      D + ++T      + SG VFVS K+ +   V+++F +L N + S N  
Sbjct  413   ELALSVQ-----DCVNDLT-----KASSGYVFVSKKIERN--VQQIFDVLVNSIESYNSG  460

Query  1622  SCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               S  I             G G   ETRF+L KIIL T
Sbjct  461   KRSHIIDYDML--------GKGNLVETRFVLGKIILKT  490



>ref|XP_006425301.1| hypothetical protein CICLE_v10025049mg [Citrus clementina]
 gb|ESR38541.1| hypothetical protein CICLE_v10025049mg [Citrus clementina]
Length=689

 Score =   489 bits (1260),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 265/518 (51%), Positives = 359/518 (69%), Gaps = 30/518 (6%)
 Frame = +2

Query  185   AILLSSVEQFVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWR  364
             AILL + ++ + +L +   + L Q+FN T       LE    R   S+    +++ SNW+
Sbjct  2     AILLQAKDRLLSRLKSLTKIQLKQRFNHT-------LEPQMCREMCSDSFNQEVDVSNWK  54

Query  365   KLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLN  544
              +D+R+ GIT + I   SWVVL +LK +GF+AYLVGGCVRDL+L R+PKDFDVITTA L 
Sbjct  55    TVDSRNLGITRAMIPQPSWVVLKILKSQGFQAYLVGGCVRDLLLRRVPKDFDVITTANLK  114

Query  545   EIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNES  724
             +I++QF+R+EI+GRRFPICRVHI+GSV+EVSSF+TVA  G+   ++   + ++P GC+E 
Sbjct  115   QIRRQFHRSEIIGRRFPICRVHIKGSVIEVSSFETVAKHGE--GKETVLLSQIPYGCDEI  172

Query  725   DVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCaril  904
             D++RWRNS+HRDFTINSLF+DPF+ +IYDYAN ++D++  KLRTLIPA LSF EDCARIL
Sbjct  173   DLVRWRNSIHRDFTINSLFFDPFLNKIYDYANGISDLRCLKLRTLIPAYLSFTEDCARIL  232

Query  905   rglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYN  1084
             RGLR+AARL  SF  + +TA+  LS S+  LDKSR+MME+NYMLSYGAA  S+CLL++YN
Sbjct  233   RGLRIAARLGLSFCKDIDTAMHSLSSSIERLDKSRIMMELNYMLSYGAAESSICLLRRYN  292

Query  1085  LLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTL  1261
             LL++LLPFHAAYL QQA K +++   MLM+LF +LD+LVSC+RPA  +LWV LL+FH  L
Sbjct  293   LLKILLPFHAAYLDQQAGKITAENPMMLMRLFFNLDKLVSCDRPADYTLWVGLLSFHQAL  352

Query  1262  VNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVE  1441
             V++PQ   +V   ASV+YH  WK+GV+FAR   K    +VPEIS      S+++LA +V 
Sbjct  353   VSDPQDAFLVWVFASVLYHGKWKEGVKFARDRAKEPVKFVPEISGFSEIESDEQLAVKVT  412

Query  1442  NMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEK  1621
              +A+ V      D + ++T      + SG VFVS K+ +   V+++F +L N + S N  
Sbjct  413   ELALSVQ-----DCVNDLT-----KASSGYVFVSKKIERN--VQQIFDVLVNSIESYNSG  460

Query  1622  SCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               S  I             G G   ETRF+L KIIL T
Sbjct  461   KRSHIID--------YDMLGKGNLVETRFVLGKIILKT  490



>gb|KDO71445.1| hypothetical protein CISIN_1g005593mg [Citrus sinensis]
Length=686

 Score =   487 bits (1254),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 265/518 (51%), Positives = 360/518 (69%), Gaps = 33/518 (6%)
 Frame = +2

Query  185   AILLSSVEQFVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWR  364
             AILL + ++ + +L +   ++ +Q+FN T       LE    R   S+    +++ SNW+
Sbjct  2     AILLQAKDRLLSRLKS---LTKIQRFNHT-------LEPQMCREMCSDSFNQEVDVSNWK  51

Query  365   KLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLN  544
              +D+R+ GIT + I   SWVVL +LK +GF+AYLVGGCVRDL+L R+PKDFDVITTA L 
Sbjct  52    TVDSRNLGITRAMIPQPSWVVLKILKSQGFQAYLVGGCVRDLLLRRVPKDFDVITTANLK  111

Query  545   EIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNES  724
             +I++QF+R+EI+GRRFPICRVHI+GSV+EVSSF+TVA  G+   ++   + ++P GC+E 
Sbjct  112   QIRRQFHRSEIIGRRFPICRVHIKGSVIEVSSFETVAKHGE--GKETVLLSQIPYGCDEI  169

Query  725   DVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCaril  904
             D++RWRNS+HRDFTINSLF+DPF+ +IYDYAN ++D++  KLRTLIPA LSF EDCARIL
Sbjct  170   DLVRWRNSIHRDFTINSLFFDPFLNKIYDYANGISDLRCLKLRTLIPAYLSFTEDCARIL  229

Query  905   rglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYN  1084
             RGLR+AARL  SF  + +TA+  LS S+  LDKSR+MME+NYMLSYGAA  S+CLL++YN
Sbjct  230   RGLRIAARLGLSFCKDIDTAMHSLSSSIERLDKSRIMMELNYMLSYGAAESSICLLRRYN  289

Query  1085  LLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTL  1261
             LL++LLPFHAAYL QQA K +++   MLM+LF +LD+LVSC+RPA  +LWV LL+FH  L
Sbjct  290   LLKILLPFHAAYLDQQAGKITAENPMMLMRLFFNLDKLVSCDRPADYTLWVGLLSFHQAL  349

Query  1262  VNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVE  1441
             V++PQ   VV   ASV+YH  WK+GV+FAR   K    +VPEIS      S+++LA +V 
Sbjct  350   VSDPQDAFVVWVFASVLYHGKWKEGVKFARDRAKEPVKFVPEISGFSEIESDEQLAVKVT  409

Query  1442  NMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEK  1621
              +A+ V      D + ++T      + SG VFVS K+ +   V+++F +L N + S N  
Sbjct  410   ELALSVQ-----DCVNDLT-----KASSGYVFVSKKIERN--VQQIFDVLVNSIESYNSG  457

Query  1622  SCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               S  I             G G   ETRF+L KIIL T
Sbjct  458   KRSHIID--------YDMLGKGNLVETRFVLGKIILKT  487



>gb|KDO71446.1| hypothetical protein CISIN_1g005593mg [Citrus sinensis]
Length=684

 Score =   484 bits (1247),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 264/518 (51%), Positives = 356/518 (69%), Gaps = 35/518 (7%)
 Frame = +2

Query  185   AILLSSVEQFVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWR  364
             AILL + ++ + +L +   + L Q+FN T       LE    R   S+    +++ SNW+
Sbjct  2     AILLQAKDRLLSRLKSLTKIQLKQRFNHT-------LEPQMCREMCSDSFNQEVDVSNWK  54

Query  365   KLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLN  544
              +D+R+ GIT + I   SWVVL +LK +GF+AYLVGGCVRDL+L R+PKDFDVITTA L 
Sbjct  55    TVDSRNLGITRAMIPQPSWVVLKILKSQGFQAYLVGGCVRDLLLRRVPKDFDVITTANLK  114

Query  545   EIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNES  724
             +I++QF+R+EI+GRRFPICRVHI+GSV+EVSSF+TVA  G+   ++   + ++P GC+E 
Sbjct  115   QIRRQFHRSEIIGRRFPICRVHIKGSVIEVSSFETVAKHGE--GKETVLLSQIPYGCDEI  172

Query  725   DVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCaril  904
             D++RWRNS+HRDFTINSLF+DPF+ +IYDYAN ++D++  KLRTLIPA LSF EDCARIL
Sbjct  173   DLVRWRNSIHRDFTINSLFFDPFLNKIYDYANGISDLRCLKLRTLIPAYLSFTEDCARIL  232

Query  905   rglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYN  1084
             RGLR+AARL  SF  + +TA+  LS S+  LDKSR+MME+NYMLSYGAA  S+CLL++YN
Sbjct  233   RGLRIAARLGLSFCKDIDTAMHSLSSSIERLDKSRIMMELNYMLSYGAAESSICLLRRYN  292

Query  1085  LLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTL  1261
             LL++LLPFHAAYL QQA K +++   MLM+LF +LD+LVSC+RPA  +LWV LL+FH  L
Sbjct  293   LLKILLPFHAAYLDQQAGKITAENPMMLMRLFFNLDKLVSCDRPADYTLWVGLLSFHQAL  352

Query  1262  VNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVE  1441
             V++PQ   VV   ASV+YH  WK+GV+FAR   K    +VPEIS      S+++LA +V 
Sbjct  353   VSDPQDAFVVWVFASVLYHGKWKEGVKFARDRAKEPVKFVPEISGFSEIESDEQLAVKVT  412

Query  1442  NMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEK  1621
              +A+ V      D + ++T           VFVS K+ +   V+++F +L N + S N  
Sbjct  413   ELALSVQ-----DCVNDLTK----------VFVSKKIERN--VQQIFDVLVNSIESYNSG  455

Query  1622  SCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               S  I             G G   ETRF+L KIIL T
Sbjct  456   KRSHIIDYDML--------GKGNLVETRFVLGKIILKT  485



>ref|XP_010266171.1| PREDICTED: uncharacterized protein LOC104603752 [Nelumbo nucifera]
Length=716

 Score =   485 bits (1248),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 287/648 (44%), Positives = 407/648 (63%), Gaps = 34/648 (5%)
 Frame = +2

Query  236   LLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPS  415
             +L+S +QK N   AG+G +       A+D+  +    + S  + +D+R  GI  S IS S
Sbjct  16    ILLSNVQKSNHILAGEGAKARLYGGVASDARAENSIFDISTSKAVDSRILGIKRSMISTS  75

Query  416   SWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFP  595
             +W VL +L+ KGF+AYLVGGCVRDL+L RIPKDFDVITTA L +I+KQF+RA IVGRRFP
Sbjct  76    TWTVLKILQSKGFEAYLVGGCVRDLLLRRIPKDFDVITTATLKQIRKQFHRARIVGRRFP  135

Query  596   ICRVHIRGSVVEVSSFDTVANKGDETKRKNSFV-PRMPKGCNESDVIRWRNSLHRDFTIN  772
             IC VH++GSV+E+SSF+TV   G+  K   + +  +M   C+E D IRWRN +HRDFTIN
Sbjct  136   ICLVHVQGSVIEISSFETV---GEHVKENETVLFSQMSTSCDEKDFIRWRNCMHRDFTIN  192

Query  773   SLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSME  952
             SLF+DPFV  IYDYAN M D+++ K+RT+ PAQLSF+EDCARILRGLR+AARL FSFS E
Sbjct  193   SLFFDPFVNTIYDYANGMQDLRTCKVRTITPAQLSFQEDCARILRGLRIAARLHFSFSEE  252

Query  953   TETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQ  1132
             T  AI  LS SVMSLDKSRLMME+N+MLSYGAA  SL LL+++ LL++LLPF AAYL +Q
Sbjct  253   TAEAIKNLSSSVMSLDKSRLMMEMNFMLSYGAAKSSLHLLKRFKLLDILLPFQAAYLAKQ  312

Query  1133  ADKQSS-DTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASV  1309
              + Q + D++MLM+LF ++D+L++C+RP+   LWV LLAFHL LVNN Q  LVV T + +
Sbjct  313   GNNQGAQDSTMLMRLFLNMDKLLACDRPSDCILWVGLLAFHLALVNNRQDALVVWTFSLL  372

Query  1310  MYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMA----VQVNMLTDA  1477
             +YH +W++ V+FAR++ +    +VPEISD+  + S+D LA+ V  +A      ++ LT  
Sbjct  373   LYHGDWREAVKFARENAQMHIHFVPEISDAGATKSDDMLAEEVSYLASLIISSIDALTGT  432

Query  1478  DNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQ  1657
             ++L +   ++  S   GLVF+S  + + +   E+F +L  D+ S   +  SL+I      
Sbjct  433   ESLLKSMDRYPLSPCPGLVFISKSVGRHVA--ELFSVLKEDIESYTRERESLEINYKLL-  489

Query  1658  KGTAHKKGNGIAHETRFLLSKIILDTlglggvileegeSKKRNSEYDEIDGLQEV-KENS  1834
                    G G  +E RF+L K+I+DT+  G V       ++   E       QE+ K+  
Sbjct  490   -------GKGDRNEVRFVLGKVIMDTMSSGVVQELRAVDEELVKEKHP----QELMKKEK  538

Query  1835  HSQMEMKQEDYNLCNISPMGGEFEPARAKKRKSTHTSSSLSEEGAVTKHKKSADEQTAFD  2014
             H Q E K +DY+    +   G       K++ + H    +++EG     KK    Q A  
Sbjct  539   HWQEEAKDKDYH--EAASKKGRGHGGVGKEKDNYH--KEVAKEGKEIHKKKEKSCQKAAK  594

Query  2015  HSKCLQKVHESATKH----KKSVDESEFTQRESSEELVKRKLNSHPKS  2146
                C +   +   +H    K+ V+  +   +E  E  +++K  SH K+
Sbjct  595   EKYCHEAASKKGRRHGGVDKEKVNYHKEVAKEGKE--IQQKEKSHQKA  640



>ref|XP_009337105.1| PREDICTED: uncharacterized protein LOC103929612 [Pyrus x bretschneideri]
Length=719

 Score =   483 bits (1242),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 269/500 (54%), Positives = 347/500 (69%), Gaps = 17/500 (3%)
 Frame = +2

Query  254   QKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLN  433
             Q+     +  G+Q +       DS    G I+ S W+K++AR  GI  S IS  SW+VL 
Sbjct  24    QRLVHALSEGGLQAQVHPKMVPDSVPDQGFIDMSKWKKVNARVLGIKPSMISQPSWIVLK  83

Query  434   VLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHI  613
             +L+ +GF+AYLVGGCVRDLIL R+PKDFDVITTA L EIKK+F+ A+IVG+RFPICRVH+
Sbjct  84    LLQAEGFEAYLVGGCVRDLILKRVPKDFDVITTANLKEIKKKFHHADIVGQRFPICRVHV  143

Query  614   RGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPF  793
             +G+V+EVSSF+TVA    + K K+S   R P GC++ D IRW+NS+HRDFTINSLF+DPF
Sbjct  144   KGTVIEVSSFETVARDAGKNKEKDSLSCR-PPGCDKKDFIRWKNSMHRDFTINSLFFDPF  202

Query  794   VYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWK  973
               +IYDYAN + D++  KLRTL  A+LSFEEDCARILRGLR+AARL  SFS ETETA+ K
Sbjct  203   TNKIYDYANGIMDLRQLKLRTLGSAKLSFEEDCARILRGLRIAARLSLSFSKETETAMHK  262

Query  974   LSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQAD--KQS  1147
             LS S++SL KSR+MME++YMLSYGAA  SLCLL +++L+ VL PFHAAY  QQ+   K  
Sbjct  263   LSSSILSLSKSRIMMEMDYMLSYGAAEASLCLLWRFDLIRVLFPFHAAYFDQQSKNLKGV  322

Query  1148  SDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNW  1327
               ++MLMKLFS++D++VSC+RP   SLWV LLAFHL LVNNPQ  LVVLT ASV+YH  W
Sbjct  323   QSSTMLMKLFSNMDKVVSCDRPGHCSLWVGLLAFHLALVNNPQDALVVLTFASVLYHEEW  382

Query  1328  KQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQV----NMLTDADNLREV  1495
             K+GV+F+R++V +   YVPEIS S    SE+ELAK+V  +A  V      LT   +  E 
Sbjct  383   KEGVKFSRENVASIVNYVPEISGSCEFKSEEELAKQVSQLASVVLDYIAALTATKDPDES  442

Query  1496  TSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHK  1675
              S++     SGLVF+S  M K +    +  +L ND+   N+   + +I          H 
Sbjct  443   MSRYPVFPFSGLVFLSKNMAKHVAA--IVEVLANDIEYYNQGRKNFEID--------CHS  492

Query  1676  KGNGIAHETRFLLSKIILDT  1735
              G G   E RF+L K+IL+T
Sbjct  493   LGKGHMREIRFVLGKVILET  512



>ref|XP_009344668.1| PREDICTED: uncharacterized protein LOC103936543 [Pyrus x bretschneideri]
Length=714

 Score =   481 bits (1237),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 263/500 (53%), Positives = 344/500 (69%), Gaps = 17/500 (3%)
 Frame = +2

Query  254   QKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLN  433
             Q+     +  G+Q +       DS    G I+   W+K+DAR  GI  S IS  SW+VL 
Sbjct  24    QRLVHALSEGGLQAQVHPKTVPDSVPDQGFIDMYKWKKIDARALGIKPSMISHPSWIVLK  83

Query  434   VLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHI  613
             +L+ +GF+AYLVGGCVRDLIL RIPKDFDVITTA L EIKK+F+ A++VG+RFPICRVH+
Sbjct  84    LLQAEGFEAYLVGGCVRDLILKRIPKDFDVITTANLKEIKKKFHHADVVGQRFPICRVHV  143

Query  614   RGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPF  793
             +G+V+EVSSF+TVA    + K K++   R P GC++ D IRW+NS+HRDFTINSLF+DPF
Sbjct  144   KGTVIEVSSFETVARDAGKKKEKDNLSFR-PPGCDKKDFIRWKNSMHRDFTINSLFFDPF  202

Query  794   VYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWK  973
             + +IYDYAN MAD++  KLRTL PA+LSFEEDCARILRGLR+AARL  S S ETETA+ K
Sbjct  203   MNKIYDYANGMADLRHLKLRTLAPAKLSFEEDCARILRGLRIAARLSLSISKETETAMHK  262

Query  974   LSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQAD--KQS  1147
             LS S++SL K R MME++YMLSYGAA  SLCLL +++L+ +L PFHAAY  QQ++  K +
Sbjct  263   LSSSILSLSKFRKMMEMDYMLSYGAAEASLCLLWRFDLIRILFPFHAAYFDQQSENLKGA  322

Query  1148  SDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNW  1327
               +SMLMKLFS++D++VSC+RP   SLWV LLAFHL LVNNPQ  LVVLT ASV+YH  W
Sbjct  323   QSSSMLMKLFSNMDKVVSCDRPGHCSLWVGLLAFHLALVNNPQDALVVLTFASVLYHEEW  382

Query  1328  KQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAV----QVNMLTDADNLREV  1495
             ++GV+F+R +      YVPEIS S G  SE++LAK+V  +A      +  LT   +  E 
Sbjct  383   EEGVKFSRDNAALIVNYVPEISGSCGFKSEEQLAKQVSKLASFMLDHIAALTATKDPDES  442

Query  1496  TSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHK  1675
              S++     S L F+   M K +    +  +LTND+   N+   + +I          + 
Sbjct  443   MSRYPVLPFSELAFLPKNMAKHVAA--IVEVLTNDIEYYNQGRKNFEID--------YYS  492

Query  1676  KGNGIAHETRFLLSKIILDT  1735
              G G   E RF+L K+IL+T
Sbjct  493   LGKGHMREIRFVLGKVILET  512



>ref|XP_009350727.1| PREDICTED: uncharacterized protein LOC103942263 [Pyrus x bretschneideri]
Length=714

 Score =   480 bits (1235),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 263/500 (53%), Positives = 344/500 (69%), Gaps = 17/500 (3%)
 Frame = +2

Query  254   QKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLN  433
             Q+     +  G+Q +       DS    G I+   W+K+DAR  GI  S IS  SW+VL 
Sbjct  24    QRLVHALSEGGLQAQVHPKIVPDSVPDQGFIDMYKWKKIDARALGIKPSMISHPSWIVLK  83

Query  434   VLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHI  613
             +L+ +GF+AYLVGGCVRDLIL RIPKDFDVITTA L EIKK+F+ A++VG+RFPICRVH+
Sbjct  84    LLQAEGFEAYLVGGCVRDLILKRIPKDFDVITTANLKEIKKKFHHADVVGQRFPICRVHV  143

Query  614   RGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPF  793
             +G+V+EVSSF+TVA    + K K++   R P GC++ D IRW+NS+HRDFTINSLF+DPF
Sbjct  144   KGTVIEVSSFETVARDAGKKKEKDNLSFR-PPGCDKKDFIRWKNSMHRDFTINSLFFDPF  202

Query  794   VYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWK  973
             + +IYDYAN MAD++  KLRTL PA+LSFEEDCARILRGLR+AARL  S S ETETA+ K
Sbjct  203   MNKIYDYANGMADLRHLKLRTLAPAKLSFEEDCARILRGLRIAARLSLSISKETETAMHK  262

Query  974   LSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQAD--KQS  1147
             LS S++SL K R MME++YMLSYGAA  SLCLL +++L+ +L PFHAAY  QQ++  K +
Sbjct  263   LSSSILSLSKFRKMMEMDYMLSYGAAEASLCLLWRFDLIRILFPFHAAYFDQQSENLKGA  322

Query  1148  SDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNW  1327
               +SMLMKLFS++D++VSC+RP   SLWV LLAFHL LVNNPQ  LVVLT ASV+YH  W
Sbjct  323   QSSSMLMKLFSNMDKVVSCDRPGHCSLWVGLLAFHLALVNNPQDALVVLTFASVLYHEEW  382

Query  1328  KQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAV----QVNMLTDADNLREV  1495
             ++GV+F+R +      YVPEIS S G  SE++LAK+V  +A      +  LT   +  E 
Sbjct  383   EEGVKFSRDNAALIVNYVPEISGSCGLKSEEQLAKQVSKLASFMLDHIAALTATKDPDES  442

Query  1496  TSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHK  1675
              S++     S L F+   M K +    +  +LTND+   N+   + +I          + 
Sbjct  443   MSRYPVLPFSELAFLPKNMAKHVAA--IVEVLTNDIEYYNQGRKNFEID--------YYS  492

Query  1676  KGNGIAHETRFLLSKIILDT  1735
              G G   E RF+L K+IL+T
Sbjct  493   LGKGHMREVRFVLGKVILET  512



>ref|XP_008448487.1| PREDICTED: putative CCA tRNA nucleotidyltransferase 2 [Cucumis 
melo]
 ref|XP_008448488.1| PREDICTED: putative CCA tRNA nucleotidyltransferase 2 [Cucumis 
melo]
 ref|XP_008448489.1| PREDICTED: putative CCA tRNA nucleotidyltransferase 2 [Cucumis 
melo]
 ref|XP_008448490.1| PREDICTED: putative CCA tRNA nucleotidyltransferase 2 [Cucumis 
melo]
Length=514

 Score =   469 bits (1206),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 263/464 (57%), Positives = 321/464 (69%), Gaps = 16/464 (3%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W K++ R FGIT   I  S   VL  L  +GF+AYLVGGCVRDLIL+R+PKDFDVITTA 
Sbjct  4     WNKVNGRVFGITRWMIPSSPRKVLEALHHEGFEAYLVGGCVRDLILDRVPKDFDVITTAG  63

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L ++ K F R+ IVGRRFPIC VHI+G++ EVSSFDT A K  E K   +   ++PK C+
Sbjct  64    LTQVNKLFRRSRIVGRRFPICMVHIQGTITEVSSFDTTA-KHSEGKEITAH-SQIPKKCD  121

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D+IRWRNS+ RDFTINSLF+DPF   IYDYA  MAD++S KLRTLIPA LSF+ DCAR
Sbjct  122   KKDLIRWRNSMERDFTINSLFFDPFSNVIYDYAEGMADLRSLKLRTLIPASLSFKLDCAR  181

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRGLR+AARL  S S ETETAI K SPS+ SLDK RLMME+NYMLSYGAAVPSL LLQ+
Sbjct  182   ILRGLRIAARLGLSISKETETAIRKFSPSITSLDKFRLMMELNYMLSYGAAVPSLYLLQR  241

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             +NLLE+LLPFHAAYL +Q   +SS +S MLMKLF +LD+LVSC RP+  ++WVALLAFHL
Sbjct  242   FNLLEILLPFHAAYLNEQGINKSSLSSVMLMKLFFNLDKLVSCARPSNCNIWVALLAFHL  301

Query  1256  TLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKR  1435
              LVNNPQ  L+VL  A+ +YH  W +GV +AR          PEI+ S    SE+ELA+ 
Sbjct  302   ALVNNPQNSLIVLAFAATLYHGEWNEGVNYARAKSLVEINLRPEITRSAEFKSENELAEG  361

Query  1436  VENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDV  1603
             V   A+ V      LT AD L E  S F  SS+SGLVFVS K  +   V  +F +L NDV
Sbjct  362   VTCFALNVQGCIAALTSADCLLEAMSTFPASSNSGLVFVSKKAARD--VANIFEVLVNDV  419

Query  1604  TSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              S  +K  + ++       G       G   E R++L K+IL+T
Sbjct  420   ESYKDKRKNFEVDYKQLGNG-------GFLRENRYVLGKVILET  456



>gb|KGN55614.1| hypothetical protein Csa_3G002350 [Cucumis sativus]
Length=788

 Score =   476 bits (1225),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 263/468 (56%), Positives = 323/468 (69%), Gaps = 16/468 (3%)
 Frame = +2

Query  347   EFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVI  526
             +   W K++ R FG+T S I  SSW VL VL ++GF+AYLVGGCVRDL+L R+PKDFDVI
Sbjct  76    DMPKWNKINGRAFGLTRSMIPSSSWKVLEVLHREGFEAYLVGGCVRDLLLRRVPKDFDVI  135

Query  527   TTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMP  706
             TTA L +I   F R+ IVGRRFPIC VHIRGS+ EVSSFDT A   +E K   +   ++P
Sbjct  136   TTAGLTQIHNLFCRSRIVGRRFPICMVHIRGSITEVSSFDTAAKHSEENKI--TAHSQIP  193

Query  707   KGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEE  886
             K C++ D+IRWRNS+ RDFTINSLF+DPF   IYDYA  MAD++S KLRTLIPA LSF+ 
Sbjct  194   KKCDKKDLIRWRNSMERDFTINSLFFDPFSNVIYDYAEGMADLRSLKLRTLIPASLSFKL  253

Query  887   DCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLC  1066
             DCARILRGLR+AARL  S S ETETAI K SPS+ SLDKSRLMME+NYMLSYGAAVPSL 
Sbjct  254   DCARILRGLRIAARLGLSISKETETAIHKFSPSITSLDKSRLMMELNYMLSYGAAVPSLY  313

Query  1067  LLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALL  1243
             LLQ++ LL  LLPFHAAYL +Q  ++SS +S MLMKLF +LD+LVSC  P+  ++WVALL
Sbjct  314   LLQRFKLLGSLLPFHAAYLDKQGIEKSSLSSVMLMKLFFNLDKLVSCAHPSNCNIWVALL  373

Query  1244  AFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDE  1423
             AFHL LVNNPQ  LVVL  A+ +YH  W +GV +AR+         PEI+ S    SE++
Sbjct  374   AFHLALVNNPQNSLVVLAFAATLYHGEWNEGVNYAREKSLVEINLRPEITRSAKFKSEEK  433

Query  1424  LAKRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGIL  1591
             LA+ V   A++V      LT  D L E  S F  SS+SGLVFVSNK  + + +  +F +L
Sbjct  434   LAEGVTRFALKVQGCIAALTSKDCLLEAMSTFPASSNSGLVFVSNKTARDVAI--IFEVL  491

Query  1592  TNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                V S  ++    KI      KG           E R++L KIIL+T
Sbjct  492   AKHVKSYKDEKKDFKIDYKRLGKGL-------FLRENRYVLGKIILET  532



>ref|XP_004146209.1| PREDICTED: uncharacterized protein LOC101212579 [Cucumis sativus]
Length=810

 Score =   476 bits (1225),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 263/468 (56%), Positives = 322/468 (69%), Gaps = 16/468 (3%)
 Frame = +2

Query  347   EFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVI  526
             +   W K++ R FG+T S I  SSW VL VL ++GF+AYLVGGCVRDL+L R+PKDFDVI
Sbjct  76    DMPKWNKINGRAFGLTRSMIPSSSWKVLEVLHREGFEAYLVGGCVRDLLLRRVPKDFDVI  135

Query  527   TTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMP  706
             TTA L +I   F R+ IVGRRFPIC VHIRGS+ EVSSFDT A   +E K       ++P
Sbjct  136   TTAGLTQIHNLFCRSRIVGRRFPICMVHIRGSITEVSSFDTAAKHSEENKITAH--SQIP  193

Query  707   KGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEE  886
             K C++ D+IRWRNS+ RDFTINSLF+DPF   IYDYA  MAD++S KLRTLIPA LSF+ 
Sbjct  194   KKCDKKDLIRWRNSMERDFTINSLFFDPFSNVIYDYAEGMADLRSLKLRTLIPASLSFKL  253

Query  887   DCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLC  1066
             DCARILRGLR+AARL  S S ETETAI K SPS+ SLDKSRLMME+NYMLSYGAAVPSL 
Sbjct  254   DCARILRGLRIAARLGLSISKETETAIHKFSPSITSLDKSRLMMELNYMLSYGAAVPSLY  313

Query  1067  LLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALL  1243
             LLQ++ LL  LLPFHAAYL +Q  ++SS +S MLMKLF +LD+LVSC  P+  ++WVALL
Sbjct  314   LLQRFKLLGSLLPFHAAYLDKQGIEKSSLSSVMLMKLFFNLDKLVSCAHPSNCNIWVALL  373

Query  1244  AFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDE  1423
             AFHL LVNNPQ  LVVL  A+ +YH  W +GV +AR+         PEI+ S    SE++
Sbjct  374   AFHLALVNNPQNSLVVLAFAATLYHGEWNEGVNYAREKSLVEINLRPEITRSAKFKSEEK  433

Query  1424  LAKRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGIL  1591
             LA+ V   A++V      LT  D L E  S F  SS+SGLVFVSNK  + + +  +F +L
Sbjct  434   LAEGVTRFALKVQGCIAALTSKDCLLEAMSTFPASSNSGLVFVSNKTARDVAI--IFEVL  491

Query  1592  TNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                V S  ++    KI      KG           E R++L KIIL+T
Sbjct  492   AKHVKSYKDEKKDFKIDYKRLGKGL-------FLRENRYVLGKIILET  532



>ref|XP_011079124.1| PREDICTED: uncharacterized protein LOC105162718 [Sesamum indicum]
Length=613

 Score =   467 bits (1202),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 272/568 (48%), Positives = 367/568 (65%), Gaps = 36/568 (6%)
 Frame = +2

Query  341   KIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFD  520
             ++EF+ WRKLD+R  GI  S IS  SW VL  L+  GF+AYLVGGCVRDL+LN++PKDFD
Sbjct  50    QVEFAKWRKLDSRRLGIAKSMISIPSWTVLRNLQAAGFEAYLVGGCVRDLLLNKVPKDFD  109

Query  521   VITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPR  700
             VITTARL ++KK+F RA IVG+RFPICRV I+ SVVEVSSF+TVA +   +K K   +  
Sbjct  110   VITTARLKQVKKKFRRAIIVGKRFPICRVTIKDSVVEVSSFETVAER---SKTKQVGISH  166

Query  701   MPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSF  880
              P  C+  D +RW+N +HRDFT+NSL +DPFV  I+DY NA+ D++S KLRT+IPA LSF
Sbjct  167   KPTSCDPRDFVRWKNCMHRDFTVNSLLFDPFVDVIFDYTNAIEDLRSLKLRTVIPAHLSF  226

Query  881   EEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPS  1060
             +ED ARILRGLR+AARL  SFS ETE AI+ LSP V  L KSR+ +E+NYMLSYGAA PS
Sbjct  227   KEDGARILRGLRIAARLNLSFSKETEAAIYSLSPLVAQLCKSRINLEMNYMLSYGAAEPS  286

Query  1061  LCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVAL  1240
             L LL+++ LLE+LLPFHA YL Q  ++    + MLMKLF +LDQL++C+RP  +SLWVA+
Sbjct  287   LLLLKRFKLLEILLPFHAVYLEQVDNRDGVRSLMLMKLFFNLDQLITCDRPCDDSLWVAI  346

Query  1241  LAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSED  1420
             LAFHL L  NPQ  LVVLT AS++YH  W++ ++FAR++  A  +YVPEI DS   +++D
Sbjct  347   LAFHLALFRNPQHSLVVLTFASLLYHGTWEESIKFARENALATRIYVPEILDSPDYLADD  406

Query  1421  ELAKRVENMAVQ----VNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGI  1588
             E+A+RV   A Q    V++L + D L +  ++F  S  SGLVFV   M K+  V+ ++ I
Sbjct  407   EIAERVTQFARQVKNSVDVLVNMDCLLKAMTRFPESPCSGLVFVPQNMGKR--VKHMYNI  464

Query  1589  LTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDTlglggvileeg  1768
             L  ++TSL  +  +L+I       G           E RF+L KIIL TL  G       
Sbjct  465   LAENITSLEAEKRNLEIDYGLLTVGN--------VDEVRFVLGKIILRTLICGATSERGE  516

Query  1769  eSKKRNSEYDEIDGLQEVKENSHSQMEMKQEDYNLCNISPMG----------GEFEPARA  1918
                KR+ +    D  +E++ +     +++     L  + P+G            ++P+  
Sbjct  517   TRAKRDDDIQATDSPRELEVSE----QIRGTLVRLNEVDPIGNNENKRKKAPANYDPSPK  572

Query  1919  KKRKSTHTSSSLSEEGAVTKHKKSADEQ  2002
               RK     S L E  ++    KS+ EQ
Sbjct  573   SARK-----SRLLESSSIAADYKSSGEQ  595



>ref|XP_004287737.1| PREDICTED: uncharacterized protein LOC101302293 [Fragaria vesca 
subsp. vesca]
Length=699

 Score =   469 bits (1208),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 253/471 (54%), Positives = 334/471 (71%), Gaps = 18/471 (4%)
 Frame = +2

Query  338   GKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDF  517
             G I+ S W+K+D+R FGIT + I  SS+ VL +L+ +GF+AYLVGGCVRDLIL R+PKDF
Sbjct  47    GLIDMSKWKKIDSRVFGITRAMIPDSSYHVLRILRGRGFEAYLVGGCVRDLILKRVPKDF  106

Query  518   DVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVP  697
             DVITTA L EIK+QF+R+ IVG RFPIC V+I+GS +EVSSF+TVAN   +   K   + 
Sbjct  107   DVITTANLKEIKRQFHRSRIVGHRFPICMVNIKGSWIEVSSFETVANNHSD---KEVTIS  163

Query  698   RMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLS  877
              +PKGC + D IRWRNS+HRDFTINSLF+DP   +IYDYAN MAD+ S KLR+L+PA+LS
Sbjct  164   EIPKGCGKKDFIRWRNSMHRDFTINSLFFDPISNKIYDYANGMADLNSLKLRSLVPAKLS  223

Query  878   FEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVP  1057
             F+EDCARILRGLR+AARL+ S S ETETAI K S S+++L  SR+MME+NYMLSYGAA P
Sbjct  224   FKEDCARILRGLRIAARLRLSISKETETAIHKCSSSILTLTTSRIMMEMNYMLSYGAAEP  283

Query  1058  SLCLLQKYNLLEVLLPFHAAYLTQQADKQ-SSDTSMLMKLFSSLDQLVSCERPARESLWV  1234
             SLCLL ++NLL++LLP HAAYL QQ+ ++   +++MLMKLFS+LD++V+ +RP+  SLWV
Sbjct  284   SLCLLWRFNLLKLLLPIHAAYLDQQSIRKFPQNSTMLMKLFSNLDKVVTVDRPSDCSLWV  343

Query  1235  ALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMS  1414
             ALL  H+ LV++PQ  LVV + AS++YH   ++G++ AR   +    Y+PEIS      S
Sbjct  344   ALLVVHMALVSHPQDALVVFSFASILYHGGCEKGLKSARDDAQVTVDYLPEISIPSACKS  403

Query  1415  EDELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVF  1582
             E++L K V   A      +  LT  ++L E  SK+  +  SG+VFV  +  +   V E+F
Sbjct  404   EEQLEKEVSRFASLVLDSIAALTATESLVEGMSKYPETPCSGVVFVPKRTAQG--VAEIF  461

Query  1583  GILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              +L +D+ S N K  S  I  P  QK        G   ET F+L KIIL+T
Sbjct  462   RVLADDIKSYNTKRKSYVIDYPLLQK--------GFLCETSFVLGKIILET  504



>ref|XP_008392492.1| PREDICTED: uncharacterized protein LOC103454675 [Malus domestica]
Length=712

 Score =   469 bits (1206),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 253/473 (53%), Positives = 332/473 (70%), Gaps = 17/473 (4%)
 Frame = +2

Query  338   GKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDF  517
             G I+   W+K+DAR  GI  S IS  SW+VL +L+ +GF+AYLVGGCVRDLIL RIPKDF
Sbjct  48    GFIDMYKWKKIDARALGIKPSMISHPSWIVLKLLQAEGFEAYLVGGCVRDLILKRIPKDF  107

Query  518   DVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVA-NKGDETKRKNSFV  694
             DVITTA L EIKK+F+RA++VG+RFPICRVH++G+V+EVSSF+TVA + G + +++   +
Sbjct  108   DVITTANLKEIKKKFHRADVVGQRFPICRVHVKGTVIEVSSFETVARDAGKKKEKQKDNL  167

Query  695   PRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQL  874
                P GC++ D IRW+NS+HRDFTINSLF+DPF  ++YDYAN M D++  KLRTL PA+L
Sbjct  168   SFRPPGCDKKDFIRWKNSMHRDFTINSLFFDPFTNKVYDYANGMXDLRHLKLRTLAPAKL  227

Query  875   SFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAV  1054
             SFEEDCARILRGLR+AARL  S S ETETA+ KLS S++SL K R MME++YMLSYGAA 
Sbjct  228   SFEEDCARILRGLRIAARLSLSISKETETAMHKLSSSILSLSKFRKMMEMDYMLSYGAAE  287

Query  1055  PSLCLLQKYNLLEVLLPFHAAYLTQQAD--KQSSDTSMLMKLFSSLDQLVSCERPARESL  1228
              SLCLL +++L+ +L PFHAAY  QQ++  K +  + MLMKLFS++D++VSC+ P   SL
Sbjct  288   ASLCLLWRFDLIRILFPFHAAYFDQQSENLKGAKSSLMLMKLFSNMDKVVSCDXPGHCSL  347

Query  1229  WVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGS  1408
             WV LLAFHL LVNNPQ  LVVLT ASV+YH  W++GV+F+R +      YVPEIS S G 
Sbjct  348   WVGLLAFHLXLVNNPQDALVVLTFASVLYHEEWEEGVKFSRDNAAXIVKYVPEISGSCGF  407

Query  1409  MSEDELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEE  1576
              SE+ELAK+V  +A      +  L    +  E  S++     S L F+   M K +    
Sbjct  408   KSEEELAKQVSKLASFMLDYIAALAATKDPDESMSRYPVLPFSELAFLPKNMAKHVAA--  465

Query  1577  VFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             +  +LTND+   N+   + +I          +  G G   E RF+L K+IL+T
Sbjct  466   IVEVLTNDIEYYNQGRKNFEID--------YYSLGKGHMREIRFILGKVILET  510



>ref|XP_010531003.1| PREDICTED: uncharacterized protein LOC104807432 [Tarenaya hassleriana]
Length=686

 Score =   466 bits (1199),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 260/521 (50%), Positives = 341/521 (65%), Gaps = 41/521 (8%)
 Frame = +2

Query  239   LMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSS  418
             L+S+  + N  +  +G       D   +S   P  ++ S W+K++A   GI GS ISPSS
Sbjct  18    LVSVFFQRNNCTLAEG-------DMGENSVLPP--VDTSKWKKINATAVGIKGSMISPSS  68

Query  419   WVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPI  598
             W VL VL+ +GF+AYLVGGCVRDLILNR+PKDFDVITTA L EI++QF RA+IVG+RFPI
Sbjct  69    WTVLRVLRNQGFEAYLVGGCVRDLILNRVPKDFDVITTANLKEIRRQFNRAQIVGKRFPI  128

Query  599   CRVHIRGSVVEVSSFDTVA-NKGD---------------ETKRKNS--FVPRMPKGCNES  724
             C V IRGS+ EVSSFDTVA   GD               E   +N    +P+M +GCNE 
Sbjct  129   CHVWIRGSITEVSSFDTVAQTAGDDENDIERGEGKGSVPENAEENEKLTLPKMLRGCNEK  188

Query  725   DVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCaril  904
             D+ RWRNS+HRDFTINSLF+DPF ++IYDY+N + D+K+ +LRTLIPAQLSFEEDCARIL
Sbjct  189   DINRWRNSMHRDFTINSLFFDPFDFKIYDYSNGIEDLKALRLRTLIPAQLSFEEDCARIL  248

Query  905   rglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYN  1084
             RGLR+AARL   FS + ETAI K   S+ SL   RLMME+NYMLSYGAA PS+ LL+K++
Sbjct  249   RGLRIAARLDLLFSKDIETAIPKFVYSIASLGPVRLMMEMNYMLSYGAAGPSILLLRKFS  308

Query  1085  LLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLV  1264
             LLE LLPF AAYL Q +      ++MLM+L S++D+LV C++PA   LW+ALLAFH  LV
Sbjct  309   LLEPLLPFQAAYLEQASKASPLRSTMLMRLLSNVDKLVFCDQPADCRLWIALLAFHTALV  368

Query  1265  NNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVEN  1444
              +PQ  LV+    SV+YH +WK+ + +AR+H K+ + + PE+S+S  + S++ELA+ V  
Sbjct  369   RDPQDALVISAFGSVLYHGHWKEAIRYAREHEKSLARFSPEVSESSVNRSDEELAEAVAQ  428

Query  1445  MAV----QVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSL  1612
                     +N+LT  + L+EV S + G+ H G VF+  +  K+  V   F  L  D+ S 
Sbjct  429   FTFLLQDSINVLTGVEELQEVLSLYPGTKHWGRVFIPKRKAKE--VAGAFDELVTDIESY  486

Query  1613  NEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                     I   S         G G   E RF+L K+ILDT
Sbjct  487   ESGREGDSINYLS--------LGKGDPCEIRFVLGKVILDT  519



>ref|XP_004159755.1| PREDICTED: uncharacterized LOC101212579 [Cucumis sativus]
Length=647

 Score =   462 bits (1190),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 252/437 (58%), Positives = 314/437 (72%), Gaps = 10/437 (2%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W K++ R FG+T S I  SSW VL VL ++GF+AYLVGGCVRDL+L R+PKDFDVITTA 
Sbjct  4     WNKINGRAFGLTRSMIPSSSWKVLEVLHREGFEAYLVGGCVRDLLLRRVPKDFDVITTAG  63

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L +I   F R+ IVGRRFPIC VHIRGS+ EVSSFDT A   +E K       ++PK C+
Sbjct  64    LTQIHNLFCRSRIVGRRFPICMVHIRGSITEVSSFDTAAKHSEENKITAH--SQIPKKCD  121

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D+IRWRNS+ RDFTINSLF+DPF   IYDYA  MAD++S KLRTLIPA LSF+ DCAR
Sbjct  122   KKDLIRWRNSMERDFTINSLFFDPFSNVIYDYAEGMADLRSLKLRTLIPASLSFKLDCAR  181

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRGLR+AARL  S S ETETAI K SPS+ SLDKSRLMME+NYMLSYGAAVPSL LLQ+
Sbjct  182   ILRGLRIAARLGLSISKETETAIHKFSPSITSLDKSRLMMELNYMLSYGAAVPSLYLLQR  241

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LL  LLPFHAAYL +Q  ++SS +S MLMKLF +LD+LVSC  P+  ++WVALLAFHL
Sbjct  242   FKLLGSLLPFHAAYLDKQGIEKSSLSSVMLMKLFFNLDKLVSCAHPSNCNIWVALLAFHL  301

Query  1256  TLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKR  1435
              LVNNPQ  LVVL  A+ +YH  W +GV +AR+         PEI+ S    SE++LA+ 
Sbjct  302   ALVNNPQNSLVVLAFAATLYHGEWNEGVNYAREKSLVEINLRPEITRSAKFKSEEKLAEG  361

Query  1436  VENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILT-ND  1600
             V   A++V      LT  D L E  S F  SS+SGLVFVSNK  + + +  +F +L  + 
Sbjct  362   VTRFALKVQGCIAALTSKDCLLEAMSTFPASSNSGLVFVSNKTARDVAI--IFEVLAKHG  419

Query  1601  VTSLNEKSCSLKIQNPS  1651
               ++ +++ +L+I  P+
Sbjct  420   NENIPDRNQNLRIDAPT  436



>ref|XP_008789358.1| PREDICTED: uncharacterized protein LOC103706875 [Phoenix dactylifera]
Length=535

 Score =   449 bits (1155),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 248/501 (50%), Positives = 340/501 (68%), Gaps = 25/501 (5%)
 Frame = +2

Query  251   LQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVL  430
             LQ++  T  G+ ++ +S  D   DS  + G  + S WR +D+R  GI  S IS S+W+VL
Sbjct  26    LQRWKHTFTGESLR-DSIRDADLDSPLKLGFFDPSTWRTVDSRTGGIRKSAISSSTWLVL  84

Query  431   NVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVH  610
              +L+ +GF++YLVGGCVRDL+L R PKDFDVITTA L +I KQF++  I+GRRFPIC+VH
Sbjct  85    KILRSRGFESYLVGGCVRDLLLKRTPKDFDVITTASLEQITKQFHKCRIIGRRFPICQVH  144

Query  611   IRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDP  790
             I GS++EVSSFD        T++KN    R+P  C E D IRW+N + RDFTIN LF+DP
Sbjct  145   ILGSIIEVSSFD--------TRQKNVKERRVPNNCAEKDFIRWKNCMERDFTINGLFFDP  196

Query  791   FVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIW  970
                 IYDY   + D+++ K+RT+IPA LSF+EDCARILRGLR+ ARL   FS ET  AI 
Sbjct  197   IDCTIYDYVGGIRDLRTSKVRTVIPAHLSFKEDCARILRGLRIVARLGLRFSKETAEAIQ  256

Query  971   KLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSS  1150
               S S+++LDK+RL+ME+N+ML+YGAA  S+ LLQK+ LLE+LLPFHAAYL  Q  KQS+
Sbjct  257   DYSASIITLDKTRLLMELNFMLAYGAAESSIHLLQKFKLLEILLPFHAAYLADQTKKQSN  316

Query  1151  DTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNW  1327
             ++S MLMKLFS++D+L++ +RP+   LW+ LLAFHL LV +PQ  LVV TL+S++YH  W
Sbjct  317   ESSVMLMKLFSNVDKLLAADRPSNYYLWLGLLAFHLALVEHPQDALVVWTLSSILYHGMW  376

Query  1328  KQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMA----VQVNMLTDADNLREV  1495
              + +EFARQ+VK    +VPEI +   S S++ L +   ++A      V+ LT  D L++ 
Sbjct  377   SKAMEFARQNVKGHGQFVPEILEPSESKSDELLLEETCHLASLVKSSVDALTRIDVLQQS  436

Query  1496  TSKFSGSSHS-GLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAH  1672
              +++  S    GLVFVS KM K   V E+F +L ND+TS ++K  +  I     ++G   
Sbjct  437   LTRYPESLPCLGLVFVSEKMGKS--VAELFDVLGNDITSHDKKRETRDINYELLKRGD--  492

Query  1673  KKGNGIAHETRFLLSKIILDT  1735
                     ETRF+L K+I+DT
Sbjct  493   ------LGETRFVLGKVIMDT  507



>ref|XP_003516528.1| PREDICTED: uncharacterized protein LOC100794882 [Glycine max]
Length=714

 Score =   445 bits (1145),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 254/503 (50%), Positives = 334/503 (66%), Gaps = 21/503 (4%)
 Frame = +2

Query  254   QKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLN  433
             Q F+  +     Q  S+T+   D +   G+I+ S W+ LDA   GIT S IS  S  VL 
Sbjct  21    QGFHSPAPKRPKQDPSSTENDLDYSVCRGRIDVSKWKTLDAEELGITSSMISYPSQFVLK  80

Query  434   VLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQF---YRAEIVGRRFPICR  604
             +L++KGF++YLVGGCVRDL+LNR PKDFDVITTA+L E++ QF    RAE+VGRRFPIC 
Sbjct  81    LLRRKGFESYLVGGCVRDLLLNRTPKDFDVITTAKLMEVRAQFRGLARAEVVGRRFPICL  140

Query  605   VHIRGSVVEVSSFDTVANKGDETKRKNSFV-PRMPKGCNESDVIRWRNSLHRDFTINSLF  781
             VHI+GSVVEV+SF+TVA   +   RK  F+   +PK  N+ D+ R +NSL RDFTINSLF
Sbjct  141   VHIKGSVVEVTSFETVARTSN---RKEQFLYSLLPKCSNKKDLFRCKNSLRRDFTINSLF  197

Query  782   YDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETET  961
             YDPF  +IYDY + MAD++S KL T+IPAQ+SF+ED  RILRG R+AARL  S S ETE 
Sbjct  198   YDPFANKIYDYTDGMADLRSLKLETVIPAQMSFKEDPGRILRGFRIAARLGLSLSRETEA  257

Query  962   AIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADK  1141
             A+WK S  V SLDK+++M+E+NYMLSYGAA PSL LL K+ LLE LLP HAAYL +QA K
Sbjct  258   AMWKYSSLVKSLDKNKIMIELNYMLSYGAAEPSLHLLWKFKLLEFLLPVHAAYLDEQAIK  317

Query  1142  QSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH  1318
             + +  S MLMKLF  LD LV+C+RP   +LWV LLAFHLTLVNNPQ  LVV   ASV+YH
Sbjct  318   EDAPASNMLMKLFFYLDNLVACDRPCDCTLWVGLLAFHLTLVNNPQDALVVWAFASVLYH  377

Query  1319  RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAV----QVNMLTDADNL  1486
               W++G++FA++H K    + PEI  S    S++E+AK V  +A      +  L ++++L
Sbjct  378   GEWEKGIKFAKEHAKMYVNFAPEIRTSSIYKSDEEIAKAVTKLASLVMHSIPALVESNSL  437

Query  1487  REVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGT  1666
              +  S++     S ++FV  K  K  +   +F +L +DV    E   + + +N     G 
Sbjct  438   LQSMSRYPSFPQSDMIFVPKKAGK--LASAIFKMLASDV----EFYKTERRKNSKINYGM  491

Query  1667  AHKKGNGIAHETRFLLSKIILDT  1735
                 G G   E  F+L KI+L+T
Sbjct  492   L---GKGHLSEIAFVLGKIVLET  511



>ref|XP_011022149.1| PREDICTED: uncharacterized protein LOC105124023 [Populus euphratica]
Length=851

 Score =   447 bits (1151),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 249/505 (49%), Positives = 336/505 (67%), Gaps = 23/505 (5%)
 Frame = +2

Query  239   LMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKI-EFSNWRKLDARHFGITGSRISPS  415
              ++ LQ+FN T   +G++     +   D   Q   + + S WRK++AR+ GIT S +  +
Sbjct  17    FLTSLQRFNHTLTKEGLKSPVCHEMGRDFLAQERYVVDRSKWRKVNARYHGITRSMVPDA  76

Query  416   SWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFP  595
              W VL +L+  GF+AYLVGGCVRDL+LNR+PKDFDVITTA L +IKK+F+RA IVGRRFP
Sbjct  77    PWTVLKLLRVGGFEAYLVGGCVRDLLLNRVPKDFDVITTANLQQIKKKFHRAHIVGRRFP  136

Query  596   ICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINS  775
             IC VH++GSV+EVSSF+T A +  E  ++   + +M + C+E D + W+NS+ RDFTINS
Sbjct  137   ICIVHVKGSVIEVSSFETSAQQCQE--KEKVLLSQMQRSCDEKDFLLWKNSMQRDFTINS  194

Query  776   LFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMET  955
             LF+DPF+ +IYDY N M D++S KL+TLIPA+LSF+EDCARILRG+R+A RL  S S +T
Sbjct  195   LFFDPFMNRIYDYTNGMEDVRSLKLQTLIPARLSFQEDCARILRGIRIAGRLGLSISKDT  254

Query  956   ETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA  1135
             ETAI KL  SV SL+K R+ ME+NYMLSYGAA  ++ LLQ+++LL++ LPFHAAYL +QA
Sbjct  255   ETAICKLQSSVKSLNKDRIKMELNYMLSYGAAESTILLLQRFHLLKIFLPFHAAYLHEQA  314

Query  1136  DKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVM  1312
             D+ S+  S MLMKL SSLD++VS +RP   SLWV LLAFH  LV NPQ   V+   AS++
Sbjct  315   DEVSAQCSTMLMKLLSSLDKMVSSDRPCDCSLWVGLLAFHQALVLNPQDAFVIWAFASIL  374

Query  1313  YHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMA--VQ--VNMLTDAD  1480
             Y   W++GV+FAR++ K    +VPEIS      S+++LA+ V  +A  VQ  VN  TD  
Sbjct  375   YCGTWQEGVKFARENAKVEGRFVPEISGFSEIKSDEKLAEEVSQLASLVQDAVNAFTDEI  434

Query  1481  NLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQK  1660
             +L E  S++        VFVS K+ +          L   + S   +  S KI      K
Sbjct  435   SLSESLSRYLDPPFDVFVFVSKKIGE-------HAALIFHMQSCEYRRESFKIDYDLLVK  487

Query  1661  GTAHKKGNGIAHETRFLLSKIILDT  1735
             G          +ETRF+L K+IL T
Sbjct  488   GD--------LYETRFVLGKVILKT  504



>ref|XP_010918240.1| PREDICTED: uncharacterized protein LOC105042652 [Elaeis guineensis]
Length=542

 Score =   437 bits (1123),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 243/501 (49%), Positives = 334/501 (67%), Gaps = 25/501 (5%)
 Frame = +2

Query  251   LQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVL  430
             LQ++  T  G+ ++  S  D  + S  + G  + S WR +D+R  GI  S IS S+ +VL
Sbjct  33    LQRWKHTFVGESLR-NSIRDTDSKSPLKLGLFDPSTWRTVDSRTVGIRKSLISSSTLLVL  91

Query  431   NVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVH  610
              +L+ +GF++YLVGGCVRDL+L R PKDFDVITTA L +I +QF++  I+GRRFPIC+VH
Sbjct  92    RILRSRGFESYLVGGCVRDLLLKRTPKDFDVITTASLEQITRQFHKCRIIGRRFPICQVH  151

Query  611   IRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDP  790
             I GS++EVSSFD         ++KN    R+P  C E D +RW+N + RDFTINSLF+DP
Sbjct  152   ILGSIIEVSSFD--------ARQKNVKERRVPNSCAEKDFVRWKNCMERDFTINSLFFDP  203

Query  791   FVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIW  970
             F   IYDY   + DI++ K+ T+IPA LSF+EDCARILRGLR+AARL   FS ET  AI 
Sbjct  204   FDCTIYDYVGGIKDIRTSKVCTVIPAHLSFKEDCARILRGLRIAARLGLRFSKETADAIQ  263

Query  971   KLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSS  1150
               S  +++LDK+RL+ME+N+ML+YGAA  S+ LLQK+ LLE+LLPFHAAYL  Q  +QS 
Sbjct  264   AYSSHIITLDKARLLMELNFMLAYGAAESSIRLLQKFKLLEILLPFHAAYLADQTKQQSD  323

Query  1151  DTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNW  1327
             ++S MLMKLFS++D+L++ ERP+   LW+ LLAFHL LV +PQ  LVV TL+S++YH  W
Sbjct  324   ESSVMLMKLFSNVDKLLAAERPSNYYLWLGLLAFHLALVEHPQDALVVWTLSSILYHGTW  383

Query  1328  KQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMA----VQVNMLTDADNLREV  1495
              +  EFARQ+VK    +VPEI +   S S++ L +    +A      V+ LT  D L++ 
Sbjct  384   SKATEFARQNVKGHDQFVPEILEPSESKSDELLMEETYCLASLIKSSVDALTRIDVLQQS  443

Query  1496  TSKFSGSSHS-GLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAH  1672
              +++       GLVF+S KM K   V E+F +L  D+TS +EK  + +I     ++G   
Sbjct  444   LTRYPEFLPCLGLVFISEKMGKN--VAELFDVLRKDITSCDEKRETREINFELLKRGD--  499

Query  1673  KKGNGIAHETRFLLSKIILDT  1735
                     ETRF+L K+I+DT
Sbjct  500   ------LGETRFVLGKVIMDT  514



>ref|XP_010029591.1| PREDICTED: uncharacterized protein LOC104419581 isoform X2 [Eucalyptus 
grandis]
 gb|KCW56509.1| hypothetical protein EUGRSUZ_I02230 [Eucalyptus grandis]
Length=726

 Score =   442 bits (1138),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 256/499 (51%), Positives = 335/499 (67%), Gaps = 20/499 (4%)
 Frame = +2

Query  257   KFNQTSAGDGIQL-ESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLN  433
             + N+T AG  +Q  E   + ++D      +I+ S W+  DAR  G+TG  I  S W VL 
Sbjct  30    RLNRTLAGGELQAQEEQAEASSDGAAHLVEIDMSKWKTYDARSCGVTGHSIPKSPWTVLA  89

Query  434   VLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHI  613
             +L+  GF AYLVGGCVRDLIL R+PKDFDVITTA L ++K++F+R +IVG+RFPICRV I
Sbjct  90    LLRDAGFNAYLVGGCVRDLILKRVPKDFDVITTASLQQVKEKFHRCDIVGKRFPICRVRI  149

Query  614   RGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPF  793
             +GSVVEVSSF T+A K  E K K +F  + P GCN+ D I WR+S+HRDFTINSLF+D  
Sbjct  150   KGSVVEVSSFKTIA-KRTEGKEKVAFSCK-PSGCNKRDFILWRDSMHRDFTINSLFFDLS  207

Query  794   VYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWK  973
               +IYDY NAM D++S KLRT+IPAQLSFEEDCARILRG+R+AARL  + S + E AI  
Sbjct  208   ENKIYDYTNAMEDVRSLKLRTIIPAQLSFEEDCARILRGVRIAARLGLALSRDIEIAIGS  267

Query  974   LSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSD  1153
             LS S+  L+K RLM+E+N +LSYGAA PSLCLLQ+  LLE++LPFHAAYL QQ    S+ 
Sbjct  268   LSSSIAGLNKHRLMLEINSILSYGAAEPSLCLLQRLRLLEIILPFHAAYLDQQNRGHSAQ  327

Query  1154  TS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWK  1330
             +S MLM+LF ++D+LVSC +P+  +LW+ LLAFHL LVNNPQ   V+   AS ++H  WK
Sbjct  328   SSLMLMRLFFNMDKLVSCNQPSDCTLWIGLLAFHLALVNNPQDASVIWAFASTLHHGKWK  387

Query  1331  QGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMA--VQ--VNMLTDADNLREVT  1498
                +FA +H K    +VPEIS S  S  +  LA+RV N+A  VQ  V++L+D + L E  
Sbjct  388   GASQFANKHAKLRVNFVPEISGS--STYKSALAERVSNLASLVQESVSILSDTNRLIESM  445

Query  1499  SKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKK  1678
             +++  SS SGLV +  ++     V E+F +L NDV   N+     +I             
Sbjct  446   TRYPHSSCSGLVLIQEQVANN--VREIFQVLVNDVEFYNDGRECFEI--------NYELL  495

Query  1679  GNGIAHETRFLLSKIILDT  1735
             G G   ETR +L  IIL+T
Sbjct  496   GKGFLRETRHVLGTIILNT  514



>ref|XP_002307206.2| hypothetical protein POPTR_0005s10310g [Populus trichocarpa]
 gb|EEE94202.2| hypothetical protein POPTR_0005s10310g [Populus trichocarpa]
Length=848

 Score =   445 bits (1144),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 251/505 (50%), Positives = 338/505 (67%), Gaps = 23/505 (5%)
 Frame = +2

Query  239   LMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKI-EFSNWRKLDARHFGITGSRISPS  415
              ++ LQ+FN T   + ++     +   D   Q   + + S WRK++AR+ GIT S I  +
Sbjct  17    FLTPLQRFNHTLTKEELKAPVCHEMGRDFLAQQRYVVDRSKWRKVNARYHGITRSMIPDA  76

Query  416   SWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFP  595
              W VL +L+  GF+AYLVGGCVRDL+LNR+PKDFDVITTA L +IKK+F+RA IVGRRFP
Sbjct  77    PWTVLKLLRVGGFEAYLVGGCVRDLLLNRVPKDFDVITTANLQQIKKKFHRAHIVGRRFP  136

Query  596   ICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINS  775
             IC VH++GSV+EVSSF+T A +  E  ++   + +M + C+E D + W+NS+ RDFTINS
Sbjct  137   ICIVHVKGSVIEVSSFETSAQQCQE--KEKVLLSQMRRSCDEKDFLLWKNSMQRDFTINS  194

Query  776   LFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMET  955
             LF+DPF+ +IYDYAN M D++S KL+TLIPA+LSF+EDCARILRG+R+A RL  S S +T
Sbjct  195   LFFDPFMNRIYDYANGMEDVRSLKLQTLIPARLSFQEDCARILRGIRIAGRLGLSISKDT  254

Query  956   ETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA  1135
             ETAI KL  SV SL+K R+ ME+NYMLSYGAA  ++ LLQ+++LL++ LPFHAAYL +QA
Sbjct  255   ETAICKLQSSVKSLNKDRIKMELNYMLSYGAAESTILLLQRFHLLKIFLPFHAAYLHEQA  314

Query  1136  DKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVM  1312
             D+ S+  S MLMKL  SLD++VS +RP   SLWV LLAFH  LV NPQ   V+   AS++
Sbjct  315   DEVSAQGSTMLMKLLYSLDKIVSSDRPCDCSLWVGLLAFHQALVLNPQDAFVIWAFASIL  374

Query  1313  YHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMA--VQ--VNMLTDAD  1480
             Y   W++GV+FAR++ K    +VPEIS      S+++LA+ V  +A  VQ  VN  TD  
Sbjct  375   YCGTWQEGVKFARENAKVEGRFVPEISGFSEIKSDEKLAEEVSQLASLVQDAVNAFTDEI  434

Query  1481  NLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQK  1660
             +L E  S++        VFVS K      + E  G+L + + S   +  S KI      K
Sbjct  435   SLSESLSRYLDPPLDVFVFVSKK------IGEHAGLLFH-MQSCEYRRESFKIDYDLLVK  487

Query  1661  GTAHKKGNGIAHETRFLLSKIILDT  1735
             G          +ETRF+L K+IL T
Sbjct  488   GD--------LYETRFVLGKVILKT  504



>ref|XP_010029590.1| PREDICTED: uncharacterized protein LOC104419581 isoform X1 [Eucalyptus 
grandis]
Length=730

 Score =   437 bits (1124),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 256/503 (51%), Positives = 335/503 (67%), Gaps = 24/503 (5%)
 Frame = +2

Query  257   KFNQTSAGDGIQL-ESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLN  433
             + N+T AG  +Q  E   + ++D      +I+ S W+  DAR  G+TG  I  S W VL 
Sbjct  30    RLNRTLAGGELQAQEEQAEASSDGAAHLVEIDMSKWKTYDARSCGVTGHSIPKSPWTVLA  89

Query  434   VLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHI  613
             +L+  GF AYLVGGCVRDLIL R+PKDFDVITTA L ++K++F+R +IVG+RFPICRV I
Sbjct  90    LLRDAGFNAYLVGGCVRDLILKRVPKDFDVITTASLQQVKEKFHRCDIVGKRFPICRVRI  149

Query  614   RGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPF  793
             +GSVVEVSSF T+A K  E K K +F  + P GCN+ D I WR+S+HRDFTINSLF+D  
Sbjct  150   KGSVVEVSSFKTIA-KRTEGKEKVAFSCK-PSGCNKRDFILWRDSMHRDFTINSLFFDLS  207

Query  794   VYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWK  973
               +IYDY NAM D++S KLRT+IPAQLSFEEDCARILRG+R+AARL  + S + E AI  
Sbjct  208   ENKIYDYTNAMEDVRSLKLRTIIPAQLSFEEDCARILRGVRIAARLGLALSRDIEIAIGS  267

Query  974   LSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFH----AAYLTQQADK  1141
             LS S+  L+K RLM+E+N +LSYGAA PSLCLLQ+  LLE++LPFH    AAYL QQ   
Sbjct  268   LSSSIAGLNKHRLMLEINSILSYGAAEPSLCLLQRLRLLEIILPFHSTLQAAYLDQQNRG  327

Query  1142  QSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH  1318
              S+ +S MLM+LF ++D+LVSC +P+  +LW+ LLAFHL LVNNPQ   V+   AS ++H
Sbjct  328   HSAQSSLMLMRLFFNMDKLVSCNQPSDCTLWIGLLAFHLALVNNPQDASVIWAFASTLHH  387

Query  1319  RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMA--VQ--VNMLTDADNL  1486
               WK   +FA +H K    +VPEIS S  S  +  LA+RV N+A  VQ  V++L+D + L
Sbjct  388   GKWKGASQFANKHAKLRVNFVPEISGS--STYKSALAERVSNLASLVQESVSILSDTNRL  445

Query  1487  REVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGT  1666
              E  +++  SS SGLV +  ++     V E+F +L NDV   N+     +I         
Sbjct  446   IESMTRYPHSSCSGLVLIQEQVANN--VREIFQVLVNDVEFYNDGRECFEI--------N  495

Query  1667  AHKKGNGIAHETRFLLSKIILDT  1735
                 G G   ETR +L  IIL+T
Sbjct  496   YELLGKGFLRETRHVLGTIILNT  518



>gb|KFK42256.1| hypothetical protein AALP_AA2G231700 [Arabis alpina]
Length=766

 Score =   431 bits (1108),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 249/523 (48%), Positives = 328/523 (63%), Gaps = 35/523 (7%)
 Frame = +2

Query  233   ALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISP  412
             A + S LQ+ N T A   ++  ST  +  D +     ++ S W+K+ A   GI  S I  
Sbjct  19    AAVYSKLQRSNCTIAEGVMEKCSTIRKVIDEDI--NSVDTSKWKKVRASDAGIRNSMIPE  76

Query  413   SSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRF  592
             SS  VL VL+++GF AYLVGGCVRDLIL+R+PKD+DVITTA L +I++ F+RA+++G+RF
Sbjct  77    SSLNVLRVLRRQGFDAYLVGGCVRDLILHRVPKDYDVITTANLKQIRRLFHRAQVIGKRF  136

Query  593   PICRVHIRGSVVEVSSFDTVANKGDETKR------KNSFVP------------RMPKGCN  718
             PIC V +RGS++EVSSFDTVA    E +       +N+  P            +M  GC+
Sbjct  137   PICHVWMRGSIIEVSSFDTVAQSDGEHEDDMGKSVENNGAPQNTEANKISSLFKMDSGCD  196

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
               D  RW+NSL RDFT+NSLFYDPF  +IYDY N M D+K  KLRTL+ A LSF+EDCAR
Sbjct  197   VKDCSRWKNSLQRDFTVNSLFYDPFELKIYDYTNGMEDLKHLKLRTLVSAHLSFKEDCAR  256

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRGLR+AARL  S S + ETAI +   SV S+ + RL+ME+NYML+YGAA PS+ LL K
Sbjct  257   ILRGLRIAARLGLSLSKDIETAIPEFVTSVASVGQFRLIMEINYMLAYGAAAPSILLLMK  316

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLT  1258
             + LL VLLPF AAYL Q +      +SML++LFS++DQLVSCE PA   LW+A+LAFH+ 
Sbjct  317   FKLLHVLLPFQAAYLDQASKTSLPSSSMLVRLFSNMDQLVSCEWPADSRLWIAVLAFHIA  376

Query  1259  LVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRV  1438
             LV NPQ  +V+   AS++YHR+W + V FAR+H  +   Y PE+S S G  S ++LA+ V
Sbjct  377   LVRNPQEAIVLRAFASLLYHRDWSKAVRFAREHEDSVPGYAPEVSKSSGETSNEDLAEAV  436

Query  1439  ENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVT  1606
              +    +     +LT+ + LRE    +     SGL+FV  K  K   V E F  ++ DV 
Sbjct  437   SDFTRLIKDTRYVLTEMETLREALCLYPDFKSSGLIFVPKKKGKD--VAEWFARVS-DVE  493

Query  1607  SLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             S   K     I         A  KGN    E  F+L KIILDT
Sbjct  494   SYESKKEGFSIDY------VALGKGNPC--EVGFVLGKIILDT  528



>ref|XP_010679948.1| PREDICTED: uncharacterized protein LOC104895205 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=761

 Score =   429 bits (1104),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 240/471 (51%), Positives = 321/471 (68%), Gaps = 18/471 (4%)
 Frame = +2

Query  335   PGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKD  514
             P   + S W+ +D+R  GIT S I  +   V+ +L+ +G+ AYLVGGCVRDL+LN+IPKD
Sbjct  48    PVDADTSKWKNVDSRSLGITLSMIPYAPRTVIRILQSEGYDAYLVGGCVRDLVLNKIPKD  107

Query  515   FDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFV  694
             FDV+TTA+L EIKK+F+RA IVGRRFPICRVH+R SV+EVSSF+TVAN G    ++   +
Sbjct  108   FDVVTTAKLQEIKKKFHRAFIVGRRFPICRVHVRDSVIEVSSFETVANHG--KGKEQDHL  165

Query  695   PRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQL  874
               MP+G ++ D +RWRNS  RDFT+NSLFYDPF +++YDY++ +AD+ + KLRTL+PA  
Sbjct  166   SEMPEGYDKKDFMRWRNSFCRDFTVNSLFYDPFAHKVYDYSDGIADLTAMKLRTLVPAHS  225

Query  875   SFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAV  1054
             SF+ DCARILRGLR+AARL  SF+ +TE AI  L  SV +LDK+RLMME+NYMLSYGAA 
Sbjct  226   SFQVDCARILRGLRIAARLGLSFAEDTEKAICDLYASVKNLDKARLMMEMNYMLSYGAAH  285

Query  1055  PSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWV  1234
              SL LL+K+NLLE+LLP+ AAYL   +  Q+   +MLMKLFS+LD LVSC++P    LWV
Sbjct  286   SSLLLLKKFNLLEMLLPYQAAYLADHSVGQTP--TMLMKLFSNLDSLVSCDQPCDSVLWV  343

Query  1235  ALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMS  1414
             +LL FHL LVNNPQ  LV+ T AS++YH  W++GV+ A +       + PEI  S   ++
Sbjct  344   SLLVFHLALVNNPQDALVIGTFASLLYHGTWREGVKAAGELSGGQVNFAPEICISSDDLA  403

Query  1415  EDELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVF  1582
             +++LA+RV   A      ++ L DA  LR++  +   SS   +VF+S    K     E+F
Sbjct  404   DEKLAQRVSKFASVVLDSISALNDAKRLRKIMGRCPSSSRPIVVFISKNAGK--AAAEIF  461

Query  1583  GILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              +L +D+ SL EK     I             G G   ETRF L K+I+DT
Sbjct  462   DVLVDDIRSLKEKRRCYSID--------YELLGKGDVVETRFALGKVIMDT  504



>ref|XP_007157989.1| hypothetical protein PHAVU_002G115200g [Phaseolus vulgaris]
 gb|ESW29983.1| hypothetical protein PHAVU_002G115200g [Phaseolus vulgaris]
Length=730

 Score =   428 bits (1100),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 243/476 (51%), Positives = 316/476 (66%), Gaps = 23/476 (5%)
 Frame = +2

Query  341   KIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFD  520
             +I  S  + LDA+ FG+T S IS SS  VL +L+ KGF++YLVGGCVRDLILNR PKDFD
Sbjct  57    RIGISEGKTLDAKEFGVTSSMISHSSMFVLKLLRSKGFESYLVGGCVRDLILNRTPKDFD  116

Query  521   VITTARLNEIKKQFYR---AEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSF  691
             VITTA+L E++KQ  R   AE+VGRRFPIC VHI+GSVVEV+SF+TVA   +   ++   
Sbjct  117   VITTAKLMEVRKQLRRSAHAEVVGRRFPICLVHIKGSVVEVTSFETVAQTSN--GKEQFL  174

Query  692   VPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQ  871
                +PK  N+ D+ R +NSL RDFTINSLFYDPF  +IYDY N MAD+K+ KL T+IPAQ
Sbjct  175   YSLLPKCSNKKDLFRCKNSLRRDFTINSLFYDPFANKIYDYTNGMADLKTLKLETVIPAQ  234

Query  872   LSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAA  1051
             LSF+ED  RILRG R+ ARL  S S E E AIW  S  V +LDKSR+M+E+ YMLSYGAA
Sbjct  235   LSFKEDPGRILRGFRITARLGLSISREIEAAIWTYSSLVKTLDKSRIMIELKYMLSYGAA  294

Query  1052  VPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESL  1228
              PSL LL K+ LLE LLP HAAYL +QA ++ +  S ML+KLF  LD+LV+C+RP   +L
Sbjct  295   EPSLRLLWKFKLLEFLLPVHAAYLDEQAIEEDAQASNMLLKLFFHLDKLVACDRPCDCTL  354

Query  1229  WVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGS  1408
             W+ LLAFHL LVNNPQ  +VV   ASV+YH  WK+GV+FA++  + +  +VPEI  S+  
Sbjct  355   WIGLLAFHLALVNNPQDAIVVWAFASVLYHGEWKEGVKFAKEQARMSVNFVPEIRKSNLY  414

Query  1409  MSEDELAKRVENMAV----QVNMLTDADNLREV--TSKFSGSSHSGLVFVSNKMVKKIVV  1570
              S++E+A  V  +A      ++ L + ++LR+    S++     SG+VFVS K     + 
Sbjct  415   KSDEEIAIAVTKLASLVIHSISPLVEKNSLRQFLSISRYPSFPQSGMVFVSRKAGN--LA  472

Query  1571  EEVFGILTNDVTSLNE-KSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               +F  L +D       +   LKI             G G   ET F+L KI+L+T
Sbjct  473   HAIFKKLASDGKFYKSGRRTDLKI--------NYDMLGKGQLSETGFVLGKIVLET  520



>ref|XP_003612324.1| Poly(A) polymerase [Medicago truncatula]
Length=675

 Score =   423 bits (1087),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 237/477 (50%), Positives = 316/477 (66%), Gaps = 24/477 (5%)
 Frame = +2

Query  338   GKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDF  517
             G+I+ SNW+  DA   G+TGS IS  S  VL +L+ KG K+YLVGGCVRDL+LNR PKDF
Sbjct  14    GRIDISNWKTFDAWKLGVTGSMISKPSHFVLKLLQDKGLKSYLVGGCVRDLVLNRTPKDF  73

Query  518   DVITTARLNEIKKQF----YRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKR--  679
             DV+TTA+L E+K+ F    +RA++VGRRFP+C VH++GSV+EV+SF T +    ET +  
Sbjct  74    DVVTTAKLIEVKRLFRRFGHRADVVGRRFPVCLVHMQGSVIEVTSFHTES----ETPKAM  129

Query  680   KNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTL  859
             KN     MPK  N+ +    +NSL RDFTINSLFYDPF  +IYDYAN MAD++S KL T+
Sbjct  130   KNVLHSLMPKCKNKENRFLCKNSLRRDFTINSLFYDPFANKIYDYANGMADLRSLKLETV  189

Query  860   IPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLS  1039
             IPAQ+SF+ED  RILRG R+AARL  S S E E AIW  S  V  L+K R+M+E+NYMLS
Sbjct  190   IPAQISFKEDPGRILRGFRIAARLGLSLSREIEAAIWTCSSLVEDLNKDRMMIEMNYMLS  249

Query  1040  YGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSS-DTSMLMKLFSSLDQLVSCERPA  1216
             YGAA PSL LL K+ LL+ LLP  AAYL +QA K+ + D++MLMKLF  +D LV C RP+
Sbjct  250   YGAAEPSLRLLWKFKLLQFLLPVQAAYLDEQATKEDAQDSNMLMKLFFHMDNLVGCGRPS  309

Query  1217  RESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISD  1396
               +LW+ LLAFHL LVNNPQ  LVV   ASV+YH +W+ G++FA++H K +  + PEI  
Sbjct  310   DCTLWIGLLAFHLALVNNPQDALVVWAFASVLYHGDWEGGIKFAKEHAKMSVNFEPEIKR  369

Query  1397  SDGSMSEDELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKI  1564
             S    S++++A+ V  +A      ++ L + ++L +  S++       +V V +K   K 
Sbjct  370   SSICKSDEDIAEAVTKLASLVIDSIHPLVNIESLSQSLSRYPSVPPPHMVLVVSKKTGK-  428

Query  1565  VVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              V E+F +L ND+     +  S KI             G+G   ETRF+L KI+L T
Sbjct  429   AVSEIFEVLVNDIKFYKSERKSAKI--------NYDMLGSGHTSETRFVLGKIVLQT  477



>gb|AES95282.2| tRNA nucleotidyltransferase/poly(A) polymerase [Medicago truncatula]
Length=713

 Score =   422 bits (1086),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 237/477 (50%), Positives = 316/477 (66%), Gaps = 24/477 (5%)
 Frame = +2

Query  338   GKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDF  517
             G+I+ SNW+  DA   G+TGS IS  S  VL +L+ KG K+YLVGGCVRDL+LNR PKDF
Sbjct  52    GRIDISNWKTFDAWKLGVTGSMISKPSHFVLKLLQDKGLKSYLVGGCVRDLVLNRTPKDF  111

Query  518   DVITTARLNEIKKQF----YRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKR--  679
             DV+TTA+L E+K+ F    +RA++VGRRFP+C VH++GSV+EV+SF T +    ET +  
Sbjct  112   DVVTTAKLIEVKRLFRRFGHRADVVGRRFPVCLVHMQGSVIEVTSFHTES----ETPKAM  167

Query  680   KNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTL  859
             KN     MPK  N+ +    +NSL RDFTINSLFYDPF  +IYDYAN MAD++S KL T+
Sbjct  168   KNVLHSLMPKCKNKENRFLCKNSLRRDFTINSLFYDPFANKIYDYANGMADLRSLKLETV  227

Query  860   IPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLS  1039
             IPAQ+SF+ED  RILRG R+AARL  S S E E AIW  S  V  L+K R+M+E+NYMLS
Sbjct  228   IPAQISFKEDPGRILRGFRIAARLGLSLSREIEAAIWTCSSLVEDLNKDRMMIEMNYMLS  287

Query  1040  YGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSS-DTSMLMKLFSSLDQLVSCERPA  1216
             YGAA PSL LL K+ LL+ LLP  AAYL +QA K+ + D++MLMKLF  +D LV C RP+
Sbjct  288   YGAAEPSLRLLWKFKLLQFLLPVQAAYLDEQATKEDAQDSNMLMKLFFHMDNLVGCGRPS  347

Query  1217  RESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISD  1396
               +LW+ LLAFHL LVNNPQ  LVV   ASV+YH +W+ G++FA++H K +  + PEI  
Sbjct  348   DCTLWIGLLAFHLALVNNPQDALVVWAFASVLYHGDWEGGIKFAKEHAKMSVNFEPEIKR  407

Query  1397  SDGSMSEDELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKI  1564
             S    S++++A+ V  +A      ++ L + ++L +  S++       +V V +K   K 
Sbjct  408   SSICKSDEDIAEAVTKLASLVIDSIHPLVNIESLSQSLSRYPSVPPPHMVLVVSKKTGK-  466

Query  1565  VVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              V E+F +L ND+     +  S KI             G+G   ETRF+L KI+L T
Sbjct  467   AVSEIFEVLVNDIKFYKSERKSAKI--------NYDMLGSGHTSETRFVLGKIVLQT  515



>ref|NP_179349.2| polynucleotide adenylyltransferase family protein [Arabidopsis 
thaliana]
 gb|AEC06655.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
thaliana]
Length=757

 Score =   423 bits (1088),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 254/549 (46%), Positives = 338/549 (62%), Gaps = 31/549 (6%)
 Frame = +2

Query  212   FVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGI  391
             F      A + S LQ+ N T A   ++  S+  +  D +     ++ S W+K+ A   GI
Sbjct  12    FFHSQALAAVYSKLQRSNCTLAEGFMEKCSSIRQVIDEDI--NSVDTSKWKKVRASDAGI  69

Query  392   TGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRA  571
               S I  SS  VL +L+++GF AYLVGGCVRDLILNR+PKD+DVITTA L +I++ F+RA
Sbjct  70    KNSMIPESSMNVLRLLRRQGFDAYLVGGCVRDLILNRVPKDYDVITTADLKQIRRLFHRA  129

Query  572   EIVGRRFPICRVHIRGSVVEVSSFDTVANKG--------------DETKRKNSFVPRMPK  709
             +++G+RFPIC V + GS++EVSSFDTVA+                D    KN+ + +M  
Sbjct  130   QVIGKRFPICHVWMGGSIIEVSSFDTVAHSDSDLEKSKEKSGVSLDTKANKNNSLFKMYS  189

Query  710   GCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEED  889
             G +  D  RWRNSL RDFTINSLFY+PF + IYDYAN M D+   KLRTL+PA LSF+ED
Sbjct  190   GWDIKDCKRWRNSLQRDFTINSLFYNPFDFTIYDYANGMEDLTDLKLRTLVPAHLSFKED  249

Query  890   CarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCL  1069
             CARILRGLR+AARL  S S + +TAI +   SV +LD+ RL+ME+NYML+YGAA PS+ L
Sbjct  250   CARILRGLRIAARLGLSLSKDVKTAIPEFVSSVANLDQFRLIMEMNYMLAYGAAAPSILL  309

Query  1070  LQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAF  1249
             L K+ LL VLLPF AAYL Q +    S + ML++LFS++D+LVSC++PA   LW+A+LAF
Sbjct  310   LMKFKLLHVLLPFQAAYLDQASKTSLSSSLMLVRLFSNMDKLVSCDQPADPKLWIAVLAF  369

Query  1250  HLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELA  1429
             H+ LV NPQ  +VV   A+++YH NW + VEFAR+H  +   Y PE+S S    S+++LA
Sbjct  370   HIALVRNPQEAIVVRAFAALLYHGNWSKAVEFAREHETSVIGYAPEVSKSSRKRSDEDLA  429

Query  1430  KRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTN  1597
             + V      +     +LTD + LRE    +     SGLVF+  K  K   V E F  L+ 
Sbjct  430   EAVSEFTCLLKDTQYVLTDKEALREALYLYPDFKFSGLVFIPKK--KGRDVAEGFMRLS-  486

Query  1598  DVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDTlglggvileegeSK  1777
             DV S   +     I             G G   E RF+L KIILDT+  G VI      K
Sbjct  487   DVESYESQKEGFSIDYVL--------LGKGNPCEVRFVLGKIILDTITEGTVIEPLNSVK  538

Query  1778  KRNSEYDEI  1804
             K+ S  + I
Sbjct  539   KKQSTRNHI  547



>ref|XP_006299875.1| hypothetical protein CARUB_v10016083mg [Capsella rubella]
 gb|EOA32773.1| hypothetical protein CARUB_v10016083mg [Capsella rubella]
Length=763

 Score =   421 bits (1081),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 238/486 (49%), Positives = 316/486 (65%), Gaps = 33/486 (7%)
 Frame = +2

Query  344   IEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDV  523
             ++ S W+K+ A   GI  S I  SS  VL +L+++GF AYLVGGCVRDLIL+R+PKD+DV
Sbjct  54    VDTSKWKKVRASDAGIRNSMIPDSSMNVLRLLRRQGFDAYLVGGCVRDLILHRVPKDYDV  113

Query  524   ITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVA-------NKGDETKRK  682
             ITTA L +I++ F+RA+++G+RFPIC V + GS++EVSSFDTVA       N  D++K K
Sbjct  114   ITTANLKQIRRLFHRAQVIGKRFPICHVWMGGSIIEVSSFDTVAHSDSGSENDLDKSKEK  173

Query  683   -----------NSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMA  829
                        N+ + ++  GC+  D  RWRNSL RDFTINSLFYDPF ++IYDY N M 
Sbjct  174   YDVPLDIEADKNNSLFKLYSGCDVRDCNRWRNSLQRDFTINSLFYDPFDFKIYDYTNGME  233

Query  830   DIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSR  1009
             D+   KLRTL+PA LSF+EDCARILRGLR+AARL  S S + ETAI +   SV +L + R
Sbjct  234   DLTDLKLRTLVPAHLSFKEDCARILRGLRIAARLGLSLSKDVETAIPEFVSSVANLGQFR  293

Query  1010  LMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLD  1189
             L+ME+NYML+YGAA PS+ LL K+ LL VLLPF AAYL Q ++   S + ML++LFS++D
Sbjct  294   LIMEMNYMLAYGAAAPSILLLMKFKLLHVLLPFQAAYLDQASETSLSTSLMLVRLFSNMD  353

Query  1190  QLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAA  1369
             +LVSC++PA   LW+A+LAFH+ LV NPQ  +VV   A+++YHRNW++ VEFAR H  + 
Sbjct  354   KLVSCDQPADSKLWIAVLAFHIALVRNPQEAIVVRAFAALLYHRNWRKAVEFARGHETSV  413

Query  1370  SLYVPEISDSDGSMSEDELAKRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVF  1537
               Y PE+  S    S+++LA+ V      +     +LTD + LRE    +     SGLVF
Sbjct  414   VGYTPEVLKSLRKRSDEDLAEAVSEFICILKDTQYVLTDIEALREALYLYPDFKFSGLVF  473

Query  1538  VSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLS  1717
             +  K  K   V E F  L+ DV     +     I   S         G G + E RF+L 
Sbjct  474   IPKK--KGRDVAEGFARLS-DVEYYESEKEGFSIDYLS--------LGKGNSCEVRFVLG  522

Query  1718  KIILDT  1735
             KIILDT
Sbjct  523   KIILDT  528



>ref|XP_002884069.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60328.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=761

 Score =   417 bits (1073),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 252/553 (46%), Positives = 339/553 (61%), Gaps = 36/553 (7%)
 Frame = +2

Query  212   FVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGI  391
             F  Q ++A   S LQ+ N T A   ++  S+     D +     ++ S W+K+ A   GI
Sbjct  13    FRSQTLSAF-YSKLQRSNCTLAEGVMEKCSSIRSVIDEDI--NSVDTSKWKKVRASDAGI  69

Query  392   TGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRA  571
               S I  SS  VL +L+++GF AYLVGGCVRDLIL+R+PKD+DVITTA L +I++ F+RA
Sbjct  70    RNSMIPESSMNVLRLLRRQGFDAYLVGGCVRDLILHRVPKDYDVITTANLKQIRRLFHRA  129

Query  572   EIVGRRFPICRVHIRGSVVEVSSFDTVANKG------------------DETKRKNSFVP  697
             +++G+RFPIC V + GS++EVSSFDTVA+                    D    KN+ + 
Sbjct  130   QVIGKRFPICHVWMGGSIIEVSSFDTVAHSDSEHEDDLEKSKEKSGVSLDTEANKNNSLF  189

Query  698   RMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLS  877
              M  G +  D  RWRNSL RDFTINSLFY+PF  +IYDYAN M D+   KLRTL+PA LS
Sbjct  190   TMYSGWDVKDCNRWRNSLQRDFTINSLFYNPFELKIYDYANGMEDLTDLKLRTLVPAHLS  249

Query  878   FEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVP  1057
             F+EDCARILRGLR+AARL  S S + ETAI +   SV +LD+ RL+ME+NYML+YGAA P
Sbjct  250   FKEDCARILRGLRIAARLGLSLSKDIETAIPEFVSSVANLDQFRLIMEMNYMLAYGAAAP  309

Query  1058  SLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVA  1237
             S+ LL K+ LL VLLPF AAYL Q ++   S + ML++LFS++D+LVSC++PA   LW+A
Sbjct  310   SILLLMKFKLLHVLLPFQAAYLDQASETSLSSSLMLVRLFSNMDKLVSCDQPADPKLWIA  369

Query  1238  LLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSE  1417
             +LAFH+ LV NPQ  +VV   A+++YHRNW + V+FAR+H  +   Y PE+S      S+
Sbjct  370   VLAFHIALVRNPQEAIVVRAFAALLYHRNWSKAVKFAREHETSVVGYAPEVSKFSRKRSD  429

Query  1418  DELAKRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFG  1585
             ++LA+ V      +     +LTD + LRE    +     SGLVF+  +  +   V E   
Sbjct  430   EDLAEAVSEFTCLLKDTQYVLTDIEALREALYLYPDFKFSGLVFIPKRKGRD--VAEGLA  487

Query  1586  ILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDTlglggvilee  1765
              L+ DV S   K     I             G G   E RF+L KIILDT+  G VI   
Sbjct  488   RLS-DVESYESKKEGFSID--------YLLLGKGNPCEVRFVLGKIILDTITEGIVIEPL  538

Query  1766  geSKKRNSEYDEI  1804
                KK+ S  ++I
Sbjct  539   NSVKKKQSTSNQI  551



>ref|XP_009150783.1| PREDICTED: uncharacterized protein LOC103874114 [Brassica rapa]
Length=745

 Score =   414 bits (1064),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 249/522 (48%), Positives = 332/522 (64%), Gaps = 34/522 (7%)
 Frame = +2

Query  212   FVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGI  391
             F      A + S LQ+ N T A   ++  S  D    S      ++ S W+K+ A   GI
Sbjct  12    FFRSQTLAAIYSKLQRSNCTLAEGVMEKCSVIDEDISS------VDTSKWKKVRAIDCGI  65

Query  392   TGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRA  571
               S +  SS  VL +L+++GF AYLVGGCVRDLIL+R PKD+DVITTA L +I++ F+RA
Sbjct  66    RNSMVPESSLNVLRLLRRQGFDAYLVGGCVRDLILHRPPKDYDVITTANLKQIRRLFHRA  125

Query  572   EIVGRRFPICRVHIRGSVVEVSSFDTVA-------NKGDETKRK-NSFVPRMPKGCNESD  727
             ++VGRRFPIC V ++GSV+EVSSF+TVA       N   E+K K N F  +M  G +  D
Sbjct  126   QVVGRRFPICHVWMKGSVIEVSSFNTVAQNDTEHENDTRESKEKINLF--KMYSGWDAKD  183

Query  728   VIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilr  907
                WRNSL RDFT+NSLF+DPF  +IYDY N M D+K  KLRTL+PA +SF EDCAR+LR
Sbjct  184   CNLWRNSLQRDFTVNSLFFDPFELKIYDYNNGMEDLKDLKLRTLVPAHVSFSEDCARVLR  243

Query  908   glrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNL  1087
             GLRL+ARL  S S + +TA+ +   S+ +L   R+ ME+NYML YGAA PS+ LL KY L
Sbjct  244   GLRLSARLGLSLSKDIKTALPESISSIANLSPVRIFMEMNYMLGYGAAAPSILLLMKYKL  303

Query  1088  LEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLV  1264
             L VLLPF AAYL +QA K S  +S MLMKLFS++D+LVSC++PA   LW+ALLAFH+TLV
Sbjct  304   LHVLLPFQAAYL-EQATKTSQQSSLMLMKLFSNMDKLVSCKQPADSRLWIALLAFHITLV  362

Query  1265  NNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEIS-DSDGSMSEDELAKRVE  1441
              NPQ  +V+   AS++YHRNW++ + FAR++  + + YVPE+S  S    S+++LA+ V 
Sbjct  363   RNPQEAIVLHAFASLLYHRNWREALRFARENENSVAGYVPEVSKKSSRKRSDEDLAEAVS  422

Query  1442  NMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTS  1609
               A  +     +LTD ++L E    F     SGLVFVS    K++   ++F  ++ DV S
Sbjct  423   EFASLLRDTQYVLTDMESLHEALYHFPSFKRSGLVFVSKNKGKQLA--DLFTGMS-DVES  479

Query  1610  LNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                +     I   S         G G+  E  F+L KIILDT
Sbjct  480   YESEKHGFSIDYCS--------LGKGVTCEVGFVLGKIILDT  513



>ref|XP_009413056.1| PREDICTED: uncharacterized protein LOC103994446 [Musa acuminata 
subsp. malaccensis]
Length=537

 Score =   404 bits (1038),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 236/473 (50%), Positives = 326/473 (69%), Gaps = 21/473 (4%)
 Frame = +2

Query  338   GKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDF  517
             G  + S+W+ +D+R  GI  S IS S+W VLN+L++KGF AYLVGGCVRDL+L RIPKDF
Sbjct  49    GSYDQSSWKTVDSRAVGIRRSSISSSTWTVLNILQRKGFDAYLVGGCVRDLLLERIPKDF  108

Query  518   DVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVP  697
             DVIT A L +IKKQF R  I+GRRFPIC+VH++GS+VEVSSF+T  N  D  K+KN    
Sbjct  109   DVITNATLKQIKKQFRRCIIIGRRFPICQVHVQGSIVEVSSFNT--NDKDLKKQKNDVHS  166

Query  698   RMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLS  877
             ++  GC+  D +RW+N + RDFTINSLF+DP  Y IYDY   + D+++ K+RT+IPA LS
Sbjct  167   QVSNGCDVDDFVRWKNCMDRDFTINSLFFDPNCYTIYDYVGGIRDLRTLKVRTVIPAHLS  226

Query  878   FEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVP  1057
             F++DCARILRGLR+ ARL   FS ET  AI  LS S+++L++SRL ME+N+ML+YGAA  
Sbjct  227   FDKDCARILRGLRIVARLGLQFSKETAAAIRDLSSSILTLNESRLRMELNFMLAYGAAES  286

Query  1058  SLCLLQKYNLLEVLLPFHAAYLTQQADKQ-SSDTSMLMKLFSSLDQLVSCERPARESLWV  1234
             S+CLLQK+ LL++LLP  AAYL  Q+ KQ +  ++MLMKLFS+ D+L++ + PA   LW+
Sbjct  287   SICLLQKFKLLDILLPIQAAYLADQSRKQVAQGSTMLMKLFSNADKLLAADHPADSILWL  346

Query  1235  ALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMS  1414
             ALLAFHL LV NPQ  LVV T ++++++  WK+  E+AR++VKA + +VPEI  S  + S
Sbjct  347   ALLAFHLALVENPQDALVVWTFSAILHNGTWKKASEYARKNVKAHAQFVPEIRSSSDTKS  406

Query  1415  EDELAKRVENMA----VQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVF  1582
             ++ + +   ++A      VN  T  D L++    + G   SG+V VS KM     V ++F
Sbjct  407   DELILEETSHLASLVKSSVNAFTSIDALQQSLGSYQGPLSSGVVLVSEKMGSN--VSKLF  464

Query  1583  GILTNDVTSLN--EKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              IL +D+ S +   K+C +  Q          KKG+    ETRF+L KII++T
Sbjct  465   KILESDIESYDNGRKTCEINYQ--------LLKKGD--PDETRFMLGKIIMET  507



>emb|CDY29183.1| BnaA06g25740D [Brassica napus]
Length=729

 Score =   409 bits (1052),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 246/520 (47%), Positives = 329/520 (63%), Gaps = 30/520 (6%)
 Frame = +2

Query  212   FVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGI  391
             F      A + S LQ+ N T A   ++  S  D    S      ++ S W+K+ A   GI
Sbjct  12    FFRSQTLAAIYSKLQRSNCTLAEGVMEKCSVIDEDISS------VDTSKWKKVRAIDCGI  65

Query  392   TGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRA  571
               S +  SS  VL +L+++GF AYLVGGCVRDLIL+R PKD+DVITTA L +I++ F+RA
Sbjct  66    RNSMVPESSLNVLRLLRRQGFDAYLVGGCVRDLILHRPPKDYDVITTANLKQIRRLFHRA  125

Query  572   EIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETK------RKNSFVPRMPKGCNESDVI  733
             ++VGRRFPIC V ++GSV+EVSSF+TVA    E +      +++S + +   G +  D  
Sbjct  126   QVVGRRFPICHVWMKGSVIEVSSFNTVAQNDTEHENDTRESKESSNLFKTYSGWDAKDCN  185

Query  734   RWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrgl  913
              WRNSL RDFT+NSLF+DPF  +IYDY N M D+K  KLRTL+PA +SF EDCAR+LRGL
Sbjct  186   LWRNSLQRDFTVNSLFFDPFELKIYDYNNGMEDLKDLKLRTLVPAHVSFSEDCARVLRGL  245

Query  914   rlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLE  1093
             RL+ARL  S S + +TA+ +   SV +L   R+ ME+NYML YGAA PS+ LL KY LL 
Sbjct  246   RLSARLGLSLSKDIKTALPESISSVANLSPVRIFMEMNYMLGYGAAAPSILLLMKYKLLH  305

Query  1094  VLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNN  1270
             VLLPF AAYL +QA K S  +S MLMKLFS++D+LVSC++PA   LW+ALLAFH+TLV N
Sbjct  306   VLLPFQAAYL-EQATKTSQQSSLMLMKLFSNMDKLVSCKQPADSRLWIALLAFHITLVRN  364

Query  1271  PQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDE-LAKRVENM  1447
             PQ  +V+   AS++YHRNW++ + FAR++  + + YVPE+S    S   DE LA+ V   
Sbjct  365   PQKTIVLHAFASLLYHRNWREALRFARENENSVAGYVPEVSKKSSSKRSDEDLAEAVSEF  424

Query  1448  AVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLN  1615
             A  +     +LTD ++L E    F     SGLVFVS    K++   ++F  ++ DV S  
Sbjct  425   ASLLKDTQYVLTDMESLHEALYHFPSFKRSGLVFVSKNKGKQLA--DLFTGMS-DVESYE  481

Query  1616  EKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              +     I   S         G G+  E  F+L KIILDT
Sbjct  482   SEKHGFSIDYCS--------LGKGVTCEVGFVLGKIILDT  513



>emb|CDY54365.1| BnaC03g74530D [Brassica napus]
Length=732

 Score =   409 bits (1050),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 245/520 (47%), Positives = 328/520 (63%), Gaps = 30/520 (6%)
 Frame = +2

Query  212   FVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGI  391
             F      A + S LQ+ N T     ++  S  D    S      ++ S W+K+ A   GI
Sbjct  12    FFRSQTLAAIYSKLQRSNCTLVEGVMEKCSVIDEDISS------VDTSKWKKVRAIDCGI  65

Query  392   TGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRA  571
               S +  SS  VL +L+++GF AYLVGGCVRDLIL+R PKD+DVITTA L +I++ F+RA
Sbjct  66    RNSMVPESSLNVLRLLRRQGFDAYLVGGCVRDLILHRPPKDYDVITTANLKQIRRLFHRA  125

Query  572   EIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETK------RKNSFVPRMPKGCNESDVI  733
             ++VGRRFPIC V ++GSV+EVSSF+TVA    E +      +++S + +M  G +  D  
Sbjct  126   QVVGRRFPICHVWMKGSVIEVSSFNTVAQSDTEHENDTRESKESSNLFKMYSGWDAKDCN  185

Query  734   RWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrgl  913
              WRNSL RDFT+NSLF+DPF  +IYDY N M D+K  KLRTLIPA +SF EDCAR+LRGL
Sbjct  186   LWRNSLQRDFTVNSLFFDPFELKIYDYNNGMEDLKDLKLRTLIPAHVSFSEDCARVLRGL  245

Query  914   rlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLE  1093
             RL+ARL  S S + +TAI +   SV +L   R+ ME+NYML YGAA PS+ LL KY LL 
Sbjct  246   RLSARLGLSLSKDIKTAIPESISSVANLSPVRIFMEMNYMLGYGAAAPSILLLMKYKLLH  305

Query  1094  VLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNN  1270
             V+LPF AAYL +QA K S  +S MLMKLFS++D+LVSC++PA   LW+ALLAFH+ L  N
Sbjct  306   VVLPFQAAYL-EQATKTSQQSSLMLMKLFSNMDKLVSCKQPADSRLWIALLAFHIALERN  364

Query  1271  PQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEIS-DSDGSMSEDELAKRVENM  1447
             PQ  +V+   AS++YHRNW++ V+FAR++  + + YVPE+S  S    S ++LA+ V   
Sbjct  365   PQEAIVLHAFASLLYHRNWREAVKFARENENSVAGYVPEVSKKSSRKRSNEDLAEAVSEF  424

Query  1448  AVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLN  1615
             A  +     +LTD ++L E    F     SGLVFVS    K++   ++F  ++ DV S  
Sbjct  425   ASLLRDTQYVLTDMESLHEALYHFPSFKRSGLVFVSKNKGKQLA--DLFTGMS-DVESYK  481

Query  1616  EKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                    I   S         G G+  E  F+L KIILDT
Sbjct  482   SGKHGFSIDYCSL--------GKGVTCEVGFVLGKIILDT  513



>ref|XP_004512255.1| PREDICTED: uncharacterized protein LOC101494125 isoform X1 [Cicer 
arietinum]
Length=851

 Score =   412 bits (1059),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 237/484 (49%), Positives = 304/484 (63%), Gaps = 34/484 (7%)
 Frame = +2

Query  299   STTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGC  478
             S+++  +D +   G+I+ S W   DA+  GI  S IS  S +VL +LK+KGFK+Y VGGC
Sbjct  37    SSSETESDYSLGRGRIDISKWETFDAKKLGINSSMISKPSQLVLKLLKEKGFKSYFVGGC  96

Query  479   VRDLILNRIPKDFDVITTARLNEIKKQF----YRAEIVGRRFPICRVHIRGSVVEVSSFD  646
             VRDLILNRIPKDFDV+TTA+L E +KQF     RA +VGRRFP+C VHIRGSVVEV+SF+
Sbjct  97    VRDLILNRIPKDFDVVTTAKLIEARKQFGRHSVRAVVVGRRFPVCLVHIRGSVVEVTSFE  156

Query  647   TVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAM  826
             T A      ++       +PK  N+ D    ++SL RDFTINSLFYDPF  +IYDYAN M
Sbjct  157   TEAKTSKAVEK--VLHSLLPKCKNKEDRFLCKSSLRRDFTINSLFYDPFANKIYDYANGM  214

Query  827   ADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKS  1006
             AD++S KL T+IPAQLSF++D  RILRG R+AARL  S S ETE AIW  S  V +++K 
Sbjct  215   ADLRSLKLETVIPAQLSFKDDPGRILRGFRIAARLGLSLSRETEAAIWTCSSLVKTMNKD  274

Query  1007  RLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSS  1183
             R+M+E+NYMLSYGAA PSL LL K+ LL+ LLP HAAYL +QA K+ +  S MLM+LF  
Sbjct  275   RVMIELNYMLSYGAAEPSLRLLWKFKLLQFLLPRHAAYLDKQATKEDALASNMLMQLFKH  334

Query  1184  LDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVK  1363
             LD LV C+RP    LW+ LLAFHL  + N Q  LVV  LASV+YH  W+ G++FA++  K
Sbjct  335   LDNLVGCDRPCDCILWIGLLAFHLASLKNSQDALVVWALASVLYHGEWEGGIKFAKERAK  394

Query  1364  AASLYVPEISDSDGSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVS  1543
                 + PEI  S    S++E+AK V  +A                   +  S  G  F+ 
Sbjct  395   MCVNFAPEIKRSSICKSDEEIAKAVTKLA-----------------SLAIDSLHGQAFIP  437

Query  1544  NKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKI  1723
              K  K   V E+F +L ND+T       S KI             G G   ETR++L KI
Sbjct  438   RKTGK--AVSEIFEVLLNDITLYKSVRQSEKINYDML--------GRGHISETRYVLGKI  487

Query  1724  ILDT  1735
             +L+T
Sbjct  488   VLET  491



>ref|XP_010679949.1| PREDICTED: uncharacterized protein LOC104895205 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=455

 Score =   398 bits (1022),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 217/404 (54%), Positives = 291/404 (72%), Gaps = 8/404 (2%)
 Frame = +2

Query  335   PGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKD  514
             P   + S W+ +D+R  GIT S I  +   V+ +L+ +G+ AYLVGGCVRDL+LN+IPKD
Sbjct  48    PVDADTSKWKNVDSRSLGITLSMIPYAPRTVIRILQSEGYDAYLVGGCVRDLVLNKIPKD  107

Query  515   FDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFV  694
             FDV+TTA+L EIKK+F+RA IVGRRFPICRVH+R SV+EVSSF+TVAN G    ++   +
Sbjct  108   FDVVTTAKLQEIKKKFHRAFIVGRRFPICRVHVRDSVIEVSSFETVANHG--KGKEQDHL  165

Query  695   PRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQL  874
               MP+G ++ D +RWRNS  RDFT+NSLFYDPF +++YDY++ +AD+ + KLRTL+PA  
Sbjct  166   SEMPEGYDKKDFMRWRNSFCRDFTVNSLFYDPFAHKVYDYSDGIADLTAMKLRTLVPAHS  225

Query  875   SFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAV  1054
             SF+ DCARILRGLR+AARL  SF+ +TE AI  L  SV +LDK+RLMME+NYMLSYGAA 
Sbjct  226   SFQVDCARILRGLRIAARLGLSFAEDTEKAICDLYASVKNLDKARLMMEMNYMLSYGAAH  285

Query  1055  PSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWV  1234
              SL LL+K+NLLE+LLP+ AAYL   +  Q+   +MLMKLFS+LD LVSC++P    LWV
Sbjct  286   SSLLLLKKFNLLEMLLPYQAAYLADHSVGQT--PTMLMKLFSNLDSLVSCDQPCDSVLWV  343

Query  1235  ALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMS  1414
             +LL FHL LVNNPQ  LV+ T AS++YH  W++GV+ A +       + PEI  S   ++
Sbjct  344   SLLVFHLALVNNPQDALVIGTFASLLYHGTWREGVKAAGELSGGQVNFAPEICISSDDLA  403

Query  1415  EDELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLV  1534
             +++LA+RV   A      ++ L DA  LR++  +   SS   +V
Sbjct  404   DEKLAQRVSKFASVVLDSISALNDAKRLRKIMGRCPSSSRPIVV  447



>ref|XP_004512256.1| PREDICTED: uncharacterized protein LOC101494125 isoform X2 [Cicer 
arietinum]
Length=847

 Score =   410 bits (1054),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 234/480 (49%), Positives = 301/480 (63%), Gaps = 30/480 (6%)
 Frame = +2

Query  299   STTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGC  478
             S+++  +D +   G+I+ S W   DA+  GI  S IS  S +VL +LK+KGFK+Y VGGC
Sbjct  37    SSSETESDYSLGRGRIDISKWETFDAKKLGINSSMISKPSQLVLKLLKEKGFKSYFVGGC  96

Query  479   VRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVAN  658
             VRDLILNRIPKDFDV+TTA+L E  +   RA +VGRRFP+C VHIRGSVVEV+SF+T A 
Sbjct  97    VRDLILNRIPKDFDVVTTAKLIEFGRHSVRAVVVGRRFPVCLVHIRGSVVEVTSFETEAK  156

Query  659   KGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIK  838
                  ++       +PK  N+ D    ++SL RDFTINSLFYDPF  +IYDYAN MAD++
Sbjct  157   TSKAVEK--VLHSLLPKCKNKEDRFLCKSSLRRDFTINSLFYDPFANKIYDYANGMADLR  214

Query  839   SQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMM  1018
             S KL T+IPAQLSF++D  RILRG R+AARL  S S ETE AIW  S  V +++K R+M+
Sbjct  215   SLKLETVIPAQLSFKDDPGRILRGFRIAARLGLSLSRETEAAIWTCSSLVKTMNKDRVMI  274

Query  1019  EVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQL  1195
             E+NYMLSYGAA PSL LL K+ LL+ LLP HAAYL +QA K+ +  S MLM+LF  LD L
Sbjct  275   ELNYMLSYGAAEPSLRLLWKFKLLQFLLPRHAAYLDKQATKEDALASNMLMQLFKHLDNL  334

Query  1196  VSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASL  1375
             V C+RP    LW+ LLAFHL  + N Q  LVV  LASV+YH  W+ G++FA++  K    
Sbjct  335   VGCDRPCDCILWIGLLAFHLASLKNSQDALVVWALASVLYHGEWEGGIKFAKERAKMCVN  394

Query  1376  YVPEISDSDGSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMV  1555
             + PEI  S    S++E+AK V  +A                   +  S  G  F+  K  
Sbjct  395   FAPEIKRSSICKSDEEIAKAVTKLA-----------------SLAIDSLHGQAFIPRKTG  437

Query  1556  KKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             K   V E+F +L ND+T       S KI             G G   ETR++L KI+L+T
Sbjct  438   K--AVSEIFEVLLNDITLYKSVRQSEKINYDML--------GRGHISETRYVLGKIVLET  487



>gb|KHN35967.1| Putative poly(A) polymerase [Glycine soja]
Length=706

 Score =   405 bits (1042),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 245/518 (47%), Positives = 315/518 (61%), Gaps = 59/518 (11%)
 Frame = +2

Query  254   QKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLN  433
             Q F+  +     Q  S+T+   D +   G+I+ S W+ LDA   GIT S IS  S  VL 
Sbjct  21    QGFHSPAPKRPKQDPSSTENDLDYSVCRGRIDVSKWKTLDAEELGITSSMISYPSQFVLK  80

Query  434   VLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQF---YRAEIVGRRFPICR  604
             +L++KGF++YLVGGCVRDL+LNR PKDFDVITTA+L E++ QF    RAE+VGRRFPIC 
Sbjct  81    LLRRKGFESYLVGGCVRDLLLNRTPKDFDVITTAKLMEVRAQFRGLARAEVVGRRFPICL  140

Query  605   VHIRGSVVEVSSFDTVANKGDETKRKNSFV-PRMPKGCNESDVIRWRNSLHRDFTINSLF  781
             VHI+GSVVEV+SF+TVA   +   RK  F+   +PK  N+ D+ R +NSL RDFTINSLF
Sbjct  141   VHIKGSVVEVTSFETVARTSN---RKEQFLYSLLPKCSNKKDLFRCKNSLRRDFTINSLF  197

Query  782   YDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETET  961
             YDPF  +IYDY + MAD++S KL T+IPAQ+SF+ED  RILRG R+AARL  S S ETE 
Sbjct  198   YDPFANKIYDYTDGMADLRSLKLETVIPAQMSFKEDPGRILRGFRIAARLGLSLSRETEA  257

Query  962   AIWKLSPSVMSLD-------------------KSRLMMEVNYMLSYGAAVPSLCLLQKYN  1084
             A+WK S  V SLD                   K+++M+E+NYMLSYGAA PSL LL K+ 
Sbjct  258   AMWKYSSLVKSLDKKCFPFYCTSFVFLTLAIRKNKIMIELNYMLSYGAAEPSLHLLWKFK  317

Query  1085  LLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTL  1261
             LLE LLP HAAYL +QA K+ +  S MLMKLF  LD LV+C+RP   +LWV LLAFHLTL
Sbjct  318   LLEFLLPVHAAYLDEQAIKEDAPASNMLMKLFFYLDNLVACDRPCDCTLWVGLLAFHLTL  377

Query  1262  VNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVE  1441
             VNNPQ  LVV   ASV+YH  W++  E A+   K ASL +  I                 
Sbjct  378   VNNPQDALVVWAFASVLYHGEWEKDEEIAKAVTKLASLVMHSIP----------------  421

Query  1442  NMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEK  1621
                     L ++++L +  S++     S ++FV  K  K  +   +F +L +DV      
Sbjct  422   -------ALVESNSLLQSMSRYPSFPQSDMIFVPKKAGK--LASAIFKMLASDVE-----  467

Query  1622  SCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                 K +     K      G G   E  F+L KI+L+T
Sbjct  468   --FYKTERRKNSKINYGMLGKGHLSEIAFVLGKIVLET  503



>ref|XP_010467537.1| PREDICTED: uncharacterized protein LOC104747583 [Camelina sativa]
Length=755

 Score =   405 bits (1040),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 247/525 (47%), Positives = 330/525 (63%), Gaps = 32/525 (6%)
 Frame = +2

Query  212   FVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGI  391
             F  Q +TA+  S LQ+ N T A   ++  ST     D +     ++ S W+K+ A   GI
Sbjct  13    FRSQNLTAV-YSKLQRSNCTLAEGVMEKCSTIRPVIDEDI--NSVDTSKWKKVRASDAGI  69

Query  392   TGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRA  571
               S I  SS  VL +L+++GF AYLVGGCVRDLIL+R+PKD+DVITTA L +I++ F+RA
Sbjct  70    RNSMIPESSMNVLRLLRRQGFDAYLVGGCVRDLILHRVPKDYDVITTANLKQIRRLFHRA  129

Query  572   EIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKR-------------KNSFVPRMPKG  712
             +++G+RFPIC V +RGS++EVSSFDTVA+   E +              KN  + ++  G
Sbjct  130   QVIGKRFPICHVWMRGSIIEVSSFDTVAHSDSEPENDLEKPFPLAIEADKNKSLFKLYSG  189

Query  713   CNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
             C+  D  RWRNSL RDFTINSLFYDPF  +IYDY N M D+   KLRTLIPA  SF+EDC
Sbjct  190   CDVKDFNRWRNSLQRDFTINSLFYDPFELKIYDYTNGMEDLTDLKLRTLIPANFSFKEDC  249

Query  893   arilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLL  1072
             ARILRGLR+AARL  S S + ETAI +   SV +LD+ RL+ME+NYML+YGAA PS+ LL
Sbjct  250   ARILRGLRIAARLGLSLSNDVETAIPEFVSSVANLDQFRLIMEMNYMLAYGAAAPSILLL  309

Query  1073  QKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
              K+ LL VLLPF AAYL +QA + S  +S+L +LFS++D+L+SC++PA   LW+A+LAFH
Sbjct  310   MKFKLLHVLLPFQAAYL-EQASETSLSSSLLARLFSNMDKLISCDQPADSKLWIAVLAFH  368

Query  1253  LTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
             + LV NPQ  +VV   A+++YHR+W + VEFAR+   +   Y PE+  S    S+++L +
Sbjct  369   IALVRNPQEAIVVRAFAALLYHRDWSKAVEFAREDETSVVGYTPEVYKSLRRRSDEDLVE  428

Query  1433  RVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
              V      +     +LT  + LRE    +     SGLVF+  +  +   V E F  L+ D
Sbjct  429   AVSEFTCLLKDTQYVLTGIEALRESLYLYPDFKFSGLVFIPKRKGRD--VAEGFARLS-D  485

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             V S   K     I   S         G G   E RF+L KIILDT
Sbjct  486   VKSYESKKEGFSIDYLS--------LGKGNPCEVRFVLGKIILDT  522



>ref|XP_006409281.1| hypothetical protein EUTSA_v10022570mg [Eutrema salsugineum]
 gb|ESQ50734.1| hypothetical protein EUTSA_v10022570mg [Eutrema salsugineum]
Length=766

 Score =   405 bits (1040),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 243/523 (46%), Positives = 329/523 (63%), Gaps = 35/523 (7%)
 Frame = +2

Query  233   ALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISP  412
             A + S LQ+ N T A   ++  S+     D +     ++ S W+K+ A   GI  S +  
Sbjct  19    AAIYSKLQRSNYTLAEGVMKKCSSIRSVIDEDI--SSVDTSKWKKVRASDAGIKNSMVPE  76

Query  413   SSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRF  592
             SS  VL++L+++GF AYLVGGCVRDLIL+R PKD+DVITTA L +I++ F+RA+++G+RF
Sbjct  77    SSLNVLSLLRRQGFDAYLVGGCVRDLILHRAPKDYDVITTANLKQIRRLFHRAQVIGKRF  136

Query  593   PICRVHIRGSVVEVSSFDTVA-------NKGDETKRK-----------NSFVPRMPKGCN  718
             PIC V ++GSV+EVSSFDTVA       N   E+K K           NS + +M  G +
Sbjct  137   PICHVWMKGSVIEVSSFDTVAQSDSEHENDLGESKAKYGVPHNTEANENSSLFKMYSGWD  196

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
               D   WRNSL RDFT+NSLFYDPF +++YDY+N M D+K  KLRTL+PAQLSF EDCAR
Sbjct  197   VKDCNLWRNSLQRDFTVNSLFYDPFEFKVYDYSNGMEDLKDLKLRTLVPAQLSFNEDCAR  256

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRGLR+AARL  S S + ETAI +   SV +L + RL++E+NYML+YGAA PS+ LL  
Sbjct  257   ILRGLRIAARLGLSLSEDIETAIPEFISSVANLGQFRLILEMNYMLAYGAAAPSILLLMN  316

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLT  1258
             + LL VLLPF AAYL Q +      +SML++LFS++D+LVSC++PA   LW+A+LAFH  
Sbjct  317   FKLLHVLLPFQAAYLDQASKTSPPSSSMLVRLFSNMDKLVSCDQPADSRLWIAVLAFHTA  376

Query  1259  LVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRV  1438
             LV +PQ  +V+   AS++YHRNW + V+FAR+H  +   Y  EIS S    S+ +LA+ V
Sbjct  377   LVRSPQEAIVLHAFASLLYHRNWSRAVKFAREHENSVLGYASEISKSSSKRSDKDLAEAV  436

Query  1439  ENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVT  1606
                A  V     +LT+ + LRE    +     SGLVF+     K+  V + F  L+ DV 
Sbjct  437   SEFAYLVRKTLIVLTEMEALREALHLYPDFKCSGLVFIPK--TKRKDVADWFARLS-DVE  493

Query  1607  SLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             S   K     I   S  KG+  + G        F+L KII+DT
Sbjct  494   SYESKKEGFSIDYISLGKGSPCEIG--------FVLGKIIMDT  528



>ref|XP_003562137.1| PREDICTED: uncharacterized protein LOC100829983 [Brachypodium 
distachyon]
Length=553

 Score =   385 bits (989),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 241/524 (46%), Positives = 329/524 (63%), Gaps = 27/524 (5%)
 Frame = +2

Query  194   LSSVEQFVEQLVTALLMSL-LQKFNQTSAGDG-IQLESTTDRAADSNFQPGKIEFSNWRK  367
             LSS+   + +L +A    L ++++     GDG   L +   R+A    +PG I+ S+WR 
Sbjct  10    LSSLSPLLPRLSSAASNLLEMRQYGSRREGDGDGGLRNGRSRSAS---RPGFIDTSSWRF  66

Query  368   LDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNE  547
              DAR  GI    I  + W VL +LK+KGF+AYLVGGCVRDL+L R PKDFDVITTA L +
Sbjct  67    FDARAVGIPTGSIPRNCWTVLQMLKRKGFEAYLVGGCVRDLLLKRAPKDFDVITTASLKQ  126

Query  548   IKKQ-FYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNES  724
             IKK  F R  I+GRRFPIC+V + GS  EVSSF T   +   ++  N F   +  G +E 
Sbjct  127   IKKLVFKRCMIIGRRFPICQVKMHGSTFEVSSFSTNGTQVKGSENVN-FSEEL-DGYDEG  184

Query  725   DVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCaril  904
             D+I W+NSL RDFTINSLF++PF Y++YDY N + D++  K+  +IPA +SFEED ARIL
Sbjct  185   DIIPWKNSLKRDFTINSLFFNPFNYRVYDYVNGVNDVRKNKVCAVIPAHVSFEEDPARIL  244

Query  905   rglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYN  1084
             RGLR+AARL F FS ET TAI  LS S++++DKSRL ME+ YMLS+GAA  S+ LL KY 
Sbjct  245   RGLRIAARLGFQFSSETSTAIRDLSSSIINIDKSRLAMEMKYMLSHGAAESSIRLLGKYG  304

Query  1085  LLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTL  1261
             LL++LLP  AAYL+ Q   QSSD + MLMKL ++LD+L S +RP   SLW+ALLAFH  L
Sbjct  305   LLDILLPLQAAYLSHQIKGQSSDRNLMLMKLLANLDKLTSADRPCHCSLWLALLAFHSAL  364

Query  1262  VNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVE  1441
             VN+PQ   V+   AS+MY   W   ++F +Q   A   +VPE     G+   + L ++  
Sbjct  365   VNSPQDAQVIKAFASLMYFGTWDSTIKFLKQDTGAPVTFVPEALQPSGT-KLNNLMEKTS  423

Query  1442  NMAVQVN----MLTDADNLREVTSKFSGSSH-SGLVFVSNKMVKKIVVEEVFGILTNDVT  1606
             ++A  VN     LT  D L++  +++  +S  SGLVFVSNK   +I+   +F  L +D++
Sbjct  424   HLASLVNCSVDTLTCLDALQQSLARYPKASQFSGLVFVSNKERSRIL--GIFKGLDSDLS  481

Query  1607  SLNEKSCSLKIQNPSPQKGTAHK-KGNGIAHETRFLLSKIILDT  1735
               + +             G  +K   +G   E RF+L K+I+DT
Sbjct  482   LYDGR---------RGMHGINYKLLDDGHTGEVRFVLGKVIMDT  516



>ref|XP_006828719.1| hypothetical protein AMTR_s00001p00028400 [Amborella trichopoda]
 gb|ERM96135.1| hypothetical protein AMTR_s00001p00028400 [Amborella trichopoda]
Length=528

 Score =   382 bits (980),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 214/504 (42%), Positives = 310/504 (62%), Gaps = 29/504 (6%)
 Frame = +2

Query  239   LMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSS  418
             L  ++++ N T+   G  L           FQ    + S W+ +D+R  G+    ++   
Sbjct  23    LFCIIKRLNHTATSTGENL----------CFQNDCFDTSTWKVVDSRTVGVNKWMVASPV  72

Query  419   WVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPI  598
             W ++ VL++KG+ +YLVGGCVRDL+L + PKDFDV+TTA LN+I++ F+   IVGRRFP+
Sbjct  73    WTIMKVLQRKGYDSYLVGGCVRDLLLGKTPKDFDVVTTAGLNKIRRTFHDCLIVGRRFPV  132

Query  599   CRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSL  778
             C V+I+GS VEVSSF+T           +S VP    GCN  D IRW++ + RDFTIN L
Sbjct  133   CHVNIQGSTVEVSSFETTDPFAQTESNLDSHVP---SGCNHKDFIRWKDCMRRDFTINGL  189

Query  779   FYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETE  958
             FYDPF   IYDYAN M D+   KLRTL PA  SF EDCARILRG R+AARL   FS ET 
Sbjct  190   FYDPFANTIYDYANGMKDLSMCKLRTLKPAHASFREDCARILRGFRIAARLNLVFSKETA  249

Query  959   TAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQAD  1138
             +AI  LS S+  L K+RL++E+NYML++GAA  SL LL K+ LLE++LP HAAYLT QA 
Sbjct  250   SAIRDLSSSIAMLSKARLLLELNYMLAFGAAEASLQLLWKFRLLEIVLPLHAAYLTHQAK  309

Query  1139  KQS-SDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMY  1315
               S  + +MLM LF++LD+L++  RP+  +LW+ LLAFHL L++ PQ  LVV T +S ++
Sbjct  310   ILSDGNPNMLMGLFANLDKLLASNRPSNTNLWIGLLAFHLALLSQPQEALVVWTFSSFLF  369

Query  1316  HRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQV----NMLTDADN  1483
             H NW + V   RQ+ +    Y+PEI +S  + ++  L+  V   A++V    + +++ D 
Sbjct  370   HGNWSKAVSIGRQNAQVGVHYLPEILESKETKTDALLSSEVSQFALKVISSIDAMSEPDA  429

Query  1484  LREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKG  1663
               E  S    S   GL  +S +M  ++ +  +F ++ +D    N ++    +Q  S    
Sbjct  430   SLETVSDLPLSPCLGLALISKRMANQVAM--IFEVVRSD---RNPRA----VQESSEIDY  480

Query  1664  TAHKKGNGIAHETRFLLSKIILDT  1735
                ++G+    + RF+L K+I++T
Sbjct  481   KLLRQGD--LEQVRFVLGKVIMET  502



>gb|EEC74451.1| hypothetical protein OsI_09859 [Oryza sativa Indica Group]
Length=558

 Score =   379 bits (972),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 225/483 (47%), Positives = 313/483 (65%), Gaps = 24/483 (5%)
 Frame = +2

Query  314   AADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLI  493
              + SN +PG ++ S+WR  D+R  GIT   I   +W VL+ LK+KGF AYLVGGCVRDL+
Sbjct  51    GSSSNRRPGFVDSSSWRYFDSRVVGITRGDIPRHAWTVLHRLKRKGFAAYLVGGCVRDLL  110

Query  494   LNRIPKDFDVITTARLNEIKKQ-FYRAEIVGRRFPICRVHIRGSVVEVSSFDTVAN--KG  664
             L R PKDFDVITTA L +IKK  F R  I+G+RFPIC+V++ G+ +EVSSF T AN  KG
Sbjct  111   LKRAPKDFDVITTASLQQIKKMVFQRCIIIGKRFPICQVNMYGTKIEVSSFSTNANHVKG  170

Query  665   DETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQ  844
                  KN       K  +E D++ W+NS+ RDFTINSLF++PF ++IYDY N + DI   
Sbjct  171   S----KNIGCSEEFKRYDEGDILLWQNSMKRDFTINSLFFNPFNFKIYDYVNGVRDISKN  226

Query  845   KLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEV  1024
             K+ T+IPA++SF+ED ARILRGLR+AARL F FS ET  AI +LS S+  +DK+RLMME+
Sbjct  227   KVSTVIPARVSFKEDPARILRGLRIAARLGFEFSSETSAAIRELSLSITDIDKARLMMEL  286

Query  1025  NYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVS  1201
             NY+LSYGAA  SL LL+KY LL+ LLPF AAY++ Q   +S+DT  MLMKL ++LD+L+S
Sbjct  287   NYLLSYGAAASSLRLLRKYGLLDFLLPFQAAYMSDQMKDKSNDTDLMLMKLLANLDKLLS  346

Query  1202  CERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYV  1381
              +RP    LW+ALL FH  LVN+P    V+   A++MY  +W+  V F  Q + A + ++
Sbjct  347   ADRPCPSCLWLALLTFHSALVNSPHDAQVIRAFAALMYFGSWEGAVNFLNQDIGAPAPFI  406

Query  1382  PEISDSDGSMSEDELAKRVENMA----VQVNMLTDADNLREVTSKFSGSSH-SGLVFVSN  1546
             PE      S  E+ L ++  ++A      V+ LT  D L++  +K+S +S  SGLV VS+
Sbjct  407   PETLGPSRSKLEN-LMEQTSHLASLVKSSVDTLTSIDALQQSLAKYSKASQVSGLVLVSS  465

Query  1547  KMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKII  1726
             +  ++++   +F  L  D+TS        +I     +        +G   E RF+L ++I
Sbjct  466   RERERVL--RIFEGLDTDLTSYEGTRGMQEIDYKLLK--------DGHPGEVRFVLGQVI  515

Query  1727  LDT  1735
             +DT
Sbjct  516   MDT  518



>ref|NP_001048863.1| Os03g0131400 [Oryza sativa Japonica Group]
 gb|ABF93816.1| polyA polymerase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10777.1| Os03g0131400 [Oryza sativa Japonica Group]
 gb|EEE58277.1| hypothetical protein OsJ_09295 [Oryza sativa Japonica Group]
Length=558

 Score =   378 bits (970),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 224/483 (46%), Positives = 314/483 (65%), Gaps = 24/483 (5%)
 Frame = +2

Query  314   AADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLI  493
              + SN +PG ++ S+WR  D+R  GIT   I   +W VL++LK+KGF AYLVGGCVRDL+
Sbjct  51    GSSSNRRPGFVDSSSWRYFDSRVVGITRGDIPRHAWTVLHMLKRKGFAAYLVGGCVRDLL  110

Query  494   LNRIPKDFDVITTARLNEIKKQ-FYRAEIVGRRFPICRVHIRGSVVEVSSFDTVAN--KG  664
             L R PKDFDVITTA L +IKK  F R  I+G+RFPIC+V++ G+ +EVSSF T AN  KG
Sbjct  111   LKRAPKDFDVITTASLQQIKKMVFQRCIIIGKRFPICQVNMYGTKIEVSSFSTNANHVKG  170

Query  665   DETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQ  844
                  KN       K  +E D++ W+NS+ RDFTINSLF++PF ++IYDY N + DI   
Sbjct  171   S----KNIGCSEEFKRYDEGDILLWQNSMKRDFTINSLFFNPFNFKIYDYVNGVRDISKN  226

Query  845   KLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEV  1024
             K+ T+IPA++SF+ED ARILRGLR+AARL F FS ET  AI +LS S+  +DK+RLMME+
Sbjct  227   KVSTVIPARVSFKEDPARILRGLRIAARLGFEFSSETSAAIRELSLSITDIDKARLMMEL  286

Query  1025  NYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVS  1201
             NY+LSYGAA  SL LL+KY LL+ LLPF AAY++ Q   +S+DT  MLMKL ++LD+L+S
Sbjct  287   NYLLSYGAAASSLRLLRKYGLLDFLLPFQAAYMSDQMKDKSNDTDLMLMKLLANLDKLLS  346

Query  1202  CERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYV  1381
              ++P    LW+ALL FH  LVN+P    V+   A++MY  +W+  V F  Q + A + ++
Sbjct  347   ADQPCPSCLWLALLTFHSALVNSPHDAQVIRAFAALMYFGSWEGAVNFLNQDIGAPAPFI  406

Query  1382  PEISDSDGSMSEDELAKRVENMA----VQVNMLTDADNLREVTSKFSGSSH-SGLVFVSN  1546
             PE      S  E+ L ++  ++A      V+ LT  D L++  +K+S +S  SGLV VS+
Sbjct  407   PETLGPSRSKLEN-LMEQTSHLASLVKSSVDTLTSIDALQQSLAKYSKASQVSGLVLVSS  465

Query  1547  KMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKII  1726
             +  ++++   +F  L  D+TS        +I     +        +G   E RF+L ++I
Sbjct  466   RERERVL--RIFEGLDTDLTSYEGTRGMQEIDYKLLK--------DGHPGEVRFVLGQVI  515

Query  1727  LDT  1735
             +DT
Sbjct  516   MDT  518



>ref|XP_006649333.1| PREDICTED: uncharacterized protein LOC102707099 isoform X1 [Oryza 
brachyantha]
Length=515

 Score =   374 bits (959),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 220/475 (46%), Positives = 303/475 (64%), Gaps = 20/475 (4%)
 Frame = +2

Query  332   QPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPK  511
             Q G ++ S+W+  D+R  GIT   I   +W VL+ LK+KGF AYLVGGCVRDL+L R+PK
Sbjct  12    QRGFVDISSWKHFDSRAIGITRGDIPRHTWAVLHKLKRKGFAAYLVGGCVRDLLLKRVPK  71

Query  512   DFDVITTARLNEIKK-QFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNS  688
             DFDVITTA L +IKK  F R  I+G+RFPIC+V++ G+ +EVSSF T  N  D    K+ 
Sbjct  72    DFDVITTASLQQIKKIVFQRCIIIGKRFPICQVNMYGTKIEVSSFST--NTNDVKGTKDI  129

Query  689   FVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPA  868
                   K C++ D++ W+NS+ RDFTIN LF++PF  +IYDY N + DI+  K+ T+IPA
Sbjct  130   SCSNELKCCDKGDILLWQNSMKRDFTINGLFFNPFNSRIYDYVNGVRDIRKNKVCTVIPA  189

Query  869   QLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGA  1048
              +SF+ED ARILRGLR+AARL F FS ET +AI +LS S+  +DK+RLMME+NY+LSYGA
Sbjct  190   SVSFDEDPARILRGLRIAARLGFEFSSETSSAIRELSSSIRLIDKARLMMEMNYLLSYGA  249

Query  1049  AVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARES  1225
             A  SL LL+KY LL +LLPF AAY + Q   +S+D   MLMKL ++LD+L+S +RP    
Sbjct  250   AESSLRLLRKYGLLNMLLPFQAAYFSDQMKDKSNDRDLMLMKLLANLDKLLSADRPCSCC  309

Query  1226  LWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDG  1405
             LW ALL FH  LVN+PQ   V+    ++MY  +W   V F  Q + A + ++PE      
Sbjct  310   LWAALLTFHSALVNSPQDAQVIRAFGALMYFGSWGSTVNFLNQDIGAPTPFIPETLGPSQ  369

Query  1406  SMSEDELAKRVENMA----VQVNMLTDADNLREVTSKFS-GSSHSGLVFVSNKMVKKIVV  1570
             S   D L ++  ++A    + V++LT  D L +   K+S  S  SGLV VS +  ++++V
Sbjct  370   S-KLDNLMEQTSHLASLVKLSVDILTSLDALEQSLDKYSEASQFSGLVLVSRRERERVLV  428

Query  1571  EEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               +F  L +D+TS        +I     +        NG   E RF+L K+I+DT
Sbjct  429   --IFEGLDSDLTSYERTRGMHEIDYRLLK--------NGDPDEVRFVLGKVIMDT  473



>tpg|DAA43182.1| TPA: hypothetical protein ZEAMMB73_451476 [Zea mays]
Length=556

 Score =   374 bits (960),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 225/518 (43%), Positives = 323/518 (62%), Gaps = 22/518 (4%)
 Frame = +2

Query  209   QFVEQLVTALLMSLLQKFNQTSAGD--GIQLESTTDRAADSNFQPGKIEFSNWRKLDARH  382
             Q + +L +     L ++++    GD  G         +A  + +PG ++ S+W+  D+R 
Sbjct  21    QLLSRLRSGASSFLARQYSTGKGGDNTGPSKPKGGGSSAPRHLRPGFVDPSSWKHFDSRA  80

Query  383   FGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQ-  559
              GI    I   +W VL  L+++GF+AYLVGGCVRDL+L R+PKDFDVITTA L ++KK  
Sbjct  81    VGIKPGAIHTDAWAVLKKLRREGFQAYLVGGCVRDLLLKRVPKDFDVITTASLEQLKKNI  140

Query  560   FYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRW  739
             F R+ IVG+RFPIC + +R SV+E+SSF TVAN G+ ++  + +V  +  G +  D++RW
Sbjct  141   FRRSRIVGKRFPICLLKMRDSVIEISSFRTVANYGNRSEVVD-YVAEL-NGSDVRDILRW  198

Query  740   RNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrl  919
             ++S+ RDFTIN LF++P   +IYDY N + D++  K+ T+IPA +SF ED ARILRG R+
Sbjct  199   KDSMRRDFTINGLFFNPMNCKIYDYVNGVRDMRKNKVCTVIPAHISFMEDPARILRGFRI  258

Query  920   aarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVL  1099
             AARL F FS ET  AI   S S+ ++DK+RLMME+NY++SYGAA PS+ LL+KY LL++L
Sbjct  259   AARLGFQFSSETSNAIRDFSSSINNIDKARLMMEMNYIMSYGAAAPSVRLLRKYGLLDIL  318

Query  1100  LPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQ  1276
             LPF +AYL++Q    SSD   MLMKL S+LD+L+S +RP   SLW+ALLAFH TLV  PQ
Sbjct  319   LPFQSAYLSEQMKGGSSDRHLMLMKLLSNLDRLLSADRPCHSSLWLALLAFHSTLVIYPQ  378

Query  1277  PKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQ  1456
               LV+   A+V+Y   W+  V+F R+ V A   + PE +        D L ++  ++A  
Sbjct  379   DTLVIRAFAAVLYFGTWETTVKFLREEVGAEVPFAPE-TMGPSRTKLDCLKEQTSHLASL  437

Query  1457  VN----MLTDADNLREVTSKFSGS-SHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEK  1621
             VN    +LT   +L +  ++FS     SG+V  SN   KK+    VF  L +D+ S + +
Sbjct  438   VNSSVDILTCPHDLEQSLARFSEPLQFSGVVVASNNDRKKL--SAVFEGLASDLHSYDGR  495

Query  1622  SCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                  I   S + G           E RF+L K+I+DT
Sbjct  496   RGMRGIDYSSLKLGD--------LAEVRFVLGKVIMDT  525



>emb|CBI38416.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   360 bits (925),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 219/255 (86%), Gaps = 2/255 (1%)
 Frame = +2

Query  353   SNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITT  532
             S W+KLD+R FGIT S IS  SWVVL +L+++GF+AYLVGGCVRDLILN+ PKDFDVITT
Sbjct  2     SKWKKLDSRTFGITRSMISSPSWVVLKLLQREGFEAYLVGGCVRDLILNKTPKDFDVITT  61

Query  533   ARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKG  712
             A+L +IKK+F RA+IVGRRFPICRVH++GSV+EVSSF+TVA  G+E K K SF  +MP G
Sbjct  62    AKLKQIKKRFRRAQIVGRRFPICRVHVKGSVIEVSSFETVAKHGEE-KEKVSF-SQMPSG  119

Query  713   CNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
             C+ESD  RWRN +HRDFTINSLF+DPFV +IYDYAN M D++S KLRTLIPAQLSF+EDC
Sbjct  120   CDESDFNRWRNCMHRDFTINSLFFDPFVNKIYDYANGMKDLRSLKLRTLIPAQLSFKEDC  179

Query  893   arilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLL  1072
             AR+LRGLR+AARL  SFS ETETAI  L+ SV SLDKSR+M+E+NYMLSYG+A PSLCLL
Sbjct  180   ARMLRGLRIAARLGLSFSRETETAIRSLASSVKSLDKSRIMLELNYMLSYGSAKPSLCLL  239

Query  1073  QKYNLLEVLLPFHAA  1117
              ++NLL++LLPFH  
Sbjct  240   WRFNLLDILLPFHVG  254



>ref|XP_004985839.1| PREDICTED: uncharacterized protein LOC101779480 [Setaria italica]
Length=549

 Score =   367 bits (943),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 217/476 (46%), Positives = 305/476 (64%), Gaps = 25/476 (5%)
 Frame = +2

Query  344   IEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDV  523
             ++ S WR  D+R FGI    I   +  VL  L+++GF+AYLVGGCVRDL+L R+PKDFDV
Sbjct  67    VDPSTWRLFDSRAFGINQDAIPKDALAVLKKLRRQGFEAYLVGGCVRDLLLKRVPKDFDV  126

Query  524   ITTARLNEIKKQ-FYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPR  700
             ITTA L ++KK  F R  IVG+RFPIC + +R SV+EVSSF TV N  ++T++ +     
Sbjct  127   ITTASLQQLKKNVFRRCMIVGKRFPICLLQMRDSVIEVSSFRTVGNHVNKTEKGDCL--E  184

Query  701   MPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSF  880
                G ++ D++RW+NS+ RDFTIN LF++P  Y+IYDY N + D++  K+ T+IPA +SF
Sbjct  185   ELNGYDDRDILRWKNSMRRDFTINGLFFNPMNYKIYDYVNGVRDMRKNKVCTVIPAHISF  244

Query  881   EEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPS  1060
              ED ARILRGLR+AARL F FS ET  AI  LS S++++DK+RLMME+NYMLSYGAA PS
Sbjct  245   MEDPARILRGLRIAARLGFQFSSETSNAIHDLSSSIINIDKARLMMEMNYMLSYGAAEPS  304

Query  1061  LCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVA  1237
             + LL  Y LL++LLPF AAYL+ Q  D+      MLMKL  +LD+L S +RP   SLW+A
Sbjct  305   VRLLGIYGLLDILLPFQAAYLSDQMKDRARYKDLMLMKLLCNLDRLFSADRPCHCSLWLA  364

Query  1238  LLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVK-----AASLYVPEISDSD  1402
             LL FH TLV +PQ  LV+   A+++Y  +W+  +EF ++  +     A   +VPE +   
Sbjct  365   LLVFHTTLVISPQDTLVIKAFAALLYFGSWESAIEFLKEEEEEEEDGAQVSFVPE-TLGP  423

Query  1403  GSMSEDELAKRVENMAVQVN----MLTDADNLREVTSKFSGSSH-SGLVFVSNKMVKKIV  1567
                  D+L ++  ++A  VN     LT +D L +  ++FS     SG+V  SN    +++
Sbjct  424   SQTKLDDLMEQTSHLASLVNASVLTLTSSDALEQSLARFSEPPQFSGVVLASNNDRNRLL  483

Query  1568  VEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               ++FG L + +TS +E+    KI   S + G           E RF+L K+I+DT
Sbjct  484   --KIFGALNSGLTSYDERRWLHKIDYWSLKDGN--------PAEVRFVLGKVIMDT  529



>ref|XP_006649334.1| PREDICTED: uncharacterized protein LOC102707099 isoform X2 [Oryza 
brachyantha]
Length=512

 Score =   363 bits (933),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 218/475 (46%), Positives = 301/475 (63%), Gaps = 23/475 (5%)
 Frame = +2

Query  332   QPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPK  511
             Q G ++ S+W+  D+R  GIT   I   +W VL+ LK+K   AYLVGGCVRDL+L R+PK
Sbjct  12    QRGFVDISSWKHFDSRAIGITRGDIPRHTWAVLHKLKRK---AYLVGGCVRDLLLKRVPK  68

Query  512   DFDVITTARLNEIKK-QFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNS  688
             DFDVITTA L +IKK  F R  I+G+RFPIC+V++ G+ +EVSSF T  N  D    K+ 
Sbjct  69    DFDVITTASLQQIKKIVFQRCIIIGKRFPICQVNMYGTKIEVSSFST--NTNDVKGTKDI  126

Query  689   FVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPA  868
                   K C++ D++ W+NS+ RDFTIN LF++PF  +IYDY N + DI+  K+ T+IPA
Sbjct  127   SCSNELKCCDKGDILLWQNSMKRDFTINGLFFNPFNSRIYDYVNGVRDIRKNKVCTVIPA  186

Query  869   QLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGA  1048
              +SF+ED ARILRGLR+AARL F FS ET +AI +LS S+  +DK+RLMME+NY+LSYGA
Sbjct  187   SVSFDEDPARILRGLRIAARLGFEFSSETSSAIRELSSSIRLIDKARLMMEMNYLLSYGA  246

Query  1049  AVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARES  1225
             A  SL LL+KY LL +LLPF AAY + Q   +S+D   MLMKL ++LD+L+S +RP    
Sbjct  247   AESSLRLLRKYGLLNMLLPFQAAYFSDQMKDKSNDRDLMLMKLLANLDKLLSADRPCSCC  306

Query  1226  LWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDG  1405
             LW ALL FH  LVN+PQ   V+    ++MY  +W   V F  Q + A + ++PE      
Sbjct  307   LWAALLTFHSALVNSPQDAQVIRAFGALMYFGSWGSTVNFLNQDIGAPTPFIPETLGPSQ  366

Query  1406  SMSEDELAKRVENMA----VQVNMLTDADNLREVTSKFS-GSSHSGLVFVSNKMVKKIVV  1570
             S   D L ++  ++A    + V++LT  D L +   K+S  S  SGLV VS +  ++++V
Sbjct  367   S-KLDNLMEQTSHLASLVKLSVDILTSLDALEQSLDKYSEASQFSGLVLVSRRERERVLV  425

Query  1571  EEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               +F  L +D+TS        +I     +        NG   E RF+L K+I+DT
Sbjct  426   --IFEGLDSDLTSYERTRGMHEIDYRLLK--------NGDPDEVRFVLGKVIMDT  470



>tpg|DAA43183.1| TPA: hypothetical protein ZEAMMB73_451476 [Zea mays]
Length=477

 Score =   357 bits (917),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 202/442 (46%), Positives = 290/442 (66%), Gaps = 11/442 (2%)
 Frame = +2

Query  209   QFVEQLVTALLMSLLQKFNQTSAGD--GIQLESTTDRAADSNFQPGKIEFSNWRKLDARH  382
             Q + +L +     L ++++    GD  G         +A  + +PG ++ S+W+  D+R 
Sbjct  21    QLLSRLRSGASSFLARQYSTGKGGDNTGPSKPKGGGSSAPRHLRPGFVDPSSWKHFDSRA  80

Query  383   FGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQ-  559
              GI    I   +W VL  L+++GF+AYLVGGCVRDL+L R+PKDFDVITTA L ++KK  
Sbjct  81    VGIKPGAIHTDAWAVLKKLRREGFQAYLVGGCVRDLLLKRVPKDFDVITTASLEQLKKNI  140

Query  560   FYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRW  739
             F R+ IVG+RFPIC + +R SV+E+SSF TVAN G+ ++  + +V  +  G +  D++RW
Sbjct  141   FRRSRIVGKRFPICLLKMRDSVIEISSFRTVANYGNRSEVVD-YVAEL-NGSDVRDILRW  198

Query  740   RNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrl  919
             ++S+ RDFTIN LF++P   +IYDY N + D++  K+ T+IPA +SF ED ARILRG R+
Sbjct  199   KDSMRRDFTINGLFFNPMNCKIYDYVNGVRDMRKNKVCTVIPAHISFMEDPARILRGFRI  258

Query  920   aarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVL  1099
             AARL F FS ET  AI   S S+ ++DK+RLMME+NY++SYGAA PS+ LL+KY LL++L
Sbjct  259   AARLGFQFSSETSNAIRDFSSSINNIDKARLMMEMNYIMSYGAAAPSVRLLRKYGLLDIL  318

Query  1100  LPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQ  1276
             LPF +AYL++Q    SSD   MLMKL S+LD+L+S +RP   SLW+ALLAFH TLV  PQ
Sbjct  319   LPFQSAYLSEQMKGGSSDRHLMLMKLLSNLDRLLSADRPCHSSLWLALLAFHSTLVIYPQ  378

Query  1277  PKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQ  1456
               LV+   A+V+Y   W+  V+F R+ V A   + PE +        D L ++  ++A  
Sbjct  379   DTLVIRAFAAVLYFGTWETTVKFLREEVGAEVPFAPE-TMGPSRTKLDCLKEQTSHLASL  437

Query  1457  VN----MLTDADNLREVTSKFS  1510
             VN    +LT   +L +  ++FS
Sbjct  438   VNSSVDILTCPHDLEQSLARFS  459



>gb|KDP43752.1| hypothetical protein JCGZ_22379 [Jatropha curcas]
Length=654

 Score =   360 bits (925),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 206/505 (41%), Positives = 283/505 (56%), Gaps = 101/505 (20%)
 Frame = +2

Query  344   IEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDV  523
             I+FS W+K++A+  G+T S+I PS W+VL +L  KGF+AYLVGGCVRDL+LNRIPKDFDV
Sbjct  14    IDFSKWKKINAKSVGVTRSKIPPSPWIVLKILHDKGFEAYLVGGCVRDLLLNRIPKDFDV  73

Query  524   ITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRM  703
             ITTA+L ++KKQF R EIVGRRFPIC VHI+GSVVEVSSF+TVA   +E  ++   + +M
Sbjct  74    ITTAKLKQVKKQFRRCEIVGRRFPICMVHIKGSVVEVSSFETVAKHAEE--KEKFLLSQM  131

Query  704   PKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTL-IPAQLSF  880
             P  C+E D IRWRN                               ++ LR L I  +L  
Sbjct  132   PSSCDEKDFIRWRN-------------------------------TRILRGLRIAGRLG-  159

Query  881   EEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPS  1060
                                S S ET  AI +LS S+ +L+K R+MME+NYMLSYGAA  +
Sbjct  160   ------------------LSISRETTLAIRELSSSLKNLNKGRIMMELNYMLSYGAAETT  201

Query  1061  LCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVAL  1240
             +CLL+++NLLE+  PFHAAY  QQA ++S    MLMKLF +LD++V C+RP   +LWV L
Sbjct  202   ICLLRRFNLLELFFPFHAAYFNQQAAEKSQSPMMLMKLFFNLDKVVGCDRPCDYTLWVGL  261

Query  1241  LAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSED  1420
             LAFH  LV++PQ  LV+   ASV+YH +WK+GV+FAR+  K    + PE+S      S++
Sbjct  262   LAFHQALVSDPQDALVIWVFASVLYHGSWKEGVKFAREGAKPQYKFAPEMSGFSEFKSDE  321

Query  1421  ELAKRVEN------MAVQVNMLTDADNLREV----TSKFSGSSHSGLVFV----------  1540
             ELAK V N      +A    +++D  +   +    +  + GS   G+ F           
Sbjct  322   ELAKEVINQSGVGLLAFHQALVSDPQDALVIWVFASVLYHGSWKEGVKFAREGAKPQYKF  381

Query  1541  ------------SNKMVKKIV--------VEEVFGILTNDVTSLNEKSCSLKIQNPSPQK  1660
                           ++ K++         V ++F  L +DV S      S  I       
Sbjct  382   APEMSGFSEFKSDEELAKEVFVSRNAGSYVSQLFDELVDDVESFERGRKSFMID------  435

Query  1661  GTAHKKGNGIAHETRFLLSKIILDT  1735
                +  G G  HETR +L ++IL+T
Sbjct  436   --YYLLGKGNLHETRCVLGQVILET  458



>ref|XP_010249182.1| PREDICTED: uncharacterized protein LOC104591829 [Nelumbo nucifera]
Length=523

 Score =   356 bits (913),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 204/476 (43%), Positives = 291/476 (61%), Gaps = 39/476 (8%)
 Frame = +2

Query  356   NWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTA  535
              W+ L+++  GIT S I+  + VVLN L++KG++ YLVGGCVRDLIL R PKDFD+IT+A
Sbjct  58    GWKTLNSKDLGITTSMIAKPTRVVLNGLRRKGYEVYLVGGCVRDLILQRTPKDFDIITSA  117

Query  536   RLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
              L E+ + F R EIVGRRFPIC VHI  ++VEVSSF T    G +  R  S+  + P GC
Sbjct  118   ELREVMRTFSRCEIVGRRFPICHVHIDDTIVEVSSFST---SGRKCNRDFSYFFKRPPGC  174

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
             +E D +RWRN L RDFTIN L +DP+   +YDY   M D+K  K+RT+IPA  SF+EDCA
Sbjct  175   DEHDFVRWRNCLQRDFTINGLMFDPYANIVYDYMGGMEDLKKAKVRTIIPATNSFQEDCA  234

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR +R+AARL F F+ ET  ++  LS SV+ LDK R++ME+NYML++G+A  S  LL 
Sbjct  235   RILRAVRIAARLGFRFTRETAHSVKDLSSSVLKLDKGRILMEMNYMLAFGSAEASFRLLW  294

Query  1076  KYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             K+ LLE+LLP  AAY   Q   ++   T+ML+ LFS+LD+L++ +RP   SLWV +LAFH
Sbjct  295   KFGLLEILLPIQAAYFVSQGFRRRDKRTNMLLSLFSNLDRLLAPDRPCHSSLWVVILAFH  354

Query  1253  LTLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELA  1429
               LV+ P+  LVV T A +V    +  + V  AR+  +   L   E+S+   S+S++ L 
Sbjct  355   KALVDQPRDPLVVATFALAVHSGGDLLEAVNIARRISQPHDLSFFELSEPQTSISDEALM  414

Query  1430  KRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTN  1597
               V ++A  V    +M+TD   + +  +++  + +S LVF+                   
Sbjct  415   DAVVDLAASVKAALSMMTDESFVSQAMAEYPQAPYSDLVFIP------------------  456

Query  1598  DVTSLNEKSCSL-KIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
                +L  K+C + +      +KG A K+G  I +         E R LL++++ DT
Sbjct  457   --LALYLKACRIFECIRVGKEKGFAPKRGRKINYEDLALGSLQEVRHLLARVVFDT  510



>ref|XP_002266814.1| PREDICTED: uncharacterized protein LOC100259104 isoform X1 [Vitis 
vinifera]
 emb|CBI35659.3| unnamed protein product [Vitis vinifera]
Length=537

 Score =   343 bits (881),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 203/475 (43%), Positives = 289/475 (61%), Gaps = 39/475 (8%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+++  GI  S I+  +  VLN LKKKG++ YLVGGCVRDLIL R PKDFD+IT+A 
Sbjct  69    WKKLNSKDLGIRTSMIAKPTRYVLNGLKKKGYEVYLVGGCVRDLILKRTPKDFDIITSAE  128

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F R E+VG+RFPIC VH+  ++VEVSSF T    G  T RK  ++ R P  C+
Sbjct  129   LKEVLRAFPRCEVVGKRFPICHVHVNDTIVEVSSFST---SGKRTGRKLDYILRRPPDCD  185

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D IRWRN L RDFTIN L +DP+   +YDY   M DIK  K+RT+IPA +SF EDCAR
Sbjct  186   DHDYIRWRNCLQRDFTINGLMFDPYTKIVYDYMGGMQDIKKAKVRTVIPANISFVEDCAR  245

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRG+R+AARL F F+ +   ++ +LS SV+ LDK R++ME+NYML+YG+A  SL LL K
Sbjct  246   ILRGVRIAARLGFRFTKDIAHSVRELSCSVLRLDKGRILMEMNYMLAYGSAEASLRLLWK  305

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  AAYL  Q  ++    S ML+ LFS+LD+LV+ +RP   SLW+ +LAFH 
Sbjct  306   FGLLEILLPIQAAYLVSQGFRRRDQRSNMLLSLFSNLDRLVAPDRPCHNSLWIGMLAFHK  365

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQ----HVKAAS-LYVPEISDSDGSMSE  1417
              LV+ P+  +VV   +  +++  +  + VE AR+    H ++ S L  P+  DSD S+  
Sbjct  366   ALVDQPRHPMVVAAFSLAVHNGGSLSEAVEIARRISQPHDQSFSELLEPQDLDSDESLI-  424

Query  1418  DELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTN  1597
             DE+     ++   +  +TD   + +  SK+  + +S LVF+S                  
Sbjct  425   DEIMDLAASVKSALMKMTDEHFVSQAMSKYPRAPYSDLVFIS------------------  466

Query  1598  DVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
              + S    S   +      +KG   K+G+ I +         E R + ++I+ DT
Sbjct  467   -LASFLRASKIFQCVQGGAEKGFVPKQGSRIDYEFLALGSLREVRHVFARIVFDT  520



>ref|XP_006649335.1| PREDICTED: uncharacterized protein LOC102707099 isoform X3 [Oryza 
brachyantha]
 ref|XP_006649336.1| PREDICTED: uncharacterized protein LOC102707099 isoform X4 [Oryza 
brachyantha]
Length=470

 Score =   340 bits (872),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 204/436 (47%), Positives = 278/436 (64%), Gaps = 20/436 (5%)
 Frame = +2

Query  449   GFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKK-QFYRAEIVGRRFPICRVHIRGSV  625
             GF AYLVGGCVRDL+L R+PKDFDVITTA L +IKK  F R  I+G+RFPIC+V++ G+ 
Sbjct  6     GFAAYLVGGCVRDLLLKRVPKDFDVITTASLQQIKKIVFQRCIIIGKRFPICQVNMYGTK  65

Query  626   VEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQI  805
             +EVSSF T  N  D    K+       K C++ D++ W+NS+ RDFTIN LF++PF  +I
Sbjct  66    IEVSSFST--NTNDVKGTKDISCSNELKCCDKGDILLWQNSMKRDFTINGLFFNPFNSRI  123

Query  806   YDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPS  985
             YDY N + DI+  K+ T+IPA +SF+ED ARILRGLR+AARL F FS ET +AI +LS S
Sbjct  124   YDYVNGVRDIRKNKVCTVIPASVSFDEDPARILRGLRIAARLGFEFSSETSSAIRELSSS  183

Query  986   VMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-M  1162
             +  +DK+RLMME+NY+LSYGAA  SL LL+KY LL +LLPF AAY + Q   +S+D   M
Sbjct  184   IRLIDKARLMMEMNYLLSYGAAESSLRLLRKYGLLNMLLPFQAAYFSDQMKDKSNDRDLM  243

Query  1163  LMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVE  1342
             LMKL ++LD+L+S +RP    LW ALL FH  LVN+PQ   V+    ++MY  +W   V 
Sbjct  244   LMKLLANLDKLLSADRPCSCCLWAALLTFHSALVNSPQDAQVIRAFGALMYFGSWGSTVN  303

Query  1343  FARQHVKAASLYVPEISDSDGSMSEDELAKRVENMA----VQVNMLTDADNLREVTSKFS  1510
             F  Q + A + ++PE      S   D L ++  ++A    + V++LT  D L +   K+S
Sbjct  304   FLNQDIGAPTPFIPETLGPSQS-KLDNLMEQTSHLASLVKLSVDILTSLDALEQSLDKYS  362

Query  1511  -GSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNG  1687
               S  SGLV VS +  ++++V  +F  L +D+TS        +I              NG
Sbjct  363   EASQFSGLVLVSRRERERVLV--IFEGLDSDLTSYERTRGMHEID--------YRLLKNG  412

Query  1688  IAHETRFLLSKIILDT  1735
                E RF+L K+I+DT
Sbjct  413   DPDEVRFVLGKVIMDT  428



>ref|XP_002890760.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67019.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=534

 Score =   341 bits (874),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 207/478 (43%), Positives = 295/478 (62%), Gaps = 42/478 (9%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KLDA  FGI  S I  S+ +VLN LKKKGF+ YLVGGCVRDLIL+RIPKDFDVITTA 
Sbjct  75    WKKLDADEFGIQRSMIPDSTRMVLNKLKKKGFQVYLVGGCVRDLILDRIPKDFDVITTAE  134

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F R +IVGRRFPIC V++   ++EVSSF T A  G +   KN    R P GC+
Sbjct  135   LKEVRKVFPRCQIVGRRFPICHVYVDDIIIEVSSFSTSARTG-KAPSKNL---RKPAGCD  190

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW+N L RDFT+N L +D     +YDY   + DI++ K+RT+  A+LSF ED AR
Sbjct  191   ERDYIRWKNCLQRDFTVNGLMFDLSENVVYDYIGGVEDIRNSKVRTVSAAKLSFVEDTAR  250

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + +   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  251   ILRAIRIAARLGFSLTKDVAISVKELSSSLLRLDPSRIRMEINYMLAYGSAEASLRLLWR  310

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + L+E+LLP  A+YL  Q   ++   ++ML+ LF +LD+LV+ +RP  E LW+ +LAFH 
Sbjct  311   FGLMEILLPIQASYLVSQGFRRRDGRSNMLLSLFRNLDRLVAPDRPCNEFLWIGILAFHK  370

Query  1256  TLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEIS--DSDGSMSEDEL  1426
              LV+ P+   VV +    +Y   +  + +  AR + K  + +  E+S  + D + SE +L
Sbjct  371   ALVDQPRDPTVVASFCLAIYSEVSLSEAIAIARSNSKQHNSHFQELSGHEKDSADSESKL  430

Query  1427  AKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGIL-  1591
             +++V  +A  +      L D D +    SK+  +  S +VF+S  M+++  VE++FG + 
Sbjct  431   SQQVIKLAESIRSAARKLNDRDYIANAMSKYPQAPGSDMVFLSRPMLER--VEKMFGSVR  488

Query  1592  ------TNDVTSL----NEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                   T DV SL    N KS +L                 G  HETR + ++I+ DT
Sbjct  489   RKRNQETEDVPSLERRINYKSLAL-----------------GDFHETRRVFARIVFDT  529



>ref|XP_008352413.1| PREDICTED: CCA tRNA nucleotidyltransferase 1, mitochondrial-like 
[Malus domestica]
Length=340

 Score =   334 bits (857),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 184/304 (61%), Positives = 233/304 (77%), Gaps = 4/304 (1%)
 Frame = +2

Query  263   NQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLK  442
             N  S G G+Q +       DS    G I+ S W+K++AR  GI  S IS  SW+VL +L+
Sbjct  28    NAFSEG-GLQAQVHPKMVPDSVPDQGFIDMSKWKKVNARVLGIKRSMISQPSWIVLKLLQ  86

Query  443   KKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGS  622
              +GF+AYLVGGCVRDLIL R+PKDFDVITTA L EIKK+F+RA+IVG+RFPICRVH++G 
Sbjct  87    AEGFEAYLVGGCVRDLILKRVPKDFDVITTANLKEIKKKFHRADIVGQRFPICRVHVKGX  146

Query  623   VVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQ  802
             V+EVSSF+TVA    E K K++   R P GC++ D +RW+NS+HRDFTIN LF+DPF  +
Sbjct  147   VIEVSSFETVARDAGENKDKDNLSCR-PPGCDKKDFVRWKNSMHRDFTINCLFFDPFANK  205

Query  803   IYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSP  982
             IYDYAN MAD++  KLRTL PA+ SFEEDCARILRGLR+AARL  S S ETETA+ KLS 
Sbjct  206   IYDYANGMADLRHLKLRTLGPAKXSFEEDCARILRGLRIAARLSLSISKETETAMHKLSS  265

Query  983   SVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQAD--KQSSDT  1156
             S++SL KSR+MME++YMLSYGAA  SLCLL +++L+ VL PFHAAY  QQ++  K++  +
Sbjct  266   SILSLSKSRIMMEMDYMLSYGAAEASLCLLWRFDLIRVLFPFHAAYFDQQSENLKEAQSS  325

Query  1157  SMLM  1168
             +MLM
Sbjct  326   TMLM  329



>ref|XP_002304649.1| polynucleotide adenylyltransferase family protein [Populus trichocarpa]
 gb|EEE79628.1| polynucleotide adenylyltransferase family protein [Populus trichocarpa]
Length=525

 Score =   340 bits (873),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 200/473 (42%), Positives = 280/473 (59%), Gaps = 20/473 (4%)
 Frame = +2

Query  338   GKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDF  517
             G+ +   W+KLDA   GI+ S IS  + VVLN LKKKG++ YLVGGCVRDLIL RIPKDF
Sbjct  49    GERKAPEWKKLDAEELGISNSIISRPTRVVLNGLKKKGYEVYLVGGCVRDLILKRIPKDF  108

Query  518   DVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVP  697
             DVIT+A L +++K F+R EIVG+RFPIC VH+  ++VEVSSF T   K D     N    
Sbjct  109   DVITSAELKQVRKAFHRCEIVGKRFPICHVHVDDAIVEVSSFSTSQLKSDGKFNGNV---  165

Query  698   RMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLS  877
             R P+GC+E D IRWRN L RDFTIN L  DP+   +YDY   + DIK  K+RT+IPA LS
Sbjct  166   RKPRGCSERDFIRWRNCLQRDFTINGLMLDPYANIVYDYMGGITDIKKTKVRTVIPANLS  225

Query  878   FEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVP  1057
             F ED  RILR +R+AARL F F+ +   ++ +LS SV+ LDK R+++E+NYM +YG+A  
Sbjct  226   FVEDSGRILRAIRIAARLHFGFTRDLALSLKELSHSVLRLDKGRILLELNYMFAYGSAEA  285

Query  1058  SLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWV  1234
             SL L+ ++ LLE+LLP  A+Y   Q  ++  + S ML+ LFS+LD+LV+ +RP   SLW+
Sbjct  286   SLRLMWRFGLLEILLPIQASYFVSQGFRRRDERSNMLLSLFSNLDRLVAPDRPCHSSLWL  345

Query  1235  ALLAFHLTLVNNPQPKLVVLTLASVMYHRNWK--QGVEFARQHVKAASLYVPEISDSDGS  1408
              + AFH  LV+ PQ  LVV T  S+  H      + VE AR+  +      PE+ ++   
Sbjct  346   GIFAFHKALVDQPQDPLVV-TAFSLAVHSGGSLLESVEIARRISQPYQSSFPELLEAQNP  404

Query  1409  MSEDELAKRVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEE  1576
              S + L  +  N A  V      +TD   + +  +K+  +  S LVF+   M   + V +
Sbjct  405   DSNNALVHKTINFAALVKTALCNMTDGCYVSKAMAKYPKAPSSDLVFIP--MALFLRVSK  462

Query  1577  VFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             +F         +  +    +      +K        G   E R + ++I+ DT
Sbjct  463   IF-------ECVRRRGMETRFVRRQGRKIDYESLAMGSLEEVRHVFARIVFDT  508



>ref|XP_010682660.1| PREDICTED: uncharacterized protein LOC104897475 [Beta vulgaris 
subsp. vulgaris]
Length=539

 Score =   341 bits (874),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 196/472 (42%), Positives = 285/472 (60%), Gaps = 33/472 (7%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL ++  GIT S I   +  VL  L+KKG++ YLVGGCVRDLIL RIPKDFD+IT+A 
Sbjct  79    WKKLSSKELGITTSMIDKPTRFVLKTLRKKGYQVYLVGGCVRDLILQRIPKDFDIITSAE  138

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L EI + F R EIVGRRFPIC VH+   V+EVSSF TVA K   + R  + + + P+GC+
Sbjct  139   LKEIVRTFPRCEIVGRRFPICHVHVADLVIEVSSFSTVARK---SGRNFNNLFKKPRGCD  195

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
               D +RW+N + RDFTIN L +DP+   +YDY   + DIK  ++RT+ PA  SF EDCAR
Sbjct  196   ADDYMRWKNCVQRDFTINGLMFDPYSKIVYDYTGGIEDIKRSRMRTVTPAFSSFTEDCAR  255

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR  R+AARL+F F+ E   ++ +LS SV+ LDK R++ME+NYML+YG+A  SL LL K
Sbjct  256   ILRACRIAARLEFKFTKEMALSLKELSFSVLRLDKGRILMEMNYMLAYGSAEASLRLLWK  315

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             Y LLE+LLP  AAY   Q   ++   +++L+ LFS+LD+L++ +RP   SLW++LLAFH 
Sbjct  316   YGLLEILLPLQAAYFVSQGFRRRDKRSNLLLCLFSNLDKLLAPDRPCHSSLWISLLAFHK  375

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              L + P+  LV+      +++  +  + V  A+   +       E+ +  G   +D+L  
Sbjct  376   ALADQPRHPLVIAAFCLAVHNGGSLSEAVSIAKSITRPYDSSFHELLEHQGQNMDDDLVN  435

Query  1433  RVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVS-------NKMVKKIVVEEV  1579
              V+++A  V      LTD   + +  +K+  +  S LVF+S       +K++  +V    
Sbjct  436   DVKDLAASVKTALCQLTDVTIVSQAMAKYPQAPISDLVFISLALQLRTDKIISCVVKGRE  495

Query  1580  FGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              G +    T +N +S ++                 G  HE R++LS+II DT
Sbjct  496   KGFVPKHGTRINYESLAI-----------------GNLHEVRYILSRIIFDT  530



>ref|NP_001077613.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
thaliana]
 gb|AEE30912.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
thaliana]
Length=478

 Score =   338 bits (867),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 199/468 (43%), Positives = 293/468 (63%), Gaps = 22/468 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KLDA  FGI  S I  S+ +VLN LKKKGF+ YLVGGCVRDLIL+RIPKDFDVITTA 
Sbjct  19    WKKLDANEFGIQRSMIPDSTRMVLNKLKKKGFQVYLVGGCVRDLILDRIPKDFDVITTAE  78

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   +IVGRRFPIC V++   ++EVSSF T A  G    +  SF  R P GC+
Sbjct  79    LKEVRKVFPGCQIVGRRFPICHVYVDDIIIEVSSFSTSARTGKAPNK--SF--RRPAGCD  134

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW+N L RDFT+N L +DP    +YDY   + D+++ K+RT+  A LSF ED AR
Sbjct  135   ERDYIRWKNCLQRDFTVNGLMFDPSENVVYDYIGGVEDLRNSKVRTVSAANLSFVEDTAR  194

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + +   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  195   ILRAIRIAARLGFSLTKDVAISVKELSSSLLRLDPSRIRMEINYMLAYGSAEASLRLLWR  254

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + L+E+LLP  A+YL  Q   ++   ++ML+ LF +LD+LV+ +RP  E LW+ +LAFH 
Sbjct  255   FGLMEILLPIQASYLVSQGFRRRDGRSNMLLSLFRNLDRLVAPDRPCSEFLWIGILAFHK  314

Query  1256  TLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEIS--DSDGSMSEDEL  1426
              LV+ P+   VV +    +Y   +  + +  AR + K  + +  E+S  + D + SE ++
Sbjct  315   ALVDQPRDPTVVASFCLAIYSEVSLSEAIAIARSNSKQHNSHFQELSSPEKDTADSESKI  374

Query  1427  AKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILT  1594
             +++V  +A  +      L + D +    SK+  +  S +VF+S  M+++  VE++FG   
Sbjct  375   SQQVIKLAESIRSAARKLNNRDYIANAMSKYPQAPGSDMVFLSRLMLER--VEKMFG---  429

Query  1595  NDVTSLNEKSCSLKIQNPSPQKGTAHKK-GNGIAHETRFLLSKIILDT  1735
                 ++  K    +   PS ++   +K    G  HETR + ++I+ DT
Sbjct  430   ----NVRRKGNQERDDVPSLERRINYKSLALGDFHETRRVFARIVFDT  473



>ref|NP_973924.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
thaliana]
 gb|ACF37205.1| At1g28090 [Arabidopsis thaliana]
 dbj|BAH20023.1| AT1G28090 [Arabidopsis thaliana]
 gb|AEE30911.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
thaliana]
Length=505

 Score =   338 bits (866),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 199/468 (43%), Positives = 293/468 (63%), Gaps = 22/468 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KLDA  FGI  S I  S+ +VLN LKKKGF+ YLVGGCVRDLIL+RIPKDFDVITTA 
Sbjct  46    WKKLDANEFGIQRSMIPDSTRMVLNKLKKKGFQVYLVGGCVRDLILDRIPKDFDVITTAE  105

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   +IVGRRFPIC V++   ++EVSSF T A  G    +  SF  R P GC+
Sbjct  106   LKEVRKVFPGCQIVGRRFPICHVYVDDIIIEVSSFSTSARTGKAPNK--SF--RRPAGCD  161

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW+N L RDFT+N L +DP    +YDY   + D+++ K+RT+  A LSF ED AR
Sbjct  162   ERDYIRWKNCLQRDFTVNGLMFDPSENVVYDYIGGVEDLRNSKVRTVSAANLSFVEDTAR  221

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + +   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  222   ILRAIRIAARLGFSLTKDVAISVKELSSSLLRLDPSRIRMEINYMLAYGSAEASLRLLWR  281

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + L+E+LLP  A+YL  Q   ++   ++ML+ LF +LD+LV+ +RP  E LW+ +LAFH 
Sbjct  282   FGLMEILLPIQASYLVSQGFRRRDGRSNMLLSLFRNLDRLVAPDRPCSEFLWIGILAFHK  341

Query  1256  TLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEIS--DSDGSMSEDEL  1426
              LV+ P+   VV +    +Y   +  + +  AR + K  + +  E+S  + D + SE ++
Sbjct  342   ALVDQPRDPTVVASFCLAIYSEVSLSEAIAIARSNSKQHNSHFQELSSPEKDTADSESKI  401

Query  1427  AKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILT  1594
             +++V  +A  +      L + D +    SK+  +  S +VF+S  M+++  VE++FG   
Sbjct  402   SQQVIKLAESIRSAARKLNNRDYIANAMSKYPQAPGSDMVFLSRLMLER--VEKMFG---  456

Query  1595  NDVTSLNEKSCSLKIQNPSPQKGTAHKK-GNGIAHETRFLLSKIILDT  1735
                 ++  K    +   PS ++   +K    G  HETR + ++I+ DT
Sbjct  457   ----NVRRKGNQERDDVPSLERRINYKSLALGDFHETRRVFARIVFDT  500



>ref|XP_010478164.1| PREDICTED: uncharacterized protein LOC104757145 [Camelina sativa]
Length=542

 Score =   339 bits (869),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 198/469 (42%), Positives = 293/469 (62%), Gaps = 24/469 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+DA  FGI  S I  S+ +VLN LKKKGF+ YLVGGCVRDLIL+RIPKDFDVITTA 
Sbjct  83    WKKMDANEFGIQRSMIPDSTRMVLNKLKKKGFQVYLVGGCVRDLILDRIPKDFDVITTAE  142

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   +IVGRRFPIC V++   ++EVSSF T A  G +   KN    R P GCN
Sbjct  143   LKEVRKVFPSCQIVGRRFPICHVYVDDIIIEVSSFSTSARTG-KAPNKNL---RKPAGCN  198

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW+N L RDFT+N L +DP    +YDY   + D+++ K+RT+  A+LSF ED AR
Sbjct  199   ERDYIRWKNCLQRDFTVNGLMFDPSENVVYDYIGGVEDLRNSKVRTVSAAKLSFVEDTAR  258

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + +   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  259   ILRAIRIAARLGFSLTKDVAISVKELSSSLLRLDPSRIRMEINYMLAYGSAEASLRLLWR  318

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + L+E+LLP  A+YL  Q   ++   ++ML+ LF +LD+LV+ +RP  E LW+ +LAFH 
Sbjct  319   FGLMEILLPIQASYLVSQGFRRRDGRSNMLLSLFRNLDRLVAPDRPCHEFLWIGILAFHK  378

Query  1256  TLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEIS-------DSDGSM  1411
              LV+ P+   VV +    +Y   +  + ++ AR + K+ +    E+S       DSD  +
Sbjct  379   ALVDKPRDPTVVASFCLAIYSELSLAEAIKIARSNSKSHNSNFQELSGHEKDIVDSDSKL  438

Query  1412  SEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGIL  1591
             ++ ++ K  E++      L D D +    S++  +  S +VF+S  ++++  VE++FG  
Sbjct  439   AQ-QVVKLAESIRSAARKLNDRDYIANAMSQYPQAPDSDMVFMSRPVLER--VEKMFG--  493

Query  1592  TNDVTSLNEKSCSLKIQNPSPQKGTAHKK-GNGIAHETRFLLSKIILDT  1735
                  ++  K    +   PS ++   +K    G  HETR + ++I+ DT
Sbjct  494   -----NVRRKGSQERDGVPSLERRIDYKSLALGDFHETRRVFARIVFDT  537



>ref|XP_006844503.1| hypothetical protein AMTR_s00016p00133200 [Amborella trichopoda]
 gb|ERN06178.1| hypothetical protein AMTR_s00016p00133200 [Amborella trichopoda]
Length=518

 Score =   337 bits (865),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 204/493 (41%), Positives = 292/493 (59%), Gaps = 36/493 (7%)
 Frame = +2

Query  299   STTDRAADSNFQPGKIEFS--NWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVG  472
             S  +   D+N   GK ++   NW+KL ++  GIT S IS  + VVLN L+K+G++ YLVG
Sbjct  42    SIKEECQDAN---GKADWGGPNWKKLSSKELGITTSMISEPTRVVLNGLRKRGYEVYLVG  98

Query  473   GCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTV  652
             GCVRDLIL R PKDFD+IT+A L E+ + F R +IVGRRFPIC VH+   +VEVSSF+T 
Sbjct  99    GCVRDLILKRTPKDFDIITSADLKEVMRTFSRCQIVGRRFPICHVHVDDYIVEVSSFNTS  158

Query  653   ANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMAD  832
                     R   ++ R P G N+ D  RW+N +HRDFTIN L +DP+   IYDY  +M D
Sbjct  159   ER---NLSRDLRYIIRKPPGQNDRDYARWKNCMHRDFTINGLMFDPYAKLIYDYMGSMED  215

Query  833   IKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRL  1012
             I+  K+RT+IPA  SF+EDCARILR +R+AARL F F+ ET  ++   S S++ LDKSRL
Sbjct  216   IRKAKVRTVIPAHNSFQEDCARILRAVRIAARLGFRFTKETAHSVKDFSSSILRLDKSRL  275

Query  1013  MMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA----DKQSSDTSMLMKLFS  1180
             +ME+NYML++G+A  SL +L K+ LLE+LLP  AAY   Q     DK+S   +ML+ LFS
Sbjct  276   LMEMNYMLAFGSAEASLRVLWKFGLLEILLPLQAAYFVSQGFLRRDKRS---NMLLTLFS  332

Query  1181  SLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQH  1357
             +LD+L++  RP   SLWV +LAFHL LV+ PQ  LVV T    +++  +  + +  AR  
Sbjct  333   NLDKLLAPNRPCHSSLWVGILAFHLALVDEPQDPLVVATFTLAVHNGGHLAEAISLARHI  392

Query  1358  VKAASLYVPEISDSDGSMSEDELAKRVENMA----VQVNMLTDADNLREVTSKFSGSSHS  1525
              +  +   PE+ +     ++  L   V ++A      ++M+TD   + +  +K+  +  S
Sbjct  393   DQPHNSIFPELLEPKKFDTDTALIDEVLDLASLVKAALSMMTDEYIVSQAMAKYPQAPFS  452

Query  1526  GLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTA---HKKGNGIAH  1696
              LVF+  ++  K             V+ L E     K +   P++G          G   
Sbjct  453   DLVFIPLQVYLK-------------VSKLFECVQGGKEKGFVPKRGKTLNYESLAQGGLR  499

Query  1697  ETRFLLSKIILDT  1735
             E R   ++I+ DT
Sbjct  500   EVRHTFARIVFDT  512



>ref|XP_010029592.1| PREDICTED: uncharacterized protein LOC104419581 isoform X3 [Eucalyptus 
grandis]
Length=605

 Score =   340 bits (872),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 207/406 (51%), Positives = 273/406 (67%), Gaps = 23/406 (6%)
 Frame = +2

Query  545   EIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNES  724
             ++K++F+R +IVG+RFPICRV I+GSVVEVSSF T+A K  E K K +F  + P GCN+ 
Sbjct  2     QVKEKFHRCDIVGKRFPICRVRIKGSVVEVSSFKTIA-KRTEGKEKVAFSCK-PSGCNKR  59

Query  725   DVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCaril  904
             D I WR+S+HRDFTINSLF+D    +IYDY NAM D++S KLRT+IPAQLSFEEDCARIL
Sbjct  60    DFILWRDSMHRDFTINSLFFDLSENKIYDYTNAMEDVRSLKLRTIIPAQLSFEEDCARIL  119

Query  905   rglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYN  1084
             RG+R+AARL  + S + E AI  LS S+  L+K RLM+E+N +LSYGAA PSLCLLQ+  
Sbjct  120   RGVRIAARLGLALSRDIEIAIGSLSSSIAGLNKHRLMLEINSILSYGAAEPSLCLLQRLR  179

Query  1085  LLEVLLPFH----AAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAF  1249
             LLE++LPFH    AAYL QQ    S+ +S MLM+LF ++D+LVSC +P+  +LW+ LLAF
Sbjct  180   LLEIILPFHSTLQAAYLDQQNRGHSAQSSLMLMRLFFNMDKLVSCNQPSDCTLWIGLLAF  239

Query  1250  HLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELA  1429
             HL LVNNPQ   V+   AS ++H  WK   +FA +H K    +VPEIS S  S  +  LA
Sbjct  240   HLALVNNPQDASVIWAFASTLHHGKWKGASQFANKHAKLRVNFVPEISGS--STYKSALA  297

Query  1430  KRVENMA--VQ--VNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTN  1597
             +RV N+A  VQ  V++L+D + L E  +++  SS SGLV +  ++     V E+F +L N
Sbjct  298   ERVSNLASLVQESVSILSDTNRLIESMTRYPHSSCSGLVLIQEQVANN--VREIFQVLVN  355

Query  1598  DVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             DV   N+     +I             G G   ETR +L  IIL+T
Sbjct  356   DVEFYNDGRECFEI--------NYELLGKGFLRETRHVLGTIILNT  393



>ref|NP_174130.2| polynucleotide adenylyltransferase family protein [Arabidopsis 
thaliana]
 gb|AEE30910.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
thaliana]
Length=541

 Score =   338 bits (866),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 199/468 (43%), Positives = 293/468 (63%), Gaps = 22/468 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KLDA  FGI  S I  S+ +VLN LKKKGF+ YLVGGCVRDLIL+RIPKDFDVITTA 
Sbjct  82    WKKLDANEFGIQRSMIPDSTRMVLNKLKKKGFQVYLVGGCVRDLILDRIPKDFDVITTAE  141

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   +IVGRRFPIC V++   ++EVSSF T A  G    +  SF  R P GC+
Sbjct  142   LKEVRKVFPGCQIVGRRFPICHVYVDDIIIEVSSFSTSARTGKAPNK--SF--RRPAGCD  197

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW+N L RDFT+N L +DP    +YDY   + D+++ K+RT+  A LSF ED AR
Sbjct  198   ERDYIRWKNCLQRDFTVNGLMFDPSENVVYDYIGGVEDLRNSKVRTVSAANLSFVEDTAR  257

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + +   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  258   ILRAIRIAARLGFSLTKDVAISVKELSSSLLRLDPSRIRMEINYMLAYGSAEASLRLLWR  317

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + L+E+LLP  A+YL  Q   ++   ++ML+ LF +LD+LV+ +RP  E LW+ +LAFH 
Sbjct  318   FGLMEILLPIQASYLVSQGFRRRDGRSNMLLSLFRNLDRLVAPDRPCSEFLWIGILAFHK  377

Query  1256  TLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEIS--DSDGSMSEDEL  1426
              LV+ P+   VV +    +Y   +  + +  AR + K  + +  E+S  + D + SE ++
Sbjct  378   ALVDQPRDPTVVASFCLAIYSEVSLSEAIAIARSNSKQHNSHFQELSSPEKDTADSESKI  437

Query  1427  AKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILT  1594
             +++V  +A  +      L + D +    SK+  +  S +VF+S  M+++  VE++FG   
Sbjct  438   SQQVIKLAESIRSAARKLNNRDYIANAMSKYPQAPGSDMVFLSRLMLER--VEKMFG---  492

Query  1595  NDVTSLNEKSCSLKIQNPSPQKGTAHKK-GNGIAHETRFLLSKIILDT  1735
                 ++  K    +   PS ++   +K    G  HETR + ++I+ DT
Sbjct  493   ----NVRRKGNQERDDVPSLERRINYKSLALGDFHETRRVFARIVFDT  536



>ref|XP_011020858.1| PREDICTED: uncharacterized protein LOC105123083 isoform X2 [Populus 
euphratica]
Length=523

 Score =   336 bits (862),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 196/472 (42%), Positives = 281/472 (60%), Gaps = 19/472 (4%)
 Frame = +2

Query  338   GKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDF  517
             G+ +   W+KLDA   GI+ S IS  + VVLN LKKKG++ YLVGGCVRDLIL RIPKDF
Sbjct  57    GERKAPEWKKLDAEELGISNSMISRPTRVVLNGLKKKGYEVYLVGGCVRDLILKRIPKDF  116

Query  518   DVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVP  697
             DV+T+A L +++K F++ EIVG+RFPIC VH+  ++VEVSSF T   K D     N    
Sbjct  117   DVVTSAELKQVRKAFHQCEIVGKRFPICHVHVDDAIVEVSSFSTSQLKSDGKFNGNV---  173

Query  698   RMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLS  877
             R P GC+E D  RWRN L RDFTIN L +DP+   +YDY   M DIK  K+RT+IPA LS
Sbjct  174   RKPLGCSERDFKRWRNCLQRDFTINGLMFDPYANIVYDYMGGMTDIKKTKVRTVIPANLS  233

Query  878   FEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVP  1057
             F ED  RIL  +R+AARL+F F+ +   ++ +LS SV+ LDK R+++E+NYML+YG+A  
Sbjct  234   FMEDSGRILHAIRIAARLQFGFTRDLALSLKELSHSVLRLDKGRILLELNYMLAYGSAEA  293

Query  1058  SLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWV  1234
             SL L+ ++ LLE+LLP  A+Y   Q  ++  + S ML+ LFS+LD+LV+ +RP   SLW+
Sbjct  294   SLRLMWRFGLLEILLPIQASYFVSQGFRRRDERSNMLLSLFSNLDRLVAPDRPCHTSLWL  353

Query  1235  ALLAFHLTLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSM  1411
              + AFH  LV+ PQ  LVV+  + +V    +  + VE AR+  +      PE+ +     
Sbjct  354   GIFAFHKALVDQPQDPLVVIAFSLAVRSGGSLLESVEIARRISQPYQSNFPELLEVQNPD  413

Query  1412  SEDELAKRVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEV  1579
             S + L  +  N A  V      +TD   + +   ++  +  S LVF+   +  K  V ++
Sbjct  414   SNNALMHKTINFAALVKTALCNMTDGCYVSKAMVRYPKAPSSDLVFIPMALFLK--VSKI  471

Query  1580  FGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             F  +   + +   +    KI       G+          E R + ++I+ DT
Sbjct  472   FECVRRGMETRFVRRQGRKIDYECLAMGS--------LEEVRHVFARIVFDT  515



>ref|XP_011020856.1| PREDICTED: uncharacterized protein LOC105123083 isoform X1 [Populus 
euphratica]
 ref|XP_011020857.1| PREDICTED: uncharacterized protein LOC105123083 isoform X1 [Populus 
euphratica]
Length=524

 Score =   336 bits (862),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 196/472 (42%), Positives = 281/472 (60%), Gaps = 19/472 (4%)
 Frame = +2

Query  338   GKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDF  517
             G+ +   W+KLDA   GI+ S IS  + VVLN LKKKG++ YLVGGCVRDLIL RIPKDF
Sbjct  58    GERKAPEWKKLDAEELGISNSMISRPTRVVLNGLKKKGYEVYLVGGCVRDLILKRIPKDF  117

Query  518   DVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVP  697
             DV+T+A L +++K F++ EIVG+RFPIC VH+  ++VEVSSF T   K D     N    
Sbjct  118   DVVTSAELKQVRKAFHQCEIVGKRFPICHVHVDDAIVEVSSFSTSQLKSDGKFNGNV---  174

Query  698   RMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLS  877
             R P GC+E D  RWRN L RDFTIN L +DP+   +YDY   M DIK  K+RT+IPA LS
Sbjct  175   RKPLGCSERDFKRWRNCLQRDFTINGLMFDPYANIVYDYMGGMTDIKKTKVRTVIPANLS  234

Query  878   FEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVP  1057
             F ED  RIL  +R+AARL+F F+ +   ++ +LS SV+ LDK R+++E+NYML+YG+A  
Sbjct  235   FMEDSGRILHAIRIAARLQFGFTRDLALSLKELSHSVLRLDKGRILLELNYMLAYGSAEA  294

Query  1058  SLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWV  1234
             SL L+ ++ LLE+LLP  A+Y   Q  ++  + S ML+ LFS+LD+LV+ +RP   SLW+
Sbjct  295   SLRLMWRFGLLEILLPIQASYFVSQGFRRRDERSNMLLSLFSNLDRLVAPDRPCHTSLWL  354

Query  1235  ALLAFHLTLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSM  1411
              + AFH  LV+ PQ  LVV+  + +V    +  + VE AR+  +      PE+ +     
Sbjct  355   GIFAFHKALVDQPQDPLVVIAFSLAVRSGGSLLESVEIARRISQPYQSNFPELLEVQNPD  414

Query  1412  SEDELAKRVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEV  1579
             S + L  +  N A  V      +TD   + +   ++  +  S LVF+   +  K  V ++
Sbjct  415   SNNALMHKTINFAALVKTALCNMTDGCYVSKAMVRYPKAPSSDLVFIPMALFLK--VSKI  472

Query  1580  FGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             F  +   + +   +    KI       G+          E R + ++I+ DT
Sbjct  473   FECVRRGMETRFVRRQGRKIDYECLAMGS--------LEEVRHVFARIVFDT  516



>emb|CDY60479.1| BnaCnng36340D [Brassica napus]
Length=534

 Score =   337 bits (863),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 199/466 (43%), Positives = 292/466 (63%), Gaps = 21/466 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KLDA  FGI  S I  S+ +VLN L+KKGF+ YLVGGCVRDLIL+RIPKDFDVIT+A 
Sbjct  77    WKKLDANEFGIQRSMIPESTRMVLNKLRKKGFQVYLVGGCVRDLILDRIPKDFDVITSAE  136

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+++ F R +IVGRRFPIC V++   ++EVSSF T A  G +T  KN    R P GCN
Sbjct  137   LKEVRQVFPRCQIVGRRFPICHVYVDDIIIEVSSFSTSARTG-KTPNKNF---RKPVGCN  192

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW+N L RDFT+N L +DP    +YDY   + DIK+ K+RT+  A+LSF ED AR
Sbjct  193   ERDYIRWKNCLQRDFTVNGLMFDPLENVVYDYIGGVEDIKNSKVRTVSAAKLSFIEDKAR  252

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + +   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  253   ILRAIRIAARLGFSLTKDVAVSVKELSTSLLRLDPSRVQMEINYMLAYGSAEASLRLLWR  312

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + L+E+LLP  A+Y   Q   ++   ++ML+ +F +LD+LV+ +RP  E LW+ +LAFH 
Sbjct  313   FGLMEILLPIQASYFVSQGFRRRDGRSNMLLSMFRNLDRLVAPDRPCAELLWIGILAFHK  372

Query  1256  TLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              LV+ P+   VV +    +Y   +  + +E A+ + K  +    E+S  D  ++  +L++
Sbjct  373   ALVDQPRDPTVVASYCLAIYSDISLSEAMEIAKSNTKQHNSNFQELSAQDKDIAGSKLSQ  432

Query  1433  RVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
             +V ++A  V      + D D L    SK+  +  S +VF+S  ++++  V+ +FG     
Sbjct  433   QVMSLAESVKSAAKKMHDRDYLANAMSKYPQAPSSDMVFMSRPLLER--VQRMFG-----  485

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKK-GNGIAHETRFLLSKIILDT  1735
               S+  K    +   PS  +   +K    G  HETR + ++I+ DT
Sbjct  486   --SVRRKGDGER-GVPSLDRRINYKSLALGDFHETRRVFARIVFDT  528



>ref|XP_010499302.1| PREDICTED: uncharacterized protein LOC104776859 isoform X1 [Camelina 
sativa]
Length=541

 Score =   337 bits (863),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 199/468 (43%), Positives = 292/468 (62%), Gaps = 22/468 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+DA  FGI  S I  S+ +VLN LKKKGF+ YLVGGCVRDLIL+RIPKDFDVITTA 
Sbjct  82    WKKMDANEFGIQRSMIPDSTRMVLNKLKKKGFQVYLVGGCVRDLILDRIPKDFDVITTAE  141

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   +IVGRRFPIC V++   ++EVSSF T A  G +   KN    R P GCN
Sbjct  142   LKEVRKVFPSCQIVGRRFPICHVYVDDIIIEVSSFSTSARTG-KAPNKNL---RKPAGCN  197

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW+N L RDFT+N L +DP    +YDY   + D+++ K+RT+  A+LSF ED AR
Sbjct  198   ERDYIRWKNCLQRDFTVNGLMFDPSENVVYDYIGGVEDLRNSKVRTVSAAKLSFVEDTAR  257

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + +   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  258   ILRAIRIAARLGFSLTKDVAISVKELSSSLLRLDPSRIRMEINYMLAYGSAEASLRLLWR  317

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + L+E+LLP  A+YL  Q   ++   ++ML+ LF +LD+LV+ +RP  E LW+ +LAFH 
Sbjct  318   FGLMEILLPIQASYLVSQGFRRRDGRSNMLLSLFRNLDRLVAPDRPCHEFLWIGILAFHK  377

Query  1256  TLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEISDSDGSM--SEDEL  1426
              LV+ P+   VV      +Y   +  + ++ AR + K  +    E+S  +  +  S+ +L
Sbjct  378   ALVDKPRDPTVVACFCLAIYSELSLAEAIKIARSNSKPHNSNFRELSGHEKDIIDSDSKL  437

Query  1427  AKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILT  1594
             A++V N+A  +      L D D +    S++  +  S +VF+S  ++++  VE++FG   
Sbjct  438   AQQVLNLAESIRSAARKLNDRDYIANAMSQYPQAPDSDMVFMSRPVLER--VEKMFG---  492

Query  1595  NDVTSLNEKSCSLKIQNPSPQKGTAHKK-GNGIAHETRFLLSKIILDT  1735
                 ++  K        PS ++   +K    G  HETR + ++I+ DT
Sbjct  493   ----NVRSKGSQETDGVPSLERRIDYKSLALGDFHETRRVFARIVFDT  536



>ref|XP_006307190.1| hypothetical protein CARUB_v10008782mg [Capsella rubella]
 gb|EOA40088.1| hypothetical protein CARUB_v10008782mg [Capsella rubella]
Length=543

 Score =   336 bits (861),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 201/468 (43%), Positives = 290/468 (62%), Gaps = 22/468 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KLDA  FGI  S I  S+ +VLN LKKKGF+ YLVGGCVRDLIL+RIPKDFDVITTA 
Sbjct  82    WKKLDANEFGIQRSMIPDSTRMVLNKLKKKGFQVYLVGGCVRDLILDRIPKDFDVITTAE  141

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   +IVGRRFPIC V++   ++EVSSF T A  G    +      R P GCN
Sbjct  142   LKEVRKVFPGCQIVGRRFPICHVYVDDIIIEVSSFSTSARTGKSPNK----TLRKPVGCN  197

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW+N L RDFT+N L +D     +YDY   + D+++ K+RT+  A+ SF ED AR
Sbjct  198   EPDYIRWKNCLQRDFTVNGLMFDLSENVVYDYIGGVEDLRNSKVRTVSAAKFSFVEDKAR  257

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + +   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  258   ILRAIRIAARLGFSLTKDVAISVKELSSSLLRLDPSRVRMEINYMLAYGSAEASLRLLWR  317

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + L+E+LLP  A+YL  Q   ++   ++ML+ LF +LD+LV+ +RP  E LW+ +LAFH 
Sbjct  318   FGLMELLLPIQASYLVSQGFRRRDGRSNMLLSLFRNLDRLVAPDRPCHEFLWIGILAFHK  377

Query  1256  TLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEIS--DSDGSMSEDEL  1426
              LV+ P+   VV T    +Y   +  + +E AR + K  +    E+S  + D   S+ +L
Sbjct  378   ALVDKPRDPTVVATFCLAIYSELSLSEAIEIARSNSKQHNSNFQELSGHEQDIDNSDSKL  437

Query  1427  AKRVENMA----VQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILT  1594
             +++V N+A      V  L D D +    SK+  +  S +VF+S  ++++  VE++FG   
Sbjct  438   SQQVINLAETIRSAVRKLNDRDYIANAMSKYPQAPGSDMVFMSRPVLER--VEKMFG---  492

Query  1595  NDVTSLNEKSCSLKIQNPSPQKGTAHKK-GNGIAHETRFLLSKIILDT  1735
                 S+  K    +   PS ++   +K    G  HETR + ++I+ DT
Sbjct  493   ----SVRRKGSQERDGLPSLERRINYKSLALGDFHETRRVFARIVFDT  536



>ref|XP_009113704.1| PREDICTED: uncharacterized protein LOC103838989 [Brassica rapa]
 emb|CDY46629.1| BnaA09g27560D [Brassica napus]
Length=533

 Score =   335 bits (860),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 200/466 (43%), Positives = 290/466 (62%), Gaps = 21/466 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KLDA  FGI  S I  S+ +VLN L+KKGF+ YLVGGCVRDLIL+RIPKDFDVIT+A 
Sbjct  76    WKKLDANEFGIQRSMIPESTRMVLNKLRKKGFQVYLVGGCVRDLILDRIPKDFDVITSAE  135

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+++ F R +IVGRRFPIC V++   ++EVSSF T A  G +   KN    R P GCN
Sbjct  136   LKEVRQVFPRCQIVGRRFPICHVYVDDIIIEVSSFSTSARTG-KAPNKNF---RKPVGCN  191

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW+N L RDFT+N L +DP    +YDY   + DIK+ K+RT+  A+LSF ED AR
Sbjct  192   ERDYIRWKNCLQRDFTVNGLMFDPLENVVYDYIGGVEDIKNSKVRTVSAAKLSFIEDKAR  251

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + +   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  252   ILRAIRIAARLGFSLTKDVAVSVKELSSSLLRLDPSRVQMEINYMLAYGSAEASLRLLWR  311

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + L+E+LLP  A+Y   Q  K+    S ML+ +F +LD+LV+ +RP  E LW+ +LAFH 
Sbjct  312   FGLMEILLPIQASYFVSQGFKRRDGRSNMLLSMFRNLDRLVAPDRPCAELLWIGILAFHK  371

Query  1256  TLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              LV+ P+   VV +    +Y   +  + +E A+ + K  +    E+S  D  ++  +L++
Sbjct  372   ALVDQPRDPTVVASYCLAIYSDISLSEAMEIAKSNTKQHNSNFQELSAQDKDIAGSKLSQ  431

Query  1433  RVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
             +V ++A  V      + D D L    SK+  +  S +VF+S  ++++  V+ +FG     
Sbjct  432   QVMSLAESVKSAAKKMHDRDYLANAMSKYPQAPSSDMVFMSRPLLER--VQRMFG-----  484

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKK-GNGIAHETRFLLSKIILDT  1735
               S+  K    +   PS  +   +K    G  HETR + ++I+ DT
Sbjct  485   --SVRRKGDGER-GVPSLDRRINYKSLAIGDFHETRRVFARIVFDT  527



>gb|KDP22554.1| hypothetical protein JCGZ_26385 [Jatropha curcas]
Length=521

 Score =   335 bits (859),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 189/422 (45%), Positives = 268/422 (64%), Gaps = 10/422 (2%)
 Frame = +2

Query  296   ESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGG  475
             E   D    S+ + GK +  +W+KL+++  GI+ S I+  +  VLNVLK++G + YLVGG
Sbjct  43    EHVIDVRRRSSGREGKGKGPDWKKLNSKDLGISTSMIARPTRNVLNVLKQRGHEVYLVGG  102

Query  476   CVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVA  655
             CVRDLIL RIPKDFD+IT+A L E+ + F R EI+G+RFPIC VHI+ +VVEVSSF T A
Sbjct  103   CVRDLILKRIPKDFDIITSAELKEVLRAFSRCEIIGKRFPICHVHIQDTVVEVSSFSTTA  162

Query  656   NKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADI  835
              K        S+  + P GC+E D +RWRN L RDFTIN   +DP+   +YDY   + DI
Sbjct  163   RKFGGN---FSYDVQSPIGCDEKDYVRWRNCLQRDFTINGFMFDPYGKIVYDYMGGLEDI  219

Query  836   KSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLM  1015
             +  K+RT+IPA  SF+EDCARILR +R+AARL F FS ET   +   + S++ LDK RL+
Sbjct  220   RKAKVRTVIPASNSFQEDCARILRAVRIAARLGFRFSRETAHFVKIFASSILRLDKGRLL  279

Query  1016  MEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQ  1192
             ME+NYML+YGAA  SL LL K+ LLE+LLP  AAY  +    ++   T+ML+ LFS++D+
Sbjct  280   MEMNYMLAYGAAEASLRLLWKFGLLEILLPIQAAYFVRHGFRRRDKRTNMLLSLFSNMDK  339

Query  1193  LVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAA  1369
             L++ ++P   SLWVA+LAFH  L + P+  LVV      +Y+  +  + V  AR   K  
Sbjct  340   LLAPDKPCNSSLWVAILAFHKALSDQPRDPLVVAVFCLAVYNGGDISEAVNIARSITKPH  399

Query  1370  SLYVPEISDSDGSMSEDELAKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVF  1537
              +   E+S+  G +    L   V ++A  +    NM+TD   + +  +++  +  S LVF
Sbjct  400   DVTFYELSEP-GVLDSKALINEVMDLAAFIKRVLNMMTDEYYVSQAMAEYPKAPRSDLVF  458

Query  1538  VS  1543
             +S
Sbjct  459   IS  460



>ref|XP_010460579.1| PREDICTED: uncharacterized protein LOC104741415 [Camelina sativa]
Length=541

 Score =   335 bits (858),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 198/468 (42%), Positives = 291/468 (62%), Gaps = 22/468 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+DA  FGI  S I  S+ +VLN LKKKGF+ YLVGGCVRDLIL+RIPKDFDVITTA 
Sbjct  82    WKKMDANEFGIQRSMIPDSTRMVLNKLKKKGFQVYLVGGCVRDLILDRIPKDFDVITTAE  141

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L  ++K F   +IVGRRFPIC V++   ++EVSSF T A  G +   KN    R P GCN
Sbjct  142   LKXVRKVFPSCQIVGRRFPICHVYVDDIIIEVSSFSTSARTG-KAPNKNL---RKPAGCN  197

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW+N L RDFT+N L +DP    +YDY   + D+++ K+RT+  A+LSF ED AR
Sbjct  198   ERDYIRWKNCLQRDFTVNGLMFDPSENVVYDYIGGVEDLRNSKVRTVSAAKLSFVEDTAR  257

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + +   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  258   ILRAIRIAARLGFSLTKDVAISVKELSSSLLRLDPSRIRMEINYMLAYGSAEASLRLLWR  317

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + L+E+LLP  A+YL  Q   ++   ++ML+ LF +LD+LV+ +RP  E LW+ +LAFH 
Sbjct  318   FGLMEILLPIQASYLVSQGFRRRDGRSNMLLSLFRNLDRLVAPDRPCHEFLWIGILAFHK  377

Query  1256  TLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEISDSDGSM--SEDEL  1426
              LV+ P+   VV      +Y   +  + ++ AR + K  +    E+S  +  +  S  +L
Sbjct  378   ALVDKPRDPTVVACFCLAIYSELSLAEAIKIARSNSKPHNSNFQELSGHEKDIVDSNSKL  437

Query  1427  AKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILT  1594
             A++V N+A  +      L D D +    S++  +  S +VF+S  ++++  VE++FG   
Sbjct  438   AQQVLNLAESIRSVARKLNDRDYIANAMSQYPQAPDSDMVFMSRPVLER--VEKMFG---  492

Query  1595  NDVTSLNEKSCSLKIQNPSPQKGTAHKK-GNGIAHETRFLLSKIILDT  1735
                 ++  K    +   PS ++   +K    G  HETR + ++I+ DT
Sbjct  493   ----NVRRKGSQERDGVPSLERRIDYKSLALGDFHETRRVFARIVFDT  536



>ref|XP_006436931.1| hypothetical protein CICLE_v10031219mg [Citrus clementina]
 ref|XP_006485115.1| PREDICTED: uncharacterized protein LOC102608253 isoform X1 [Citrus 
sinensis]
 gb|ESR50171.1| hypothetical protein CICLE_v10031219mg [Citrus clementina]
Length=527

 Score =   332 bits (852),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 197/464 (42%), Positives = 278/464 (60%), Gaps = 18/464 (4%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+A+  GI+ S I   +  VLN LKKKG++ YLVGGCVRDL+LNRIPKDFD+IT+A 
Sbjct  69    WKKLNAKDLGISTSMIDKPTRKVLNGLKKKGYEVYLVGGCVRDLMLNRIPKDFDIITSAE  128

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F + EIVG+RFPIC VH   ++VEVSSF T    G    R   +  + P GC+
Sbjct  129   LKEVVRVFSQCEIVGKRFPICHVHFEDTIVEVSSFST---SGRRFSRDFKYEFQRPIGCD  185

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRWRN L RDFTIN L +DP+   IYDY   + DI+  K++T+IPA  SF+EDCAR
Sbjct  186   EKDFIRWRNCLQRDFTINGLMFDPYAKIIYDYIGGIEDIRKAKVQTVIPASTSFQEDCAR  245

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F FS ET   +  LSPS++ LD+ RL+ME+NYML+YG+A  SL LL K
Sbjct  246   ILRAIRIAARLGFRFSRETAHFVKHLSPSILKLDRGRLLMEMNYMLAYGSAEASLRLLWK  305

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLEVLLP  AAYL +   ++    S ML+ LFS+LD+L++ +RP   SLW+A+LAFH 
Sbjct  306   FGLLEVLLPIQAAYLVKHGFRRRDKRSNMLLSLFSNLDKLLAPDRPCHSSLWIAILAFHK  365

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEI---SDSDGSMSEDE  1423
              L + P+  LVV   +  +Y+  +  + V+ AR+  K+      E+    D D    + E
Sbjct  366   ALSDQPRDPLVVAVFSLAVYNGGDMLEAVKIARRINKSHDESFCELLEPRDLDFEALKHE  425

Query  1424  LAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDV  1603
             +    E+    ++ +TD   + +  + +S +  S LVF+   +  K +  ++F  +    
Sbjct  426   VMDLAESSKGALSKMTDEYFVSQAMAGYSRAPFSDLVFIPLALYLKAI--KIFECMRGGA  483

Query  1604  TSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                       KI   S   G+          E R   ++I+ DT
Sbjct  484   ERRFASKQGSKIDYESLAYGS--------PQEVRHTFARIVFDT  519



>gb|EPS60978.1| hypothetical protein M569_13823, partial [Genlisea aurea]
Length=436

 Score =   329 bits (844),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 188/468 (40%), Positives = 270/468 (58%), Gaps = 46/468 (10%)
 Frame = +2

Query  368   LDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNE  547
             +D+R  G++   +   SW VL +L+  G +AY VGGCVRDL+L ++PKDFD++TTA L +
Sbjct  1     MDSRSLGLSAKMVPNHSWTVLRMLQAAGKEAYFVGGCVRDLLLKKVPKDFDIVTTAELKQ  60

Query  548   I------KKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPK  709
             +      K+ F RA I+G+RFPIC+V  +   VEVSSF+T + K    K K     +MPK
Sbjct  61    VVFFFLVKRMFNRAIIIGKRFPICKVFHKDCSVEVSSFETASQK---CKGKKIAFSQMPK  117

Query  710   GCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEED  889
             GC+  D  R++N + RDFT+NSL++DP    I+DY NA+ DI+S+KLRT+  A+LSF+ED
Sbjct  118   GCDRLDFARFKNCMKRDFTVNSLYFDPARNVIFDYTNALRDIRSKKLRTITLAKLSFKED  177

Query  890   CarilrglrlaarlKFSF--SMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSL  1063
                      L    + +   S E E AI  LS SV +L   R+ +E+NYM SYGAA  S+
Sbjct  178   EGLSRILRGLRLAARLNLIISKEAEEAINSLSSSVTNLSTDRIALEMNYMFSYGAAELSI  237

Query  1064  CLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALL  1243
              LLQKY LL++LLPFHAAY ++Q                         R    S    ++
Sbjct  238   ILLQKYKLLQILLPFHAAYFSEQGR----------------------NRFDMRSTMAGIM  275

Query  1244  AFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDE  1423
             AFH  L +NP   +VVLT AS++YH  W++ ++FAR++   A ++VPE+ D  G +S+DE
Sbjct  276   AFHRALFSNPNHPVVVLTFASLLYHGTWEESLKFARKNASTAKIFVPEMLDDSGHLSDDE  335

Query  1424  LAKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGIL  1591
             L  ++ ++A Q+    N L   D+L +  ++F  S  S  VFV+ K + KI  +E+F IL
Sbjct  336   LVDKIVHLARQMDESANFLVSKDHLSDAMARFPESPCSDTVFVAKKTLLKI--KEIFSIL  393

Query  1592  TNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                VTS   K    +         TA     G   ETR+ + +IILDT
Sbjct  394   RTGVTS--SKRGGDRNTEIRSSLVTA-----GDVSETRYAIGRIILDT  434



>ref|XP_009604520.1| PREDICTED: uncharacterized protein LOC104099282 isoform X1 [Nicotiana 
tomentosiformis]
Length=527

 Score =   330 bits (846),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 198/476 (42%), Positives = 282/476 (59%), Gaps = 41/476 (9%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL +   GI+ S I+  + VVLN LKKKGF+ YLVGGCVRDL+LN+ PKDFD+IT+A 
Sbjct  68    WKKLSSEELGISTSMIAKPTRVVLNGLKKKGFEVYLVGGCVRDLLLNKTPKDFDIITSAE  127

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSF-VPRMPKGC  715
             L E+ K F R EIVGRRFPIC VH+  ++VEVSSF+T   +     R+NS+ V R P  C
Sbjct  128   LKEVLKTFQRCEIVGRRFPICHVHVDDTIVEVSSFNTTGRRF----RRNSYNVVRRPATC  183

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
             +E+D IRW+N L RDFTIN L +DPF   +YDY   + DI+  K+R +IPA  SF EDCA
Sbjct  184   DEADFIRWKNCLGRDFTINGLMFDPFARIVYDYLGGLEDIRRAKVRCVIPASASFVEDCA  243

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILRG+R+A RL F FS ET   + +L+ S+  LDK R++ME+NYML+YG+A  SL LL 
Sbjct  244   RILRGVRIAGRLGFRFSRETAHFVKELASSISRLDKGRILMEMNYMLAYGSAEASLRLLW  303

Query  1076  KYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             K+ LLE+LLP  A+Y   Q   ++   ++ML+ LFS+LD L++ +RP   SLW+A+LAFH
Sbjct  304   KFGLLEILLPIQASYFISQGFRRRDKRSNMLLTLFSTLDNLLAPDRPCHSSLWIAILAFH  363

Query  1253  LTLVNNPQPKLVVLTLASVMYH--RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDEL  1426
               LV+ P+  LVV    SV  H   +    +  AR+  +       E+ D     S++ L
Sbjct  364   KALVDRPRDPLVVAAF-SVAVHCGGSLSDVLGVARKISQPHDTRFSELLDFRIVESDEAL  422

Query  1427  AKRVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILT  1594
                + ++A  V      +TD   +    +++  +  S LVF+   + +K  V+ +F  + 
Sbjct  423   LDEMMDLATYVEAALRKMTDEHFISRALTEYPQAPKSDLVFIPWALSQK--VDAIFECVR  480

Query  1595  NDVTSLNEKSCSLKIQNPSPQKGTAHKKGN---------GIAHETRFLLSKIILDT  1735
                                 +KG   K+G+         G  HE R + ++++ DT
Sbjct  481   R-----------------GKEKGFRRKRGSKIDYESLALGKLHEIRHIFARVVFDT  519



>ref|XP_009779993.1| PREDICTED: putative CCA tRNA nucleotidyltransferase 2 isoform 
X1 [Nicotiana sylvestris]
Length=527

 Score =   330 bits (846),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 195/475 (41%), Positives = 283/475 (60%), Gaps = 39/475 (8%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL +   GI+ S I+  + VVLN LKKKGF+ YLVGGCVRDL+LN+ PKDFD+IT+A 
Sbjct  68    WKKLSSEELGISTSMIAKPTRVVLNGLKKKGFEVYLVGGCVRDLLLNKTPKDFDIITSAE  127

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ K F R EIVGRRFPIC VH+  ++VEVSSF+T    G   KR +  V R P  C+
Sbjct  128   LKEVLKTFQRCEIVGRRFPICHVHVDDTIVEVSSFNTT---GRRFKRNSYNVVRRPAMCD  184

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E+D IRW+N L RDFTIN L +DPF   +YDY   + DI+  K+R +IPA  SF EDCAR
Sbjct  185   EADFIRWKNCLGRDFTINGLMFDPFARIVYDYLGGLEDIRRAKVRCVIPASASFIEDCAR  244

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRG+R+A RL F FS ET   + +L+ S+  LDK R++ME+NYML+YG+A  SL LL K
Sbjct  245   ILRGVRIAGRLGFRFSRETAHFVKELASSISKLDKGRILMEMNYMLAYGSAEASLRLLWK  304

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  A+Y   Q   ++   ++ML+ LFS+LD L++ +RP   SLW+A+LAFH 
Sbjct  305   FGLLEILLPIQASYFISQGFRRRDKRSNMLLSLFSTLDNLLAPDRPCHSSLWIAILAFHK  364

Query  1256  TLVNNPQPKLVVLTLASVMYHRNWKQGV-----EFARQH-VKAASLYVPEISDSDGSMSE  1417
              LV+ P+  LVV   ++ ++       V     + ++ H  + + L    I +SD ++  
Sbjct  365   ALVDRPRDPLVVAAFSAAVHCGGSLSDVLGVAGKISQPHDTRFSELLDFRIVESDEALL-  423

Query  1418  DELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTN  1597
             DE+      +   +  +TD   + +  +++  +  S LVF+   + +K  V+ +F  +  
Sbjct  424   DEMMDLATYVEAALRKMTDEYFISQALTEYPQAPKSDLVFIPWALSQK--VDAIFECVRR  481

Query  1598  DVTSLNEKSCSLKIQNPSPQKGTAHKKGN---------GIAHETRFLLSKIILDT  1735
                                +KG   K+G+         G  HE R + ++++ DT
Sbjct  482   -----------------GKEKGFRQKRGSKIDYESLALGKLHEIRHIFARVVFDT  519



>ref|XP_007038104.1| Polynucleotide adenylyltransferase family protein [Theobroma 
cacao]
 gb|EOY22605.1| Polynucleotide adenylyltransferase family protein [Theobroma 
cacao]
Length=528

 Score =   330 bits (845),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 191/411 (46%), Positives = 263/411 (64%), Gaps = 16/411 (4%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+++  GI+ + IS  +  VLN LK+KG++ YLVGGCVRDLIL R PKDFD+ITTA 
Sbjct  71    WKKLNSQDLGISTTNISKPTRKVLNGLKRKGYEVYLVGGCVRDLILKRTPKDFDIITTAE  130

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F R EIVGRRFPIC VHI  ++VEVSSF T    G +  R  ++    P GC+
Sbjct  131   LREVVRAFSRCEIVGRRFPICHVHIGDTIVEVSSFST---SGQKFGRSLNYKLGRPAGCD  187

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRWRN L RDFTIN L +DP+   IYDY   + DI+  K+RT+IPA  SF+EDCAR
Sbjct  188   EKDFIRWRNCLQRDFTINGLMFDPYARIIYDYMGGIEDIRKAKVRTVIPAGTSFQEDCAR  247

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FSFS ET   I  LS S++ LDKSR++ME+NYML+YG+A  SL LL K
Sbjct  248   ILRAIRIAARLGFSFSRETAHFIKNLSCSILRLDKSRILMEMNYMLAYGSAEASLRLLWK  307

Query  1079  YNLLEVLLPFHAAYLT----QQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLA  1246
             + LLE+LLP  AAY      ++ DK+S   +ML+ LFS+LD+L++ +RP   SLWV +LA
Sbjct  308   FGLLEILLPIQAAYFVSNGLRRCDKRS---NMLLSLFSNLDRLLAPDRPCHGSLWVGILA  364

Query  1247  FHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDE  1423
             FH  L + P+  LVV   + V+++  +  + V  A +  K+      E+S+   ++    
Sbjct  365   FHKALFDKPRDPLVVAAYSLVVHNGGDILEAVNIATRINKSHDTSFRELSEPR-NLENQT  423

Query  1424  LAKRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKI  1564
             L   V ++A  V      +TD   + +  S +  +  S LVF+   +  K+
Sbjct  424   LINEVMDLAASVKSTLCKMTDEHFVSQAMSAYPQAPFSDLVFIPLALYLKV  474



>ref|XP_006415699.1| hypothetical protein EUTSA_v10007307mg [Eutrema salsugineum]
 gb|ESQ34052.1| hypothetical protein EUTSA_v10007307mg [Eutrema salsugineum]
Length=539

 Score =   330 bits (845),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 198/468 (42%), Positives = 292/468 (62%), Gaps = 23/468 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             ++KLDA  FGI  S I  S+ +VLN L+KKGF+ YLVGGCVRDLIL+RIPKDFDVIT+A 
Sbjct  81    FKKLDANEFGIQRSMIPESTRMVLNKLRKKGFQVYLVGGCVRDLILDRIPKDFDVITSAE  140

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F R +IVGRRFPIC V++   ++EVSSF T A  G +   KN    R P GCN
Sbjct  141   LTEVRKVFPRCQIVGRRFPICHVYVDDIIIEVSSFSTSARTG-KAPNKNF---RKPAGCN  196

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D IRW+N L RDFT+N L +DP    +YDY   + DI++ K+RT+  A+LSF ED AR
Sbjct  197   DRDYIRWKNCLQRDFTVNGLMFDPLENVVYDYIGGVEDIRNSKVRTVSSAKLSFIEDKAR  256

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + E   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  257   ILRAIRIAARLGFSLTKEVAVSVKELSSSLLRLDPSRVQMEINYMLAYGSAEASLRLLWR  316

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + L+E+LLP  A+Y   Q   ++   ++ML+ +F +LD+LV+ +RP  E LW+ +LA H 
Sbjct  317   FGLMEILLPIQASYFVSQGFRRRDGRSNMLLSMFRNLDRLVAPDRPCNEFLWIGILALHK  376

Query  1256  TLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEIS--DSDGSMSEDEL  1426
              LV+ P+   VV +    +Y   +  + +E A+ + K  +    E+S  + D   S+ +L
Sbjct  377   ALVDQPRDPTVVASYCLAIYSEVSLSEAIEIAKSNSKQHNSNFQELSGHEKDTVDSDSKL  436

Query  1427  AKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILT  1594
             +K+V ++A  +      + D D L    SK+  +  S +VF+S  M+++  V+++FG + 
Sbjct  437   SKQVMSLAESIKSAARKMNDRDYLANAMSKYPQAPSSDMVFMSKLMLER--VQKMFGSVR  494

Query  1595  NDVTSLNEKSCSLKIQNPSPQKGTAHKK-GNGIAHETRFLLSKIILDT  1735
                   NE+        PS  +   +K    G  HETR + ++I+ DT
Sbjct  495   R---RGNEERGV-----PSLDRRINYKSLALGDFHETRRVFARIVFDT  534



>ref|XP_010656776.1| PREDICTED: uncharacterized protein LOC100259104 isoform X2 [Vitis 
vinifera]
Length=445

 Score =   325 bits (834),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 193/449 (43%), Positives = 273/449 (61%), Gaps = 39/449 (9%)
 Frame = +2

Query  437   LKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIR  616
             LKKKG++ YLVGGCVRDLIL R PKDFD+IT+A L E+ + F R E+VG+RFPIC VH+ 
Sbjct  3     LKKKGYEVYLVGGCVRDLILKRTPKDFDIITSAELKEVLRAFPRCEVVGKRFPICHVHVN  62

Query  617   GSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFV  796
              ++VEVSSF T    G  T RK  ++ R P  C++ D IRWRN L RDFTIN L +DP+ 
Sbjct  63    DTIVEVSSFST---SGKRTGRKLDYILRRPPDCDDHDYIRWRNCLQRDFTINGLMFDPYT  119

Query  797   YQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKL  976
               +YDY   M DIK  K+RT+IPA +SF EDCARILRG+R+AARL F F+ +   ++ +L
Sbjct  120   KIVYDYMGGMQDIKKAKVRTVIPANISFVEDCARILRGVRIAARLGFRFTKDIAHSVREL  179

Query  977   SPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDT  1156
             S SV+ LDK R++ME+NYML+YG+A  SL LL K+ LLE+LLP  AAYL  Q  ++    
Sbjct  180   SCSVLRLDKGRILMEMNYMLAYGSAEASLRLLWKFGLLEILLPIQAAYLVSQGFRRRDQR  239

Query  1157  S-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWK  1330
             S ML+ LFS+LD+LV+ +RP   SLW+ +LAFH  LV+ P+  +VV   +  +++  +  
Sbjct  240   SNMLLSLFSNLDRLVAPDRPCHNSLWIGMLAFHKALVDQPRHPMVVAAFSLAVHNGGSLS  299

Query  1331  QGVEFARQ----HVKAAS-LYVPEISDSDGSMSEDELAKRVENMAVQVNMLTDADNLREV  1495
             + VE AR+    H ++ S L  P+  DSD S+  DE+     ++   +  +TD   + + 
Sbjct  300   EAVEIARRISQPHDQSFSELLEPQDLDSDESLI-DEIMDLAASVKSALMKMTDEHFVSQA  358

Query  1496  TSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHK  1675
              SK+  + +S LVF+S                   + S    S   +      +KG   K
Sbjct  359   MSKYPRAPYSDLVFIS-------------------LASFLRASKIFQCVQGGAEKGFVPK  399

Query  1676  KGNGIAH---------ETRFLLSKIILDT  1735
             +G+ I +         E R + ++I+ DT
Sbjct  400   QGSRIDYEFLALGSLREVRHVFARIVFDT  428



>ref|XP_006361913.1| PREDICTED: uncharacterized protein LOC102603580 isoform X2 [Solanum 
tuberosum]
Length=509

 Score =   326 bits (836),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 185/414 (45%), Positives = 257/414 (62%), Gaps = 8/414 (2%)
 Frame = +2

Query  338   GKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDF  517
             G  +   W+KL +   GI+ S I+  + +VLN LKKKGF+ YLVGGCVRDLILNR PKDF
Sbjct  44    GDGDAPKWKKLSSEELGISTSMIAKPTRLVLNGLKKKGFEVYLVGGCVRDLILNRTPKDF  103

Query  518   DVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVP  697
             D++T+A L E+ K F R EIVGRRFPIC VHI  ++VEVSSF      G + KR    V 
Sbjct  104   DILTSAELKEVLKIFQRCEIVGRRFPICHVHIDDTIVEVSSFTAT---GRKFKRNGYNVV  160

Query  698   RMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLS  877
             R P  C+E+D IRW+N L RDFTIN L +DPF   +YDY   + DI+  K+R +IPA  S
Sbjct  161   RRPPACSEADFIRWKNCLARDFTINGLMFDPFAKIVYDYLGGLEDIRRAKVRCVIPANAS  220

Query  878   FEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVP  1057
             F EDCARILRG+R+A RL+F F+ ET   I +L+ S+  LDK R+++E+NYML+YG+A  
Sbjct  221   FIEDCARILRGVRIAGRLRFRFARETAHFIKELASSISRLDKGRILLEMNYMLAYGSAEA  280

Query  1058  SLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWV  1234
             SL LL K+ LLE+LLP  A+YL  Q   ++   ++ML+ LFS+LD L++  RP   SLW+
Sbjct  281   SLRLLWKFGLLEILLPIQASYLISQGFRRRDRRSNMLLTLFSTLDNLLAPNRPCHSSLWI  340

Query  1235  ALLAFHLTLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSM  1411
             A+LAFH  LV+ P+  LVV   + +V    +    +   R+  +      PE+ D +   
Sbjct  341   AILAFHKALVDRPRDPLVVAAFSIAVHCGGSLSDVLGIVRKISQPHDTRFPELLDQNIES  400

Query  1412  SE---DELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKI  1564
              E   DE+      +   +  +TD   +     ++  +  S LVF+S  + +K+
Sbjct  401   DEALLDEMMDLATYVEAALQEMTDEHFVSRALIEYPQAPKSDLVFISWTLAQKV  454



>ref|XP_006361912.1| PREDICTED: uncharacterized protein LOC102603580 isoform X1 [Solanum 
tuberosum]
Length=520

 Score =   326 bits (835),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 184/407 (45%), Positives = 255/407 (63%), Gaps = 8/407 (2%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL +   GI+ S I+  + +VLN LKKKGF+ YLVGGCVRDLILNR PKDFD++T+A 
Sbjct  62    WKKLSSEELGISTSMIAKPTRLVLNGLKKKGFEVYLVGGCVRDLILNRTPKDFDILTSAE  121

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ K F R EIVGRRFPIC VHI  ++VEVSSF      G + KR    V R P  C+
Sbjct  122   LKEVLKIFQRCEIVGRRFPICHVHIDDTIVEVSSFTAT---GRKFKRNGYNVVRRPPACS  178

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E+D IRW+N L RDFTIN L +DPF   +YDY   + DI+  K+R +IPA  SF EDCAR
Sbjct  179   EADFIRWKNCLARDFTINGLMFDPFAKIVYDYLGGLEDIRRAKVRCVIPANASFIEDCAR  238

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRG+R+A RL+F F+ ET   I +L+ S+  LDK R+++E+NYML+YG+A  SL LL K
Sbjct  239   ILRGVRIAGRLRFRFARETAHFIKELASSISRLDKGRILLEMNYMLAYGSAEASLRLLWK  298

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  A+YL  Q   ++   ++ML+ LFS+LD L++  RP   SLW+A+LAFH 
Sbjct  299   FGLLEILLPIQASYLISQGFRRRDRRSNMLLTLFSTLDNLLAPNRPCHSSLWIAILAFHK  358

Query  1256  TLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSE---DE  1423
              LV+ P+  LVV   + +V    +    +   R+  +      PE+ D +    E   DE
Sbjct  359   ALVDRPRDPLVVAAFSIAVHCGGSLSDVLGIVRKISQPHDTRFPELLDQNIESDEALLDE  418

Query  1424  LAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKI  1564
             +      +   +  +TD   +     ++  +  S LVF+S  + +K+
Sbjct  419   MMDLATYVEAALQEMTDEHFVSRALIEYPQAPKSDLVFISWTLAQKV  465



>ref|XP_010929642.1| PREDICTED: uncharacterized protein LOC105051064 isoform X1 [Elaeis 
guineensis]
Length=548

 Score =   326 bits (835),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 183/400 (46%), Positives = 253/400 (63%), Gaps = 10/400 (3%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+ ++  GI  S I+  +  VLN L+KKG+  YLVGGCVRDLI+ R PKDFD+IT+A 
Sbjct  82    WKKMSSKDLGIKTSMIAKPTRSVLNALRKKGYDVYLVGGCVRDLIMKRTPKDFDIITSAE  141

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F R  IVG+RFPIC V+   S+VEVSSF T  NK +     +S  P     C+
Sbjct  142   LKEVEKTFSRCNIVGKRFPICHVYCNNSIVEVSSFSTPLNKPNHDMTYSSRRP----DCD  197

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D +RWRN L RDFTIN L ++PF   +YDY   M D+K  K+RT+IPA  SF+EDCAR
Sbjct  198   KQDYMRWRNCLGRDFTINGLMFNPFSNSVYDYLGGMEDLKKAKVRTVIPAHTSFQEDCAR  257

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F FS ET  ++  L+ SV+ LDK R++ME+NYML+YG+A  SL LL +
Sbjct  258   ILRAIRIAARLGFRFSKETAYSVRDLASSVLGLDKGRILMEMNYMLAYGSAEASLRLLWR  317

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  AAY   Q   ++   ++ML+ LF +LD+L++ +RP   SLWV LLAFH 
Sbjct  318   FGLLELLLPIQAAYFVSQGFRRRDKRSNMLLTLFFNLDKLLAPDRPCHNSLWVGLLAFHQ  377

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              LV  P+  LVV T    +++  +  + VE AR       +  PE+        +DEL K
Sbjct  378   ALVRQPRDPLVVATFTLALHNGGDLAEAVEIARAINYPHDVSFPELLQPQRWEMDDELVK  437

Query  1433  RVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFV  1540
              V ++A  VN     +TD   + +  +K+  +  S LVF+
Sbjct  438   EVVDLASAVNAALSSMTDEYFVSKAMAKYPRAPCSDLVFI  477



>ref|XP_006485116.1| PREDICTED: uncharacterized protein LOC102608253 isoform X2 [Citrus 
sinensis]
Length=523

 Score =   325 bits (832),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 194/461 (42%), Positives = 276/461 (60%), Gaps = 18/461 (4%)
 Frame = +2

Query  368   LDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNE  547
             L+A+  GI+ S I   +  VLN LKKKG++ YLVGGCVRDL+LNRIPKDFD+IT+A L E
Sbjct  68    LNAKDLGISTSMIDKPTRKVLNGLKKKGYEVYLVGGCVRDLMLNRIPKDFDIITSAELKE  127

Query  548   IKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESD  727
             + + F + EIVG+RFPIC VH   ++VEVSSF T    G    R   +  + P GC+E D
Sbjct  128   VVRVFSQCEIVGKRFPICHVHFEDTIVEVSSFST---SGRRFSRDFKYEFQRPIGCDEKD  184

Query  728   VIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilr  907
              IRWRN L RDFTIN L +DP+   IYDY   + DI+  K++T+IPA  SF+EDCARILR
Sbjct  185   FIRWRNCLQRDFTINGLMFDPYAKIIYDYIGGIEDIRKAKVQTVIPASTSFQEDCARILR  244

Query  908   glrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNL  1087
              +R+AARL F FS ET   +  LSPS++ LD+ RL+ME+NYML+YG+A  SL LL K+ L
Sbjct  245   AIRIAARLGFRFSRETAHFVKHLSPSILKLDRGRLLMEMNYMLAYGSAEASLRLLWKFGL  304

Query  1088  LEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLV  1264
             LEVLLP  AAYL +    ++   ++ML+ LFS+LD+L++ +RP   SLW+A+LAFH  L 
Sbjct  305   LEVLLPIQAAYLVKHGFRRRDKRSNMLLSLFSNLDKLLAPDRPCHSSLWIAILAFHKALS  364

Query  1265  NNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEI---SDSDGSMSEDELAK  1432
             + P+  LVV   +  +Y+  +  + V+ AR+  K+      E+    D D    + E+  
Sbjct  365   DQPRDPLVVAVFSLAVYNGGDMLEAVKIARRINKSHDESFCELLEPRDLDFEALKHEVMD  424

Query  1433  RVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSL  1612
               E+    ++ +TD   + +  + +S +  S LVF+   +  K +  ++F  +       
Sbjct  425   LAESSKGALSKMTDEYFVSQAMAGYSRAPFSDLVFIPLALYLKAI--KIFECMRGGAERR  482

Query  1613  NEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                    KI   S   G+          E R   ++I+ DT
Sbjct  483   FASKQGSKIDYESLAYGS--------PQEVRHTFARIVFDT  515



>ref|XP_008454134.1| PREDICTED: uncharacterized protein LOC103494627 isoform X1 [Cucumis 
melo]
Length=538

 Score =   325 bits (833),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 196/465 (42%), Positives = 288/465 (62%), Gaps = 23/465 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+ L +   GI  S IS ++ VVL+ L+K+G++ YLVGGCVRDLIL RIPKDFDVIT+A+
Sbjct  73    WKALSSEDLGIDSSMISKATRVVLDGLRKQGYEVYLVGGCVRDLILKRIPKDFDVITSAQ  132

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F R  +VG+RFPIC VH+ G+ VEVSSF T  ++       N+++ + P   +
Sbjct  133   LKEVRKIFARCLVVGKRFPICHVHVSGTFVEVSSFSTSGSRNGF----NNYINK-PSNLS  187

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW N   RDFTINSL YDP+   +YDY  AM DI+  K+RT+ PA LSF EDCAR
Sbjct  188   EPDYIRWENCSRRDFTINSLMYDPYNKVVYDYLGAMEDIRKSKVRTVKPANLSFTEDCAR  247

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRG+R+AARL F F+ +   +I +LS SV+ LDK RL+ME+NYML++G+A  SL LL +
Sbjct  248   ILRGVRIAARLGFHFTKDIALSIKELSCSVLKLDKGRLLMEMNYMLAFGSAEASLRLLWR  307

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  A+Y   Q   ++ + ++ML+ LFS+LD+LV+  RP   SLW+ALLAFH 
Sbjct  308   FGLLEILLPIQASYFVSQGFRRRDARSNMLLILFSNLDKLVAPNRPCHSSLWIALLAFHK  367

Query  1256  TLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              LV+ PQ  +VV  L+ ++    +  + VE A Q++        EI +S+   S+  LA+
Sbjct  368   ALVDQPQDPVVVAALSLAINNGGSLFEAVEIA-QNISQPHASFHEIVESNHKESDYSLAE  426

Query  1433  RVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
             +V ++A  VN     +T++  + +   K+  +  S LVF+S  +   +   ++F  +   
Sbjct  427   QVIDLADSVNTVLWKMTNSQYVSQAMIKYPQAPWSDLVFISQPLSTSVC--KIFECI---  481

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                   +S +  +  P   +   +    G   E R   ++I+ DT
Sbjct  482   ------RSYNKNVSVPKISRINHYALARGNLPEVRHAFARIVFDT  520



>ref|XP_008239544.1| PREDICTED: uncharacterized protein LOC103338135 [Prunus mume]
Length=528

 Score =   325 bits (832),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 199/519 (38%), Positives = 300/519 (58%), Gaps = 39/519 (8%)
 Frame = +2

Query  221   QLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGS  400
             Q +  + ++L+         +G+  ++ T+ +A+       ++   W+KL+++  GIT S
Sbjct  22    QCINKVQLNLVAAMEALDEPEGLFKDNKTNNSANGR---KDVKAPAWKKLNSKELGITTS  78

Query  401   RISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIV  580
              I   +  VLN LK+KG++ YLVGGCVRDLIL R PKDFD+IT+A L E+ + F   EIV
Sbjct  79    MIDKPTRKVLNGLKRKGYEVYLVGGCVRDLILKRTPKDFDIITSAELKEVTRTFSWCEIV  138

Query  581   GRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRD  760
             G+RFPIC VHI  +VVEVSSF   A K    +  N+   + P  C++ D IRWRN L RD
Sbjct  139   GKRFPICHVHISDTVVEVSSFSISARK--YGRHVNADFGK-PVHCDDKDYIRWRNCLQRD  195

Query  761   FTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFS  940
             FTIN L +DP+   +YDY   M DI++ K++T+IPA  SF EDCARILR +R+AARL F 
Sbjct  196   FTINGLMFDPYARIVYDYMGGMEDIRNAKVQTVIPASTSFREDCARILRAIRIAARLGFR  255

Query  941   FSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAY  1120
              S ET  ++  LS S++ LDK RL+ME+NYML+YG+A  SL LL K+ LLE+LLP  AAY
Sbjct  256   ISKETAHSVKNLSDSILRLDKGRLLMEMNYMLAYGSAEASLRLLWKFGLLELLLPIQAAY  315

Query  1121  LTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLT  1297
               +    ++   T+ML+ LFS+LD+L+S ++P   SLWVA+LAFH  L   P+  LVV  
Sbjct  316   FVRHGFRRRDKRTNMLLSLFSNLDKLLSPDKPCHSSLWVAILAFHRALSEQPRDPLVVAA  375

Query  1298  LASVMYH-RNWKQGVEFARQHVKAASLYVPEIS---DSDGSMSEDELAKRVENMAVQVNM  1465
              +  +++  +  + V  AR   K   +   E+S   D +    +DE+     ++   +N 
Sbjct  376   FSLAIHNGGDMLEAVNIARGITKLHDVSFNELSETQDLNPRALKDEVVNLATSLKRALNH  435

Query  1466  LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQN  1645
             +TD   + E  + +  + +S LVF+   +   + V  VF  +T+                
Sbjct  436   MTDEQIVSEAMAGYPQAPYSDLVFIPWGL--SLRVSRVFSCVTS----------------  477

Query  1646  PSPQKGTAHKKGNGIAHET---------RFLLSKIILDT  1735
                ++G   K+G+ I +E+         R + ++++ DT
Sbjct  478   -GAERGFVPKQGSKIDYESLAAGNLPEVRHIFARVVFDT  515



>ref|XP_010066437.1| PREDICTED: uncharacterized protein LOC104453547 isoform X3 [Eucalyptus 
grandis]
Length=532

 Score =   324 bits (830),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 178/409 (44%), Positives = 260/409 (64%), Gaps = 11/409 (3%)
 Frame = +2

Query  356   NWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTA  535
              W+KL +   GI  S IS  + VVLN LKKKG++ YLVGGCVRDLIL R PKDFD+IT+A
Sbjct  71    QWKKLSSVELGIRSSMISKPTRVVLNALKKKGYEVYLVGGCVRDLILKRTPKDFDIITSA  130

Query  536   RLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
              L +++  F R E++GRRFPIC VH+  +++EVSSF T         R N    + P GC
Sbjct  131   ELKQVRNTFSRCEVIGRRFPICHVHVDETIIEVSSFSTSGRNSFGGLRNNV---KRPPGC  187

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
              E D +RW+N L RDFT+N LF+DP+   IYDY   M DIK  K+RT+IPA LSF EDCA
Sbjct  188   GERDFMRWKNCLKRDFTVNGLFFDPYAKIIYDYVGGMEDIKKAKVRTVIPANLSFVEDCA  247

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR  R+A+RL F F+ E   ++  L  SV+ LDK R++MEVNYML++G+   SL LL 
Sbjct  248   RILRAFRVASRLGFRFTREIALSLRVLYRSVLRLDKGRILMEVNYMLAFGSGEASLRLLW  307

Query  1076  KYNLLEVLLPFHAAY-LTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             ++ LLE+LLPF A+Y ++Q+  ++   +++L+ LF+SLD++V  +RP   SLW+A+LAFH
Sbjct  308   RFGLLELLLPFQASYFVSQRFKRRDKGSNLLLSLFASLDKVVGPDRPCHSSLWLAILAFH  367

Query  1253  LTLVNNPQPKLVVLTLASVMYHRNWK--QGVEFARQHVKAASLYVPEISDSDGSMSEDEL  1426
               LV+ P+  L+V    S+  H +    + +E AR   +       E+ +S   +S+  +
Sbjct  368   KALVDKPRDPLIVAAF-SIALHSSGSLLEAIEIARGINQPHDSSYMELQESPVLLSKLAM  426

Query  1427  AKRVENMAVQV-NMLTDADNLREVT---SKFSGSSHSGLVFVSNKMVKK  1561
                V ++A  + ++L    ++R V+   S +  +  + LVFV   ++++
Sbjct  427   RDEVVDLAASIKDILFKMTSVRYVSQAMSMYPQAPRTDLVFVPEALLQR  475



>ref|XP_009779994.1| PREDICTED: uncharacterized protein LOC104229113 isoform X2 [Nicotiana 
sylvestris]
Length=520

 Score =   323 bits (827),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 196/474 (41%), Positives = 283/474 (60%), Gaps = 44/474 (9%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL +   GI+ S I+  + VVLN LKKKGF+ YLVGGCVRDL+LN+ PKDFD+IT+A 
Sbjct  68    WKKLSSEELGISTSMIAKPTRVVLNGLKKKGFEVYLVGGCVRDLLLNKTPKDFDIITSAE  127

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ K F R EIVGRRFPIC VH+  ++VEVSSF+T    G   KR +  V R P  C+
Sbjct  128   LKEVLKTFQRCEIVGRRFPICHVHVDDTIVEVSSFNTT---GRRFKRNSYNVVRRPAMCD  184

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E+D IRW+N L RDFTIN L +DPF   +YDY   + DI+  K+R +IPA  SF EDCAR
Sbjct  185   EADFIRWKNCLGRDFTINGLMFDPFARIVYDYLGGLEDIRRAKVRCVIPASASFIEDCAR  244

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRG+R+A RL F FS ET   + +L+ S+  LDK R++ME+NYML+YG+A  SL LL K
Sbjct  245   ILRGVRIAGRLGFRFSRETAHFVKELASSISKLDKGRILMEMNYMLAYGSAEASLRLLWK  304

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLT  1258
             + LLE+LLP       ++ DK+S   +ML+ LFS+LD L++ +RP   SLW+A+LAFH  
Sbjct  305   FGLLEILLPIQG---FRRRDKRS---NMLLSLFSTLDNLLAPDRPCHSSLWIAILAFHKA  358

Query  1259  LVNNPQPKLVVLTLASVMYHRNWKQGV-----EFARQH-VKAASLYVPEISDSDGSMSED  1420
             LV+ P+  LVV   ++ ++       V     + ++ H  + + L    I +SD ++  D
Sbjct  359   LVDRPRDPLVVAAFSAAVHCGGSLSDVLGVAGKISQPHDTRFSELLDFRIVESDEALL-D  417

Query  1421  ELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
             E+      +   +  +TD   + +  +++  +  S LVF+   + +K  V+ +F      
Sbjct  418   EMMDLATYVEAALRKMTDEYFISQALTEYPQAPKSDLVFIPWALSQK--VDAIF------  469

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGN---------GIAHETRFLLSKIILDT  1735
                     C  +      +KG   K+G+         G  HE R + ++++ DT
Sbjct  470   -------ECVRR----GKEKGFRQKRGSKIDYESLALGKLHEIRHIFARVVFDT  512



>ref|XP_011042946.1| PREDICTED: uncharacterized protein LOC105138540 [Populus euphratica]
 ref|XP_011042947.1| PREDICTED: uncharacterized protein LOC105138540 [Populus euphratica]
Length=515

 Score =   322 bits (826),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 196/507 (39%), Positives = 287/507 (57%), Gaps = 38/507 (7%)
 Frame = +2

Query  257   KFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNV  436
             +F+  +A + + ++    +    N   G  +   W+KL ++  G++ S IS  +  VLN 
Sbjct  28    RFSSVAAIETLDVQENVIKGNSRNL--GDCKAPEWKKLSSKELGLSNSLISMPTKKVLNG  85

Query  437   LKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIR  616
             LKK G++ YLVGGCVRDLIL RIPKDFD+IT+A L ++ + F R EIVG+ FPIC VH+ 
Sbjct  86    LKKNGYEVYLVGGCVRDLILKRIPKDFDIITSAELKQVVRAFSRCEIVGKWFPICHVHVG  145

Query  617   GSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFV  796
              ++VEVSSF T   K     R +   P     C+E D +RW+N L RDFTIN L +DPF 
Sbjct  146   DTIVEVSSFSTTGRKFKVDLRNDIICP---LDCDEKDYVRWKNCLQRDFTINGLMFDPFK  202

Query  797   YQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKL  976
               +YDY   + DIK  K+RT+IPA +SF+EDCARILR +R AARL F F+ ET   +  L
Sbjct  203   RIVYDYMGGLEDIKKAKVRTVIPAGISFQEDCARILRAVRNAARLGFRFTRETAHFVKNL  262

Query  977   SPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDT  1156
             S S++ LDK R+MME+NYML+YG+A  SL +L K+ LLE+LLP  AAY  +   K+    
Sbjct  263   SHSLLRLDKPRIMMEMNYMLAYGSAEASLRILWKFGLLELLLPIQAAYFVRDGFKRRDRR  322

Query  1157  S-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWK  1330
             S ML+ LFS+LD+L++ +RP   SLWV +LAFH  L + P+  +VV      +++  +  
Sbjct  323   SNMLLCLFSNLDKLLAPDRPCHSSLWVGILAFHKALADQPRDPIVVAAFCLAVHNGGDIL  382

Query  1331  QGVEFARQHVKAASLYVPEIS---DSDGSMSEDELAKRVENMAVQVNMLTDADNLREVTS  1501
              GV  AR+  K   +   E++   D D  M  DE+     ++   +N +TD   +    +
Sbjct  383   GGVNMARKITKPHDISFHELTEPRDLDSDMLIDEVVDFAASVKQVLNWMTDEYYVSLAMA  442

Query  1502  KFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKG  1681
             ++  + +S LVF    +  ++    +F              CS       P+KG   K+G
Sbjct  443   EYPQAPYSDLVFFPLAVYLRVC--RIF-------------ECS----RDGPEKGFTPKRG  483

Query  1682  NGIAH---------ETRFLLSKIILDT  1735
               I +         E R   ++++ DT
Sbjct  484   RKIDYEMLGLGSLQEVRHAFARVVFDT  510



>ref|XP_009604528.1| PREDICTED: uncharacterized protein LOC104099282 isoform X2 [Nicotiana 
tomentosiformis]
Length=520

 Score =   323 bits (827),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 199/475 (42%), Positives = 282/475 (59%), Gaps = 46/475 (10%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL +   GI+ S I+  + VVLN LKKKGF+ YLVGGCVRDL+LN+ PKDFD+IT+A 
Sbjct  68    WKKLSSEELGISTSMIAKPTRVVLNGLKKKGFEVYLVGGCVRDLLLNKTPKDFDIITSAE  127

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSF-VPRMPKGC  715
             L E+ K F R EIVGRRFPIC VH+  ++VEVSSF+T   +     R+NS+ V R P  C
Sbjct  128   LKEVLKTFQRCEIVGRRFPICHVHVDDTIVEVSSFNTTGRRF----RRNSYNVVRRPATC  183

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
             +E+D IRW+N L RDFTIN L +DPF   +YDY   + DI+  K+R +IPA  SF EDCA
Sbjct  184   DEADFIRWKNCLGRDFTINGLMFDPFARIVYDYLGGLEDIRRAKVRCVIPASASFVEDCA  243

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILRG+R+A RL F FS ET   + +L+ S+  LDK R++ME+NYML+YG+A  SL LL 
Sbjct  244   RILRGVRIAGRLGFRFSRETAHFVKELASSISRLDKGRILMEMNYMLAYGSAEASLRLLW  303

Query  1076  KYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             K+ LLE+LLP       ++ DK+S   +ML+ LFS+LD L++ +RP   SLW+A+LAFH 
Sbjct  304   KFGLLEILLPIQG---FRRRDKRS---NMLLTLFSTLDNLLAPDRPCHSSLWIAILAFHK  357

Query  1256  TLVNNPQPKLVVLTLASVMYH--RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELA  1429
              LV+ P+  LVV    SV  H   +    +  AR+  +       E+ D     S++ L 
Sbjct  358   ALVDRPRDPLVVAAF-SVAVHCGGSLSDVLGVARKISQPHDTRFSELLDFRIVESDEALL  416

Query  1430  KRVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTN  1597
               + ++A  V      +TD   +    +++  +  S LVF+   + +K  V+ +F     
Sbjct  417   DEMMDLATYVEAALRKMTDEHFISRALTEYPQAPKSDLVFIPWALSQK--VDAIF-----  469

Query  1598  DVTSLNEKSCSLKIQNPSPQKGTAHKKGN---------GIAHETRFLLSKIILDT  1735
                      C  +      +KG   K+G+         G  HE R + ++++ DT
Sbjct  470   --------ECVRR----GKEKGFRRKRGSKIDYESLALGKLHEIRHIFARVVFDT  512



>ref|XP_010113247.1| Poly(A) polymerase [Morus notabilis]
 gb|EXC35254.1| Poly(A) polymerase [Morus notabilis]
Length=768

 Score =   330 bits (845),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 198/443 (45%), Positives = 268/443 (60%), Gaps = 65/443 (15%)
 Frame = +2

Query  425   VLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICR  604
             ++ V K  GF AYLVGGCVRDL+LN+IPKDFDVITTA L++IKKQF RA IVG+RFPICR
Sbjct  6     LIPVCKGPGFDAYLVGGCVRDLLLNKIPKDFDVITTANLDQIKKQFRRAIIVGQRFPICR  65

Query  605   VHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFY  784
             VHI+GSV E      +   G   K+KN   P+  K          + +L    T  S   
Sbjct  66    VHIQGSVTE-----WLNRMG---KKKNLISPKHHKAVE-------KETLCSGETPRS---  107

Query  785   DPFVYQIYDYANAMADIKSQKLRTL-IPAQLSFEEDCarilrglrlaarlKFSFSMETET  961
                     + +  +A I    LR L I A+L                     SFS +TET
Sbjct  108   --------ETSQLIARI----LRGLRIAARLGL-------------------SFSKDTET  136

Query  962   AIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADK  1141
             AI+ LS S++ L ++R+MME+NYMLSYGAA PSLCLLQK+NLL+++LP HAAYL QQA K
Sbjct  137   AIYDLSSSILKLARARIMMELNYMLSYGAAKPSLCLLQKFNLLKIVLPIHAAYLEQQASK  196

Query  1142  QSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH  1318
             +S + S MLM+LF +LD++VSC+RP+   LWV LLAFHL LVNNPQ   VVL  AS+ YH
Sbjct  197   KSDENSLMLMELFFNLDKVVSCDRPSDCRLWVGLLAFHLALVNNPQDPFVVLAFASIFYH  256

Query  1319  RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMA--VQ--VNMLTDADNL  1486
              +WK+G+ FA+++ +    + PE+S S    S+ +L + V  +A  VQ  +++LTD ++L
Sbjct  257   GDWKEGIRFAKENAEVKVNFAPELSRSFTFKSDKQLVEEVSQLASFVQDSIDVLTDTESL  316

Query  1487  REVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGT  1666
              E  S +  S  SGLVFVS K+ + + V  +F +L N +    ++  +  +         
Sbjct  317   FESMSSYPTSPCSGLVFVSKKVGQDVAV--LFELLVNHIGCYEKRRENFDVD--------  366

Query  1667  AHKKGNGIAHETRFLLSKIILDT  1735
              H  G G   ETRF+L K+IL+T
Sbjct  367   YHLLGKGYLWETRFVLGKVILET  389



>gb|KCW64326.1| hypothetical protein EUGRSUZ_G01958 [Eucalyptus grandis]
Length=559

 Score =   323 bits (829),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 178/409 (44%), Positives = 260/409 (64%), Gaps = 11/409 (3%)
 Frame = +2

Query  356   NWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTA  535
              W+KL +   GI  S IS  + VVLN LKKKG++ YLVGGCVRDLIL R PKDFD+IT+A
Sbjct  98    QWKKLSSVELGIRSSMISKPTRVVLNALKKKGYEVYLVGGCVRDLILKRTPKDFDIITSA  157

Query  536   RLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
              L +++  F R E++GRRFPIC VH+  +++EVSSF T         R N    + P GC
Sbjct  158   ELKQVRNTFSRCEVIGRRFPICHVHVDETIIEVSSFSTSGRNSFGGLRNNV---KRPPGC  214

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
              E D +RW+N L RDFT+N LF+DP+   IYDY   M DIK  K+RT+IPA LSF EDCA
Sbjct  215   GERDFMRWKNCLKRDFTVNGLFFDPYAKIIYDYVGGMEDIKKAKVRTVIPANLSFVEDCA  274

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR  R+A+RL F F+ E   ++  L  SV+ LDK R++MEVNYML++G+   SL LL 
Sbjct  275   RILRAFRVASRLGFRFTREIALSLRVLYRSVLRLDKGRILMEVNYMLAFGSGEASLRLLW  334

Query  1076  KYNLLEVLLPFHAAY-LTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             ++ LLE+LLPF A+Y ++Q+  ++   +++L+ LF+SLD++V  +RP   SLW+A+LAFH
Sbjct  335   RFGLLELLLPFQASYFVSQRFKRRDKGSNLLLSLFASLDKVVGPDRPCHSSLWLAILAFH  394

Query  1253  LTLVNNPQPKLVVLTLASVMYHRNWK--QGVEFARQHVKAASLYVPEISDSDGSMSEDEL  1426
               LV+ P+  L+V    S+  H +    + +E AR   +       E+ +S   +S+  +
Sbjct  395   KALVDKPRDPLIVAAF-SIALHSSGSLLEAIEIARGINQPHDSSYMELQESPVLLSKLAM  453

Query  1427  AKRVENMAVQV-NMLTDADNLREVT---SKFSGSSHSGLVFVSNKMVKK  1561
                V ++A  + ++L    ++R V+   S +  +  + LVFV   ++++
Sbjct  454   RDEVVDLAASIKDILFKMTSVRYVSQAMSMYPQAPRTDLVFVPEALLQR  502



>ref|XP_007209947.1| hypothetical protein PRUPE_ppa004759mg [Prunus persica]
 gb|EMJ11146.1| hypothetical protein PRUPE_ppa004759mg [Prunus persica]
Length=493

 Score =   321 bits (823),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 194/473 (41%), Positives = 278/473 (59%), Gaps = 36/473 (8%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+++  GI  S I   +  VLN LK+KG++ YLVGGCVRDLIL R PKDFD+IT+A 
Sbjct  30    WKKLNSKELGIITSMIDKPTRKVLNGLKRKGYEVYLVGGCVRDLILKRTPKDFDIITSAE  89

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F   EIVG+RFPIC VHI  +VVEVSSF   A K     R  S     P  C+
Sbjct  90    LKEVTRTFSWCEIVGKRFPICHVHIGDTVVEVSSFSISARK---YGRNVSADFGKPVHCD  146

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D IRWRN L RDFTIN L +DP+   +YDY   M DI++ K++T+IPA  SF EDCAR
Sbjct  147   DKDYIRWRNCLQRDFTINGLMFDPYARIVYDYMGGMEDIRNAKVQTVIPASTSFREDCAR  206

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F  S ET  ++  LS S++ LDK RL+ME+NYML+YG+A  SL LL K
Sbjct  207   ILRAIRIAARLGFRISKETAYSVKNLSYSILRLDKGRLLMEMNYMLAYGSAEASLRLLWK  266

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  AAY       ++   T+ML+ LFS+LD+L+S ++P   SLWVA+LAFH 
Sbjct  267   FGLLELLLPIQAAYFVSHGFRRRDKRTNMLLSLFSNLDKLLSPDKPCHSSLWVAILAFHK  326

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEIS---DSDGSMSEDE  1423
              L   P+  LVV   +  +++  +  + V  AR+  K   +   E+S   D +    +DE
Sbjct  327   ALSEQPRDPLVVAVFSLAIHNGGDMLEAVNIARRITKLHDVSFNELSETQDLNPRALKDE  386

Query  1424  LAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDV  1603
             +     ++   +N +TD   + E  + +  + +S LVF+   +   + V  VF  +T+  
Sbjct  387   VVNLATSLKRALNHMTDEQIVSEAMAGYPQAPYSDLVFIPWGL--SLRVSRVFSCVTS--  442

Query  1604  TSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHET---------RFLLSKIILDT  1735
                              ++G   K+G+ I +E+         R + ++++ DT
Sbjct  443   ---------------GAERGFVPKQGSKIDYESLAVGNLPEVRHIFARVVFDT  480



>ref|XP_011013323.1| PREDICTED: uncharacterized protein LOC105117373 [Populus euphratica]
Length=515

 Score =   322 bits (824),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 193/480 (40%), Positives = 277/480 (58%), Gaps = 36/480 (8%)
 Frame = +2

Query  338   GKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDF  517
             G  +   W+KL ++  G++ S IS  +  VLN LKK G++ YLVGGCVRDLIL RIPKDF
Sbjct  53    GDCKAPEWKKLSSKELGLSNSLISMPTKKVLNGLKKNGYEVYLVGGCVRDLILKRIPKDF  112

Query  518   DVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVP  697
             D+IT+A L ++ + F R EIVG+ FPIC VH+  ++VEVSSF T   K     R +   P
Sbjct  113   DIITSAELKQVVRAFSRCEIVGKWFPICHVHVGDTIVEVSSFSTTGRKFKVDLRNDIICP  172

Query  698   RMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLS  877
                  C+E D +RW+N L RDFTIN L +DPF   +YDY   + DIK  K+RT+IPA +S
Sbjct  173   ---LDCDEKDYVRWKNCLQRDFTINGLMFDPFKRIVYDYMGGLEDIKKAKVRTVIPAGIS  229

Query  878   FEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVP  1057
             F+EDCARILR +R+AARL F F+ ET   +  LS S++ LDK R+MME+NYML+YG+A  
Sbjct  230   FQEDCARILRAVRIAARLGFRFTRETAHFVKNLSHSLLRLDKPRIMMEMNYMLAYGSAEA  289

Query  1058  SLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWV  1234
             SL +L K+ LLE+LLP  AAY  +   K+    S ML+ LFS+LD+L++ +RP   SLWV
Sbjct  290   SLRILWKFGLLELLLPIQAAYFVRDGFKRRDRRSNMLLCLFSNLDKLLAPDRPCHSSLWV  349

Query  1235  ALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEIS---DSD  1402
              +LAFH  L + P+  +VV      +++  +   GV  AR+  K   +   E++   D D
Sbjct  350   GILAFHKALADQPRDPIVVAAFCLAVHNGGDILGGVNMARKITKPHDISFHELTEPRDLD  409

Query  1403  GSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVF  1582
               M  DE+     ++   +N +TD   +    +++  + +S LVF    +  ++    +F
Sbjct  410   SDMLIDEVVDFAASVKQVLNWMTDEYYVSLAMAEYPQAPYSDLVFFPLAVYLRVC--RIF  467

Query  1583  GILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
                           CS       P+KG   K+G  I +         E R   ++++ DT
Sbjct  468   -------------ECS----RDGPEKGFTPKRGRKIDYEMLGLGSLQEVRHAFARVVFDT  510



>emb|CDO98660.1| unnamed protein product [Coffea canephora]
Length=519

 Score =   322 bits (824),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 188/478 (39%), Positives = 276/478 (58%), Gaps = 42/478 (9%)
 Frame = +2

Query  353   SNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITT  532
             S W+KL++   GI  S I  ++  VLN LK+KGF+ YLVGGCVRDLIL + PKDFD+IT+
Sbjct  59    SQWKKLNSADLGIRSSMIPRTTRAVLNGLKRKGFEVYLVGGCVRDLILRKTPKDFDIITS  118

Query  533   ARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKG  712
             A L E+ + F R EI+G+RFPIC VHI  ++VEVSSF T    G  ++R  S V   P G
Sbjct  119   AELKEVMRTFSRCEIIGKRFPICHVHIGDNIVEVSSFSTC---GRNSRRDFSLVFEKPVG  175

Query  713   CNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
             CNE D IRWRN L RDFTIN L +DP+   IYDY   + DI+  K+RT+IPA  S  EDC
Sbjct  176   CNEKDYIRWRNCLKRDFTINGLMFDPYAKLIYDYIGGVEDIRKAKVRTIIPASFSLTEDC  235

Query  893   arilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLL  1072
             ARILR +R+ ARL+F F+ +T  ++ KL+ S++ LD+ RL+ME+NYML+YG+A  SL LL
Sbjct  236   ARILRAIRIGARLQFRFAKDTALSVKKLTSSILRLDRGRLLMEMNYMLAYGSAESSLRLL  295

Query  1073  QKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAF  1249
              ++ LLE+LLP  AAY       ++   ++ML+ +FSSLD+ ++ +RP   SLWVALL F
Sbjct  296   WRFGLLEILLPIQAAYFVDSGFRRRDKRSNMLLSIFSSLDKCLAPDRPCHSSLWVALLVF  355

Query  1250  HLTLVNNP-QPKLVVLTLASVMYHRNWKQGVEFA-----RQHVKAASLYVPEISDSDGSM  1411
             H  L ++P  P +V     +V    +  +  + A     R       L  P+  D D  +
Sbjct  356   HRALFDHPSDPSVVAAFCLAVNNGGDLSEASDIAKRITRRHDTNFVELLEPQDLDFDSLV  415

Query  1412  SE-DELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGI  1588
             +E   LA  V++       +TD  ++    +++  + +S +VF+   +  K+   ++F  
Sbjct  416   AEVKHLAALVQDTLAN---MTDEYSVSRAMAQYPKAPYSDIVFIPLALYLKVC--KIF--  468

Query  1589  LTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
                            +      ++G   K+G+ I H         E R + ++++ D 
Sbjct  469   ---------------ECVRAGKERGFVPKQGSKIHHELLALGSLQEVRHVFARVVFDA  511



>ref|XP_009790370.1| PREDICTED: uncharacterized protein LOC104237840 isoform X1 [Nicotiana 
sylvestris]
Length=507

 Score =   321 bits (822),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 198/482 (41%), Positives = 279/482 (58%), Gaps = 47/482 (10%)
 Frame = +2

Query  347   EFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVI  526
             E + W++ +++  GI+ S I+  + VVLN LK KGF+ YLVGGCVRDLIL R PKDFD+I
Sbjct  43    EPAEWKRFNSKELGISSSMIAKPTRVVLNGLKSKGFEVYLVGGCVRDLILKRTPKDFDII  102

Query  527   TTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMP  706
             TTA L E+++ F   EIVGRRFPIC VH+   VVEVSSF T    G  ++R  S     P
Sbjct  103   TTAELKEVRRTFSHCEIVGRRFPICHVHVDTEVVEVSSFHT---SGIRSERGLSLSFEKP  159

Query  707   KGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEE  886
               C+E D  RWRN LHRDFTIN L +DP+   +YDY   + DI+  K+RT+ PA  SF E
Sbjct  160   VDCDEKDHFRWRNCLHRDFTINGLMFDPYSKFVYDYMGGVDDIRKAKVRTIGPASFSFIE  219

Query  887   DCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLC  1066
             DCARILR +R+AARL F F  ET  +I  LS SV+ LD+ RL+ME+NYML+YG+A  SL 
Sbjct  220   DCARILRAVRIAARLGFRFGRETALSIKNLSSSVLRLDRGRLLMEMNYMLAYGSAEASLR  279

Query  1067  LLQKYNLLEVLLPFHAAYLT----QQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWV  1234
             LL K+ LLE+LLP  AAY      ++ DK+S   +ML+ LFS+LD+L++ +RP   SLWV
Sbjct  280   LLWKFGLLEILLPIQAAYFVYYGFRRRDKRS---NMLLSLFSNLDKLLAPDRPCHSSLWV  336

Query  1235  ALLAFHLTLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFAR----QHVKAASLYVPEISDS  1399
             A+LAFH  L + P+  LVV      V    +  + +  A+    QH    S +  E  D 
Sbjct  337   AILAFHKALSDQPRDPLVVAAFVLGVHNGGDLSEALSIAKRISTQH--DGSFHELESQDL  394

Query  1400  DGSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEV  1579
             D +  ++E+ +   ++   +  +TD   +    + +  + +S LVF+             
Sbjct  395   DLAALKEEVVELATSVQRALTNMTDEYFVSRAMTNYPKAPYSDLVFIP------------  442

Query  1580  FGILTNDVTSLNEKSCSL-KIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIIL  1729
                      +L  +SC + +      +KG   K+G+ I +         E R + ++I+ 
Sbjct  443   --------LALYLRSCKVFQCVRMGKEKGFVAKQGSKIDYELLALGSLQEVRHVFARIVF  494

Query  1730  DT  1735
             DT
Sbjct  495   DT  496



>ref|XP_004228444.1| PREDICTED: putative CCA tRNA nucleotidyltransferase 2 [Solanum 
lycopersicum]
Length=514

 Score =   321 bits (822),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 182/424 (43%), Positives = 261/424 (62%), Gaps = 8/424 (2%)
 Frame = +2

Query  308   DRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRD  487
             +R+ +++   G  +   W+KL +   GI+ S I+  + +VLN LKKKGF+ YLVGGCVRD
Sbjct  39    NRSYNASDGKGDGDAPKWKKLSSEELGISTSMIAKPTRLVLNGLKKKGFEVYLVGGCVRD  98

Query  488   LILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGD  667
             LIL+R PKDFDV+T+A L E+ K F R EIVGRRFPIC VHI  ++VEVSSF      G 
Sbjct  99    LILDRTPKDFDVLTSAELKEVLKIFQRCEIVGRRFPICHVHIDDTIVEVSSFTAT---GR  155

Query  668   ETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQK  847
             + KR    + R P  C+E+D IRW+N L RDFTIN L +DPF   +YDY   + DI+  K
Sbjct  156   KFKRNGYNIVRRPPACSEADFIRWKNCLARDFTINGLMFDPFTKIVYDYLGGLEDIRRAK  215

Query  848   LRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVN  1027
             +R +IPA  SF EDCARILRG+R+A RL+F F+ ET  +I +L+ S+  LDK R+++E+N
Sbjct  216   VRCVIPANASFIEDCARILRGVRIAGRLRFRFARETAHSIKELASSISRLDKGRILLEMN  275

Query  1028  YMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSC  1204
             YML+YG+A  SL LL K+ LLE+LLP  A+Y   Q   ++   ++ML+ LFS+LD L++ 
Sbjct  276   YMLAYGSAEASLRLLWKFGLLEILLPIQASYFISQGFRRRDKRSNMLLTLFSTLDNLLAP  335

Query  1205  ERPARESLWVALLAFHLTLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFARQHVKAASLYV  1381
              +P   SLW+A+L FH  LV+ P+  LVV   + +V    +    +   R+  +      
Sbjct  336   NKPCNSSLWIAILTFHKALVDKPRDPLVVAAFSIAVHCGGSLSDVLGIVRKISQPHDTRF  395

Query  1382  PEISDSDGSMSE---DELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKM  1552
             PE+ D +    E   DE+      +   +  +TD   +      +  +  S LVF+S  +
Sbjct  396   PELVDQNIESDEALLDEMMDLATYVEAALQEMTDEHVVSRALIDYPKAPKSDLVFISWAL  455

Query  1553  VKKI  1564
              +K+
Sbjct  456   SQKV  459



>gb|KEH35694.1| tRNA nucleotidyltransferase/poly(A) polymerase [Medicago truncatula]
Length=552

 Score =   322 bits (825),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 195/486 (40%), Positives = 279/486 (57%), Gaps = 23/486 (5%)
 Frame = +2

Query  299   STTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGC  478
             + ++ + D N   G  +   W+K+  +  GI  S I P++  VLN LKK+G+  YLVGGC
Sbjct  62    NASETSTDENSGGGNEKSPAWKKIGTKELGIHNSSIGPAARKVLNGLKKRGYDVYLVGGC  121

Query  479   VRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTV-A  655
             VRDLIL + PKDFD+IT+A L E+ K F   +IVG+RFPIC VH+  ++VEVSSF+T   
Sbjct  122   VRDLILKQTPKDFDIITSAELKEVMKVFSWCKIVGKRFPICHVHMDDTIVEVSSFNTARG  181

Query  656   NKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADI  835
              KG E+        + P  C E D++RW+N L+RDFTIN L  DP+   +YDY   + DI
Sbjct  182   KKGVESSHHT----KAPNSC-EKDLLRWKNCLNRDFTINGLILDPYERVVYDYMGGIEDI  236

Query  836   KSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLM  1015
             +  K+RT+ PA +SF EDCARILR +R+AARL FS S ET   I  LS SV+ LDK RL+
Sbjct  237   RKAKVRTINPADISFREDCARILRAIRIAARLGFSISKETAHFIKNLSSSVLRLDKGRLL  296

Query  1016  MEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQ  1192
             ME+NYML+YG+   SL LL K+ LL++LLPF AAY       ++   T+ML+ LFS+LD+
Sbjct  297   MEINYMLAYGSGEASLRLLWKFGLLDILLPFQAAYFAHHGFRRRDKRTNMLLSLFSNLDK  356

Query  1193  LVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAA  1369
             L++  RP   SLW A+LA H  L + P+  LVV   +  +++  N  + V  A    KA 
Sbjct  357   LLAPNRPCYGSLWFAILALHKALSDRPRDPLVVAAFSLAVHNGGNLLEAVNIAGMINKAH  416

Query  1370  SLYVPEISDSDGSMSEDELAKRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVF  1537
              +  PE+ D  G M    L   V ++A  +      +TD   + +  + +  + HS LVF
Sbjct  417   DMRFPELLDPSG-MDAKALEAGVRDLAESIRGTLLQMTDEHFVSQAMADYPQAPHSDLVF  475

Query  1538  VSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLS  1717
             +  ++  K+    +F  +       +     +KI   S          NG   E R + +
Sbjct  476   IPLELYVKVF--NIFECVKRSAVKRSLSKQGMKIDYES--------LANGDIQEIRHVFA  525

Query  1718  KIILDT  1735
             +I+ DT
Sbjct  526   RIVFDT  531



>ref|XP_009790371.1| PREDICTED: uncharacterized protein LOC104237840 isoform X2 [Nicotiana 
sylvestris]
Length=504

 Score =   320 bits (820),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 197/478 (41%), Positives = 277/478 (58%), Gaps = 47/478 (10%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W++ +++  GI+ S I+  + VVLN LK KGF+ YLVGGCVRDLIL R PKDFD+ITTA 
Sbjct  44    WKRFNSKELGISSSMIAKPTRVVLNGLKSKGFEVYLVGGCVRDLILKRTPKDFDIITTAE  103

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+++ F   EIVGRRFPIC VH+   VVEVSSF T    G  ++R  S     P  C+
Sbjct  104   LKEVRRTFSHCEIVGRRFPICHVHVDTEVVEVSSFHT---SGIRSERGLSLSFEKPVDCD  160

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D  RWRN LHRDFTIN L +DP+   +YDY   + DI+  K+RT+ PA  SF EDCAR
Sbjct  161   EKDHFRWRNCLHRDFTINGLMFDPYSKFVYDYMGGVDDIRKAKVRTIGPASFSFIEDCAR  220

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F F  ET  +I  LS SV+ LD+ RL+ME+NYML+YG+A  SL LL K
Sbjct  221   ILRAVRIAARLGFRFGRETALSIKNLSSSVLRLDRGRLLMEMNYMLAYGSAEASLRLLWK  280

Query  1079  YNLLEVLLPFHAAYLT----QQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLA  1246
             + LLE+LLP  AAY      ++ DK+S   +ML+ LFS+LD+L++ +RP   SLWVA+LA
Sbjct  281   FGLLEILLPIQAAYFVYYGFRRRDKRS---NMLLSLFSNLDKLLAPDRPCHSSLWVAILA  337

Query  1247  FHLTLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFAR----QHVKAASLYVPEISDSDGSM  1411
             FH  L + P+  LVV      V    +  + +  A+    QH    S +  E  D D + 
Sbjct  338   FHKALSDQPRDPLVVAAFVLGVHNGGDLSEALSIAKRISTQH--DGSFHELESQDLDLAA  395

Query  1412  SEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGIL  1591
              ++E+ +   ++   +  +TD   +    + +  + +S LVF+                 
Sbjct  396   LKEEVVELATSVQRALTNMTDEYFVSRAMTNYPKAPYSDLVFIP----------------  439

Query  1592  TNDVTSLNEKSCSL-KIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
                  +L  +SC + +      +KG   K+G+ I +         E R + ++I+ DT
Sbjct  440   ----LALYLRSCKVFQCVRMGKEKGFVAKQGSKIDYELLALGSLQEVRHVFARIVFDT  493



>gb|KEH35695.1| tRNA nucleotidyltransferase/poly(A) polymerase [Medicago truncatula]
Length=530

 Score =   320 bits (821),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 192/466 (41%), Positives = 271/466 (58%), Gaps = 23/466 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+  +  GI  S I P++  VLN LKK+G+  YLVGGCVRDLIL + PKDFD+IT+A 
Sbjct  60    WKKIGTKELGIHNSSIGPAARKVLNGLKKRGYDVYLVGGCVRDLILKQTPKDFDIITSAE  119

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTV-ANKGDETKRKNSFVPRMPKGC  715
             L E+ K F   +IVG+RFPIC VH+  ++VEVSSF+T    KG E+        + P  C
Sbjct  120   LKEVMKVFSWCKIVGKRFPICHVHMDDTIVEVSSFNTARGKKGVESSHHT----KAPNSC  175

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
              E D++RW+N L+RDFTIN L  DP+   +YDY   + DI+  K+RT+ PA +SF EDCA
Sbjct  176   -EKDLLRWKNCLNRDFTINGLILDPYERVVYDYMGGIEDIRKAKVRTINPADISFREDCA  234

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR +R+AARL FS S ET   I  LS SV+ LDK RL+ME+NYML+YG+   SL LL 
Sbjct  235   RILRAIRIAARLGFSISKETAHFIKNLSSSVLRLDKGRLLMEINYMLAYGSGEASLRLLW  294

Query  1076  KYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             K+ LL++LLPF AAY       ++   T+ML+ LFS+LD+L++  RP   SLW A+LA H
Sbjct  295   KFGLLDILLPFQAAYFAHHGFRRRDKRTNMLLSLFSNLDKLLAPNRPCYGSLWFAILALH  354

Query  1253  LTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELA  1429
               L + P+  LVV   +  +++  N  + V  A    KA  +  PE+ D  G M    L 
Sbjct  355   KALSDRPRDPLVVAAFSLAVHNGGNLLEAVNIAGMINKAHDMRFPELLDPSG-MDAKALE  413

Query  1430  KRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTN  1597
               V ++A  +      +TD   + +  + +  + HS LVF+  ++  K+    +F  +  
Sbjct  414   AGVRDLAESIRGTLLQMTDEHFVSQAMADYPQAPHSDLVFIPLELYVKVF--NIFECVKR  471

Query  1598  DVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                  +     +KI   S          NG   E R + ++I+ DT
Sbjct  472   SAVKRSLSKQGMKIDYES--------LANGDIQEIRHVFARIVFDT  509



>ref|XP_009607914.1| PREDICTED: uncharacterized protein LOC104102017 isoform X3 [Nicotiana 
tomentosiformis]
Length=507

 Score =   320 bits (819),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 192/479 (40%), Positives = 279/479 (58%), Gaps = 41/479 (9%)
 Frame = +2

Query  347   EFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVI  526
             E + W++ +++  GI+ S I+  + VVLN LK KGF+ YLVGGCVRDLIL R PKDFD+I
Sbjct  43    EPAEWKRFNSKELGISSSMIAKPTRVVLNGLKSKGFEVYLVGGCVRDLILKRTPKDFDII  102

Query  527   TTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMP  706
             TTA L E+++ F R EIVGRRFPIC VH+   VVEVSSF T    G  ++R  S     P
Sbjct  103   TTAELKEVRRTFSRCEIVGRRFPICHVHVDNEVVEVSSFHT---SGIRSERGLSLSFEKP  159

Query  707   KGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEE  886
               C+E D  RWRN LHRDFTIN L +DP+   +YDY   + DI+  K+RT+ PA  S  E
Sbjct  160   VDCDEKDHFRWRNCLHRDFTINGLMFDPYSKFVYDYMGGVDDIRKAKVRTIGPASFSLIE  219

Query  887   DCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLC  1066
             DCARILR +R+AARL F F  ET  +I  LS SV+ LD+ RL+ME+NYML+YG+A  SL 
Sbjct  220   DCARILRAIRIAARLGFRFGRETALSIKNLSSSVLRLDRGRLLMEMNYMLAYGSAEASLR  279

Query  1067  LLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALL  1243
             LL K+ LLE+LLP  AAY  +    ++   ++ML+ LFS+LD+L++ +RP   SLWVA+L
Sbjct  280   LLWKFGLLEILLPVQAAYFVRYGFRRRDKRSNMLLSLFSNLDKLLAPDRPCHSSLWVAIL  339

Query  1244  AFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFAR----QHVKAASLYVPEISDSDGS  1408
             AFH  + + P+  LVV      +++  +  + +  A+    QH    S +  E  D D +
Sbjct  340   AFHKAISDQPRDPLVVAAFGLGIHNGGDLSEALSIAKRISTQH--DGSFHELESQDLDLA  397

Query  1409  MSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGI  1588
               ++E+ +   ++   +  +TD   +    + +  + +S LVF+                
Sbjct  398   ALKEEVVELATSVQRALTNMTDEYFVSRAMTNYPKAPYSDLVFIP---------------  442

Query  1589  LTNDVTSLNEKSCSL-KIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
                   +L  ++C + +      +KG   K+G+ I +         E R + ++I+ DT
Sbjct  443   -----LALYLRTCKVFQCVRMGKEKGFVAKQGSKIDYELLALGSLQEVRHVFARIVFDT  496



>ref|XP_006436933.1| hypothetical protein CICLE_v10031219mg [Citrus clementina]
 gb|ESR50173.1| hypothetical protein CICLE_v10031219mg [Citrus clementina]
Length=445

 Score =   317 bits (813),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 189/442 (43%), Positives = 265/442 (60%), Gaps = 18/442 (4%)
 Frame = +2

Query  425   VLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICR  604
             VLN LKKKG++ YLVGGCVRDL+LNRIPKDFD+IT+A L E+ + F + EIVG+RFPIC 
Sbjct  9     VLNGLKKKGYEVYLVGGCVRDLMLNRIPKDFDIITSAELKEVVRVFSQCEIVGKRFPICH  68

Query  605   VHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFY  784
             VH   ++VEVSSF T    G    R   +  + P GC+E D IRWRN L RDFTIN L +
Sbjct  69    VHFEDTIVEVSSFST---SGRRFSRDFKYEFQRPIGCDEKDFIRWRNCLQRDFTINGLMF  125

Query  785   DPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETA  964
             DP+   IYDY   + DI+  K++T+IPA  SF+EDCARILR +R+AARL F FS ET   
Sbjct  126   DPYAKIIYDYIGGIEDIRKAKVQTVIPASTSFQEDCARILRAIRIAARLGFRFSRETAHF  185

Query  965   IWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQ  1144
             +  LSPS++ LD+ RL+ME+NYML+YG+A  SL LL K+ LLEVLLP  AAYL +   ++
Sbjct  186   VKHLSPSILKLDRGRLLMEMNYMLAYGSAEASLRLLWKFGLLEVLLPIQAAYLVKHGFRR  245

Query  1145  SSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-  1318
                 S ML+ LFS+LD+L++ +RP   SLW+A+LAFH  L + P+  LVV   +  +Y+ 
Sbjct  246   RDKRSNMLLSLFSNLDKLLAPDRPCHSSLWIAILAFHKALSDQPRDPLVVAVFSLAVYNG  305

Query  1319  RNWKQGVEFARQHVKAASLYVPEI---SDSDGSMSEDELAKRVENMAVQVNMLTDADNLR  1489
              +  + V+ AR+  K+      E+    D D    + E+    E+    ++ +TD   + 
Sbjct  306   GDMLEAVKIARRINKSHDESFCELLEPRDLDFEALKHEVMDLAESSKGALSKMTDEYFVS  365

Query  1490  EVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTA  1669
             +  + +S +  S LVF+   +  K +  ++F  +              KI   S   G+ 
Sbjct  366   QAMAGYSRAPFSDLVFIPLALYLKAI--KIFECMRGGAERRFASKQGSKIDYESLAYGS-  422

Query  1670  HKKGNGIAHETRFLLSKIILDT  1735
                      E R   ++I+ DT
Sbjct  423   -------PQEVRHTFARIVFDT  437



>ref|XP_004157007.1| PREDICTED: poly(A) polymerase-like [Cucumis sativus]
Length=532

 Score =   318 bits (816),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 198/469 (42%), Positives = 290/469 (62%), Gaps = 30/469 (6%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+ L     GI  S IS  + +VLN L+K+G++ YLVGGCVRDLIL RIPKDFDVIT+A+
Sbjct  66    WKALSCEDLGIDSSMISKPTRLVLNGLRKQGYEVYLVGGCVRDLILKRIPKDFDVITSAQ  125

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRM--PKG  712
             L E+++ F +  +VG+RFPIC V++ G++VEVSSF T       ++ +N F   +  P  
Sbjct  126   LKEVRRIFSQCLVVGKRFPICHVNVLGTIVEVSSFST-------SRSRNGFNNYINKPSN  178

Query  713   CNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
              +E D IRW N   RDFTINSL YDP+   +YDY  AM DI+  K+RT+ PA LSF EDC
Sbjct  179   LSEPDYIRWENCSQRDFTINSLMYDPYKKVVYDYLGAMEDIRKSKVRTVKPANLSFTEDC  238

Query  893   arilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLL  1072
             ARILRG+RLAARL+F FS +   +I +LS SV+ LDK RL+ME+NYML++G+A  SL LL
Sbjct  239   ARILRGVRLAARLEFRFSKDIALSIKELSCSVLKLDKGRLLMEMNYMLAFGSAEASLRLL  298

Query  1073  QKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAF  1249
              ++ LLE+LLP  A+Y   Q   ++ + ++ML+ LFS+LD+ V+  RP   SLW+ALLAF
Sbjct  299   WRFGLLEILLPIQASYFVSQGFRRRDARSNMLLILFSNLDKFVAPNRPCHSSLWIALLAF  358

Query  1250  HLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDEL  1426
             H  LV+ PQ  +VV   +  ++   +  + VE A Q++    +   EI +S+   S+  L
Sbjct  359   HKALVDQPQDPVVVAAFSLAIHSGGSLYEAVEIA-QNISQPHVSFHEIVESNHKESDYSL  417

Query  1427  AKRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGIL-  1591
              ++V ++A  VN     +T++  +     K+  +  S LVF+S  +   I V ++F  + 
Sbjct  418   VEQVIDLADSVNSVLWKMTNSQYVSRAMIKYPQAPWSDLVFISQSL--SISVCKIFDCVR  475

Query  1592  -TNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               N+  S+ ++  S +I + S   G           E R + ++I+ DT
Sbjct  476   RGNETGSVPKR--SRRINHDSLAMGN--------LSEVRHVFARIVFDT  514



>ref|XP_002318161.2| polynucleotide adenylyltransferase family protein [Populus trichocarpa]
 gb|EEE96381.2| polynucleotide adenylyltransferase family protein [Populus trichocarpa]
Length=515

 Score =   317 bits (813),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 194/507 (38%), Positives = 286/507 (56%), Gaps = 38/507 (7%)
 Frame = +2

Query  257   KFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNV  436
             +F+  +A + + ++    +    N   G  +   W+KL ++  G++ S IS  +  VLN 
Sbjct  28    RFSSVAAIETLDVQENVIKGNSRNL--GDCKAPEWKKLSSKELGLSNSLISMPTKKVLNG  85

Query  437   LKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIR  616
             LKK G++ YLVGGCVRDLIL RIPKDFD+IT+A L E+ + F   EIVG+ FPIC VH+ 
Sbjct  86    LKKNGYEVYLVGGCVRDLILKRIPKDFDIITSAELKEVVRTFSHCEIVGKWFPICHVHVG  145

Query  617   GSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFV  796
              ++VEVSSF T   K     R +   P     C+E D +RW+N L RDFTIN L +DP+ 
Sbjct  146   DTIVEVSSFSTTGRKFKVDLRNDIICP---IDCDEKDYVRWKNCLQRDFTINGLMFDPYK  202

Query  797   YQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKL  976
               +YDY   + DIK  K+RT+IPA +SF+EDCARILR +R+AARL F F+ ET   +  L
Sbjct  203   RIVYDYMGGLEDIKKAKVRTVIPAGISFQEDCARILRAVRIAARLGFRFTRETAHFVKNL  262

Query  977   SPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDT  1156
             S  ++ LDK R+MME+NYML+YG+A  SL +L K+ LLE+LLP  AAY  +   K+    
Sbjct  263   SRLLLRLDKPRIMMEMNYMLAYGSAEASLRILWKFGLLELLLPIQAAYFVRDGFKRRDKR  322

Query  1157  S-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWK  1330
             S ML+ LFS+LD+L++ +RP   SLWV +LAFH  L + P+  +VV      +++  +  
Sbjct  323   SNMLLCLFSNLDKLLAPDRPCHSSLWVGILAFHKALADQPRDPMVVAAFCLAVHNGGDIL  382

Query  1331  QGVEFARQHVKAASLYVPEIS---DSDGSMSEDELAKRVENMAVQVNMLTDADNLREVTS  1501
              GV  AR+  K   +   E++   D D  M  DE+     ++   +N +TD   +    +
Sbjct  383   GGVNMARKITKPHDISFHELTKPQDLDSKMLIDEVVDFAASVKQVLNWMTDEYYVSLAMA  442

Query  1502  KFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKG  1681
             ++  + +S LVF    +  ++    +F              CS       P+KG   K+G
Sbjct  443   EYPQAPYSDLVFFPLAVYLRVC--RIF-------------ECS----RDGPEKGFLPKQG  483

Query  1682  NGIAH---------ETRFLLSKIILDT  1735
               I +         E R   ++++ DT
Sbjct  484   RKIDYEMLGLGGLQEVRHTFARVVFDT  510



>ref|XP_004152154.1| PREDICTED: poly(A) polymerase-like [Cucumis sativus]
 gb|KGN52978.1| hypothetical protein Csa_4G008810 [Cucumis sativus]
Length=539

 Score =   318 bits (815),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 198/469 (42%), Positives = 290/469 (62%), Gaps = 30/469 (6%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+ L     GI  S IS  + +VLN L+K+G++ YLVGGCVRDLIL RIPKDFDVIT+A+
Sbjct  73    WKALSCEDLGIDSSMISKPTRLVLNGLRKQGYEVYLVGGCVRDLILKRIPKDFDVITSAQ  132

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRM--PKG  712
             L E+++ F +  +VG+RFPIC V++ G++VEVSSF T       ++ +N F   +  P  
Sbjct  133   LKEVRRIFSQCLVVGKRFPICHVNVLGTIVEVSSFST-------SRSRNGFNNYINKPSN  185

Query  713   CNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
              +E D IRW N   RDFTINSL YDP+   +YDY  AM DI+  K+RT+ PA LSF EDC
Sbjct  186   LSEPDYIRWENCSQRDFTINSLMYDPYKKVVYDYLGAMEDIRKSKVRTVKPANLSFTEDC  245

Query  893   arilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLL  1072
             ARILRG+RLAARL+F FS +   +I +LS SV+ LDK RL+ME+NYML++G+A  SL LL
Sbjct  246   ARILRGVRLAARLEFRFSKDIALSIKELSCSVLKLDKGRLLMEMNYMLAFGSAEASLRLL  305

Query  1073  QKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAF  1249
              ++ LLE+LLP  A+Y   Q   ++ + ++ML+ LFS+LD+ V+  RP   SLW+ALLAF
Sbjct  306   WRFGLLEILLPIQASYFVSQGFRRRDARSNMLLILFSNLDKFVAPNRPCHSSLWIALLAF  365

Query  1250  HLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDEL  1426
             H  LV+ PQ  +VV   +  ++   +  + VE A Q++    +   EI +S+   S+  L
Sbjct  366   HKALVDQPQDPVVVAAFSLAIHSGGSLYEAVEIA-QNISQPHVSFHEIVESNHKESDYSL  424

Query  1427  AKRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGIL-  1591
              ++V ++A  VN     +T++  +     K+  +  S LVF+S  +   I V ++F  + 
Sbjct  425   VEQVIDLADSVNSVLWKMTNSQYVSRAMIKYPQAPWSDLVFISQSL--SISVCKIFDCVR  482

Query  1592  -TNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               N+  S+ ++  S +I + S   G           E R + ++I+ DT
Sbjct  483   RGNETGSVPKR--SRRINHDSLAMGN--------LSEVRHVFARIVFDT  521



>ref|XP_009390835.1| PREDICTED: uncharacterized protein LOC103977130 [Musa acuminata 
subsp. malaccensis]
Length=560

 Score =   318 bits (815),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 192/473 (41%), Positives = 289/473 (61%), Gaps = 32/473 (7%)
 Frame = +2

Query  353   SNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITT  532
             S W+ L ++  GI  S I   +  VLN L+KKG++ YLVGGCVRDL++ + PKDFD+IT+
Sbjct  93    SEWKMLSSKELGIRSSMIPKPTRTVLNELRKKGYEVYLVGGCVRDLVMKKTPKDFDIITS  152

Query  533   ARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKG  712
             A L E+KK F   +IVG+RFPIC VH+   VVEVSSF+T   K +      S       G
Sbjct  153   ADLREVKKNFSHCDIVGKRFPICHVHVNDYVVEVSSFNTHGRKQNHDLTNFS-----RSG  207

Query  713   CNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
             C+E D +RWRN L RDFTIN L ++P+   +YDY   M DIK+ K+RT+IPA +SF EDC
Sbjct  208   CDEHDYVRWRNCLGRDFTINGLMFNPYSKLVYDYLGGMEDIKNSKVRTVIPANMSFSEDC  267

Query  893   arilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLL  1072
             ARILR +R+AARL F FS ET  ++  L+ SV+ LDK R++ME+NYML+YG+A  SL LL
Sbjct  268   ARILRAIRIAARLGFRFSKETAYSVKDLASSVLRLDKGRILMEMNYMLAYGSAENSLRLL  327

Query  1073  QKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAF  1249
              K+ LLE+LLP  AAY   Q   ++   ++ML+ +F++LD+L++  RP   SLWV +LAF
Sbjct  328   WKFGLLELLLPIQAAYFVSQGFRRRDKRSNMLLAMFANLDKLLAPNRPCHNSLWVGILAF  387

Query  1250  HLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKA-----ASLYVPEISDSDGSM  1411
             H  LV  P+  LVV      +++  N  + V+ A++   +     + L  P+  D++G +
Sbjct  388   HQALVRQPRDPLVVAIFTLALHNGGNLSEAVDIAKKITHSHDGSYSELLEPQKWDAEGDL  447

Query  1412  SED--ELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKI--VVEEV  1579
               D  +LA  V +    ++ +TD   + +  +++  + +S LVF+  ++  ++  + E V
Sbjct  448   LSDVIDLASSVGS---ALSSMTDEHLVSQAMAQYPQAPYSDLVFIPLQLYLRVCRLFECV  504

Query  1580  -FGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              +G    D+ +  +K C  KI   +  +G       G+A E R + ++++ DT
Sbjct  505   RYGQRERDLVT--KKGC--KINYFTLAQG-------GLA-EIRHVFARVVFDT  545



>ref|XP_008791060.1| PREDICTED: uncharacterized protein LOC103708071 [Phoenix dactylifera]
Length=543

 Score =   317 bits (813),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 190/465 (41%), Positives = 274/465 (59%), Gaps = 20/465 (4%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             WRK+ ++  GI  S I   +  VLN L+KKG++ YLVGGCVRDLI+ R PKDFD+IT+A 
Sbjct  78    WRKMSSKELGIKTSMIRKPTRSVLNTLRKKGYEVYLVGGCVRDLIMKRTPKDFDIITSAE  137

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F R  IVG+RFPIC V+   S+VEVSSF T+  K +     +S  P     C+
Sbjct  138   LKEVQKTFSRCNIVGKRFPICHVYCNNSIVEVSSFSTLGRKPNNDLTYSSRRP----DCD  193

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRWRN L RDFTIN L ++PF   +YDY   M D+K  K+RT+  A  SF+EDCAR
Sbjct  194   EQDYIRWRNCLGRDFTINGLMFNPFSNFVYDYLGGMEDLKKAKVRTVNRAHTSFQEDCAR  253

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F FS ET  ++  L+ SV++LDK R++ME+NYML+YG+A  SL LL +
Sbjct  254   ILRAIRIAARLGFRFSKETAYSVRDLASSVLTLDKGRILMEMNYMLAYGSAEASLRLLWR  313

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  AAY   Q   ++   ++ML+ LFS+LD+L++ +RP  +SLWV LLAFH 
Sbjct  314   FGLLELLLPIQAAYFVSQGFRRRDKRSNMLLTLFSNLDKLLAPDRPCHKSLWVGLLAFHQ  373

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              LV  P+  LVV      +++  +  + VE AR          PE+       ++ EL K
Sbjct  374   ALVRQPRDPLVVAIFTLALHNGGDLPEAVEIARAITYPNDANFPELLQLQRWDTDHELVK  433

Query  1433  RVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
              V +++  VN     +TD   + +  + +  +  S +VF+  ++   ++V  +F     +
Sbjct  434   EVVDLSSAVNAALSSMTDEYFVSKAMAGYPRAPCSDMVFIPLQVY--LMVCRMF-----E  486

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                  +K        P   K   H    G   E R + ++++ DT
Sbjct  487   CVGHGDKDSRFI---PKRGKINYHVLAQGGLAEVRHVFARVVFDT  528



>gb|KHG14471.1| Poly (A) polymerase [Gossypium arboreum]
Length=521

 Score =   317 bits (811),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 201/493 (41%), Positives = 286/493 (58%), Gaps = 46/493 (9%)
 Frame = +2

Query  323   SNFQPGK------IEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVR  484
             ++F P K       + S W+KL+++  GI+ S IS  +  VLN LK KG++ YLVGGCVR
Sbjct  46    AHFSPAKNVNGEGSKLSQWKKLNSQDLGISTSNISKPTRKVLNGLKTKGYEVYLVGGCVR  105

Query  485   DLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVA-NK  661
             DLIL R PKDFD+ITTA L E+ K F R EI+GRRFPIC VH+  ++VEVSSF T A N 
Sbjct  106   DLILKRTPKDFDIITTAELREVVKAFSRCEIIGRRFPICHVHMDDTIVEVSSFSTSARNF  165

Query  662   GDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKS  841
             G    R  ++    P G ++ D +RWRN L RDFTIN L +DPF   IYDY   + DIK 
Sbjct  166   G----RGLTYEIEKPAGSDKKDFVRWRNCLQRDFTINGLMFDPFARIIYDYMGGIEDIKK  221

Query  842   QKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMME  1021
              K+RT+IPA  SF+ED ARILR +R+AARL FSFS ET   +  LS  ++ LDKSRL+ME
Sbjct  222   AKVRTVIPASTSFQEDGARILRAIRIAARLGFSFSRETAHFVKNLSCLILRLDKSRLLME  281

Query  1022  VNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLV  1198
             +NYM++YG+A  SL LL K+ LLE+LLP  AAY  +    ++   ++ML+ LFS LD+++
Sbjct  282   MNYMMAYGSAEASLRLLWKFGLLELLLPIQAAYFVRTGFRRRDKRSNMLLSLFSKLDRIL  341

Query  1199  SCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASL  1375
             +  RP   SLWV +LAFH  L N P+  LVV   +  +++  +  + +  A+   K+   
Sbjct  342   APNRPCYSSLWVGILAFHKALSNKPRDPLVVAAFSLAVHNGGDIPEAINIAKNINKSHDG  401

Query  1376  YVPEISDSDGSMSEDELAKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVS  1543
                E+S+   ++    L   V ++A  V    + +TD   + +  S +  +  S LVF+ 
Sbjct  402   SFHELSEPQ-NLGNLTLVNEVMDLAASVKSTLSEMTDEHFVSQAMSAYPQAPFSDLVFIP  460

Query  1544  NKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAH---------  1696
               +   + V +VF  +T                    +KG   K+G+ I +         
Sbjct  461   --LALYLNVCKVFECVTM-----------------GAEKGFVAKQGSRIDYELLALGSLR  501

Query  1697  ETRFLLSKIILDT  1735
             ETR   ++++ DT
Sbjct  502   ETRHTFARVVFDT  514



>ref|XP_010499303.1| PREDICTED: uncharacterized protein LOC104776859 isoform X2 [Camelina 
sativa]
Length=521

 Score =   316 bits (809),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 193/467 (41%), Positives = 281/467 (60%), Gaps = 40/467 (9%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+DA  FGI  S I  S+ +VLN LKKKGF+ YLVGGCVRDLIL+RIPKDFDVITTA 
Sbjct  82    WKKMDANEFGIQRSMIPDSTRMVLNKLKKKGFQVYLVGGCVRDLILDRIPKDFDVITTAE  141

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   +IVGRRFPIC V++   ++EVSSF T A  G +   KN    R P GCN
Sbjct  142   LKEVRKVFPSCQIVGRRFPICHVYVDDIIIEVSSFSTSARTG-KAPNKNL---RKPAGCN  197

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW+N L RDFT+N L +DP    +YDY   + D+++ K+RT+  A+LSF ED AR
Sbjct  198   ERDYIRWKNCLQRDFTVNGLMFDPSENVVYDYIGGVEDLRNSKVRTVSAAKLSFVEDTAR  257

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + +   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  258   ILRAIRIAARLGFSLTKDVAISVKELSSSLLRLDPSRIRMEINYMLAYGSAEASLRLLWR  317

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLT  1258
             + L+E+LLP  +                   LF +LD+LV+ +RP  E LW+ +LAFH  
Sbjct  318   FGLMEILLPIQS-------------------LFRNLDRLVAPDRPCHEFLWIGILAFHKA  358

Query  1259  LVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEISDSDGSM--SEDELA  1429
             LV+ P+   VV      +Y   +  + ++ AR + K  +    E+S  +  +  S+ +LA
Sbjct  359   LVDKPRDPTVVACFCLAIYSELSLAEAIKIARSNSKPHNSNFRELSGHEKDIIDSDSKLA  418

Query  1430  KRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTN  1597
             ++V N+A  +      L D D +    S++  +  S +VF+S  ++++  VE++FG    
Sbjct  419   QQVLNLAESIRSAARKLNDRDYIANAMSQYPQAPDSDMVFMSRPVLER--VEKMFG----  472

Query  1598  DVTSLNEKSCSLKIQNPSPQKGTAHKK-GNGIAHETRFLLSKIILDT  1735
                ++  K        PS ++   +K    G  HETR + ++I+ DT
Sbjct  473   ---NVRSKGSQETDGVPSLERRIDYKSLALGDFHETRRVFARIVFDT  516



>ref|XP_011073135.1| PREDICTED: uncharacterized protein LOC105158182 [Sesamum indicum]
Length=523

 Score =   315 bits (808),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 185/428 (43%), Positives = 267/428 (62%), Gaps = 15/428 (4%)
 Frame = +2

Query  275   AGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGF  454
             A DG + E   D  + ++   G++    W+KL+++  GI+ S+IS  + VVLN LK++GF
Sbjct  38    AFDGTESEKVVDSVSGADVY-GRV--PEWKKLNSKDLGISTSKISRPTRVVLNCLKRRGF  94

Query  455   KAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEV  634
             + YLVGGCVRDLIL RIPKDFD+IT+A L E+ + F R E++G+RFPIC VHI  ++VEV
Sbjct  95    EVYLVGGCVRDLILKRIPKDFDIITSAELKEVMRTFSRCEMIGKRFPICHVHIDDTIVEV  154

Query  635   SSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDY  814
             SSF T A +     R  +  P  P  C+E D +RWRN L RDFTIN L +DP+   +YDY
Sbjct  155   SSFSTRATR---FGRDLTLDPEKPADCDEKDYVRWRNCLQRDFTINGLMFDPYAKLVYDY  211

Query  815   ANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMS  994
                + DI+  K+RT+ PA LS  EDCARILR +R+AARL F FS ET  A+ +LS SV+ 
Sbjct  212   TGGVKDIRKAKVRTIKPANLSLTEDCARILRAVRIAARLGFRFSRETALAVKRLSASVLR  271

Query  995   LDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMK  1171
             LD+ RL+MEVNYM++YG+A  SL LL K  LLE+LLP  A+Y  +    ++    +ML+ 
Sbjct  272   LDRGRLLMEVNYMMAYGSAEASLRLLWKLGLLEILLPIQASYFVRHGFRRRDKRYNMLLS  331

Query  1172  LFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFA  1348
             LF +LD+L++ +RP   SLW A+LAFH  L   P+  LV+   +  +++  +  + +  A
Sbjct  332   LFFNLDKLLAPDRPCHNSLWFAILAFHEALSEQPRDPLVIAAFSLAVHNGGDLPEALSIA  391

Query  1349  R----QH-VKAASLYVPEISDSDGSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSG  1513
             R    QH +    L  P   DSD  +  +E+     ++   +  +TD   + +  +K+  
Sbjct  392   RRINKQHDISFHELLEPRNLDSDALL--EEVMSLAASVRAALTHMTDEYFVSQAMAKYPK  449

Query  1514  SSHSGLVF  1537
             + +S LVF
Sbjct  450   APYSDLVF  457



>ref|XP_006361914.1| PREDICTED: uncharacterized protein LOC102603580 isoform X3 [Solanum 
tuberosum]
Length=445

 Score =   312 bits (800),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 178/392 (45%), Positives = 246/392 (63%), Gaps = 8/392 (2%)
 Frame = +2

Query  404   ISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVG  583
             I+  + +VLN LKKKGF+ YLVGGCVRDLILNR PKDFD++T+A L E+ K F R EIVG
Sbjct  2     IAKPTRLVLNGLKKKGFEVYLVGGCVRDLILNRTPKDFDILTSAELKEVLKIFQRCEIVG  61

Query  584   RRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDF  763
             RRFPIC VHI  ++VEVSSF      G + KR    V R P  C+E+D IRW+N L RDF
Sbjct  62    RRFPICHVHIDDTIVEVSSFTAT---GRKFKRNGYNVVRRPPACSEADFIRWKNCLARDF  118

Query  764   TINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSF  943
             TIN L +DPF   +YDY   + DI+  K+R +IPA  SF EDCARILRG+R+A RL+F F
Sbjct  119   TINGLMFDPFAKIVYDYLGGLEDIRRAKVRCVIPANASFIEDCARILRGVRIAGRLRFRF  178

Query  944   SMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYL  1123
             + ET   I +L+ S+  LDK R+++E+NYML+YG+A  SL LL K+ LLE+LLP  A+YL
Sbjct  179   ARETAHFIKELASSISRLDKGRILLEMNYMLAYGSAEASLRLLWKFGLLEILLPIQASYL  238

Query  1124  TQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTL  1300
               Q   ++   ++ML+ LFS+LD L++  RP   SLW+A+LAFH  LV+ P+  LVV   
Sbjct  239   ISQGFRRRDRRSNMLLTLFSTLDNLLAPNRPCHSSLWIAILAFHKALVDRPRDPLVVAAF  298

Query  1301  A-SVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSE---DELAKRVENMAVQVNML  1468
             + +V    +    +   R+  +      PE+ D +    E   DE+      +   +  +
Sbjct  299   SIAVHCGGSLSDVLGIVRKISQPHDTRFPELLDQNIESDEALLDEMMDLATYVEAALQEM  358

Query  1469  TDADNLREVTSKFSGSSHSGLVFVSNKMVKKI  1564
             TD   +     ++  +  S LVF+S  + +K+
Sbjct  359   TDEHFVSRALIEYPQAPKSDLVFISWTLAQKV  390



>ref|XP_004503795.1| PREDICTED: poly(A) polymerase-like [Cicer arietinum]
Length=516

 Score =   315 bits (806),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 186/478 (39%), Positives = 282/478 (59%), Gaps = 19/478 (4%)
 Frame = +2

Query  320   DSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILN  499
             +SN + G  +   W+KL+++  G   S I+     VLN+LKKKG+  YLVGGCVRD+IL 
Sbjct  43    ESNRKQGSNKAPVWKKLNSKELGFRNSMIASPIKKVLNMLKKKGYTVYLVGGCVRDMILM  102

Query  500   RIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKR  679
             + PKDFD+IT+A L E+ + F   EIVG+RFPIC VH+ G+++EVSSF+T   K     R
Sbjct  103   QTPKDFDIITSADLKEVMRTFSWCEIVGKRFPICHVHMDGTIIEVSSFNTARCK---PGR  159

Query  680   KNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTL  859
               +   + PKGC++ D +RWRN ++RDFTIN   +D F   +YDY   M D++  K++T+
Sbjct  160   HFAHDIKAPKGCDKEDYLRWRNCVNRDFTINGFMFDLFAKIVYDYMGGMEDLRKAKVQTI  219

Query  860   IPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLS  1039
             +PA  SF+EDCARILR +R+AARL FS S ET  +I  LS S++ LDK RL+ME+NYML+
Sbjct  220   VPAATSFQEDCARILRAIRIAARLGFSISSETAHSIKNLSYSLLRLDKGRLLMEMNYMLA  279

Query  1040  YGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPA  1216
             YG+   SL LL K+ LL++LLPF A Y  +    ++   T+ML+ LF +LD+L++  RP 
Sbjct  280   YGSGEASLRLLWKFGLLDILLPFQALYFVRHGFQRRDKRTNMLLSLFFNLDKLLAPNRPC  339

Query  1217  RESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEIS  1393
               SLWV +LA H +L + P+  LV+   +  +++  N  + V+ AR+  K   +  PEIS
Sbjct  340   HSSLWVGILALHKSLSDQPRNPLVIAAFSLAVHNGGNLLEAVDIARRINKPHDVRFPEIS  399

Query  1394  ----DSDGSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKK  1561
                 D +    E+E+    E++   +  +T   ++    + +  + HS +VF+   M  K
Sbjct  400   ADPFDLNKKALENEILDLAESVKASLLQMTSRHSVARAMADYPQAPHSDMVFIPLGMYLK  459

Query  1562  IVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
              +   +F  +        + S   K  +   +K        G   E + L ++I+ DT
Sbjct  460   AL--RIFDCV--------KVSACKKFLSKKGRKIDYESLARGDLQEIQHLFARIVFDT  507



>gb|AET05044.2| tRNA nucleotidyltransferase/poly(A) polymerase [Medicago truncatula]
Length=516

 Score =   315 bits (806),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 185/464 (40%), Positives = 273/464 (59%), Gaps = 18/464 (4%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K++++  G   S I+     VLN+LKKKG+  YLVGGCVRD+IL + PKDFD++T+A 
Sbjct  57    WKKMNSKELGFRNSMIASPIKKVLNMLKKKGYNVYLVGGCVRDMILRQTPKDFDILTSAD  116

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F   EIVG+RFPIC VH+ G +VEVSSF+T   K     R  +     PKG +
Sbjct  117   LKEVMRTFSWCEIVGKRFPICHVHMDGIIVEVSSFNTAKRK---PGRHFAHDIEAPKGFD  173

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D +RWRN ++RDFTIN   +DPF   +YDY   M DI   K+RT++PA  SF+EDCAR
Sbjct  174   KEDYLRWRNCVNRDFTINGFMFDPFAKIVYDYMGGMEDIIKAKVRTMVPAATSFQEDCAR  233

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS S ET  ++  LS S++ LDK RL+ME+NYML+YG+   SL LL K
Sbjct  234   ILRAIRIAARLGFSISTETARSVKHLSYSILRLDKGRLLMEMNYMLAYGSGEASLRLLWK  293

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LL++LLPF A Y  +    ++   T+ML+ LF +LD+L++   P   SLWV +LA H 
Sbjct  294   FGLLDILLPFQALYFVRHGFRRRDKRTNMLLSLFFNLDKLLAPNSPCHSSLWVGILALHK  353

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDS---DGSMSEDE  1423
             +L + P+  LV+   +  +++  N  + V+ AR+  K   +  PE+SD    +    E+E
Sbjct  354   SLSDQPRNPLVIAAFSLAVHNGGNLLEAVDIARRINKPHDIRFPELSDPCDLNAKALENE  413

Query  1424  LAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDV  1603
             +   VE++ V +  +T   ++      +  + HS +VF+   M  K +   +F       
Sbjct  414   ILDLVESVKVSLLQMTSRHSVARAMVDYPQAPHSDMVFIPLGMYLKAL--SIF-------  464

Query  1604  TSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               L   SC  K  +   +K        G   E R L ++++ DT
Sbjct  465   DCLKVSSCK-KFLSKKSRKIDYESLARGDLPEIRHLFARVVFDT  507



>ref|XP_002511109.1| poly(A) polymerase, putative [Ricinus communis]
 gb|EEF51711.1| poly(A) polymerase, putative [Ricinus communis]
Length=524

 Score =   315 bits (806),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 190/483 (39%), Positives = 274/483 (57%), Gaps = 42/483 (9%)
 Frame = +2

Query  338   GKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDF  517
             G      W+KL+++  GIT S I+  +  +LN LK++G++ YLVGGCVRDLIL RIPKDF
Sbjct  60    GDCNGPKWKKLNSKELGITNSMIASPTRKILNGLKQRGYEVYLVGGCVRDLILKRIPKDF  119

Query  518   DVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANK--GDETKRKNSF  691
             D+IT+A L E+ + F R EIVGRRFPIC V++  +VVEVSSF T   K  GD      S 
Sbjct  120   DIITSAELREVARAFSRCEIVGRRFPICHVYVGDTVVEVSSFSTTGQKFGGDWNYDTQS-  178

Query  692   VPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQ  871
                 P  C+E D +RWRN   RDFTIN L +DP+   +YDY   + DI+  K+RT+ PA 
Sbjct  179   ----PIDCDEKDYMRWRNCSQRDFTINGLMFDPYEKIVYDYIGGLEDIRKAKVRTVTPAS  234

Query  872   LSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAA  1051
              SF+EDCARILR +R+AARL F FS ET   +   + S++ LDK RL+ME+NYML+YG++
Sbjct  235   NSFQEDCARILRAVRIAARLGFRFSRETAHFLKHFAHSILRLDKGRLLMEMNYMLAYGSS  294

Query  1052  VPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESL  1228
               SL LL K+ LLE+LLP  AAY      K+    S ML+ L S++D+L++ +RP    L
Sbjct  295   EASLRLLWKFGLLEILLPIQAAYFVHCGFKRRDKRSNMLLSLLSNMDKLLAPDRPCHSCL  354

Query  1229  WVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDG  1405
             W+ +LAFH  L   P+  LVV      +++  +  + V  A++  K   +   E+    G
Sbjct  355   WIGILAFHKALSEQPRDPLVVAAFCLAVHNGGDMSEAVNIAKRIDKPHDMSFHELCKP-G  413

Query  1406  SMSEDELAKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVE  1573
              M  D+L   V ++A  +    +M+TD   + +  +++  + +S LVF+S  +  +  V 
Sbjct  414   DMDTDQLVDEVMDLAQSIKRVLSMMTDEHYVSQAMAEYPQAPYSDLVFISFALYLR--VG  471

Query  1574  EVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKII  1726
              VF  +                     +KG   K+G  I +         E R   ++I+
Sbjct  472   RVFECVRQ-----------------GKEKGFVPKQGGKINYQLLALGSLKEVRHTFARIV  514

Query  1727  LDT  1735
              DT
Sbjct  515   FDT  517



>ref|XP_008464383.1| PREDICTED: uncharacterized protein LOC103502286 isoform X1 [Cucumis 
melo]
Length=513

 Score =   313 bits (802),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 193/473 (41%), Positives = 278/473 (59%), Gaps = 34/473 (7%)
 Frame = +2

Query  356   NWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTA  535
             NW++  + H GI  S I   +  VLN LKK G++ YLVGGCVRDLIL+R PKDFD+IT+A
Sbjct  58    NWKRFSSNHLGIVTSMIPKPTRKVLNGLKKAGYEVYLVGGCVRDLILDRPPKDFDIITSA  117

Query  536   RLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
             +L E+ + F   EIVGRRFPIC VHI G++VEVSSF T +   D  +  NS        C
Sbjct  118   QLKEVSRIFLWCEIVGRRFPICHVHIDGTIVEVSSFSTSSKPFD--RHLNSAAIEKSMNC  175

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
              E D +RW+N L RDFTIN + YDP+   +YDY   M DI+  K+RT++PA  SF+EDCA
Sbjct  176   EEIDFVRWKNCLQRDFTINGMMYDPYNNVVYDYLGGMEDIRQAKVRTVVPACTSFQEDCA  235

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR +R+AARL+F F+ +   +I  LS  V +L+K+RL ME+NY+LSYG+A  SL LL 
Sbjct  236   RILRAIRIAARLQFHFAKDIAGSIKNLSCLVSTLNKARLQMEMNYLLSYGSAEASLRLLW  295

Query  1076  KYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             KY LLE+LLP  AAY  +   ++S+  S ML+ LFSSLD+L++  RP   SLWVA+LA H
Sbjct  296   KYGLLEILLPIQAAYFIRNGFRRSNKRSNMLLSLFSSLDKLLAPNRPCHSSLWVAVLALH  355

Query  1253  LTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKA--ASLY-VPEISDSDGSMSED  1420
             + L + P+  LVV T    +++  N  + +  A+   +A  A+ Y + E  + +     D
Sbjct  356   VALSDQPRSPLVVATFGLAVHNGGNMMEAISIAKSINRAHNANFYELLEPQNMEVQALID  415

Query  1421  ELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
             E+     ++ V ++ +TD   +      +  +  S LVF+   +V  + V ++F      
Sbjct  416   EVMDLTTSVKVALHKMTDEHFVSLALESYPQAPASDLVFI--PLVVYLKVCKIF------  467

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGN--------GIAHETRFLLSKIILDT  1735
                     C ++      ++G   K+G         G   E R + ++I+ DT
Sbjct  468   -------ECVVE----GAERGFVPKRGKINYECLALGNVPELRHVFARIVFDT  509



>gb|AAG51472.1|AC069471_3 hypothetical protein [Arabidopsis thaliana]
Length=462

 Score =   311 bits (796),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 181/413 (44%), Positives = 260/413 (63%), Gaps = 21/413 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KLDA  FGI  S I  S+ +VLN LKKKGF+ YLVGGCVRDLIL+RIPKDFDVITTA 
Sbjct  46    WKKLDANEFGIQRSMIPDSTRMVLNKLKKKGFQVYLVGGCVRDLILDRIPKDFDVITTAE  105

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   +IVGRRFPIC V++   ++EVS      NK        SF  R P GC+
Sbjct  106   LKEVRKVFPGCQIVGRRFPICHVYVDDIIIEVSRTGKAPNK--------SF--RRPAGCD  155

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW+N L RDFT+N L +DP    +YDY   + D+++ K+RT+  A LSF ED AR
Sbjct  156   ERDYIRWKNCLQRDFTVNGLMFDPSENVVYDYIGGVEDLRNSKVRTVSAANLSFVEDTAR  215

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS + +   ++ +LS S++ LD SR+ ME+NYML+YG+A  SL LL +
Sbjct  216   ILRAIRIAARLGFSLTKDVAISVKELSSSLLRLDPSRIRMEINYMLAYGSAEASLRLLWR  275

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + L+E+LLP  A+YL  Q   ++   ++ML+ LF +LD+LV+ +RP  E LW+ +LAFH 
Sbjct  276   FGLMEILLPIQASYLVSQGFRRRDGRSNMLLSLFRNLDRLVAPDRPCSEFLWIGILAFHK  335

Query  1256  TLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEIS--DSDGSMSEDEL  1426
              LV+ P+   VV +    +Y   +  + +  AR + K  + +  E+S  + D + SE ++
Sbjct  336   ALVDQPRDPTVVASFCLAIYSEVSLSEAIAIARSNSKQHNSHFQELSSPEKDTADSESKI  395

Query  1427  AKRVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVE  1573
             +++V  +A  +      L + D +    SK+  +  S +V +   +VK  V E
Sbjct  396   SQQVIKLAESIRSAARKLNNRDYIANAMSKYPQAPGSDMVGI---LVKTYVGE  445



>ref|XP_010678332.1| PREDICTED: uncharacterized protein LOC104893895 [Beta vulgaris 
subsp. vulgaris]
Length=561

 Score =   313 bits (802),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 181/400 (45%), Positives = 259/400 (65%), Gaps = 10/400 (3%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+ ++  GI+ S IS  + VVL  LKKKG++ YLVGGCVRDLIL RIPKDFD++T+A 
Sbjct  76    WKKISSKELGISTSLISEPTRVVLKRLKKKGYEVYLVGGCVRDLILKRIPKDFDILTSAE  135

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+K+ F R EIVG+RFPIC VHI  +V+EVSSF T   K +   R  SF    P  C+
Sbjct  136   LREVKRTFPRCEIVGKRFPICHVHIDNNVLEVSSFSTGQQKYN---RNLSFAVGGPISCD  192

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D +RWRN + RDFT+N L +DPF   I+DY   + DI+  KL+T+IPA  SF ED AR
Sbjct  193   EGDKVRWRNCIQRDFTVNGLMFDPFARLIFDYFGGLEDIRKAKLQTIIPASTSFREDNAR  252

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS S ET  +I  LS  ++ LDK+R++ME+NYML+YG+A  SL LL K
Sbjct  253   ILRAIRIAARLGFSLSRETVQSIKNLSCLILRLDKARILMEMNYMLAYGSAEASLRLLWK  312

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  AAY  +    ++ S +++L+ +F++LD+LV+ +RP   SLWV +LAFH 
Sbjct  313   FGLLELLLPHQAAYFVRCGFRRRDSGSNLLLAMFANLDKLVAPDRPCHSSLWVTILAFHK  372

Query  1256  TLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              L ++P+   V+ T   +V    +  + V+ A    +A+     E+ +S  S+ +  L  
Sbjct  373   ALSDHPRAPSVIATFTLAVNNGGHIAEAVDIASLISRASEQSFCELQESQ-SLEKMVLRD  431

Query  1433  RVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFV  1540
              V  +A  VN     +TD + + +  +K+  + +S LVF+
Sbjct  432   HVLCLAGSVNRALSDMTDGNVVSKAMAKYPLAPYSDLVFI  471



>gb|KEH20978.1| tRNA nucleotidyltransferase/poly(A) polymerase [Medicago truncatula]
Length=457

 Score =   308 bits (789),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 183/461 (40%), Positives = 270/461 (59%), Gaps = 18/461 (4%)
 Frame = +2

Query  368   LDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNE  547
             ++++  G   S I+     VLN+LKKKG+  YLVGGCVRD+IL + PKDFD++T+A L E
Sbjct  1     MNSKELGFRNSMIASPIKKVLNMLKKKGYNVYLVGGCVRDMILRQTPKDFDILTSADLKE  60

Query  548   IKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESD  727
             + + F   EIVG+RFPIC VH+ G +VEVSSF+T   K     R  +     PKG ++ D
Sbjct  61    VMRTFSWCEIVGKRFPICHVHMDGIIVEVSSFNTAKRK---PGRHFAHDIEAPKGFDKED  117

Query  728   VIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilr  907
              +RWRN ++RDFTIN   +DPF   +YDY   M DI   K+RT++PA  SF+EDCARILR
Sbjct  118   YLRWRNCVNRDFTINGFMFDPFAKIVYDYMGGMEDIIKAKVRTMVPAATSFQEDCARILR  177

Query  908   glrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNL  1087
              +R+AARL FS S ET  ++  LS S++ LDK RL+ME+NYML+YG+   SL LL K+ L
Sbjct  178   AIRIAARLGFSISTETARSVKHLSYSILRLDKGRLLMEMNYMLAYGSGEASLRLLWKFGL  237

Query  1088  LEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLV  1264
             L++LLPF A Y  +    ++   T+ML+ LF +LD+L++   P   SLWV +LA H +L 
Sbjct  238   LDILLPFQALYFVRHGFRRRDKRTNMLLSLFFNLDKLLAPNSPCHSSLWVGILALHKSLS  297

Query  1265  NNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDS---DGSMSEDELAK  1432
             + P+  LV+   +  +++  N  + V+ AR+  K   +  PE+SD    +    E+E+  
Sbjct  298   DQPRNPLVIAAFSLAVHNGGNLLEAVDIARRINKPHDIRFPELSDPCDLNAKALENEILD  357

Query  1433  RVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSL  1612
              VE++ V +  +T   ++      +  + HS +VF+   M  K +   +F         L
Sbjct  358   LVESVKVSLLQMTSRHSVARAMVDYPQAPHSDMVFIPLGMYLKAL--SIF-------DCL  408

Query  1613  NEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                SC  K  +   +K        G   E R L ++++ DT
Sbjct  409   KVSSCK-KFLSKKSRKIDYESLARGDLPEIRHLFARVVFDT  448



>gb|KGN63445.1| hypothetical protein Csa_1G000690 [Cucumis sativus]
Length=512

 Score =   309 bits (791),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 186/467 (40%), Positives = 276/467 (59%), Gaps = 22/467 (5%)
 Frame = +2

Query  356   NWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTA  535
             NW++  + H GI  S I   +  VLN LKK G++ YLVGGCVRDLILNR+PKDFD+IT+A
Sbjct  57    NWKRFSSNHLGIATSMIPIPTRKVLNGLKKTGYEVYLVGGCVRDLILNRVPKDFDIITSA  116

Query  536   RLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
             +L E+ + F   EIVGRRFPIC VHI G++VEVSSF T +N+  + +  ++ + + P  C
Sbjct  117   QLKEVSRIFLWCEIVGRRFPICHVHIDGTIVEVSSFST-SNRPFDRQLTSAAIEK-PMNC  174

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
              E D +RW+N L RDFTIN L YDP+   +YDY   M DI+  K+RT++PA  SF+ED A
Sbjct  175   EEIDFVRWKNCLQRDFTINGLMYDPYNNVVYDYLGGMEDIRKAKVRTVVPACTSFQEDFA  234

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RI R +R AARL+F FS +   +I  LS  V +L+K+RL ME+NY+LSYG+A  SL LL 
Sbjct  235   RIFRAIRFAARLQFHFSKDIAGSIKNLSCLVFTLNKARLQMEMNYLLSYGSAEASLRLLW  294

Query  1076  KYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             KY LLE+LLP  AAY  +   ++S   S ML+ LFSSLD+L++  RP   SLWVA+LA H
Sbjct  295   KYGLLEILLPIQAAYFIRNGFRRSDKGSNMLLSLFSSLDKLLAPNRPCHSSLWVAVLALH  354

Query  1253  LTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSE---D  1420
             + L + P+  LVV      +++  N  + +  A+   +A +    E+ + +    +   D
Sbjct  355   VALSDQPRSPLVVAAFGLAVHNGGNMMEAISIAKSINRAHNANFCELLEPENLEVQALID  414

Query  1421  ELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
             E+      +   ++ +TD   +      +  +  S LVF+   +V  + V ++F  +   
Sbjct  415   EVMDLTTFVKAALHKMTDEHFVSLALETYPQAPASDLVFI--PLVVYLKVCKIFECVVEG  472

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAH--ETRFLLSKIILDT  1735
                          +   P++G  + +   + +  E R + ++I+ DT
Sbjct  473   AE-----------RGFVPKRGKINYECLALGNLLELRHVFARIVFDT  508



>ref|XP_004161378.1| PREDICTED: poly(A) polymerase-like [Cucumis sativus]
Length=571

 Score =   310 bits (793),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 187/467 (40%), Positives = 271/467 (58%), Gaps = 22/467 (5%)
 Frame = +2

Query  356   NWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTA  535
             NW++  + H GI  S I   +  VLN LKK G++ YLVGGCVRDLILNR+PKDFD+IT+A
Sbjct  116   NWKRFSSNHLGIATSMIPIPTRKVLNGLKKTGYEVYLVGGCVRDLILNRVPKDFDIITSA  175

Query  536   RLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
             +L E+ + F   EIVGRRFPIC VHI G++VEVSSF T     D  ++  S     P  C
Sbjct  176   QLKEVSRIFLWCEIVGRRFPICHVHIDGTIVEVSSFSTSNRPFD--RQLTSAAIEKPMNC  233

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
              E D +RW+N L RDFTIN L YDP+   +YDY   M DI+  K+RT++PA  SF+ED A
Sbjct  234   EEIDFVRWKNCLQRDFTINGLMYDPYNNVVYDYLGGMEDIRKAKVRTVVPACTSFQEDFA  293

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RI R +R AARL+F FS +   +I  LS  V +L+K+RL ME+NY+LSYG+A  SL LL 
Sbjct  294   RIFRAIRFAARLQFHFSKDIAGSIKNLSCLVFTLNKARLQMEMNYLLSYGSAEASLRLLW  353

Query  1076  KYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             KY LLE+LLP  AAY  +   ++S   S ML+ LFSSLD+L++  RP   SLWVA+LA H
Sbjct  354   KYGLLEILLPIQAAYFIRNGFRRSDKGSNMLLSLFSSLDKLLAPNRPCHSSLWVAVLALH  413

Query  1253  LTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSE---D  1420
             + L + P+  LVV      +++  N  + +  A+   +A +    E+ + +    +   D
Sbjct  414   VALSDQPRSPLVVAAFGLAVHNGGNMMEAISIAKSINRAHNANFCELLEPENLEVQALID  473

Query  1421  ELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
             E+      +   ++ +TD   +      +  +  S LVF+   +V  + V ++F  +   
Sbjct  474   EVMDLTTFVKAALHKMTDEHFVSLALETYPQAPASDLVFIP--LVVYLKVCKIFECVVEG  531

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAH--ETRFLLSKIILDT  1735
                          +   P++G  + +   + +  E R + ++I+ DT
Sbjct  532   AE-----------RGFVPKRGKINYECLALGNLLELRHVFARIVFDT  567



>ref|XP_004501740.1| PREDICTED: CCA-adding enzyme-like [Cicer arietinum]
Length=532

 Score =   308 bits (789),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 197/522 (38%), Positives = 288/522 (55%), Gaps = 30/522 (6%)
 Frame = +2

Query  209   QFVEQLVTALLMSLLQKFNQTSAGDGIQLES----TTDRAADSNFQPGKIEFSNWRKLDA  376
             +FV Q    L ++  Q   +      + +E+    T      S  + G  +   W+++ +
Sbjct  7     KFVHQSTLHLRLTPFQYLRKVVPKSFVAVEASENFTNQNDNGSIREEGNKKVPEWKRIGS  66

Query  377   RHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKK  556
             +  G+  S I  +   VLN LKK+G+  YLVGGCVRDLIL + PKDFD+IT+A L E+ K
Sbjct  67    KELGVHNSSIGVTIKKVLNGLKKRGYDVYLVGGCVRDLILKQTPKDFDIITSAELKEVMK  126

Query  557   QFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIR  736
              F   +IVGRRFPIC VH+ G++VEVSSF+T   K      + S   + P  C+E D++R
Sbjct  127   VFSWCKIVGRRFPICHVHMDGTIVEVSSFNTARCK---KSVEFSHHRQAPNDCDEKDLLR  183

Query  737   WRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglr  916
             W N L+RDFTIN L  DP+   +YDY   + D++  K+RT+  A +SF+EDCARILR +R
Sbjct  184   WMNCLNRDFTINGLMLDPYARIVYDYMGGIEDLRKAKVRTIXXADISFQEDCARILRAIR  243

Query  917   laarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEV  1096
             +AARL FS S ET   +  LS SV+ LDK+RL+ME+NYML+YG+   SL LL K+ LL++
Sbjct  244   IAARLGFSISKETAHFVKNLSSSVLKLDKNRLLMEINYMLAYGSGEASLRLLWKFGLLDI  303

Query  1097  LLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNP  1273
             LLPF AAY       ++   T+ML+ LFS+LD+L++  RP   SLW  +LA H  L + P
Sbjct  304   LLPFQAAYFAHHGFRRRDKRTNMLLSLFSNLDKLLAPNRPCHSSLWFGILALHKALSDRP  363

Query  1274  QPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMA  1450
             +  LVV   +  +++  N  + V  A    K   +  PE+ D  G +  + L   V ++A
Sbjct  364   RDPLVVAAFSLAVHNGGNLLEAVNIAGMINKPHDMRFPELLDPSG-LDTEALEAGVRDLA  422

Query  1451  VQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNE  1618
               V      +TD   + +  + +  + +S LVF+   +  K      F I  +   S N 
Sbjct  423   ESVRGTLLQMTDEHFVSQAMADYPQAPNSDLVFIPLGLYVK-----AFSIFESVKRSANR  477

Query  1619  KSCS---LKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             K  S   +KI   S   G           E R + ++I+ DT
Sbjct  478   KCLSKQGMKIDYESLADGN--------LQEIRHVFARIVFDT  511



>ref|XP_004297502.1| PREDICTED: uncharacterized protein LOC101314744 [Fragaria vesca 
subsp. vesca]
Length=515

 Score =   305 bits (781),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 195/501 (39%), Positives = 290/501 (58%), Gaps = 28/501 (6%)
 Frame = +2

Query  257   KFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNV  436
             + N  SA + I  +    +  D+N + GK     W+KL+++  GI+ S I      VLN 
Sbjct  31    QLNLVSAMEAIDEQEGCSK--DNNSRDGKA--LQWKKLNSKELGISSSMIDKPIRKVLNG  86

Query  437   LKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIR  616
             LK+KG++ YLVGGCVRDLIL R PKDFD++T+A L E+ + F   E+VGRRFPIC VH+ 
Sbjct  87    LKRKGYEVYLVGGCVRDLILKRTPKDFDILTSAELREVTRTFSWCEVVGRRFPICHVHVG  146

Query  617   GSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFV  796
              +VVEVSSF   A       R +S   + P  C++ D +RW N L RDFTIN L +DP+ 
Sbjct  147   DTVVEVSSFSISAR---SHGRNSSSDIKKPVHCDDKDFMRWSNCLKRDFTINGLMFDPYE  203

Query  797   YQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKL  976
               +YDY   + D+K+ K++T+IPA  SF EDCARILR +R+AARL F  S ET  +I  L
Sbjct  204   RIVYDYLGGIEDLKNAKVQTVIPANTSFREDCARILRAIRIAARLGFRISKETADSIKNL  263

Query  977   SPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSD  1153
             S S++ LDK R++ME+NYM++YG+A  SL LL K+ LLE+LLP  AAY  +    ++   
Sbjct  264   SYSIVRLDKGRILMEMNYMMAYGSAEASLRLLWKFGLLELLLPIQAAYFVRHGFRRRDKR  323

Query  1154  TSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVV--LTLASVMYHRNW  1327
             ++ML+ LFS+LD+L++ ++P   SLW+A+LAFH  L   P+  LVV   TLA V    + 
Sbjct  324   SNMLLSLFSNLDKLLAPDKPCHSSLWIAILAFHTALSEQPRDALVVAAFTLA-VHNGGDM  382

Query  1328  KQGVEFARQHVKAASLYVPEISDS---DGSMSEDELAKRVENMAVQVNMLTDADNLREVT  1498
              + VE AR   K   +   E+ +    D      E+     +    ++ +TDA  + E  
Sbjct  383   LEAVEIARTITKPHEVSFHELLEPQRLDSGAYTKEIRDLEASFRRAIDHMTDAQIVSEAM  442

Query  1499  SKFSGSSHSGLVFVSNKMVKKIVVEEVFGI--LTNDVTSLNEKSCSLKIQNPSPQKGTAH  1672
             + +  +  S LVF+   +   + V  +F    +  ++ S+ ++S   KI   S  +G+  
Sbjct  443   AAYPQAPFSDLVFIPWGL--SLRVSRIFNCVKVGGELGSVAKQSS--KIDYESLAQGS--  496

Query  1673  KKGNGIAHETRFLLSKIILDT  1735
                     E R + ++++ DT
Sbjct  497   ------LPEIRHMFARVVFDT  511



>gb|EMT05038.1| Putative poly(A) polymerase [Aegilops tauschii]
Length=506

 Score =   304 bits (778),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 201/528 (38%), Positives = 283/528 (54%), Gaps = 88/528 (17%)
 Frame = +2

Query  182   PAILLSSVEQFVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNW  361
             PA LLS +     +L+       ++K+     G G      +  A+    +PG I+ S+W
Sbjct  16    PAPLLSRLSSAASRLLQ------MRKYGSRKEGGGGLRNGRSSSAS----RPGSIDPSSW  65

Query  362   RKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARL  541
             +  D+R  GI    I  +   VL +LK+KGF+AYLVGGCVRDL+L R PKDFDVITTA L
Sbjct  66    KYFDSRAVGIPAGAIPRNCMAVLQMLKRKGFEAYLVGGCVRDLLLKRAPKDFDVITTASL  125

Query  542   NEIKKQ-FYRAEIVGRRFPICRVHIRGSVVEVSSF--DTVANKGDETKRKNSFVPRMPKG  712
              EIK+  F R  IVG RFPIC V  RGS+ EVSSF  +T   KG+E    N        G
Sbjct  126   KEIKEHVFSRCFIVGNRFPICLVRWRGSLFEVSSFKTNTTQVKGNE----NVNCSEDTDG  181

Query  713   CNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
              +  D++RW++SL RDFT+NSLF++PF +++YDY N + D++  K R             
Sbjct  182   RDGGDILRWKDSLRRDFTVNSLFFNPFNHRVYDYVNGVKDLRKNKPR-------------  228

Query  893   arilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLL  1072
                                                    L ME+ YMLSYGAA  S+ LL
Sbjct  229   ---------------------------------------LAMEMKYMLSYGAAESSIRLL  249

Query  1073  QKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAF  1249
             +KY LL++LLPF AAYL+ Q   +SSD   MLM L ++LD+  S +RP   SLW+ALLAF
Sbjct  250   RKYGLLDILLPFQAAYLSDQLKGKSSDRGLMLMNLLANLDKFFSADRPCHCSLWLALLAF  309

Query  1250  HLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELA  1429
             H  LVN+PQ   V+   A++M+   W   +EF  + V A   YVPE     G+   D+L 
Sbjct  310   HNALVNSPQDAQVIKAFAALMHFGTWDSAIEFLNEDVGAPVTYVPEAFGLSGA-KVDDLM  368

Query  1430  KRVENMA----VQVNMLTDADNLREVTSKFSGSSH-SGLVFVSNKMVKKIVVEEVFGILT  1594
             ++  ++A      V+ LT  + L++   ++ G+S  SGLVFVS +  +K  V  +F  L 
Sbjct  369   EQTSHLASLVKSSVDTLTCLNTLKQSVIRYPGASQFSGLVFVSAR--EKGRVLGIFNGLD  426

Query  1595  NDVTSLNEKSCSLKIQNPSPQKGTAHK-KGNGIAHETRFLLSKIILDT  1735
             +D+TS +++             G  +K   +G+  E RF+L K+I+DT
Sbjct  427   SDLTSYDKR---------RGMHGIDYKLLEDGVTAEVRFVLGKVIMDT  465



>ref|NP_001168693.1| hypothetical protein [Zea mays]
 gb|ACN29221.1| unknown [Zea mays]
 tpg|DAA38069.1| TPA: hypothetical protein ZEAMMB73_877949 [Zea mays]
Length=535

 Score =   305 bits (780),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 184/432 (43%), Positives = 256/432 (59%), Gaps = 24/432 (6%)
 Frame = +2

Query  314   AADSNFQPGK--IEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRD  487
             A  S+  PG   +E   W+K+ A+ FGI  S I P +W VL+ L+ +G+  YLVGGCVRD
Sbjct  53    APTSDSGPGAEGMEGLEWKKISAKRFGIKESMIPPEAWNVLHRLRSRGYDVYLVGGCVRD  112

Query  488   LILNRIPKDFDVITTARLNEIKKQFY-RAEIVGRRFPICRVHIRGSVVEVSSFDTVANKG  664
             LI+ + PKDFD+ITTA L ++K  F   A IVGRRFPIC VH   S+VEVSSF+T A   
Sbjct  113   LIMKKTPKDFDIITTADLRQVKDTFLGSAVIVGRRFPICHVHENNSIVEVSSFNTCARGS  172

Query  665   DETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQ  844
               ++  NS      + C+++D +RW+N   RDFTIN L ++P+  +IYDY   + DIK  
Sbjct  173   SGSQIYNS----KSQNCSKNDFVRWKNCQRRDFTINGLMFNPYSEKIYDYLGGIEDIKKA  228

Query  845   KLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEV  1024
             K+RT+IPA  SF+EDCARILR +R+AARL FSF  ET   +  L+ SV  LDK+R++ME+
Sbjct  229   KVRTVIPAGTSFQEDCARILRAIRIAARLGFSFPKETAYYVRTLACSVARLDKARILMEM  288

Query  1025  NYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQ-QADKQSSDTSMLMKLFSSLDQLVS  1201
             NYML+YG+A  SL LL ++ LLE LLPF AAY +  +  ++   T+ML+ LFS LD  ++
Sbjct  289   NYMLAYGSAEASLRLLWRFGLLEHLLPFQAAYFSSTRFKRKDKGTNMLLVLFSKLDNFLA  348

Query  1202  CERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRN-----WKQGVEFARQH-VK  1363
               RP   SLW++LLAFH  L   P   L+V T A   Y           G    RQH   
Sbjct  349   PNRPCHNSLWISLLAFHEALARKPCDPLIVATFALAFYLGGDMSLAVDIGKSINRQHDTG  408

Query  1364  AASLYVPEISDSDGSMSEDELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGL  1531
                L  P++       ++  LA  V++ A      +  +TD  ++    +K   +  S L
Sbjct  409   FRELLEPKV------WTDKHLAGEVQSFAALMKQALTEMTDEYHVANAMAKIPQAPSSDL  462

Query  1532  VFVSNKMVKKIV  1567
             VF+  +   K++
Sbjct  463   VFIPLQAYLKVL  474



>tpg|DAA38070.1| TPA: hypothetical protein ZEAMMB73_877949 [Zea mays]
Length=471

 Score =   302 bits (774),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 179/415 (43%), Positives = 249/415 (60%), Gaps = 22/415 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+ A+ FGI  S I P +W VL+ L+ +G+  YLVGGCVRDLI+ + PKDFD+ITTA 
Sbjct  6     WKKISAKRFGIKESMIPPEAWNVLHRLRSRGYDVYLVGGCVRDLIMKKTPKDFDIITTAD  65

Query  539   LNEIKKQFY-RAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
             L ++K  F   A IVGRRFPIC VH   S+VEVSSF+T A     ++  NS      + C
Sbjct  66    LRQVKDTFLGSAVIVGRRFPICHVHENNSIVEVSSFNTCARGSSGSQIYNS----KSQNC  121

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
             +++D +RW+N   RDFTIN L ++P+  +IYDY   + DIK  K+RT+IPA  SF+EDCA
Sbjct  122   SKNDFVRWKNCQRRDFTINGLMFNPYSEKIYDYLGGIEDIKKAKVRTVIPAGTSFQEDCA  181

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR +R+AARL FSF  ET   +  L+ SV  LDK+R++ME+NYML+YG+A  SL LL 
Sbjct  182   RILRAIRIAARLGFSFPKETAYYVRTLACSVARLDKARILMEMNYMLAYGSAEASLRLLW  241

Query  1076  KYNLLEVLLPFHAAYLTQ-QADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             ++ LLE LLPF AAY +  +  ++   T+ML+ LFS LD  ++  RP   SLW++LLAFH
Sbjct  242   RFGLLEHLLPFQAAYFSSTRFKRKDKGTNMLLVLFSKLDNFLAPNRPCHNSLWISLLAFH  301

Query  1253  LTLVNNPQPKLVVLTLASVMYHRN-----WKQGVEFARQH-VKAASLYVPEISDSDGSMS  1414
               L   P   L+V T A   Y           G    RQH      L  P++       +
Sbjct  302   EALARKPCDPLIVATFALAFYLGGDMSLAVDIGKSINRQHDTGFRELLEPKV------WT  355

Query  1415  EDELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIV  1567
             +  LA  V++ A      +  +TD  ++    +K   +  S LVF+  +   K++
Sbjct  356   DKHLAGEVQSFAALMKQALTEMTDEYHVANAMAKIPQAPSSDLVFIPLQAYLKVL  410



>ref|XP_006436932.1| hypothetical protein CICLE_v10031219mg [Citrus clementina]
 gb|ESR50172.1| hypothetical protein CICLE_v10031219mg [Citrus clementina]
Length=356

 Score =   297 bits (761),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 157/291 (54%), Positives = 206/291 (71%), Gaps = 4/291 (1%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+A+  GI+ S I   +  VLN LKKKG++ YLVGGCVRDL+LNRIPKDFD+IT+A 
Sbjct  69    WKKLNAKDLGISTSMIDKPTRKVLNGLKKKGYEVYLVGGCVRDLMLNRIPKDFDIITSAE  128

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F + EIVG+RFPIC VH   ++VEVSSF T    G    R   +  + P GC+
Sbjct  129   LKEVVRVFSQCEIVGKRFPICHVHFEDTIVEVSSFST---SGRRFSRDFKYEFQRPIGCD  185

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRWRN L RDFTIN L +DP+   IYDY   + DI+  K++T+IPA  SF+EDCAR
Sbjct  186   EKDFIRWRNCLQRDFTINGLMFDPYAKIIYDYIGGIEDIRKAKVQTVIPASTSFQEDCAR  245

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F FS ET   +  LSPS++ LD+ RL+ME+NYML+YG+A  SL LL K
Sbjct  246   ILRAIRIAARLGFRFSRETAHFVKHLSPSILKLDRGRLLMEMNYMLAYGSAEASLRLLWK  305

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESL  1228
             + LLEVLLP  AAYL +    ++   ++ML+ LFS+LD+L++ +RP   SL
Sbjct  306   FGLLEVLLPIQAAYLVKHGFRRRDKRSNMLLSLFSNLDKLLAPDRPCHSSL  356



>ref|XP_009607919.1| PREDICTED: uncharacterized protein LOC104102017 isoform X4 [Nicotiana 
tomentosiformis]
Length=487

 Score =   301 bits (772),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 187/478 (39%), Positives = 269/478 (56%), Gaps = 59/478 (12%)
 Frame = +2

Query  347   EFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVI  526
             E + W++ +++  GI+ S I+  + VVLN LK KGF+ YLVGGCVRDLIL R PKDFD+I
Sbjct  43    EPAEWKRFNSKELGISSSMIAKPTRVVLNGLKSKGFEVYLVGGCVRDLILKRTPKDFDII  102

Query  527   TTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMP  706
             TTA L E+++ F R EIVGRRFPIC VH+   VVEVSSF T    G  ++R  S     P
Sbjct  103   TTAELKEVRRTFSRCEIVGRRFPICHVHVDNEVVEVSSFHT---SGIRSERGLSLSFEKP  159

Query  707   KGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEE  886
               C+E D  RWRN LHRDFTIN L +DP+   +YDY   + DI+  K+RT+ PA  S  E
Sbjct  160   VDCDEKDHFRWRNCLHRDFTINGLMFDPYSKFVYDYMGGVDDIRKAKVRTIGPASFSLIE  219

Query  887   DCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLC  1066
             DCARILR +R+AARL F F  ET  +I  LS SV+ LD+ RL+ME+NYML+YG+A  SL 
Sbjct  220   DCARILRAIRIAARLGFRFGRETALSIKNLSSSVLRLDRGRLLMEMNYMLAYGSAEASLR  279

Query  1067  LLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLA  1246
             LL K+ LLE+LLP  +                   LFS+LD+L++ +RP   SLWVA+LA
Sbjct  280   LLWKFGLLEILLPVQS-------------------LFSNLDKLLAPDRPCHSSLWVAILA  320

Query  1247  FHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFAR----QHVKAASLYVPEISDSDGSM  1411
             FH  + + P+  LVV      +++  +  + +  A+    QH    S +  E  D D + 
Sbjct  321   FHKAISDQPRDPLVVAAFGLGIHNGGDLSEALSIAKRISTQH--DGSFHELESQDLDLAA  378

Query  1412  SEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGIL  1591
              ++E+ +   ++   +  +TD   +    + +  + +S LVF+                 
Sbjct  379   LKEEVVELATSVQRALTNMTDEYFVSRAMTNYPKAPYSDLVFIP----------------  422

Query  1592  TNDVTSLNEKSCSL-KIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
                  +L  ++C + +      +KG   K+G+ I +         E R + ++I+ DT
Sbjct  423   ----LALYLRTCKVFQCVRMGKEKGFVAKQGSKIDYELLALGSLQEVRHVFARIVFDT  476



>ref|XP_010239840.1| PREDICTED: uncharacterized protein LOC100821667 [Brachypodium 
distachyon]
Length=534

 Score =   301 bits (772),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 194/478 (41%), Positives = 264/478 (55%), Gaps = 37/478 (8%)
 Frame = +2

Query  347   EFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVI  526
             E   W+K+ A+ FG   S I   +W VL+ L+ +G+  YLVGGCVRDLI+ +IPKDFD+I
Sbjct  65    EGPEWKKVSAKRFGFKESMIPDEAWNVLHRLRSRGYDVYLVGGCVRDLIMKKIPKDFDII  124

Query  527   TTARLNEIKKQFY-RAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRM  703
             TTA L ++K  F   A IVGRRFPI  VH   S+VEVSSF+T A      +   S  P  
Sbjct  125   TTADLRQVKDTFTGSAVIVGRRFPIVHVHDNNSIVEVSSFNTYARGSSGNQAHTSKSPH-  183

Query  704   PKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFE  883
                C+++D IRW+N   RDFTIN L ++P+  +IYDY   + DIK  K+RT+IPA  SF 
Sbjct  184   ---CSKNDYIRWKNCQGRDFTINGLMFNPYSEKIYDYLGGIEDIKKAKVRTVIPAGTSFH  240

Query  884   EDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSL  1063
             EDCARILR +R+AARL FSF  ET   +  L+ SV  LDK RL+MEVNYML+YG+A  SL
Sbjct  241   EDCARILRAIRIAARLGFSFPKETAYYVRTLACSVARLDKGRLLMEVNYMLAYGSAEASL  300

Query  1064  CLLQKYNLLEVLLPFHAAYLTQ-QADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVAL  1240
              LL ++ LLE LLPF AAY +     ++   T+ML+ LFS LD  ++  RP   SLW+++
Sbjct  301   RLLWRFGLLEHLLPFQAAYFSSTHFKRKDKGTNMLLILFSKLDSFLAPNRPCHNSLWISI  360

Query  1241  LAFHLTLVNNPQPKLVVLTLASVMYHRN-----WKQGVEFARQHVKAAS-LYVPEISDSD  1402
             LAFH  LV  P+  LVV T A  MY           G    R+H    S L  P++    
Sbjct  361   LAFHEALVRQPRDPLVVATFALAMYLGGDLSLAVDIGQSINRRHDAGFSELLEPQV----  416

Query  1403  GSMSEDELAKRVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVV  1570
                S+  L   V+ +A  +      +TD   +    +K   +  S LVF+  +   K+  
Sbjct  417   --WSDKHLVAEVQGLATSMRRALTEMTDEYYVANAMAKIPQAPSSDLVFIPLQAYLKV--  472

Query  1571  EEVFGILTNDVTSLNEKSCSLKIQNPSPQKGT---AHKKGNGIAHETRFLLSKIILDT  1735
                  +   +     +K C  +     P++      H   +G   E R L + +I DT
Sbjct  473   -----LKLIECVQHGKKECGYE-----PKRDGNIDYHSLSHGTPAEVRNLFTLVIFDT  520



>ref|XP_006584696.1| PREDICTED: uncharacterized protein LOC100801072 isoform X2 [Glycine 
max]
Length=494

 Score =   300 bits (768),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 193/477 (40%), Positives = 272/477 (57%), Gaps = 43/477 (9%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+++  G+  S I+  +  VLNVLKKKG   YLVGGCVRDLIL + PKDFD+IT+A 
Sbjct  34    WKKLNSKELGLRNSMIAVPTKKVLNVLKKKGHDVYLVGGCVRDLILKQTPKDFDIITSAD  93

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFV---PRMPK  709
             L E++K F   EIVG+RFPIC VH+ G++VEVSSF+T        K    F+      P 
Sbjct  94    LKEVRKTFSWCEIVGKRFPICHVHMDGTIVEVSSFNTA-----RCKSSMHFIYDDIEAPN  148

Query  710   GCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEED  889
              C++ D +RWRN L RDFTIN L +DP+   +YDY   M DI   K+RT++PA  SF ED
Sbjct  149   DCDKEDYLRWRNCLKRDFTINGLMFDPYARIVYDYMGGMEDIIKAKVRTVVPAATSFRED  208

Query  890   CarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCL  1069
             CARILR +R+AARL FS S ET  ++  LS SV+ LDK RL ME+NYML+YG+   SL L
Sbjct  209   CARILRAIRVAARLGFSISRETAQSVKNLSYSVLRLDKGRLWMEINYMLAYGSGEASLRL  268

Query  1070  LQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLA  1246
             L ++ LL++LLPF AAY       ++   T++L+  FS++D+L++  RP   SLWVA+LA
Sbjct  269   LWRFGLLDILLPFQAAYFVCGGFRRRDKRTNLLLSFFSNVDKLLAPNRPCHSSLWVAILA  328

Query  1247  FHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDE  1423
              H  L + P+   VV   +  +++  N  + +  AR+  KA     PE+ D  G + E+ 
Sbjct  329   LHKALSDKPRDSSVVAAFSLALHNGGNLSEAINIARRINKAHDARFPELLDPSG-LDEEN  387

Query  1424  LAKRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGIL  1591
             L   + ++A  V      +TD   +    + +  + HS LV +   M  K          
Sbjct  388   LEAEILDLAESVKGSLLQMTDRHLVSGAMADYPQAPHSNLVLIPLSMFLK----------  437

Query  1592  TNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHET---------RFLLSKIILDT  1735
                  +LN   C     N S  K    K+G  I +E+         R + ++I+ DT
Sbjct  438   -----ALNFFDCV----NVSTGKNYLSKQGRQIDYESLARGDLLEVRHVFARIVFDT  485



>ref|XP_002321741.1| polynucleotide adenylyltransferase family protein [Populus trichocarpa]
 gb|EEF05868.1| polynucleotide adenylyltransferase family protein [Populus trichocarpa]
Length=481

 Score =   299 bits (765),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 172/398 (43%), Positives = 247/398 (62%), Gaps = 8/398 (2%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K +++  GI+ S IS  +  VL+ LKK G++ YLVGGCVRDLIL R PKDFD+IT+A 
Sbjct  24    WKKWNSKELGISNSTISRPTKKVLDGLKKNGYEVYLVGGCVRDLILKRTPKDFDIITSAE  83

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F +  IVG+RFPIC VH+  ++VEVSSF T   K       N   P  P  C+
Sbjct  84    LKEVVRTFPQCIIVGKRFPICHVHVGDTIVEVSSFSTTGPKF-RLDLSNGISP--PIDCD  140

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D +RW+N L RD TIN L +DP+   +YDY   + DIK  K+RT++PA  SF+EDCAR
Sbjct  141   EKDYVRWKNCLRRDLTINGLMFDPYKRIVYDYVGGLEDIKKAKVRTVVPASTSFQEDCAR  200

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F F+ ET   I  LS S++ LD  R+MME+NYML+YG+A  SL +L K
Sbjct  201   ILRAVRIAARLGFRFTRETAHFIKNLSRSLLRLDNQRIMMEMNYMLAYGSAEASLRILWK  260

Query  1079  YNLLEVLLPFHAAYLTQQADK-QSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLPF AAY  +   K Q   ++ML+ LFS+LD+ ++ +RP   SLWV +LAFH 
Sbjct  261   FGLLELLLPFQAAYFVRDGFKRQDKRSNMLLCLFSNLDKHLAPDRPCHNSLWVGILAFHK  320

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSE---DE  1423
              L + P+  +VV      +++  +   GV+  ++  K   +   E+S+     SE   DE
Sbjct  321   ALSDQPRDPMVVAAFCLAVHNGGDILGGVKMVKKFTKPHDVSFHELSEPQNLNSEALVDE  380

Query  1424  LAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVF  1537
             +     ++   +  +TD   + +  +++  +  S LVF
Sbjct  381   VVDFAASVKQVLYWMTDEYCVSQAMAEYPQAPCSDLVF  418



>ref|XP_007159981.1| hypothetical protein PHAVU_002G283000g [Phaseolus vulgaris]
 gb|ESW31975.1| hypothetical protein PHAVU_002G283000g [Phaseolus vulgaris]
Length=525

 Score =   300 bits (767),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 197/496 (40%), Positives = 282/496 (57%), Gaps = 42/496 (8%)
 Frame = +2

Query  299   STTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGC  478
             ST +R   +N      +   W+KLD++  G+  S I+  +  VLNVLKKKG   YLVGGC
Sbjct  43    STRERGKGTNELENNSKVPAWKKLDSKELGLRNSMIAVPTKKVLNVLKKKGHDVYLVGGC  102

Query  479   VRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVAN  658
             VRDLIL +IPKDFD+IT+A L E++K F   EIVG+RFPIC VH+ G++VEVSSF+T   
Sbjct  103   VRDLILKQIPKDFDIITSADLREVRKTFSWCEIVGKRFPICHVHMDGTIVEVSSFNT---  159

Query  659   KGDETKRKNSFVPRM--PKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMAD  832
                  K    F   +  P  C++ D +RWRN L RDFTIN L +DP+   +YDY   M D
Sbjct  160   --GRWKSSMYFTHDIEAPNNCDKEDYLRWRNCLSRDFTINGLMFDPYARIVYDYMGGMED  217

Query  833   IKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRL  1012
             I   K+RT++PA  SF+EDCARILR +R+AARL FS S ET  +I  LS SV+ LDK RL
Sbjct  218   ITKAKVRTVVPAATSFQEDCARILRAIRIAARLGFSISRETAQSIKNLSYSVLRLDKGRL  277

Query  1013  MMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLD  1189
             +ME+NYML+YG+   SL LL ++ LL++LLPF AAY  +    ++   T++L+  FS++D
Sbjct  278   VMEINYMLAYGSGEASLRLLWRFGLLDILLPFQAAYFVRGGFRRRDKRTNLLLSFFSNVD  337

Query  1190  QLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKA  1366
             +L++  RP   SLWV++LA H  L + P+   VV   +  +++  N  + +  AR+  K 
Sbjct  338   KLLAPNRPCHSSLWVSVLALHKALSDQPRDCSVVAAFSLALHNGGNLSEAISIARRINKP  397

Query  1367  ASLYVPEISDSDGSMSEDELAKRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLV  1534
                   E+ D  G + E++L   + ++A  V      +T+   +    + F  + HS LV
Sbjct  398   HDARFHELLDPSG-LDEEDLEAEILDLAESVKGSLLQMTNGHLVSGAMADFPQAPHSDLV  456

Query  1535  FVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHET----  1702
              +   M  K               +LN   C       S  K    KKG  I +E+    
Sbjct  457   VIPLSMYLK---------------ALNFFDCV----RVSAGKNFLSKKGREIDYESLARG  497

Query  1703  -----RFLLSKIILDT  1735
                  R ++++I+ DT
Sbjct  498   DLLEVRHVVARIVFDT  513



>ref|XP_003532392.2| PREDICTED: uncharacterized protein LOC100801072 isoform X1 [Glycine 
max]
Length=536

 Score =   300 bits (767),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 192/474 (41%), Positives = 271/474 (57%), Gaps = 37/474 (8%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+++  G+  S I+  +  VLNVLKKKG   YLVGGCVRDLIL + PKDFD+IT+A 
Sbjct  76    WKKLNSKELGLRNSMIAVPTKKVLNVLKKKGHDVYLVGGCVRDLILKQTPKDFDIITSAD  135

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   EIVG+RFPIC VH+ G++VEVSSF+T   K       +      P  C+
Sbjct  136   LKEVRKTFSWCEIVGKRFPICHVHMDGTIVEVSSFNTARCKSSMHFIYDDI--EAPNDCD  193

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D +RWRN L RDFTIN L +DP+   +YDY   M DI   K+RT++PA  SF EDCAR
Sbjct  194   KEDYLRWRNCLKRDFTINGLMFDPYARIVYDYMGGMEDIIKAKVRTVVPAATSFREDCAR  253

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS S ET  ++  LS SV+ LDK RL ME+NYML+YG+   SL LL +
Sbjct  254   ILRAIRVAARLGFSISRETAQSVKNLSYSVLRLDKGRLWMEINYMLAYGSGEASLRLLWR  313

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LL++LLPF AAY       ++   T++L+  FS++D+L++  RP   SLWVA+LA H 
Sbjct  314   FGLLDILLPFQAAYFVCGGFRRRDKRTNLLLSFFSNVDKLLAPNRPCHSSLWVAILALHK  373

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              L + P+   VV   +  +++  N  + +  AR+  KA     PE+ D  G + E+ L  
Sbjct  374   ALSDKPRDSSVVAAFSLALHNGGNLSEAINIARRINKAHDARFPELLDPSG-LDEENLEA  432

Query  1433  RVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
              + ++A  V      +TD   +    + +  + HS LV +   M  K             
Sbjct  433   EILDLAESVKGSLLQMTDRHLVSGAMADYPQAPHSNLVLIPLSMFLK-------------  479

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHET---------RFLLSKIILDT  1735
               +LN   C     N S  K    K+G  I +E+         R + ++I+ DT
Sbjct  480   --ALNFFDCV----NVSTGKNYLSKQGRQIDYESLARGDLLEVRHVFARIVFDT  527



>ref|XP_008374181.1| PREDICTED: uncharacterized protein LOC103437489 isoform X2 [Malus 
domestica]
Length=527

 Score =   299 bits (766),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 184/473 (39%), Positives = 279/473 (59%), Gaps = 36/473 (8%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL++   GIT S I   +  VLN LK+KG++ YLVGGCVRDLILNR PKDFD+IT+A 
Sbjct  64    WKKLNSTELGITTSMIDKPTRKVLNGLKRKGYEVYLVGGCVRDLILNRTPKDFDIITSAE  123

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F   EIVG+RFPIC VHI  +V+EVSSF   A K      ++    R P  C+
Sbjct  124   LKEVTRTFSWCEIVGKRFPICHVHICDTVIEVSSFSISARKSGRNJSRDF---RKPNHCD  180

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D +RW N   RDFTIN L +DP+   +YDY   + DI+  K++T+IPA  SF+EDCAR
Sbjct  181   DXDYMRWMNCSQRDFTINGLMFDPYARIVYDYMGGIEDIRKAKVQTVIPASTSFQEDCAR  240

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F  S ET  ++  LS S++ LDK RL+ME+NYML+YG+A  SL LL K
Sbjct  241   ILRAIRIAARLGFRISKETAHSVKSLSYSILRLDKGRLLMEMNYMLAYGSAEASLRLLWK  300

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  AAY  +    ++   T++L+ LFS+LD+L+S ++P   SLWVA+LAFH 
Sbjct  301   FGLLELLLPIQAAYFVRHGFRRRDKRTNLLLSLFSNLDKLLSPDKPCHSSLWVAILAFHN  360

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDS---DGSMSEDE  1423
              L   P+  LVV  L+  +++  +  + V  A++  K   +   E+ ++   +     DE
Sbjct  361   ALSEQPRDPLVVAALSLAIHNGGDMLEAVSIAKRVTKVHDVSFHELLENQNLNPRALRDE  420

Query  1424  LAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDV  1603
             +   V ++   +N +TD   + +  + +  + +S LV +   +  ++    +F  +T+  
Sbjct  421   VVNLVTSLKRALNNMTDEQIVSQAMAAYPQAPYSDLVLIPWGLSLRVC--RIFSCITS--  476

Query  1604  TSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHET---------RFLLSKIILDT  1735
                              ++G   K+G+ I +E+         R + ++++ DT
Sbjct  477   ---------------GAERGFXPKQGSKIDYESLAQGALPEVRHIFARVVFDT  514



>ref|XP_003630568.1| Poly(A) polymerase [Medicago truncatula]
Length=543

 Score =   300 bits (767),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 185/491 (38%), Positives = 273/491 (56%), Gaps = 45/491 (9%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKG---------------------------FK  457
             W+K++++  G   S I+     VLN+LKKKG                           + 
Sbjct  57    WKKMNSKELGFRNSMIASPIKKVLNMLKKKGMFCCVSACYLNSKLSRSVTLFLVVVVGYN  116

Query  458   AYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVS  637
              YLVGGCVRD+IL + PKDFD++T+A L E+ + F   EIVG+RFPIC VH+ G +VEVS
Sbjct  117   VYLVGGCVRDMILRQTPKDFDILTSADLKEVMRTFSWCEIVGKRFPICHVHMDGIIVEVS  176

Query  638   SFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYA  817
             SF+T   K     R  +     PKG ++ D +RWRN ++RDFTIN   +DPF   +YDY 
Sbjct  177   SFNTAKRK---PGRHFAHDIEAPKGFDKEDYLRWRNCVNRDFTINGFMFDPFAKIVYDYM  233

Query  818   NAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSL  997
               M DI   K+RT++PA  SF+EDCARILR +R+AARL FS S ET  ++  LS S++ L
Sbjct  234   GGMEDIIKAKVRTMVPAATSFQEDCARILRAIRIAARLGFSISTETARSVKHLSYSILRL  293

Query  998   DKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKL  1174
             DK RL+ME+NYML+YG+   SL LL K+ LL++LLPF A Y  +    ++   T+ML+ L
Sbjct  294   DKGRLLMEMNYMLAYGSGEASLRLLWKFGLLDILLPFQALYFVRHGFRRRDKRTNMLLSL  353

Query  1175  FSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFAR  1351
             F +LD+L++   P   SLWV +LA H +L + P+  LV+   +  +++  N  + V+ AR
Sbjct  354   FFNLDKLLAPNSPCHSSLWVGILALHKSLSDQPRNPLVIAAFSLAVHNGGNLLEAVDIAR  413

Query  1352  QHVKAASLYVPEISDS---DGSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSH  1522
             +  K   +  PE+SD    +    E+E+   VE++ V +  +T   ++      +  + H
Sbjct  414   RINKPHDIRFPELSDPCDLNAKALENEILDLVESVKVSLLQMTSRHSVARAMVDYPQAPH  473

Query  1523  SGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHET  1702
             S +VF+   M  K +   +F         L   SC  K  +   +K        G   E 
Sbjct  474   SDMVFIPLGMYLKAL--SIF-------DCLKVSSCK-KFLSKKSRKIDYESLARGDLPEI  523

Query  1703  RFLLSKIILDT  1735
             R L ++++ DT
Sbjct  524   RHLFARVVFDT  534



>ref|XP_008374180.1| PREDICTED: uncharacterized protein LOC103437489 isoform X1 [Malus 
domestica]
Length=528

 Score =   299 bits (765),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 183/467 (39%), Positives = 276/467 (59%), Gaps = 24/467 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL++   GIT S I   +  VLN LK+KG++ YLVGGCVRDLILNR PKDFD+IT+A 
Sbjct  65    WKKLNSTELGITTSMIDKPTRKVLNGLKRKGYEVYLVGGCVRDLILNRTPKDFDIITSAE  124

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F   EIVG+RFPIC VHI  +V+EVSSF   A K      ++    R P  C+
Sbjct  125   LKEVTRTFSWCEIVGKRFPICHVHICDTVIEVSSFSISARKSGRNJSRDF---RKPNHCD  181

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D +RW N   RDFTIN L +DP+   +YDY   + DI+  K++T+IPA  SF+EDCAR
Sbjct  182   DXDYMRWMNCSQRDFTINGLMFDPYARIVYDYMGGIEDIRKAKVQTVIPASTSFQEDCAR  241

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F  S ET  ++  LS S++ LDK RL+ME+NYML+YG+A  SL LL K
Sbjct  242   ILRAIRIAARLGFRISKETAHSVKSLSYSILRLDKGRLLMEMNYMLAYGSAEASLRLLWK  301

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  AAY  +    ++   T++L+ LFS+LD+L+S ++P   SLWVA+LAFH 
Sbjct  302   FGLLELLLPIQAAYFVRHGFRRRDKRTNLLLSLFSNLDKLLSPDKPCHSSLWVAILAFHN  361

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDS---DGSMSEDE  1423
              L   P+  LVV  L+  +++  +  + V  A++  K   +   E+ ++   +     DE
Sbjct  362   ALSEQPRDPLVVAALSLAIHNGGDMLEAVSIAKRVTKVHDVSFHELLENQNLNPRALRDE  421

Query  1424  LAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDV  1603
             +   V ++   +N +TD   + +  + +  + +S LV +   +  ++    +F  +T+  
Sbjct  422   VVNLVTSLKRALNNMTDEQIVSQAMAAYPQAPYSDLVLIPWGLSLRVC--RIFSCITSGA  479

Query  1604  TSLNEKSCSLKIQNPSPQKGTA---HKKGNGIAHETRFLLSKIILDT  1735
                         +   P++G+         G   E R + ++++ DT
Sbjct  480   E-----------RGFXPKQGSKIDYESLAQGALPEVRHIFARVVFDT  515



>ref|NP_001052662.1| Os04g0395900 [Oryza sativa Japonica Group]
 emb|CAD40772.1| OSJNBb0039F02.3 [Oryza sativa Japonica Group]
 dbj|BAF14576.1| Os04g0395900 [Oryza sativa Japonica Group]
 dbj|BAG99859.1| unnamed protein product [Oryza sativa Japonica Group]
Length=542

 Score =   299 bits (765),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/415 (43%), Positives = 248/415 (60%), Gaps = 22/415 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+ A+ FGI  S I   +W VL+ L+ +G+  YLVGGCVRDLI+ + PKDFD+ITTA 
Sbjct  77    WKKVSAKRFGIKDSMIPDEAWNVLHRLRSRGYDVYLVGGCVRDLIMKKTPKDFDIITTAD  136

Query  539   LNEIKKQFY-RAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
             L ++K  F   A IVGRRFPIC V+   S+VEVSSF+T A      +   S  P     C
Sbjct  137   LRQVKDTFSGSAVIVGRRFPICHVYENNSIVEVSSFNTYARGSTSNQIYTSKSPH----C  192

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
             +++D IRW+N   RDFTIN L ++P+  +IYDY   + DIK  K+RT+IPA  SF+EDCA
Sbjct  193   SKNDYIRWKNCQGRDFTINGLMFNPYAEKIYDYFGGIEDIKKAKVRTVIPAGTSFQEDCA  252

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR +R+AARL F+F  ET   +  L+ SV  LDK R++ME+NYML+YG+A  SL LL 
Sbjct  253   RILRAIRIAARLGFNFPKETAYYVRTLACSVARLDKGRILMEINYMLAYGSAEASLRLLW  312

Query  1076  KYNLLEVLLPFHAAYLTQ-QADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             ++ LLE LLPF AAY +  +  ++   T+ML+ LFS LD  ++  RP   SLW+++LA H
Sbjct  313   RFGLLEHLLPFQAAYFSSTRFKRKDKGTNMLLVLFSKLDNFLAPNRPCHNSLWISILALH  372

Query  1253  LTLVNNPQPKLVVLTLASVMYHRN-----WKQGVEFARQHVKAAS-LYVPEISDSDGSMS  1414
               LV  P+  LVV T A  +Y           G    RQH    S L  P++ D      
Sbjct  373   EALVRQPRDPLVVATFALALYLGGDMSLALDIGKSINRQHNTGFSELLEPQVWD------  426

Query  1415  EDELAKRVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIV  1567
             +  L   V+++AV +      +TD   +    +K   +  S LVF+  +   K++
Sbjct  427   DKHLVGEVQSLAVSMRRALTEMTDEYFVANAMAKIPQAPSSDLVFIPLQAYLKVL  481



>gb|EAY93937.1| hypothetical protein OsI_15711 [Oryza sativa Indica Group]
Length=542

 Score =   299 bits (765),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/415 (43%), Positives = 248/415 (60%), Gaps = 22/415 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+ A+ FGI  S I   +W VL+ L+ +G+  YLVGGCVRDLI+ + PKDFD+ITTA 
Sbjct  77    WKKVSAKRFGIKDSMIPDEAWNVLHRLRSRGYDVYLVGGCVRDLIMKKTPKDFDIITTAD  136

Query  539   LNEIKKQFY-RAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
             L ++K  F   A IVGRRFPIC V+   S+VEVSSF+T A      +   S  P     C
Sbjct  137   LRQVKDTFSGSAVIVGRRFPICHVYENNSIVEVSSFNTYARGSTSNQIYTSKSPH----C  192

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
             +++D IRW+N   RDFTIN L ++P+  +IYDY   + DIK  K+RT+IPA  SF+EDCA
Sbjct  193   SKNDYIRWKNCQGRDFTINGLMFNPYAEKIYDYFGGIEDIKKAKVRTVIPAGTSFQEDCA  252

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR +R+AARL F+F  ET   +  L+ SV  LDK R++ME+NYML+YG+A  SL LL 
Sbjct  253   RILRAIRIAARLGFNFPKETAYYVRTLACSVARLDKGRILMEINYMLAYGSAEASLRLLW  312

Query  1076  KYNLLEVLLPFHAAYLTQ-QADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             ++ LLE LLPF AAY +  +  ++   T+ML+ LFS LD  ++  RP   SLW+++LA H
Sbjct  313   RFGLLEHLLPFQAAYFSSTRFKRKDKGTNMLLVLFSKLDNFLAPNRPCHNSLWISILALH  372

Query  1253  LTLVNNPQPKLVVLTLASVMYHRN-----WKQGVEFARQHVKAAS-LYVPEISDSDGSMS  1414
               LV  P+  LVV T A  +Y           G    RQH    S L  P++ D      
Sbjct  373   EALVRQPRDPLVVATFALALYLGGDMSLALDIGKSINRQHNTGFSELLEPQVWD------  426

Query  1415  EDELAKRVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIV  1567
             +  L   V+++AV +      +TD   +    +K   +  S LVF+  +   K++
Sbjct  427   DKHLVGEVQSLAVSMRRALTEMTDEYFVANAMAKIPQAPSSDLVFIPLQAYLKVL  481



>ref|XP_004975447.1| PREDICTED: uncharacterized protein LOC101786112 [Setaria italica]
Length=537

 Score =   298 bits (764),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 217/331 (66%), Gaps = 8/331 (2%)
 Frame = +2

Query  335   PGK--IEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIP  508
             PG   +E   W+K+ A+ FGI  S I   +W VL+ L+ +G+  YLVGGCVRDLI+ + P
Sbjct  62    PGAEGLEGPEWKKVSAKRFGIKESMIPAEAWNVLHRLRSRGYDVYLVGGCVRDLIMKKTP  121

Query  509   KDFDVITTARLNEIKKQFY-RAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKN  685
             KDFD+ITTA L ++K  F   A IVGRRFPIC VH   S+VEVSSF+T A     ++  N
Sbjct  122   KDFDIITTADLRQVKDTFSGSAVIVGRRFPICHVHENNSIVEVSSFNTCARGSSGSQIYN  181

Query  686   SFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIP  865
             S      + C+++D +RW+N   RDFTIN L ++P+  +IYDY   + DIK  K+RT+IP
Sbjct  182   S----KSQNCSKNDFVRWKNCQGRDFTINGLMFNPYSEKIYDYLGGIEDIKKAKVRTVIP  237

Query  866   AQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYG  1045
             A  SF+EDCARILR +R+AARL FSF  ET   +  L+ SV  LDK R++ME+NYML+YG
Sbjct  238   AGTSFQEDCARILRAIRIAARLGFSFPKETAYYVRTLACSVARLDKGRILMEMNYMLAYG  297

Query  1046  AAVPSLCLLQKYNLLEVLLPFHAAYLTQ-QADKQSSDTSMLMKLFSSLDQLVSCERPARE  1222
             +A  SL LL ++ LLE LLPF AAY +  +  ++   T+ML+ LFS LD  ++  RP   
Sbjct  298   SAEASLRLLWRFGLLEHLLPFQAAYFSSTRFKRKDKGTNMLLVLFSKLDNFLAPNRPCHN  357

Query  1223  SLWVALLAFHLTLVNNPQPKLVVLTLASVMY  1315
             SLW++LLAFH  L   P   LVV T A   Y
Sbjct  358   SLWISLLAFHEALARQPCDPLVVATFALAFY  388



>ref|XP_008454136.1| PREDICTED: uncharacterized protein LOC103494627 isoform X2 [Cucumis 
melo]
Length=507

 Score =   298 bits (762),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 179/465 (38%), Positives = 260/465 (56%), Gaps = 54/465 (12%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+ L +   GI  S IS ++ VVL+ L+K+G++ YLVGGCVRDLIL RIPKDFDVIT+A+
Sbjct  73    WKALSSEDLGIDSSMISKATRVVLDGLRKQGYEVYLVGGCVRDLILKRIPKDFDVITSAQ  132

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F R  +VG+RFPIC VH+ G+ VEVSSF T  ++       N      P   +
Sbjct  133   LKEVRKIFARCLVVGKRFPICHVHVSGTFVEVSSFSTSGSRNGFNNYINK-----PSNLS  187

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IRW N   RDFTINSL YDP+   +YDY  AM DI+  K+RT+ PA LSF EDCAR
Sbjct  188   EPDYIRWENCSRRDFTINSLMYDPYNKVVYDYLGAMEDIRKSKVRTVKPANLSFTEDCAR  247

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             I                               L   RL+ME+NYML++G+A  SL LL +
Sbjct  248   I-------------------------------LRGGRLLMEMNYMLAFGSAEASLRLLWR  276

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  A+Y   Q   ++ + ++ML+ LFS+LD+LV+  RP   SLW+ALLAFH 
Sbjct  277   FGLLEILLPIQASYFVSQGFRRRDARSNMLLILFSNLDKLVAPNRPCHSSLWIALLAFHK  336

Query  1256  TLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              LV+ PQ  +VV  L+ ++    +  + VE A Q++        EI +S+   S+  LA+
Sbjct  337   ALVDQPQDPVVVAALSLAINNGGSLFEAVEIA-QNISQPHASFHEIVESNHKESDYSLAE  395

Query  1433  RVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
             +V ++A  VN     +T++  + +   K+  +  S LVF+S  +   +   ++F  +   
Sbjct  396   QVIDLADSVNTVLWKMTNSQYVSQAMIKYPQAPWSDLVFISQPLSTSVC--KIFECI---  450

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
                   +S +  +  P   +   +    G   E R   ++I+ DT
Sbjct  451   ------RSYNKNVSVPKISRINHYALARGNLPEVRHAFARIVFDT  489



>ref|XP_002872067.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48326.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=533

 Score =   298 bits (763),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 188/468 (40%), Positives = 270/468 (58%), Gaps = 21/468 (4%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W++L+++  GI+ S I+ S+  VLN LK KG   YLVGGCVRDLIL R PKDFD++T+A 
Sbjct  68    WKRLNSKDLGISSSMIAKSTRKVLNGLKSKGHDVYLVGGCVRDLILKRTPKDFDILTSAE  127

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F R EIVGRRFPIC VHI   +VEVSSF T A       R  S       G  
Sbjct  128   LREVVQTFPRCEIVGRRFPICHVHIGDDLVEVSSFSTSAQNYPRNTRTESKESSGSDG--  185

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D IR  N L RDFTIN L +DP+   +YDY   M DI+  K+RT+I A  SF++DCAR
Sbjct  186   DEDCIRLNNCLQRDFTINGLMFDPYAKVVYDYLGGMEDIRKAKVRTVIHAGTSFQQDCAR  245

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F  S ET   I  LS  V  LDK R++ME+NYML+YG+A  SL LL K
Sbjct  246   ILRAIRIAARLGFRMSKETAHFIKNLSLLVQRLDKGRILMEMNYMLAYGSAEASLRLLWK  305

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  AAYL +    ++   T+ML+ LF++LD+L++ +RP   SLW+A+LAFH 
Sbjct  306   FGLLEILLPIQAAYLARSGFRRRDKRTNMLLSLFANLDKLLAPDRPCHSSLWIAILAFHK  365

Query  1256  TLVNNPQPKLVVLTLASVMYH-----RNWKQGVEFARQHVKAASLYVPEISDSDGSMSED  1420
              L + P+  LVV   +  +++        K   + AR H K+    V    + D     D
Sbjct  366   ALADQPRSPLVVAAFSLAVHNCGDILEAVKITKKIARPHDKSFFELVEPEENLDFQTLLD  425

Query  1421  ELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
             E+     ++   +N +TD   + +  S +  + +S LVF+  ++  +     +F     D
Sbjct  426   EVMDLDASIKDALNQMTDGYYISKAMSAYPQAPYSDLVFIPLQLYLR--AGRIF-----D  478

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKG---NGIAHETRFLLSKIILDT  1735
                 +E    ++ +    +KG+  + G   +G   E R + ++++ DT
Sbjct  479   CVKKDETHTQMEFE---AKKGSKIEYGSLYSGDFPEIRHVFARVVFDT  523



>gb|KHN17469.1| Poly(A) polymerase [Glycine soja]
Length=538

 Score =   298 bits (762),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 175/404 (43%), Positives = 250/404 (62%), Gaps = 9/404 (2%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+++  G+  S I+  +  VLNVLKKKG   YLVGGCVRDLIL + PKDFD+IT+A 
Sbjct  67    WKKLNSKEIGLRNSMIAIPTKKVLNVLKKKGHDVYLVGGCVRDLILKQTPKDFDIITSAD  126

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   EIVG+RFPIC VH+ G++VEVSSF+T   K       +      P  C+
Sbjct  127   LKEVRKTFSLCEIVGKRFPICHVHMDGTIVEVSSFNTARCKSSMHFIYDDI--EAPHDCD  184

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D +RWRN L RDFTIN L +DP+   +YDY   M DI   K+RT++PA  SF EDCAR
Sbjct  185   KEDYLRWRNCLRRDFTINGLMFDPYARIVYDYMGGMEDIVKAKVRTVVPAATSFREDCAR  244

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS S ET  ++  LS SV+ LD+SRL+ME+NYML+YG+   SL LL +
Sbjct  245   ILRAIRVAARLGFSISRETAQSVKNLSYSVLRLDRSRLLMEINYMLAYGSGEASLRLLWR  304

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LL++LLPF AAY  +    ++   T++L+  FS++D+L++  RP   SLWV +LA H 
Sbjct  305   FGLLDILLPFQAAYFVRGGFRRRDKRTNLLLSFFSNVDKLLAPNRPCHSSLWVVILALHK  364

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              L + P+   VV   +  +++  N  + +  AR+  KA     PE+ D  G + E++L  
Sbjct  365   ALSDKPRDSSVVAAFSLALHNGGNLSEAINIARRINKAHDARFPELLDPSG-LDEEDLEA  423

Query  1433  RVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKM  1552
              + ++A  V      + D   +    + +  + HS LV +   M
Sbjct  424   EILDLAESVKGSLLQMKDRHFVSGAMADYPQAPHSDLVLIPIPM  467



>ref|XP_004138025.1| PREDICTED: poly(A) polymerase-like [Cucumis sativus]
Length=441

 Score =   294 bits (753),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 179/444 (40%), Positives = 265/444 (60%), Gaps = 22/444 (5%)
 Frame = +2

Query  425   VLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICR  604
             VLN LKK G++ YLVGGCVRDLILNR+PKDFD+IT+A+L E+ + F   EIVGRRFPIC 
Sbjct  9     VLNGLKKTGYEVYLVGGCVRDLILNRVPKDFDIITSAQLKEVSRIFLWCEIVGRRFPICH  68

Query  605   VHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFY  784
             VHI G++VEVSSF T +N+  + +  ++ + + P  C E D +RW+N L RDFTIN L Y
Sbjct  69    VHIDGTIVEVSSFST-SNRPFDRQLTSAAIEK-PMNCEEIDFVRWKNCLQRDFTINGLMY  126

Query  785   DPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETA  964
             DP+   +YDY   M DI+  K+RT++PA  SF+ED ARI R +R AARL+F FS +   +
Sbjct  127   DPYNNVVYDYLGGMEDIRKAKVRTVVPACTSFQEDFARIFRAIRFAARLQFHFSKDIAGS  186

Query  965   IWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQ  1144
             I  LS  V +L+K+RL ME+NY+LSYG+A  SL LL KY LLE+LLP  AAY  +   ++
Sbjct  187   IKNLSCLVFTLNKARLQMEMNYLLSYGSAEASLRLLWKYGLLEILLPIQAAYFIRNGFRR  246

Query  1145  SSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-  1318
             S   S ML+ LFSSLD+L++  RP   SLWVA+LA H+ L + P+  LVV      +++ 
Sbjct  247   SDKGSNMLLSLFSSLDKLLAPNRPCHSSLWVAVLALHVALSDQPRSPLVVAAFGLAVHNG  306

Query  1319  RNWKQGVEFARQHVKAASLYVPEISDSDGSMSE---DELAKRVENMAVQVNMLTDADNLR  1489
              N  + +  A+   +A +    E+ + +    +   DE+      +   ++ +TD   + 
Sbjct  307   GNMMEAISIAKSINRAHNANFCELLEPENLEVQALIDEVMDLTTFVKAALHKMTDEHFVS  366

Query  1490  EVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTA  1669
                  +  +  S LVF+   +V  + V ++F  +                +   P++G  
Sbjct  367   LALETYPQAPASDLVFIP--LVVYLKVCKIFECVVEGAE-----------RGFVPKRGKI  413

Query  1670  HKKGNGIAH--ETRFLLSKIILDT  1735
             + +   + +  E R + ++I+ DT
Sbjct  414   NYECLALGNLLELRHVFARIVFDT  437



>ref|NP_197758.2| polynucleotide adenylyltransferase family protein [Arabidopsis 
thaliana]
 gb|AED93199.1| polynucleotide adenylyltransferase family protein [Arabidopsis 
thaliana]
Length=527

 Score =   296 bits (759),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 193/509 (38%), Positives = 286/509 (56%), Gaps = 35/509 (7%)
 Frame = +2

Query  257   KFNQTSAG-------DGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPS  415
             +FN  +A        DG   +S  DR    + +P   E   W++L+++  G++ S I+ S
Sbjct  28    RFNTVAAAIETMDESDGFATDS--DRQDKVSDEPRDRE---WKQLNSKDLGLSSSMIAKS  82

Query  416   SWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFP  595
             +  VLN LK KG   YLVGGCVRDLIL R PKDFD++T+A L E+ + F R EIVGRRFP
Sbjct  83    TRKVLNGLKSKGHDVYLVGGCVRDLILKRTPKDFDILTSAELREVVRTFPRCEIVGRRFP  142

Query  596   ICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINS  775
             IC VHI   ++EVSSF T A       R          G  + D IR  N L RDFTIN 
Sbjct  143   ICHVHIGDDLIEVSSFSTSAQNSSRNTRTECKESSGSDG--DEDCIRLNNCLQRDFTING  200

Query  776   LFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMET  955
             L +DP+   +YDY   M DI+  K+RT+I A  SF +DCARILR +R+AARL F  S ET
Sbjct  201   LMFDPYAKVVYDYLGGMEDIRKAKVRTVIHAGTSFHQDCARILRAIRIAARLGFRMSKET  260

Query  956   ETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA  1135
                I  LS  V  LDK R++ME+NYML+YG+A  SL LL K+ +LE+LLP  AAYL +  
Sbjct  261   AHFIKNLSLLVQRLDKGRILMEMNYMLAYGSAEASLRLLWKFGILEILLPIQAAYLARSG  320

Query  1136  -DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVM  1312
               ++   T+ML+ LF++LD+L++ +RP   SLW+A+LAFH  L + P+  +VV   +  +
Sbjct  321   FRRRDKRTNMLLSLFANLDKLLAPDRPCHSSLWIAILAFHKALADKPRSPIVVAAFSLAV  380

Query  1313  YH-RNWKQGVE----FARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQVNMLTDA  1477
             ++  +  + VE      R H K+    V    + D     DE+     ++   +N +TDA
Sbjct  381   HNCGDILEAVEITKKITRPHDKSFFELVEPEENLDFQTLLDEVMDLDASIEDALNQMTDA  440

Query  1478  DNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQ  1657
               + +  S +  + +S LVF+  ++  +     +F  + N+ T +  ++          +
Sbjct  441   YFISKAMSAYPQAPYSDLVFIPLQLYLR--AGRIFDCVKNEETRIGFEA----------K  488

Query  1658  KGTAHKKG---NGIAHETRFLLSKIILDT  1735
             +G+  + G   +G   E R + ++++ DT
Sbjct  489   QGSKIEYGSLNSGYFPEIRHVFARVVFDT  517



>ref|XP_010550754.1| PREDICTED: uncharacterized protein LOC104821535 [Tarenaya hassleriana]
Length=524

 Score =   296 bits (759),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 191/497 (38%), Positives = 281/497 (57%), Gaps = 50/497 (10%)
 Frame = +2

Query  308   DRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRD  487
             ++ +D     G      W+KL+++  GI+ S I+  +  VLN LKKKGF+ YLVGGCVRD
Sbjct  52    NKGSDGKRTEGNGTIREWKKLNSKDLGISTSMIAKPTRQVLNGLKKKGFEVYLVGGCVRD  111

Query  488   LILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGD  667
             LIL RIPKDFD++T+A L E+ + F R EIVG+RFPIC VH+   +VEVSSF T A    
Sbjct  112   LILKRIPKDFDILTSAELREVVRTFSRCEIVGKRFPICHVHVGDDIVEVSSFSTSA----  167

Query  668   ETKRKNSFVPR-MPKGCNES------DVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAM  826
                 +NS  PR M     E+      D IR+ N L RDFTIN L +DP+   +YDY   +
Sbjct  168   ----RNS--PRNMVSDFGEASWSDNQDCIRFNNCLQRDFTINGLMFDPYAKVVYDYLGGI  221

Query  827   ADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKS  1006
              DI+  K+RT+  A  SF+EDCARILR +R+AARL F  S ET   +  LS  V  LDK 
Sbjct  222   EDIREAKVRTVSHAGTSFQEDCARILRAIRIAARLGFRISKETAHFVKNLSFLVKRLDKG  281

Query  1007  RLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSS  1183
             R+MME+NYML+YG+A  SL LL K+ +LE+LLP  AAY  +    ++   ++ML+ LFS+
Sbjct  282   RIMMEMNYMLAYGSAEASLRLLWKFGILEILLPIQAAYFVRSGFRRRDKRSNMLLSLFSN  341

Query  1184  LDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHV  1360
             LD+L++ +RP    LW+A+LAFH  L + P+  LVV   +  +++  +  + V+  R+  
Sbjct  342   LDKLLAPDRPCHSILWIAILAFHKALTDQPRDPLVVAAFSLAVHNGGDLFEAVKITRKIT  401

Query  1361  KA---ASLYVPEISDSDGSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGL  1531
             K    +   + E  D D     DE+     ++   +  +TD   + +  S +  + +S L
Sbjct  402   KPHNRSFFELVEPQDMDLRTMLDEVMDLDASVKDALGQMTDEYFVSKAMSAYPQAPYSDL  461

Query  1532  VFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAH-----  1696
             VF+  ++  +  V  +F  + +DV                 +KG   K+G+ I H     
Sbjct  462   VFIPLQLYLR--VGRIFHCVKDDV-----------------EKGFVPKQGSKINHASLSE  502

Query  1697  ----ETRFLLSKIILDT  1735
                 E R + ++++ DT
Sbjct  503   GNLPEVRHVFARVVFDT  519



>ref|XP_011002101.1| PREDICTED: uncharacterized protein LOC105109184 isoform X1 [Populus 
euphratica]
Length=517

 Score =   296 bits (758),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 183/441 (41%), Positives = 257/441 (58%), Gaps = 15/441 (3%)
 Frame = +2

Query  245   SLLQKFNQTSAGDGIQLESTTDR---AADSNFQPGKIEFSNWRKLDARHFGITGSRISPS  415
             SL   F +        +E+  D+     D N   G  +   W+K +++  GI  S IS  
Sbjct  19    SLFHCFEKVRFSSVAAIETLFDQDNFIKDKNQNLGDPKALEWKKWNSKELGIINSTISRP  78

Query  416   SWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFP  595
             +  VL+ LKK G++ YLVGGCVRDLIL R PKDFD+IT+A L E+ + F R  IVG+RFP
Sbjct  79    TKKVLDGLKKNGYEVYLVGGCVRDLILKRTPKDFDIITSAELKEVVRAFPRCIIVGKRFP  138

Query  596   ICRVHIRGSVVEVSSFDTVANKG--DETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTI  769
             IC VHI  ++VEVSSF T   K   D +K  +      P  C+E D  RW+N L RD TI
Sbjct  139   ICHVHIGDTIVEVSSFSTTGPKFRLDLSKGISP-----PIDCDEKDYFRWKNCLRRDLTI  193

Query  770   NSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSM  949
             N L +DP+   +YDY   + DIK  K+RT++PA  SF+EDCARILR +R+AARL F F+ 
Sbjct  194   NGLMFDPYKRIVYDYVGGLEDIKKAKVRTVVPAGTSFQEDCARILRAVRIAARLGFRFTR  253

Query  950   ETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQ  1129
             ET   I  LS S++ LD  R+MME+NYML+YG+A  SL +L K+ LLE+LLPF AAY  +
Sbjct  254   ETAHFIKNLSCSLLRLDNQRIMMEMNYMLAYGSAEASLRILWKFGLLELLLPFQAAYFVR  313

Query  1130  QADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLA-  1303
                K+    S ML+ LFS+LD+ ++ +RP   SLWV +LAFH  L + P+  +VV     
Sbjct  314   DGFKRRDKRSNMLLCLFSNLDKHLAPDRPCHNSLWVGILAFHKALSDQPRDPMVVAAFCL  373

Query  1304  SVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSE---DELAKRVENMAVQVNMLTD  1474
             +V    +   GV+  ++  K       E+S+     SE   DE+     ++   +  +TD
Sbjct  374   AVNNGGDILGGVKMVKKFTKPHDASFHELSEPQNLNSEALVDEVVDFAASVKQVLYWMTD  433

Query  1475  ADNLREVTSKFSGSSHSGLVF  1537
                + +  +++  +  S LVF
Sbjct  434   EYCVSQAMAEYPQAPCSDLVF  454



>ref|XP_010109202.1| Poly(A) polymerase [Morus notabilis]
 gb|EXC21324.1| Poly(A) polymerase [Morus notabilis]
Length=486

 Score =   295 bits (754),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 192/500 (38%), Positives = 281/500 (56%), Gaps = 68/500 (14%)
 Frame = +2

Query  308   DRAADSNFQ--------PGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAY  463
             D + D+NF+         G  +   W+KL+++  GI+ S I+  +  VLN LK+KG++ Y
Sbjct  19    DLSGDNNFRNLVHERGNVGDGQVREWKKLNSKELGISTSNITKPTRKVLNSLKQKGYEVY  78

Query  464   LVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSF  643
             LVGGCVRDL+L R PKDFD+IT+A+L E+KK F   EIVG+RFPIC VH+  S+VEVSSF
Sbjct  79    LVGGCVRDLLLKRTPKDFDIITSAQLKEVKKAFSWCEIVGKRFPICHVHVEDSIVEVSSF  138

Query  644   DTVAN--KGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYA  817
              T  N   GD     + FV   P   +E D  RWR+ L RDFTINSL +DP+   +YDY 
Sbjct  139   STRQNMVGGDV---HHDFVK--PTVYDEKDYGRWRDCLRRDFTINSLIFDPYTSTVYDYL  193

Query  818   NAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSL  997
               + D+K  K+RT+IPA +SF+EDCARILR +R+AARL F  S ET  ++  LS SV  L
Sbjct  194   GGIEDLKKAKVRTVIPASISFQEDCARILRAIRIAARLGFRLSRETAHSVKVLSGSVAKL  253

Query  998   DKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLF  1177
             DK RL+ME NY+L+YG+A  SL LL K+ LLE+LLP  +                   LF
Sbjct  254   DKGRLLMEANYLLAYGSAEASLRLLWKFGLLEILLPVQS-------------------LF  294

Query  1178  SSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQ  1354
             S++D+L++ ++P   SLWVA+LAFH  L + PQ  LVV   +  +++  +  + V+ AR+
Sbjct  295   SNMDKLLAPDKPCHSSLWVAILAFHKALFDQPQDPLVVAAFSLALHNGGDVAEAVQIARR  354

Query  1355  HVKAASLYVPEISDSDGSMSEDELAKRVENMAVQVNM----LTDADNLREVTSKFSGSSH  1522
                       E+ + + S+   EL   V ++A  V      +TD   + +  +++  +  
Sbjct  355   ITSPHDASFHELLEPE-SLESQELIDEVMDLADCVKCALYRMTDEQVVSQAMAEYPKAPF  413

Query  1523  SGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAH--  1696
             S LV +   +  ++    VF  +         + C          +G A K+G+ I +  
Sbjct  414   SDLVLIPLGLYLRVC--RVFECV---------RDCG--------AQGFASKQGSKIDYKS  454

Query  1697  -------ETRFLLSKIILDT  1735
                    E R + ++I+ DT
Sbjct  455   LAMGSLQEVRHVFARIVFDT  474



>gb|AAL67117.1| AT5g23690/MQM1_4 [Arabidopsis thaliana]
 gb|AAM91472.1| AT5g23690/MQM1_4 [Arabidopsis thaliana]
Length=527

 Score =   295 bits (755),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 193/509 (38%), Positives = 285/509 (56%), Gaps = 35/509 (7%)
 Frame = +2

Query  257   KFNQTSAG-------DGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPS  415
             +FN  +A        DG   +S  DR    + +P   E   W++L+++  G++ S I+ S
Sbjct  28    RFNTVAAAIETMDESDGFATDS--DRQDKVSDEPRDRE---WKQLNSKDLGLSSSMIAKS  82

Query  416   SWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFP  595
             +  VLN LK KG   YLVGGCVRDLIL R PKDFD++T+A L E+ + F R EIVGRRFP
Sbjct  83    TRKVLNGLKSKGHDVYLVGGCVRDLILKRTPKDFDILTSAELREVVRTFPRCEIVGRRFP  142

Query  596   ICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINS  775
             IC VHI   ++EVSSF T A       R          G  + D IR  N L RDFTIN 
Sbjct  143   ICHVHIGDDLIEVSSFSTSAQNSSRNTRTECKESSGSDG--DEDCIRLNNCLQRDFTING  200

Query  776   LFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMET  955
             L +DP+   +YDY   M DI+  K+RT I A  SF +DCARILR +R+AARL F  S ET
Sbjct  201   LMFDPYAKVVYDYLGGMEDIRKAKVRTEIHAGTSFHQDCARILRAIRIAARLGFRMSKET  260

Query  956   ETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA  1135
                I  LS  V  LDK R++ME+NYML+YG+A  SL LL K+ +LE+LLP  AAYL +  
Sbjct  261   AHFIKNLSLLVQRLDKGRILMEMNYMLAYGSAEASLRLLWKFGILEILLPIQAAYLARSG  320

Query  1136  -DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVM  1312
               ++   T+ML+ LF++LD+L++ +RP   SLW+A+LAFH  L + P+  +VV   +  +
Sbjct  321   FRRRDKRTNMLLSLFANLDKLLAPDRPCHSSLWIAILAFHKALADKPRSPIVVAAFSLAV  380

Query  1313  YH-RNWKQGVE----FARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQVNMLTDA  1477
             ++  +  + VE      R H K+    V    + D     DE+     ++   +N +TDA
Sbjct  381   HNCGDILEAVEITKKITRPHDKSFFELVEPEENLDFQTLLDEVMDLDASIEDALNQMTDA  440

Query  1478  DNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQ  1657
               + +  S +  + +S LVF+  ++  +     +F  + N+ T +  ++          +
Sbjct  441   YFISKAMSAYPQAPYSDLVFIPLQLYLR--AGRIFDCVKNEETRIGFEA----------K  488

Query  1658  KGTAHKKG---NGIAHETRFLLSKIILDT  1735
             +G+  + G   +G   E R + ++++ DT
Sbjct  489   QGSKIEYGSLNSGYFPEIRHVFARVVFDT  517



>ref|XP_008668345.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=548

 Score =   296 bits (757),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 184/445 (41%), Positives = 257/445 (58%), Gaps = 37/445 (8%)
 Frame = +2

Query  314   AADSNFQPGK--IEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRD  487
             A  S+  PG   +E   W+K+ A+ FGI  S I P +W VL+ L+ +G+  YLVGGCVRD
Sbjct  53    APTSDSGPGAEGMEGLEWKKISAKRFGIKESMIPPEAWNVLHRLRSRGYDVYLVGGCVRD  112

Query  488   LILNRIPKDFDVITTARLNE-------------IKKQFY-RAEIVGRRFPICRVHIRGSV  625
             LI+ + PKDFD+ITTA L++             +K  F   A IVGRRFPIC VH   S+
Sbjct  113   LIMKKTPKDFDIITTADLSDKSFISDNPEYFTKVKDTFLGSAVIVGRRFPICHVHENNSI  172

Query  626   VEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQI  805
             VEVSSF+T A     ++  NS      + C+++D +RW+N   RDFTIN L ++P+  +I
Sbjct  173   VEVSSFNTCARGSSGSQIYNS----KSQNCSKNDFVRWKNCQRRDFTINGLMFNPYSEKI  228

Query  806   YDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPS  985
             YDY   + DIK  K+RT+IPA  SF+EDCARILR +R+AARL FSF  ET   +  L+ S
Sbjct  229   YDYLGGIEDIKKAKVRTVIPAGTSFQEDCARILRAIRIAARLGFSFPKETAYYVRTLACS  288

Query  986   VMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQ-QADKQSSDTSM  1162
             V  LDK+R++ME+NYML+YG+A  SL LL ++ LLE LLPF AAY +  +  ++   T+M
Sbjct  289   VARLDKARILMEMNYMLAYGSAEASLRLLWRFGLLEHLLPFQAAYFSSTRFKRKDKGTNM  348

Query  1163  LMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRN-----W  1327
             L+ LFS LD  ++  RP   SLW++LLAFH  L   P   L+V T A   Y         
Sbjct  349   LLVLFSKLDNFLAPNRPCHNSLWISLLAFHEALARKPCDPLIVATFALAFYLGGDMSLAV  408

Query  1328  KQGVEFARQH-VKAASLYVPEISDSDGSMSEDELAKRVENMAV----QVNMLTDADNLRE  1492
               G    RQH      L  P++       ++  LA  V++ A      +  +TD  ++  
Sbjct  409   DIGKSINRQHDTGFRELLEPKV------WTDKHLAGEVQSFAALMKQALTEMTDEYHVAN  462

Query  1493  VTSKFSGSSHSGLVFVSNKMVKKIV  1567
               +K   +  S LVF+  +   K++
Sbjct  463   AMAKIPQAPSSDLVFIPLQAYLKVL  487



>ref|XP_002447721.1| hypothetical protein SORBIDRAFT_06g014480 [Sorghum bicolor]
 gb|EES12049.1| hypothetical protein SORBIDRAFT_06g014480 [Sorghum bicolor]
Length=542

 Score =   295 bits (755),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 178/415 (43%), Positives = 247/415 (60%), Gaps = 22/415 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+ A+ FGI  S I   +W VL+ L+ +G+  YLVGGCVRDLI+ + PKDFD+ITTA 
Sbjct  77    WKKVSAKRFGIKESMIPAEAWNVLHRLRSRGYDVYLVGGCVRDLIMKKTPKDFDIITTAD  136

Query  539   LNEIKKQFY-RAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
             L ++K  F   A IVGRRFPIC VH   S+VEVSSF T A     ++  NS      + C
Sbjct  137   LRQVKDTFSGSAVIVGRRFPICHVHENNSIVEVSSFYTSARGSSGSQIYNS----KSQNC  192

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
             +++D +RW+N   RDFTIN L ++P+  +IYDY   + DIK  K+RT+IPA  SF+EDCA
Sbjct  193   SKNDFVRWKNCQGRDFTINGLMFNPYSEKIYDYLGGIEDIKKAKVRTVIPAGTSFQEDCA  252

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR +R+AARL FSF  ET   +  L+ SV  LDK R+++E+NYML+YG+A  SL LL 
Sbjct  253   RILRAIRIAARLGFSFPKETAYYVRTLAYSVARLDKGRILLEMNYMLAYGSAEASLRLLW  312

Query  1076  KYNLLEVLLPFHAAYLTQ-QADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             ++ LLE LLPF AAY +  +  ++   T+ML+ LFS LD  ++  RP   SLW++LLAFH
Sbjct  313   RFGLLEHLLPFQAAYFSSTRFKRKDKGTNMLLVLFSKLDNFLAPNRPCHNSLWISLLAFH  372

Query  1253  LTLVNNPQPKLVVLTLASVMYHRN-----WKQGVEFARQH-VKAASLYVPEISDSDGSMS  1414
               L   P   LVV T A   Y           G    RQH      L  P++       +
Sbjct  373   EALARKPCDPLVVATFALAFYLGGDMSLAVDIGKSINRQHDTGFRELLEPKV------WT  426

Query  1415  EDELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIV  1567
             +  LA  V++ A      +  +TD  ++    +K   +  S LVF+  ++  K++
Sbjct  427   DKHLAGEVQSFAALMKRALTEMTDEYHVGNAMAKIPQAPSSDLVFIPLQVYLKVL  481



>ref|XP_004235296.1| PREDICTED: uncharacterized protein LOC101251959 isoform X1 [Solanum 
lycopersicum]
Length=507

 Score =   293 bits (751),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 191/479 (40%), Positives = 271/479 (57%), Gaps = 41/479 (9%)
 Frame = +2

Query  347   EFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVI  526
             E + W++ +++  GI+ S I+  + VVLN LK KGF+ YLVGGCVRDLIL R PKDFD+I
Sbjct  43    EPAEWKRFNSKELGISSSMIARPTRVVLNGLKSKGFEVYLVGGCVRDLILKRTPKDFDII  102

Query  527   TTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMP  706
             TTA L E+ + F   EIVGRRFPIC VH+   VVEVSSF T    G    R        P
Sbjct  103   TTAELKEVCRTFSHCEIVGRRFPICHVHVDDEVVEVSSFHT---SGIRPVRNLGLSFEKP  159

Query  707   KGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEE  886
               C+E D  RW N L RDFTIN L +DP+   +YDY   + DI+  K++T+ PA  SF E
Sbjct  160   VDCDEKDHFRWTNCLRRDFTINGLMFDPYSKLVYDYMGGVDDIRKAKIQTIGPASFSFVE  219

Query  887   DCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLC  1066
             DCARILR +R+AARL F F  ET  +I  LS SV+ LD+ RL+ME+NYML+YG+A  SL 
Sbjct  220   DCARILRAIRIAARLGFRFGRETALSIKNLSSSVLKLDRGRLLMEMNYMLAYGSAEASLR  279

Query  1067  LLQKYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALL  1243
             LL K+ LL++LLP  AAY  +   ++    S +L+ LFS+LD+LV+ +RP   SLWV +L
Sbjct  280   LLWKFGLLDILLPIQAAYFVRHGFRRRDKRSHLLLSLFSNLDKLVAPDRPCHSSLWVTIL  339

Query  1244  AFHLTLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFAR----QHVKAASLYVPEISDSDGS  1408
             AFH  L + P+  LVV   +  V    +  + +  AR    QH    S +  E  D D +
Sbjct  340   AFHKALSDQPRDPLVVAAFSLGVHNGGDLSEALSIARRISAQH--DGSFHELESRDLDLA  397

Query  1409  MSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGI  1588
               ++E+ +   ++   +  +TD  ++    + +  + +S LVF+                
Sbjct  398   ALKEEVVELATSVQRALTNMTDEYSVSRAMANYPKAPYSDLVFIP---------------  442

Query  1589  LTNDVTSLNEKSCSL-KIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
                   +L  K+C + +      +KG   K+G+ I +         E R + ++I+ DT
Sbjct  443   -----LALYLKACKVCQCVRMGREKGFVAKQGSKIDYELLASGSLQEVRHVFARIVFDT  496



>ref|XP_009368790.1| PREDICTED: uncharacterized protein LOC103958265 isoform X2 [Pyrus 
x bretschneideri]
Length=494

 Score =   293 bits (750),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 181/473 (38%), Positives = 276/473 (58%), Gaps = 36/473 (8%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL++   GIT S I   +  VLN LK+KG+  YLVGGCVRDLILNR PKDFD+IT+A 
Sbjct  31    WKKLNSTELGITTSMIDKPTRKVLNGLKRKGYDVYLVGGCVRDLILNRTPKDFDIITSAE  90

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F   EIVG+RFPIC VHI  +V+EVSSF   A K      ++    R P  C+
Sbjct  91    LKEVTRTFSWCEIVGKRFPICHVHIGDTVIEVSSFSISARKSGRNLSRDF---RKPSHCD  147

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             ++D +RW N   RDFTIN L +DP+   +YDY   + DI+  K++T+ PA  SF+EDCAR
Sbjct  148   DNDYMRWMNCSQRDFTINGLMFDPYARIVYDYMGGIEDIRKAKVQTVKPASTSFQEDCAR  207

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F  S +T  ++  LS S++ LDK RL+ME+NYML+YG+A  SL LL K
Sbjct  208   ILRAIRIAARLGFRISKDTAHSVKSLSYSILRLDKGRLLMEMNYMLAYGSAEASLRLLWK  267

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  AAY  +    ++   T++L+ LFS+LD+L+S ++P   SLWVA+LAFH 
Sbjct  268   FGLLELLLPIQAAYFVRHGFRRRDKRTNLLLSLFSNLDKLLSPDKPCHSSLWVAILAFHN  327

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDS---DGSMSEDE  1423
              L   P+  LVV  L+  +++  +  + V  A++  K   +   E+ ++   +     DE
Sbjct  328   ALSEQPRDPLVVAALSLAIHNGGDMLEAVSIAKRVTKVHDVSFHELLENQNLNHRALRDE  387

Query  1424  LAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDV  1603
             +     ++   +N +TD   + +  + +  + +S LV +   +  ++    +F  +T+  
Sbjct  388   VVNLTTSLKRALNNMTDEQIVSQAMAAYPQAPYSDLVLIPWGLSLRVC--RIFSCVTS--  443

Query  1604  TSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHET---------RFLLSKIILDT  1735
                              ++G   K+G  I +E+         R + ++++ DT
Sbjct  444   ---------------GAERGFIPKQGGKIDYESLAQGALPEVRHIFARVVFDT  481



>ref|XP_010421177.1| PREDICTED: uncharacterized protein LOC104706666 [Camelina sativa]
Length=530

 Score =   293 bits (751),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 167/400 (42%), Positives = 247/400 (62%), Gaps = 8/400 (2%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W++L+++  GI+ S I+  +  VLN LK KG   YLVGGCVRDLIL R PKDFD++T+A 
Sbjct  66    WKQLNSKDLGISSSMIAIPTRKVLNGLKSKGHDVYLVGGCVRDLILKRTPKDFDILTSAE  125

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F R EIVGRRFPIC VH+   +VEVSSF T A       R    +        
Sbjct  126   LKEVVRTFPRCEIVGRRFPICHVHVGDDLVEVSSFSTSAQNSSRNMRTE--LKESSGSDG  183

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D IR  N L RDFTIN L +DP+   +YDY   + DIK  K+RT+I A  SF++DCAR
Sbjct  184   DEDCIRLNNCLQRDFTINGLMFDPYAKVVYDYLGGIEDIKKAKVRTVIHAGTSFQQDCAR  243

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL+F  S ET   I  LS  V  LDK R++ME+NYML+YGAA  SL LL K
Sbjct  244   ILRAIRIAARLRFRMSKETAHYIKNLSLLVQRLDKGRILMEMNYMLAYGAAEASLRLLWK  303

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + +LE+LLPF AAYL +    ++   T+ML+ LF++LD+L++ +RP   SLW+A+LAFH 
Sbjct  304   FGILEILLPFQAAYLVRSGFRRRDKRTNMLLSLFANLDKLLAPDRPCHSSLWIAILAFHK  363

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              L + P+  LVV   +  +++  +  + VE  ++  +  +    E+ + + +++ + +  
Sbjct  364   ALADQPRSPLVVAAFSLAVHNCGDILEAVEITKKITRPHNKSFIELVEREENLNFEAMLD  423

Query  1433  RVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFV  1540
              V ++       +N +TD   + +  + +  + +S +VF+
Sbjct  424   EVMDLDAFIRDALNQMTDGYFISKAMAAYPQAPYSDMVFI  463



>ref|XP_011002102.1| PREDICTED: uncharacterized protein LOC105109184 isoform X2 [Populus 
euphratica]
Length=458

 Score =   291 bits (745),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 177/410 (43%), Positives = 243/410 (59%), Gaps = 9/410 (2%)
 Frame = +2

Query  245   SLLQKFNQTSAGDGIQLESTTDR---AADSNFQPGKIEFSNWRKLDARHFGITGSRISPS  415
             SL   F +        +E+  D+     D N   G  +   W+K +++  GI  S IS  
Sbjct  19    SLFHCFEKVRFSSVAAIETLFDQDNFIKDKNQNLGDPKALEWKKWNSKELGIINSTISRP  78

Query  416   SWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFP  595
             +  VL+ LKK G++ YLVGGCVRDLIL R PKDFD+IT+A L E+ + F R  IVG+RFP
Sbjct  79    TKKVLDGLKKNGYEVYLVGGCVRDLILKRTPKDFDIITSAELKEVVRAFPRCIIVGKRFP  138

Query  596   ICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINS  775
             IC VHI  ++VEVSSF T   K      K    P  P  C+E D  RW+N L RD TIN 
Sbjct  139   ICHVHIGDTIVEVSSFSTTGPKFRLDLSKG-ISP--PIDCDEKDYFRWKNCLRRDLTING  195

Query  776   LFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMET  955
             L +DP+   +YDY   + DIK  K+RT++PA  SF+EDCARILR +R+AARL F F+ ET
Sbjct  196   LMFDPYKRIVYDYVGGLEDIKKAKVRTVVPAGTSFQEDCARILRAVRIAARLGFRFTRET  255

Query  956   ETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA  1135
                I  LS S++ LD  R+MME+NYML+YG+A  SL +L K+ LLE+LLPF AAY  +  
Sbjct  256   AHFIKNLSCSLLRLDNQRIMMEMNYMLAYGSAEASLRILWKFGLLELLLPFQAAYFVRDG  315

Query  1136  DKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLA-SV  1309
              K+    S ML+ LFS+LD+ ++ +RP   SLWV +LAFH  L + P+  +VV     +V
Sbjct  316   FKRRDKRSNMLLCLFSNLDKHLAPDRPCHNSLWVGILAFHKALSDQPRDPMVVAAFCLAV  375

Query  1310  MYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQV  1459
                 +   GV+  ++  K       E+S+   +++ + L   V + A  V
Sbjct  376   NNGGDILGGVKMVKKFTKPHDASFHELSEPQ-NLNSEALVDEVVDFAASV  424



>ref|XP_010538159.1| PREDICTED: uncharacterized protein LOC104812601 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010538160.1| PREDICTED: uncharacterized protein LOC104812601 isoform X2 [Tarenaya 
hassleriana]
Length=527

 Score =   293 bits (749),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 187/469 (40%), Positives = 282/469 (60%), Gaps = 22/469 (5%)
 Frame = +2

Query  353   SNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITT  532
             S W+KLDA   GI  S I  S+ +VLN LKKKGF+ YLVGGCVRDLIL+RIPKDFD+ITT
Sbjct  67    SPWKKLDANGLGIRKSMIPESARMVLNKLKKKGFQVYLVGGCVRDLILDRIPKDFDIITT  126

Query  533   ARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKG  712
             A L +++K F    IVG+RFPIC VH+  ++VEVSSF T A        KN    + P G
Sbjct  127   AELKQVRKVFPSCLIVGKRFPICHVHVDDTIVEVSSFSTSAKSSKGF--KNCL--KRPPG  182

Query  713   CNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
             CNE D  RWRN + RDFTIN L +DP    +YDY   + DI++ +++T+ PA+LSF ED 
Sbjct  183   CNEIDYARWRNCIQRDFTINGLMFDPSENVVYDYIGGVEDIRNSQVKTVCPARLSFVEDS  242

Query  893   arilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLL  1072
             ARILR +R+AARL F F+ +   ++ +LS S++ LDK+R++ME+NYM++YG+A  SL LL
Sbjct  243   ARILRAIRIAARLGFGFTKDVAVSLKELSSSLLRLDKTRVLMEMNYMMAYGSAEASLRLL  302

Query  1073  QKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAF  1249
              ++ LLEVLLP  A+Y   Q   ++   ++ML+ LF +LD+LV+ +RP    LW+ +LAF
Sbjct  303   WRFGLLEVLLPIQASYFVSQGFRRRDGRSNMLLSLFRNLDRLVAPDRPCPTLLWIGILAF  362

Query  1250  HLTLVNNPQPKLVVLTLASVMYHR-NWKQGVEFARQHVKAASLYVPEI------SDSDGS  1408
             H  LV+ P+  +VV      +++  +  + ++  +   +  +    E+      SDSD  
Sbjct  363   HKALVDQPRDPIVVAAFCLTLFNEGSLSESIDVTKSITQKHNSEFRELSARRTDSDSDAR  422

Query  1409  MSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGI  1588
             +S+ ++ +  E++   V  + D D +     ++  +  S LV +S  + ++++   +F  
Sbjct  423   LSK-QVVEFAESVRSAVRKMKDRDYISRAMREYPQAPESDLVLMSEALSERVM--RIFAC  479

Query  1589  LTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             +        E+ C  + +     K  A     G   ETR +L++I  DT
Sbjct  480   VRR---GNQERCCKKRREGRIDYKSLAL----GDLQETRRVLARIAFDT  521



>ref|XP_009368789.1| PREDICTED: uncharacterized protein LOC103958265 isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   292 bits (748),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 181/473 (38%), Positives = 276/473 (58%), Gaps = 36/473 (8%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL++   GIT S I   +  VLN LK+KG+  YLVGGCVRDLILNR PKDFD+IT+A 
Sbjct  65    WKKLNSTELGITTSMIDKPTRKVLNGLKRKGYDVYLVGGCVRDLILNRTPKDFDIITSAE  124

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F   EIVG+RFPIC VHI  +V+EVSSF   A K      ++    R P  C+
Sbjct  125   LKEVTRTFSWCEIVGKRFPICHVHIGDTVIEVSSFSISARKSGRNLSRDF---RKPSHCD  181

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             ++D +RW N   RDFTIN L +DP+   +YDY   + DI+  K++T+ PA  SF+EDCAR
Sbjct  182   DNDYMRWMNCSQRDFTINGLMFDPYARIVYDYMGGIEDIRKAKVQTVKPASTSFQEDCAR  241

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F  S +T  ++  LS S++ LDK RL+ME+NYML+YG+A  SL LL K
Sbjct  242   ILRAIRIAARLGFRISKDTAHSVKSLSYSILRLDKGRLLMEMNYMLAYGSAEASLRLLWK  301

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  AAY  +    ++   T++L+ LFS+LD+L+S ++P   SLWVA+LAFH 
Sbjct  302   FGLLELLLPIQAAYFVRHGFRRRDKRTNLLLSLFSNLDKLLSPDKPCHSSLWVAILAFHN  361

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDS---DGSMSEDE  1423
              L   P+  LVV  L+  +++  +  + V  A++  K   +   E+ ++   +     DE
Sbjct  362   ALSEQPRDPLVVAALSLAIHNGGDMLEAVSIAKRVTKVHDVSFHELLENQNLNHRALRDE  421

Query  1424  LAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDV  1603
             +     ++   +N +TD   + +  + +  + +S LV +   +  ++    +F  +T+  
Sbjct  422   VVNLTTSLKRALNNMTDEQIVSQAMAAYPQAPYSDLVLIPWGLSLRVC--RIFSCVTS--  477

Query  1604  TSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHET---------RFLLSKIILDT  1735
                              ++G   K+G  I +E+         R + ++++ DT
Sbjct  478   ---------------GAERGFIPKQGGKIDYESLAQGALPEVRHIFARVVFDT  515



>ref|XP_006578722.1| PREDICTED: CCA tRNA nucleotidyltransferase 1, mitochondrial-like 
isoform X1 [Glycine max]
Length=361

 Score =   285 bits (730),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 152/292 (52%), Positives = 199/292 (68%), Gaps = 4/292 (1%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W++L+    GI  S I  ++  VLN LKKKG+  YLVGGCVRDLIL + PKDFD+IT+A 
Sbjct  69    WKRLNYEELGIRNSMIGSTTKKVLNGLKKKGYDVYLVGGCVRDLILKKTPKDFDIITSAE  128

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F  +EIVG+RFP+C VH+  ++VEVSSFDT   K      + S     P GC 
Sbjct  129   LKEVTRTFSWSEIVGKRFPVCHVHMDDTIVEVSSFDTTKCKAG---MEFSHHIEAPSGCG  185

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D +RW N L+RDFTIN L  DP+    YDY   + DI+  K+RT+IPA+ SF+EDCAR
Sbjct  186   KKDHLRWMNCLNRDFTINGLMLDPYARIAYDYFGGIEDIRKAKVRTVIPAETSFQEDCAR  245

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS S ET   I  LS SV+SLDK RL+ME+NYML++G+   SL LL K
Sbjct  246   ILRAIRIAARLGFSISKETAHFIKNLSSSVLSLDKGRLLMEMNYMLAFGSGEASLRLLWK  305

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLW  1231
             + LL++LLPF AAY  Q    ++   T+ML+ LFS+LD+L++  RP   SLW
Sbjct  306   FGLLDILLPFQAAYFAQHGFQRRDRRTNMLLSLFSNLDKLLAPNRPCHNSLW  357



>ref|XP_010454656.1| PREDICTED: uncharacterized protein LOC104736383 [Camelina sativa]
Length=530

 Score =   290 bits (742),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 171/417 (41%), Positives = 250/417 (60%), Gaps = 14/417 (3%)
 Frame = +2

Query  308   DRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRD  487
             D+AAD      +     W++L+++  GI+ S I+  +  VLN LK KG   YLVGGCVRD
Sbjct  55    DKAAD------RTRGCEWKQLNSKDLGISSSMIAIPTRKVLNGLKSKGHDVYLVGGCVRD  108

Query  488   LILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGD  667
             LIL R PKDFD++T+A L E+ + F R EIVGRRFPIC VH+   +VEVSSF T A    
Sbjct  109   LILKRTPKDFDILTSAELKEVVRTFPRCEIVGRRFPICHVHVGDDLVEVSSFSTSAQNSR  168

Query  668   ETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQK  847
                R    +        + D IR  N L RDFTIN L +DP+   +YDY   + DIK  K
Sbjct  169   GNMRTE--LKESSGSDGDEDCIRLNNCLQRDFTINGLMFDPYAKVVYDYLGGIEDIKKAK  226

Query  848   LRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVN  1027
             +RT+I A  SF++DCARILR +R+AARL F  S ET   I  LS  V  LDK R++ME+N
Sbjct  227   VRTVIHAGTSFQQDCARILRAIRIAARLGFRMSKETSHYIKNLSLLVQRLDKGRILMEMN  286

Query  1028  YMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSC  1204
             YML+YG+A  SL LL K+ +LE+LLP  AAYL +    ++   T+ML+ LF++LD+L++ 
Sbjct  287   YMLAYGSAEASLRLLWKFGILEILLPIQAAYLVRSGFRRRDKRTNMLLSLFANLDKLLAP  346

Query  1205  ERPARESLWVALLAFHLTLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFARQHVKAASLYV  1381
             +RP   SLW+A+LAFH  L + P+  LVV   + +V   R+  + VE  ++  +      
Sbjct  347   DRPCHSSLWIAILAFHKALADQPRSPLVVAAFSLAVNNCRDILEAVEITKKITRPHDKSF  406

Query  1382  PEISDSDGSMSEDELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFV  1540
              E+ + + +++ + +   V ++       +N +TD   + +  + +  + +S +VF+
Sbjct  407   IELVEREENLNFEAMLDEVMDLDAFIRDALNQMTDGYFISKAMAAYPQAPYSDMVFI  463



>ref|XP_007137889.1| hypothetical protein PHAVU_009G164400g [Phaseolus vulgaris]
 gb|ESW09883.1| hypothetical protein PHAVU_009G164400g [Phaseolus vulgaris]
Length=447

 Score =   287 bits (735),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 167/387 (43%), Positives = 234/387 (60%), Gaps = 15/387 (4%)
 Frame = +2

Query  404   ISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVG  583
             I  S+  VLN LKKKG+  YLVGGCVRDLILN+ PKDF +IT+A L E+ + F   EIVG
Sbjct  2     IGSSTKKVLNGLKKKGYDVYLVGGCVRDLILNQTPKDFHIITSAELKEVMRTFSWCEIVG  61

Query  584   RRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDF  763
             +RFP+C V + G++VEVSSFD       E       +     G ++ D +RW N L+RDF
Sbjct  62    KRFPVCHVQLDGTIVEVSSFDAKFKADFEFSHHTEAL----NGVDKKDHLRWMNCLNRDF  117

Query  764   TINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSF  943
             TIN L  DP    +YDY   + DI+  K+RT+IPA+ SF+EDCA ILR +R+AAR+ FS 
Sbjct  118   TINGLMLDPHARIVYDYFGGIEDIRKAKVRTIIPAETSFKEDCAHILRAIRIAARIGFSI  177

Query  944   SMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYL  1123
             S E    I KLS SV+SLDK RL+ME+N+ML+YG+   SL LL K+ LL++L PF AAY 
Sbjct  178   SKEAAHHIRKLSSSVLSLDKGRLLMEMNHMLAYGSGEASLRLLWKFGLLDILFPFQAAYF  237

Query  1124  TQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTL  1300
                   ++   T+ML+ LFS+LD+L++  RP   SLWV +LA H TL + P+  L V   
Sbjct  238   AHHGFQRRDRRTNMLLSLFSNLDKLLAPNRPCHNSLWVGILALHKTLSDRPRDPLAVAAF  297

Query  1301  ASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSED------ELAKRVENMAVQV  1459
             +  +++  N  + V  A    K   +  PE+ +  G  +E       +LA+ V    +Q 
Sbjct  298   SITIHNGGNLSEAVYIAGMINKPHDVRFPELLNHSGLETESLEAEILDLAESVRGTMLQ-  356

Query  1460  NMLTDADNLREVTSKFSGSSHSGLVFV  1540
               +T+   + +  + +  + HS LVF+
Sbjct  357   --MTNEYFVSQAMADYPQAPHSNLVFI  381



>dbj|BAC41875.1| putative poly(A) polymerase [Arabidopsis thaliana]
Length=571

 Score =   290 bits (743),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 231/372 (62%), Gaps = 15/372 (4%)
 Frame = +2

Query  701   MPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSF  880
             M  G +  D  RWRNSL RDFTINSLFY+PF + IYDYAN M D+   KLRTL+PA LSF
Sbjct  1     MYSGWDIKDCKRWRNSLQRDFTINSLFYNPFDFTIYDYANGMEDLTDLKLRTLVPAHLSF  60

Query  881   EEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPS  1060
             +EDCARILRGLR+AARL  S S + +TAI +   SV +LD+ RL+ME+NYML+YGAA PS
Sbjct  61    KEDCARILRGLRIAARLGLSLSKDVKTAIPEFVSSVANLDQFRLIMEMNYMLAYGAAAPS  120

Query  1061  LCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVAL  1240
             + LL K+ LL VLLPF AAYL Q +    S + ML++LFS++D+LVSC++PA   LW+A+
Sbjct  121   ILLLMKFKLLHVLLPFQAAYLDQASKTSLSSSLMLVRLFSNMDKLVSCDQPADPKLWIAV  180

Query  1241  LAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSED  1420
             LAFH+ LV NPQ  +VV   A+++YH NW + VEFAR+H  +   Y PE+S S    S++
Sbjct  181   LAFHIALVRNPQEAIVVRAFAALLYHGNWSKAVEFAREHGTSVIGYAPEVSKSSRKRSDE  240

Query  1421  ELAKRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGI  1588
             +LA+ V      +     +LTD + LRE    +     SGLVF+  K  K   V E F  
Sbjct  241   DLAEAVSEFTCLLKDTQYVLTDKEALREALYLYPDFKFSGLVFIPKK--KGRDVAEGFMR  298

Query  1589  LTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDTlglggvileeg  1768
             L+ DV S   +     I             G G   E RF+L KIILDT+  G VI    
Sbjct  299   LS-DVESYESQKEGFSID--------YVLLGKGNPCEVRFVLGKIILDTITEGTVIEPLN  349

Query  1769  eSKKRNSEYDEI  1804
               KK+ S  + I
Sbjct  350   SVKKKQSTRNHI  361



>ref|XP_010493491.1| PREDICTED: uncharacterized protein LOC104770729 isoform X2 [Camelina 
sativa]
Length=529

 Score =   288 bits (738),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 179/474 (38%), Positives = 270/474 (57%), Gaps = 34/474 (7%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W++L+++  GI+ S I+  +  VLN LK KG   YLVGGCVRDLIL R PKDFD++T+A 
Sbjct  65    WKQLNSKDLGISSSMIAIPTRKVLNGLKSKGHDVYLVGGCVRDLILKRTPKDFDILTSAE  124

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F R EIVGRRFPIC VH+   +VEVSSF T A       R    +        
Sbjct  125   LKEVVRTFPRCEIVGRRFPICHVHVGDDLVEVSSFSTSAQNSPRNMRTE--LKESSGSDG  182

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D IR  N L RDFTIN L +DP+   +YDY   + DIK  K+RT+I A  SF++DCAR
Sbjct  183   DEDCIRLNNCLQRDFTINGLMFDPYAKVVYDYLGGIEDIKKAKVRTVIHAGTSFQQDCAR  242

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F  S ET   I  LS  V  LDK R++ME+NYML+YG+A  SL LL K
Sbjct  243   ILRAIRIAARLSFRMSKETAHYIKNLSLLVQRLDKGRILMEMNYMLAYGSAEASLRLLWK  302

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + +LE LLPF AAYL +    ++   T+ML+ LF++LD+L++ +RP   SLW+A+LAFH 
Sbjct  303   FGILETLLPFQAAYLVRSGFRRRDKRTNMLLSLFANLDKLLAPDRPCHSSLWIAILAFHK  362

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              L + P+  LVV   +  +++  +  + VE  ++  +       E+ + + +++ + +  
Sbjct  363   ALADQPRSPLVVAAFSLAVHNCGDILEAVEITKKITRPHDKSFFELVEREENLNFETMLD  422

Query  1433  RVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
              V ++       +N +TD   + +  + +  + +S +VF+  ++  +     +F      
Sbjct  423   EVMDLDAFIRDALNQMTDGYFISKAMAAYPQAPYSDMVFIPLQLYLR--AGRIF------  474

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
                     C  K +    Q G   K+G+ I +         ETR + ++++ DT
Sbjct  475   -------ECVRKEER--QQMGFEAKQGSKIEYGSLLSGDFPETRHVFARVVFDT  519



>ref|XP_010503525.1| PREDICTED: uncharacterized protein LOC104780704 [Camelina sativa]
Length=513

 Score =   288 bits (736),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 172/401 (43%), Positives = 239/401 (60%), Gaps = 15/401 (4%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL++   GIT S IS  + VVLN LK KG   YLVGGCVRDLIL R PKDFDV+T+A 
Sbjct  56    WKKLNSEDLGITSSMISKPARVVLNGLKSKGHDVYLVGGCVRDLILKRTPKDFDVLTSAE  115

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F R EIVGRRFPIC VH+   ++EVSSF T A     T    S       G  
Sbjct  116   LREVVRTFSRCEIVGRRFPICHVHVGNDMIEVSSFSTSAQHSPRTGSGKS------NGSY  169

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D IR+ N L RDFTIN L +DP+   +YDY   M DI+  K+RT+  A  SF+EDCAR
Sbjct  170   DEDSIRYNNCLQRDFTINGLMFDPYAKVVYDYLGGMEDIRKAKVRTVFHAGTSFQEDCAR  229

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRG R+AARL F+ S ET   +  LS  V  L + R++ME+NYML+YG+A  SL LL K
Sbjct  230   ILRGTRIAARLGFTISKETAHFLRNLSFLVQRLHRGRILMEMNYMLAYGSAEASLRLLWK  289

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + +LE+LLP  AAYL     K+  +T+ ML+ LF +LD L++ +RP   SLW+A+LA H 
Sbjct  290   FGILEILLPIQAAYLVHSGFKRRDETTNMLLSLFGNLDTLLAPDRPCNSSLWLAILALHK  349

Query  1256  TLVNNPQ-PKLVVLTLASVMYHRNWKQGVEFARQHVKAAS-----LYVPEISDSDGSMSE  1417
              L + P+ P +V     +V    +  + ++  ++  K  +     L  PE  DS   +  
Sbjct  350   ALADQPRYPSVVAAFSLAVHNGGDVLEAIKITQEVTKPHNRSFFELLEPEELDSQTLL--  407

Query  1418  DELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFV  1540
             DE+     ++   +  +T+   + +  + +  + HS +VF+
Sbjct  408   DEVMDLDSSIKEALGQMTNGKFISKAMAAYPQAPHSDMVFI  448



>ref|XP_010515211.1| PREDICTED: uncharacterized protein LOC104791106 [Camelina sativa]
Length=504

 Score =   287 bits (735),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 173/401 (43%), Positives = 237/401 (59%), Gaps = 15/401 (4%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL++   GIT S IS  + VVLN LK KG   YLVGGCVRDLIL R PKDFDV+T A 
Sbjct  47    WKKLNSEDLGITSSMISKPARVVLNGLKSKGHDVYLVGGCVRDLILKRTPKDFDVLTNAE  106

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F R EIVGRRFPIC VH+   ++EVSSF T A     T    S       G  
Sbjct  107   LREVVRTFSRCEIVGRRFPICHVHVGNDMIEVSSFSTSAQHSPRTGSGKS------NGSY  160

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D IR+ N L RDFTIN L +DP+   +YDY   M DI+  K+RT+  A  SF+EDCAR
Sbjct  161   DEDSIRYNNCLQRDFTINGLMFDPYAKVVYDYLGGMEDIRKAKVRTVFHAGTSFQEDCAR  220

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRG R+AARL F+ S ET   +  LS  V  L + R++ME+NYML+YG+A  SL LL K
Sbjct  221   ILRGTRIAARLGFTISKETAHFLRNLSFLVQRLHRGRILMEMNYMLAYGSAEASLRLLWK  280

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + +LE+LLP  AAYL     K+  +T+ ML+ LF +LD L++ +RP   SLW+A+LA H 
Sbjct  281   FGILEILLPIQAAYLIHSGFKRRDETTNMLLSLFGNLDTLLAPDRPCPSSLWLAILALHK  340

Query  1256  TLVNNPQPKLVVLTLASVMYHRN-----WKQGVEFARQHVKA-ASLYVPEISDSDGSMSE  1417
              L + P+   VV   +  +++        K   E  + H ++   L  PE  DS   +  
Sbjct  341   ALADQPRYPSVVAAFSLAVHNGGDVLEAIKITHEVTKPHNRSFFELLEPEELDSQTLL--  398

Query  1418  DELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFV  1540
             DE+     ++   +  +T+   + +  + +  + HS +VF+
Sbjct  399   DEVMDLDSSIKEALGQMTNGKFISKAMAAYPQAPHSDMVFI  439



>ref|XP_006287492.1| hypothetical protein CARUB_v10000701mg [Capsella rubella]
 gb|EOA20390.1| hypothetical protein CARUB_v10000701mg [Capsella rubella]
Length=526

 Score =   287 bits (735),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 174/468 (37%), Positives = 271/468 (58%), Gaps = 23/468 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W++L ++  GI+ S I+  +  VLN LK KG   YLVGGCVRDLIL R PKDFD++T+A 
Sbjct  63    WKQLSSKDLGISSSMIAKPTRKVLNGLKNKGHDVYLVGGCVRDLILKRTPKDFDILTSAE  122

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F R EIVGRRFPIC V++   +VEVSSF T A       R    +        
Sbjct  123   LKEVVRTFPRCEIVGRRFPICHVYVGDDLVEVSSFSTSAQNSRGNMRTE--LKESSGSDG  180

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D IR  N L RDFTIN L +DP+   +YDY   + DIK  K+RT+I A  SF++DCAR
Sbjct  181   DEDCIRLNNCLQRDFTINGLMFDPYAKVVYDYLGGIEDIKRAKVRTVIHAGTSFQQDCAR  240

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F  S ET   +  LS  V  LDK R++ME+NYML+YG+A  SL LL K
Sbjct  241   ILRAIRIAARLGFRMSKETAHFVKNLSFLVQRLDKGRILMEMNYMLAYGSAEASLRLLWK  300

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + +LE++LP  AAYL +    ++   T+ML+ LF++LD+L++ +RP   SLW+A+LAFH 
Sbjct  301   FGILEIILPIQAAYLVRSGFRRRDKRTNMLLSLFANLDKLLAPDRPCHSSLWIAILAFHK  360

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              L + P+  LVV      +++  +  + VE  ++  +       E+ + + ++  + L  
Sbjct  361   ALADQPRSPLVVAAFCLAVHNCGDILEAVEITKKITREHDRSFIELVEPEDNLDFETLLD  420

Query  1433  RVENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
              V ++ V +    N +TD   + +  + +  + +S +VF+  ++  +     +F  +  +
Sbjct  421   EVMDLDVSIKDALNQMTDGYFISKAMAAYPQAPYSDMVFIPLQLYLR--ASRIFECVRKE  478

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKG---NGIAHETRFLLSKIILDT  1735
              T +  ++          ++G+  + G   +G   ETR + ++++ DT
Sbjct  479   ETQMGFEA----------KQGSKIEYGSLLSGDFPETRHVFARVVFDT  516



>ref|XP_009607901.1| PREDICTED: uncharacterized protein LOC104102017 isoform X1 [Nicotiana 
tomentosiformis]
Length=511

 Score =   283 bits (725),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 184/484 (38%), Positives = 266/484 (55%), Gaps = 47/484 (10%)
 Frame = +2

Query  347   EFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVI  526
             E + W++ +++  GI+ S I+  + VVLN LK KGF+ YLVGGCVRDLIL R PKDFD+I
Sbjct  43    EPAEWKRFNSKELGISSSMIAKPTRVVLNGLKSKGFEVYLVGGCVRDLILKRTPKDFDII  102

Query  527   TTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMP  706
             TTA L E+++ F R EIVGRRFPIC VH+   VVEVSSF T    G  ++R  S     P
Sbjct  103   TTAELKEVRRTFSRCEIVGRRFPICHVHVDNEVVEVSSFHT---SGIRSERGLSLSFEKP  159

Query  707   KGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEE  886
               C+E D  RWRN LHRDFTIN L +DP+   +YDY   + DI+  K+RT+ PA  S  E
Sbjct  160   VDCDEKDHFRWRNCLHRDFTINGLMFDPYSKFVYDYMGGVDDIRKAKVRTIGPASFSLIE  219

Query  887   DCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLC  1066
             DCARILR +R+AARL F F  ET  +I  LS SV+ LD+ RL+ME+NYML+YG+A  SL 
Sbjct  220   DCARILRAIRIAARLGFRFGRETALSIKNLSSSVLRLDRGRLLMEMNYMLAYGSAEASLR  279

Query  1067  LLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLW-----  1231
             LL K+ LLE+LLP  AAY  +   ++  D S+      S   L+     A   +      
Sbjct  280   LLWKFGLLEILLPVQAAYFVRYGFRR-RDKSLCFPTSISYWPLIGHATVAYGKILCTGFS  338

Query  1232  -VALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFAR----QHVKAASLYVPEIS  1393
              VA+LAFH  + + P+  LVV      +++  +  + +  A+    QH    S +  E  
Sbjct  339   KVAILAFHKAISDQPRDPLVVAAFGLGIHNGGDLSEALSIAKRISTQH--DGSFHELESQ  396

Query  1394  DSDGSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVE  1573
             D D +  ++E+ +   ++   +  +TD   +    + +  + +S LVF+           
Sbjct  397   DLDLAALKEEVVELATSVQRALTNMTDEYFVSRAMTNYPKAPYSDLVFIP----------  446

Query  1574  EVFGILTNDVTSLNEKSCSL-KIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKI  1723
                        +L  ++C + +      +KG   K+G+ I +         E R + ++I
Sbjct  447   ----------LALYLRTCKVFQCVRMGKEKGFVAKQGSKIDYELLALGSLQEVRHVFARI  496

Query  1724  ILDT  1735
             + DT
Sbjct  497   VFDT  500



>ref|XP_009607910.1| PREDICTED: uncharacterized protein LOC104102017 isoform X2 [Nicotiana 
tomentosiformis]
Length=508

 Score =   283 bits (724),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 183/480 (38%), Positives = 264/480 (55%), Gaps = 47/480 (10%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W++ +++  GI+ S I+  + VVLN LK KGF+ YLVGGCVRDLIL R PKDFD+ITTA 
Sbjct  44    WKRFNSKELGISSSMIAKPTRVVLNGLKSKGFEVYLVGGCVRDLILKRTPKDFDIITTAE  103

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+++ F R EIVGRRFPIC VH+   VVEVSSF T    G  ++R  S     P  C+
Sbjct  104   LKEVRRTFSRCEIVGRRFPICHVHVDNEVVEVSSFHT---SGIRSERGLSLSFEKPVDCD  160

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D  RWRN LHRDFTIN L +DP+   +YDY   + DI+  K+RT+ PA  S  EDCAR
Sbjct  161   EKDHFRWRNCLHRDFTINGLMFDPYSKFVYDYMGGVDDIRKAKVRTIGPASFSLIEDCAR  220

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F F  ET  +I  LS SV+ LD+ RL+ME+NYML+YG+A  SL LL K
Sbjct  221   ILRAIRIAARLGFRFGRETALSIKNLSSSVLRLDRGRLLMEMNYMLAYGSAEASLRLLWK  280

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLW------VAL  1240
             + LLE+LLP  AAY  +   ++  D S+      S   L+     A   +       VA+
Sbjct  281   FGLLEILLPVQAAYFVRYGFRR-RDKSLCFPTSISYWPLIGHATVAYGKILCTGFSKVAI  339

Query  1241  LAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFAR----QHVKAASLYVPEISDSDG  1405
             LAFH  + + P+  LVV      +++  +  + +  A+    QH    S +  E  D D 
Sbjct  340   LAFHKAISDQPRDPLVVAAFGLGIHNGGDLSEALSIAKRISTQH--DGSFHELESQDLDL  397

Query  1406  SMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFG  1585
             +  ++E+ +   ++   +  +TD   +    + +  + +S LVF+               
Sbjct  398   AALKEEVVELATSVQRALTNMTDEYFVSRAMTNYPKAPYSDLVFIP--------------  443

Query  1586  ILTNDVTSLNEKSCSL-KIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
                    +L  ++C + +      +KG   K+G+ I +         E R + ++I+ DT
Sbjct  444   ------LALYLRTCKVFQCVRMGKEKGFVAKQGSKIDYELLALGSLQEVRHVFARIVFDT  497



>ref|XP_006652226.1| PREDICTED: CCA tRNA nucleotidyltransferase 1, mitochondrial-like 
[Oryza brachyantha]
Length=452

 Score =   281 bits (718),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 170/396 (43%), Positives = 236/396 (60%), Gaps = 14/396 (4%)
 Frame = +2

Query  404   ISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFY-RAEIV  580
             I   +W VL+ L+ KG+  YLVGGCVRDLI+ + PKDFD+ITTA L ++K  F   A IV
Sbjct  2     IPGEAWNVLHRLRSKGYDVYLVGGCVRDLIMKKTPKDFDIITTADLRQVKDTFSGSAVIV  61

Query  581   GRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRD  760
             GRRFPIC V+   S+VEVSSF+T A      +   S  P     C+++D +RW+N   RD
Sbjct  62    GRRFPICHVYENNSIVEVSSFNTYARGSTSNQIYTSKSPH----CSKNDYMRWKNCQGRD  117

Query  761   FTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFS  940
             FTIN L ++P+  +IYDY   + DIK  K+RT+IPA  SF+EDCARILR +R+AARL F+
Sbjct  118   FTINGLMFNPYAEKIYDYFGGIEDIKKAKVRTVIPAGTSFQEDCARILRAIRIAARLGFN  177

Query  941   FSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAY  1120
             F  ET   +  L+ SV  LDK R++MEVNYML+YG+A  SL LL ++ LLE LLPF AAY
Sbjct  178   FPKETAYYVRTLACSVARLDKGRILMEVNYMLAYGSAEASLRLLWRFGLLEHLLPFQAAY  237

Query  1121  L-TQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLT  1297
               + +  ++   T+ML+ LFS LD  ++  RP   SLW+++LA H  LV  P   LVV T
Sbjct  238   FSSNRFKRKDKGTNMLLVLFSKLDSFLAPNRPCHNSLWISILALHEALVRKPCDPLVVAT  297

Query  1298  LASVMYHRN-----WKQGVEFARQH-VKAASLYVPEISDSDGSMSEDELAKRVENMAVQV  1459
              A  +Y           G    RQH  + + L  P++ D    ++  E+     +M   +
Sbjct  298   FALALYLGGDMSLALDIGKSINRQHNAEFSELLEPKVWDDQHLLA--EVQSLAASMRRAL  355

Query  1460  NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIV  1567
               +TD   +    +K   +  S LVF+  +   K++
Sbjct  356   TEMTDEYFVANAMAKIPQAPSSDLVFIPLQAYLKVL  391



>ref|XP_010318327.1| PREDICTED: uncharacterized protein LOC101251959 isoform X2 [Solanum 
lycopersicum]
Length=447

 Score =   280 bits (715),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 186/460 (40%), Positives = 259/460 (56%), Gaps = 41/460 (9%)
 Frame = +2

Query  404   ISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVG  583
             I+  + VVLN LK KGF+ YLVGGCVRDLIL R PKDFD+ITTA L E+ + F   EIVG
Sbjct  2     IARPTRVVLNGLKSKGFEVYLVGGCVRDLILKRTPKDFDIITTAELKEVCRTFSHCEIVG  61

Query  584   RRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDF  763
             RRFPIC VH+   VVEVSSF T    G    R        P  C+E D  RW N L RDF
Sbjct  62    RRFPICHVHVDDEVVEVSSFHT---SGIRPVRNLGLSFEKPVDCDEKDHFRWTNCLRRDF  118

Query  764   TINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSF  943
             TIN L +DP+   +YDY   + DI+  K++T+ PA  SF EDCARILR +R+AARL F F
Sbjct  119   TINGLMFDPYSKLVYDYMGGVDDIRKAKIQTIGPASFSFVEDCARILRAIRIAARLGFRF  178

Query  944   SMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYL  1123
               ET  +I  LS SV+ LD+ RL+ME+NYML+YG+A  SL LL K+ LL++LLP  AAY 
Sbjct  179   GRETALSIKNLSSSVLKLDRGRLLMEMNYMLAYGSAEASLRLLWKFGLLDILLPIQAAYF  238

Query  1124  TQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTL  1300
              +   ++    S +L+ LFS+LD+LV+ +RP   SLWV +LAFH  L + P+  LVV   
Sbjct  239   VRHGFRRRDKRSHLLLSLFSNLDKLVAPDRPCHSSLWVTILAFHKALSDQPRDPLVVAAF  298

Query  1301  A-SVMYHRNWKQGVEFAR----QHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQVNM  1465
             +  V    +  + +  AR    QH    S +  E  D D +  ++E+ +   ++   +  
Sbjct  299   SLGVHNGGDLSEALSIARRISAQH--DGSFHELESRDLDLAALKEEVVELATSVQRALTN  356

Query  1466  LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSL-KIQ  1642
             +TD  ++    + +  + +S LVF+                      +L  K+C + +  
Sbjct  357   MTDEYSVSRAMANYPKAPYSDLVFIP--------------------LALYLKACKVCQCV  396

Query  1643  NPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
                 +KG   K+G+ I +         E R + ++I+ DT
Sbjct  397   RMGREKGFVAKQGSKIDYELLASGSLQEVRHVFARIVFDT  436



>gb|EYU29621.1| hypothetical protein MIMGU_mgv1a0199721mg, partial [Erythranthe 
guttata]
Length=273

 Score =   273 bits (699),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/270 (59%), Positives = 203/270 (75%), Gaps = 14/270 (5%)
 Frame = +2

Query  368   LDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNE  547
             +D+R+ G+T S +S  + VVL  L+  GF+AYLVGGC+RDL+LN++PKDFDVITTA L +
Sbjct  1     IDSRNLGLTRSMVSIPASVVLRNLRAAGFEAYLVGGCIRDLLLNKVPKDFDVITTASLKQ  60

Query  548   I----------KKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVP  697
             +          KK+F RA IVG+RFPICRV I+G +VEVSSF+TVA K   +K K   + 
Sbjct  61    VISNVLSHFSVKKKFQRAIIVGKRFPICRVIIKGCLVEVSSFETVAVK---SKSKQVDIF  117

Query  698   RMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLS  877
              MPKGCN  D  RW+N + RDFT+NSLF+DP V  I+DY NAMAD++S KL T+IPAQ S
Sbjct  118   EMPKGCNPRDFARWKNCMSRDFTVNSLFFDPAVNVIFDYTNAMADLRSLKLSTVIPAQRS  177

Query  878   FEED-CarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAV  1054
             F+ED  +RILRGLRLAARL  SFS ETE A++ LS  V +L  SR+ +E+N MLSYGAA 
Sbjct  178   FKEDEGSRILRGLRLAARLNLSFSKETEVALYSLSSLVANLSTSRIGLEMNNMLSYGAAE  237

Query  1055  PSLCLLQKYNLLEVLLPFHAAYLTQQADKQ  1144
             PSL LL+++NLLE+LLPFHAAY+++Q D Q
Sbjct  238   PSLLLLKRFNLLEILLPFHAAYISEQVDNQ  267



>ref|XP_006404213.1| hypothetical protein EUTSA_v10010292mg [Eutrema salsugineum]
 gb|ESQ45666.1| hypothetical protein EUTSA_v10010292mg [Eutrema salsugineum]
Length=520

 Score =   281 bits (720),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 166/399 (42%), Positives = 244/399 (61%), Gaps = 8/399 (2%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+++  GIT S I   +  VL+ LK KG   YLVGGCVRDLIL + PKDFD++T+A 
Sbjct  60    WKKLNSKELGITNSMIPKPARQVLSGLKSKGHNVYLVGGCVRDLILKQTPKDFDILTSAE  119

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F R EIVGRRFPIC VHI   ++EVSSF T A       R  S       G  
Sbjct  120   LREVVRAFSRCEIVGRRFPICHVHIGNDIIEVSSFSTSAQNSPRNMRTGS---EKSNGSC  176

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D IR+ N L RDFTIN L +DP+   +YDY   + DI+  K+RT++ A +SF+EDCAR
Sbjct  177   DEDSIRFNNCLQRDFTINGLMFDPYAKVVYDYLGGIEDIRKAKVRTVVHAGISFQEDCAR  236

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRG R+AARL F+ S ET   + KLS  V  L + R++ME+NYML+YG+A  SL LL K
Sbjct  237   ILRGTRIAARLGFTISKETAHFVKKLSFLVQRLHRGRILMEMNYMLAYGSAEASLRLLWK  296

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSD-TSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + +LE+LLP  AAY      K+    T+ML+ LF++LD+L++ +RP   SLW+A+LA H 
Sbjct  297   FGILEILLPIQAAYFVHSGFKRRDKRTNMLLSLFANLDKLLAPDRPCHSSLWLAILALHK  356

Query  1256  TLVNNPQ-PKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              L   P+ P +V     +V    +  + ++  R+  K  +    E+ + +   S+  L +
Sbjct  357   ALAAQPRYPSVVAAFSLAVHNGGDVLEAIKITRKITKPHNRSFFELLEPEKLDSQTLLDE  416

Query  1433  RVE-NMAVQ--VNMLTDADNLREVTSKFSGSSHSGLVFV  1540
              ++ ++AV+  +  +TD   + +  + +  + +S +VF+
Sbjct  417   VMDFDLAVKEALGQMTDGFFISKAMAAYPQAPYSDMVFI  455



>ref|XP_010426382.1| PREDICTED: uncharacterized protein LOC104711381 [Camelina sativa]
 ref|XP_010426383.1| PREDICTED: uncharacterized protein LOC104711381 [Camelina sativa]
Length=504

 Score =   280 bits (717),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 169/401 (42%), Positives = 235/401 (59%), Gaps = 15/401 (4%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL++   GIT S IS  + VVLN LK KG   YLVGGCVRDL+L R PKDFDV+T+A 
Sbjct  47    WKKLNSEDLGITSSMISKPARVVLNGLKSKGHDVYLVGGCVRDLVLKRTPKDFDVLTSAE  106

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L ++ + F R EIVGRRFPIC VH+   ++EVSSF T A     T            G  
Sbjct  107   LRDVVRTFSRCEIVGRRFPICHVHVGSDMIEVSSFSTSAQHSPRTGSGKF------NGSY  160

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D IR+ N L RDFTIN L +DP+   +YDY   M DI+  KLRT+  A  SF+EDCAR
Sbjct  161   DEDRIRYNNCLQRDFTINGLMFDPYAKVVYDYLGGMEDIRKAKLRTVFHAGTSFQEDCAR  220

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRG R+AARL F+ + ET   +  LS  V  L + R++ME+NYML+YG+A  SL LL K
Sbjct  221   ILRGTRIAARLGFTIAKETAHFLRNLSFLVQRLHRGRILMEMNYMLAYGSAEASLRLLWK  280

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + +LE+LLP  AAYL     K+  +T+ ML+ LF +LD L++ +RP   SLW+A+LA H 
Sbjct  281   FGILEILLPIQAAYLVHSGFKRRDETTNMLLSLFGNLDTLLAPDRPCPSSLWLAILALHK  340

Query  1256  TLVNNPQPKLVVLTLASVMYHRN-----WKQGVEFARQH-VKAASLYVPEISDSDGSMSE  1417
              L + P+   VV   +  +++        K   E  + H +    L  PE  DS   +  
Sbjct  341   ALADQPRYPSVVAAFSLAVHNGGDVLEAIKITEEVTKPHNISFFELLEPEEMDSQTLL--  398

Query  1418  DELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFV  1540
             DE+     ++   +  +T+   + +  + +  +  S +VF+
Sbjct  399   DEVMDLDSSVKEALGQMTNGKFISKAMAAYPQAPRSDMVFI  439



>ref|XP_010493490.1| PREDICTED: uncharacterized protein LOC104770729 isoform X1 [Camelina 
sativa]
Length=536

 Score =   281 bits (720),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 179/481 (37%), Positives = 270/481 (56%), Gaps = 41/481 (9%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W++L+++  GI+ S I+  +  VLN LK KG   YLVGGCVRDLIL R PKDFD++T+A 
Sbjct  65    WKQLNSKDLGISSSMIAIPTRKVLNGLKSKGHDVYLVGGCVRDLILKRTPKDFDILTSAE  124

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F R EIVGRRFPIC VH+   +VEVSSF T A       R    +        
Sbjct  125   LKEVVRTFPRCEIVGRRFPICHVHVGDDLVEVSSFSTSAQNSPRNMRTE--LKESSGSDG  182

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQK-------LRTLIPAQLS  877
             + D IR  N L RDFTIN L +DP+   +YDY   + DIK  K       +RT+I A  S
Sbjct  183   DEDCIRLNNCLQRDFTINGLMFDPYAKVVYDYLGGIEDIKKAKVVFLQSQVRTVIHAGTS  242

Query  878   FEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVP  1057
             F++DCARILR +R+AARL F  S ET   I  LS  V  LDK R++ME+NYML+YG+A  
Sbjct  243   FQQDCARILRAIRIAARLSFRMSKETAHYIKNLSLLVQRLDKGRILMEMNYMLAYGSAEA  302

Query  1058  SLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWV  1234
             SL LL K+ +LE LLPF AAYL +    ++   T+ML+ LF++LD+L++ +RP   SLW+
Sbjct  303   SLRLLWKFGILETLLPFQAAYLVRSGFRRRDKRTNMLLSLFANLDKLLAPDRPCHSSLWI  362

Query  1235  ALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSM  1411
             A+LAFH  L + P+  LVV   +  +++  +  + VE  ++  +       E+ + + ++
Sbjct  363   AILAFHKALADQPRSPLVVAAFSLAVHNCGDILEAVEITKKITRPHDKSFFELVEREENL  422

Query  1412  SEDELAKRVENMAV----QVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEV  1579
             + + +   V ++       +N +TD   + +  + +  + +S +VF+  ++  +     +
Sbjct  423   NFETMLDEVMDLDAFIRDALNQMTDGYFISKAMAAYPQAPYSDMVFIPLQLYLR--AGRI  480

Query  1580  FGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILD  1732
             F              C  K +    Q G   K+G+ I +         ETR + ++++ D
Sbjct  481   F-------------ECVRKEER--QQMGFEAKQGSKIEYGSLLSGDFPETRHVFARVVFD  525

Query  1733  T  1735
             T
Sbjct  526   T  526



>ref|XP_002875928.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52187.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=610

 Score =   283 bits (724),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 176/442 (40%), Positives = 250/442 (57%), Gaps = 28/442 (6%)
 Frame = +2

Query  257   KFNQTSAG-------DGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPS  415
             +FN  +A        D   LE  +DR + +           W+KL+++  GIT S IS  
Sbjct  28    QFNTVAAAIETVDDKDSDHLEKGSDRTSKA---------PEWKKLNSKDLGITSSMISKP  78

Query  416   SWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFP  595
             + +VLN LK KG+  YLVGGCVRDLIL R PKDFD++T+A L E+ + F R EIVG+RFP
Sbjct  79    TRLVLNGLKSKGYDVYLVGGCVRDLILKRTPKDFDILTSAELREVVRTFSRCEIVGKRFP  138

Query  596   ICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINS  775
             IC VH+   ++EVSSF T A       R  S       G  + D  R  N L RDFTIN 
Sbjct  139   ICHVHVGNEMIEVSSFSTSAQNSPRNMRTGS---GKSNGSYDEDNTRLNNCLQRDFTING  195

Query  776   LFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMET  955
             L +DP+   +YDY   + DIK  K+RT+  A  SF+EDCARILRG R+AARL F+ S ET
Sbjct  196   LMFDPYAEVVYDYLGGIEDIKKAKIRTVFHAGTSFQEDCARILRGTRIAARLGFTISKET  255

Query  956   ETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA  1135
                +  LS  V  L + R++ME+NYML+YG+A  SL LL K+ +LE+LLP  AAYL    
Sbjct  256   AHFLKNLSFLVQRLHRGRILMEMNYMLAYGSAEASLRLLWKFGILEILLPIQAAYLVHTG  315

Query  1136  DKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQ-PKLVVLTLASV  1309
              K+    S +L+ LF +LD+L++ +RP   SLW+ +LA H  L + P+ P +V     +V
Sbjct  316   FKRRDKRSNLLLSLFGNLDKLLAPDRPCHSSLWLTILALHKALADQPRYPSVVAAFSLAV  375

Query  1310  MYHRNWKQGVEFARQHVKAAS-----LYVPEISDSDGSMSEDELAKRVENMAVQVNMLTD  1474
                 +  + V+  R+  K  +     L  PE  DS   +  DE+     ++   +  +TD
Sbjct  376   HNGGDVLEAVKITRKVTKPHNRSFFELLEPEELDSQTLL--DEVMDFDSSIKEALGQMTD  433

Query  1475  ADNLREVTSKFSGSSHSGLVFV  1540
                + +  + +  + +S +VF+
Sbjct  434   GRFISKAMAAYPQAPYSDMVFI  455



>ref|XP_006290905.1| hypothetical protein CARUB_v10017016mg [Capsella rubella]
 gb|EOA23803.1| hypothetical protein CARUB_v10017016mg [Capsella rubella]
Length=521

 Score =   279 bits (714),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 177/440 (40%), Positives = 253/440 (58%), Gaps = 22/440 (5%)
 Frame = +2

Query  257   KFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSN-----WRKLDARHFGITGSRISPSSW  421
             +FN  +A     +E+  D+  DS+   G  + SN     W+KL++   GIT S IS  + 
Sbjct  27    QFNTVAAA---AIETVDDK--DSDHDKGSDQTSNGKAPEWKKLNSEDLGITSSMISKPTR  81

Query  422   VVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPIC  601
             +VLN LK KG   YLVGGCVRDLIL R PKDFD++T+A L E+ + F R EIVGRRFPIC
Sbjct  82    LVLNGLKNKGHDVYLVGGCVRDLILKRTPKDFDILTSAELREVVRTFSRCEIVGRRFPIC  141

Query  602   RVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLF  781
              VH+   ++EVSS  T A       R  S          + D IR+ N L RDFTIN L 
Sbjct  142   HVHVGNDMIEVSSISTSAQHSPRNMRNGS---GKSSDSYDEDSIRFNNCLQRDFTINGLM  198

Query  782   YDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETET  961
             +DP+   +YDY   + DI+  K++T+  A  SF+EDCARILRG R+AARL F+ S ET  
Sbjct  199   FDPYAKVVYDYLGGIEDIRKAKVQTVFHAGKSFQEDCARILRGTRIAARLGFTISKETAH  258

Query  962   AIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADK  1141
              +  LS  V  L + R++ME+NYML+YG+A  SL LL K+ +LE+LLP  AAYL     K
Sbjct  259   FLKNLSFLVQRLHRGRILMEINYMLAYGSAEASLRLLWKFGILEILLPIQAAYLVHSGFK  318

Query  1142  QSSD-TSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQ-PKLVVLTLASVMY  1315
             +    T+ML+ LF +LD+L++ +RP   SLW+A+LA H  L + P+ P +V     +V  
Sbjct  319   RRDKRTNMLLSLFGNLDKLLAPDRPCPSSLWLAILALHKALADQPRYPSVVAAFSLAVHN  378

Query  1316  HRNWKQGVEFARQHVKAAS-----LYVPEISDSDGSMSEDELAKRVENMAVQVNMLTDAD  1480
               +  + V+  ++  K  +     L  PE  DS   +   E+     ++   +  +TD  
Sbjct  379   GGDVLEAVKITQKVTKPHNRSFFELLEPEELDSQSLLY--EVMDFDSSIKEALGQMTDGK  436

Query  1481  NLREVTSKFSGSSHSGLVFV  1540
              + +  + +  + HS +VF+
Sbjct  437   FISKAMAAYPQAPHSDMVFI  456



>gb|KHN16874.1| Poly(A) polymerase [Glycine soja]
Length=508

 Score =   279 bits (713),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 187/474 (39%), Positives = 262/474 (55%), Gaps = 56/474 (12%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+++  G+  S I+  +  VLNVLKKKG   YLVGGCVRDLIL + PKDFD+IT+A 
Sbjct  67    WKKLNSKELGLRNSMIAVPTKKVLNVLKKKGHDVYLVGGCVRDLILKQTPKDFDIITSAD  126

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   EIVG+RFPIC VH+ G++VEVSSF+T   K       +      P  C+
Sbjct  127   LKEVRKTFSWCEIVGKRFPICHVHMDGTIVEVSSFNTARCKSSMHFIYDDI--EAPNDCD  184

Query  719   ESDVIRWRNSLHRDFTINSLF-YDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
             + D +RWRN L RDFTIN L  +DP+   +YDY   M DI   K+RT++PA  SF EDCA
Sbjct  185   KEDYLRWRNCLKRDFTINGLLMFDPYARIVYDYMGGMEDIIKAKVRTVVPAATSFREDCA  244

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR +R+AARL FS S ET  ++  LS SV+ LDK RL ME+NYML+YG+   SL LL 
Sbjct  245   RILRAIRVAARLGFSISRETAQSVKNLSYSVLRLDKGRLWMEINYMLAYGSGEASLRLLW  304

Query  1076  KYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             ++ LL++LLPF +                    FS++D+L++  RP   SLWVA+LA H 
Sbjct  305   RFGLLDILLPFQS-------------------FFSNVDKLLAPNRPCHSSLWVAILALHK  345

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              L + P+   VV   +  +++  N  + +  AR+  KA     PE+ D  G + E+ L  
Sbjct  346   ALSDKPRDSSVVAAFSLALHNGGNLSEAINIARRINKAHDARFPELLDPSG-LDEENLEA  404

Query  1433  RVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
              + ++A  V      +TD   +    + +  + HS LV +   M  K             
Sbjct  405   EILDLAESVKGSLLQMTDRHLVSGAMADYPQAPHSNLVLIPLSMFLK-------------  451

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHET---------RFLLSKIILDT  1735
               +LN   C     N S  K    K+G  I +E+         R + ++I+ DT
Sbjct  452   --ALNFFDCV----NVSTGKNYLSKQGRQIDYESLARGDLLEVRHVFARIVFDT  499



>ref|XP_006363976.1| PREDICTED: uncharacterized protein LOC102596961 [Solanum tuberosum]
Length=507

 Score =   278 bits (711),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 189/479 (39%), Positives = 273/479 (57%), Gaps = 41/479 (9%)
 Frame = +2

Query  347   EFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVI  526
             E + W++ +++  GI+ S I+  + VVLN LK KGF+ YLVGGCVRDL+L R PKDFD+I
Sbjct  43    EPAEWKRFNSKELGISSSMIARPTRVVLNGLKSKGFEVYLVGGCVRDLLLKRTPKDFDII  102

Query  527   TTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMP  706
             TTA L E+++ F   EIVGRRFPIC VH+   VVEVSSF T    G    R        P
Sbjct  103   TTAELKEVRRTFSHCEIVGRRFPICHVHVDDEVVEVSSFHT---SGIRPVRNLGLSFEKP  159

Query  707   KGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEE  886
               C+E D  RWRN L RDFTIN L +DP+   IYDY   + DI+  K++T+ PA  SF E
Sbjct  160   VDCDEKDHFRWRNCLRRDFTINGLMFDPYSKLIYDYMGGVDDIRKAKVQTIGPASFSFIE  219

Query  887   DCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLC  1066
             DCARILR +R+AARL F F  ET  +I  LS SV+ LD+ RL+ME+NYML+YG+A  SL 
Sbjct  220   DCARILRAIRIAARLGFRFGRETALSIKNLSSSVLRLDRGRLLMEMNYMLAYGSAEASLR  279

Query  1067  LLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALL  1243
             LL K+ LL++LLP  AAY  +    ++   +++L+ LFS+LD+LV+ +RP   SLWV +L
Sbjct  280   LLWKFGLLDILLPIQAAYFVRHGFRRRDKRSNLLLSLFSNLDKLVAPDRPCHSSLWVTIL  339

Query  1244  AFHLTLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFAR----QHVKAASLYVPEISDSDGS  1408
             AFH  L + P+  LVV      V    +  + +  A+    QH    S +  E  D + +
Sbjct  340   AFHKALSDQPRDPLVVAAFGLGVHNGGDLSEALSIAKRISAQH--DGSFHELESRDLNLA  397

Query  1409  MSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGI  1588
               ++E+ +   ++   +  +TD  ++    + +  + +S LVF+                
Sbjct  398   ALKEEVVELATSVQRALTNMTDEYSVSRAMANYPKAPYSDLVFIP---------------  442

Query  1589  LTNDVTSLNEKSCSL-KIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
                   +L  K+C + +      +KG   K+G+ I +         E R + ++I+ DT
Sbjct  443   -----LALYLKACKVCQCVRMGREKGFVAKQGSKIDYELLASGSLQEVRHVFARIVFDT  496



>gb|KFK34184.1| hypothetical protein AALP_AA5G111500 [Arabis alpina]
Length=518

 Score =   278 bits (712),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 179/435 (41%), Positives = 249/435 (57%), Gaps = 15/435 (3%)
 Frame = +2

Query  257   KFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPSSWVVLNV  436
             +FN  SA + +  +       DS+      E   W+KL++   GIT S IS  +  VLNV
Sbjct  27    RFNTVSAIETVDYKDNDVHDIDSDKTSKAPE---WKKLNSEDLGITSSMISKPTRQVLNV  83

Query  437   LKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIR  616
             LK KG   YLVGGCVRDLIL R PKDFD++T+A L E+ + F R EIVGRRFPIC VHI 
Sbjct  84    LKSKGHDVYLVGGCVRDLILKRTPKDFDILTSAELREVVRTFSRCEIVGRRFPICHVHIG  143

Query  617   GSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFV  796
               ++EVSSF T A+      R  S   +    C+E D +R  N L RDFTIN L +D + 
Sbjct  144   NDMIEVSSFSTSAHNSPGNMRTGS--GKSNGSCDE-DSLRLNNCLQRDFTINGLMFDSYA  200

Query  797   YQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKL  976
               +YDY   + DI+  K+RT+  A  SF+EDCARILRG R+AARL F+ S ET   +  L
Sbjct  201   KVVYDYLGGIEDIRKAKVRTVFHAGSSFKEDCARILRGTRIAARLGFTISKETAHFLKNL  260

Query  977   SPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSD-  1153
             S  V  L + R++ME+NYML+YG+A  SL LL K+ +LE+LLP  AAYL     K+    
Sbjct  261   SFLVQRLHRGRILMEMNYMLAYGSAEASLRLLWKFGILEILLPIQAAYLVHSGFKRRDKR  320

Query  1154  TSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQ-PKLVVLTLASVMYHRNWK  1330
             T+ML+ LF +LD L++ +RP   SLW+A+LA H  L + P+ P +V     +V    +  
Sbjct  321   TNMLLSLFGNLDILLAPDRPCHSSLWLAILALHKALADQPRFPSVVAAFSLAVHNGGDVL  380

Query  1331  QGVEFARQHVKAAS-----LYVPEISDSDGSMSEDELAKRVENMAVQVNMLTDADNLREV  1495
             + V+  R+  K        L  PE  DS   +  DE+     +    +  +TD   + + 
Sbjct  381   EAVKITREITKPHDRSFFELLEPEKLDSQTLL--DEVMDLEVSTREALGQMTDGRFISKA  438

Query  1496  TSKFSGSSHSGLVFV  1540
              + +  + +S +VF+
Sbjct  439   MAAYPQAPYSDMVFI  453



>gb|KFK27655.1| hypothetical protein AALP_AA8G411400 [Arabis alpina]
Length=534

 Score =   279 bits (713),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 175/468 (37%), Positives = 265/468 (57%), Gaps = 24/468 (5%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W++L+++  GI+ S I+  +  VLN LK++G   YLVGGCVRDLIL R P+DFD++T+A 
Sbjct  72    WKQLNSKDLGISSSMIAKPTRKVLNGLKREGHDVYLVGGCVRDLILKRTPRDFDILTSAE  131

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F + EIVGRRFPIC VH+   VVEVSSF T A       R      +   G +
Sbjct  132   LREVVRTFSKCEIVGRRFPICHVHVGDDVVEVSSFSTSAQNSPRNMRTEF---KQSSGSD  188

Query  719   -ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
              + D IR  N L RDFTIN L +DP+   +YDY   + DI+  K+RT+I A  SF++DCA
Sbjct  189   GDEDCIRLNNCLQRDFTINGLMFDPYAKVVYDYLGGIEDIRKAKVRTVIHAGTSFQQDCA  248

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILRG+R+AARL F  S ET   +  LS  V  LDK R++ME+NYML+YG+A  SL LL 
Sbjct  249   RILRGIRIAARLGFRISKETAHFVKNLSFLVQRLDKGRILMEMNYMLAYGSAEASLRLLW  308

Query  1076  KYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             K+ +LE+L+P  AAYL +    ++   T++L+ LF++LD+L++ +RP   SLW+A+LAFH
Sbjct  309   KFGILEILIPIQAAYLARNGFRRRDKRTNLLLSLFANLDKLLAPDRPCHSSLWIAILAFH  368

Query  1253  LTLVNNPQPKLVVLTLASVMYHRNWKQGVE-------FARQHVKAASLYVPEISDSDGSM  1411
               L + P+  LV+   +  ++  N    VE         R H ++    +    + D   
Sbjct  369   KALADKPRSPLVLAAFSLAVH--NGGDIVEAVNITKKITRPHDRSFFELLELKKNLDFQT  426

Query  1412  SEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGIL  1591
               DE+     ++   +N +TD   + +  + +  + +S +VF+  ++  +     +F  +
Sbjct  427   LLDEVMDLDASIKNALNQMTDGYYISKAMAAYPQAPYSDMVFIPLQLYLR--AGRIFQCV  484

Query  1592  TNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               D     E     KI+      G           ETR + ++++ DT
Sbjct  485   KEDREIGFESKQGSKIEYALLYSGD--------IPETRHVFARVVFDT  524



>ref|XP_010929643.1| PREDICTED: uncharacterized protein LOC105051064 isoform X2 [Elaeis 
guineensis]
Length=520

 Score =   277 bits (709),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 168/400 (42%), Positives = 233/400 (58%), Gaps = 38/400 (10%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+K+ ++  GI  S I+  +  VLN L+KKG+  YLVGGCVRDLI+ R PKDFD+IT+A 
Sbjct  82    WKKMSSKDLGIKTSMIAKPTRSVLNALRKKGYDVYLVGGCVRDLIMKRTPKDFDIITSAE  141

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E                            VSSF T  NK +     +S  P     C+
Sbjct  142   LKE----------------------------VSSFSTPLNKPNHDMTYSSRRP----DCD  169

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D +RWRN L RDFTIN L ++PF   +YDY   M D+K  K+RT+IPA  SF+EDCAR
Sbjct  170   KQDYMRWRNCLGRDFTINGLMFNPFSNSVYDYLGGMEDLKKAKVRTVIPAHTSFQEDCAR  229

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F FS ET  ++  L+ SV+ LDK R++ME+NYML+YG+A  SL LL +
Sbjct  230   ILRAIRIAARLGFRFSKETAYSVRDLASSVLGLDKGRILMEMNYMLAYGSAEASLRLLWR  289

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LLE+LLP  AAY   Q   ++   ++ML+ LF +LD+L++ +RP   SLWV LLAFH 
Sbjct  290   FGLLELLLPIQAAYFVSQGFRRRDKRSNMLLTLFFNLDKLLAPDRPCHNSLWVGLLAFHQ  349

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
              LV  P+  LVV T    +++  +  + VE AR       +  PE+        +DEL K
Sbjct  350   ALVRQPRDPLVVATFTLALHNGGDLAEAVEIARAINYPHDVSFPELLQPQRWEMDDELVK  409

Query  1433  RVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFV  1540
              V ++A  VN     +TD   + +  +K+  +  S LVF+
Sbjct  410   EVVDLASAVNAALSSMTDEYFVSKAMAKYPRAPCSDLVFI  449



>emb|CDX80381.1| BnaC07g30630D [Brassica napus]
Length=533

 Score =   276 bits (707),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 154/323 (48%), Positives = 208/323 (64%), Gaps = 6/323 (2%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W++L ++  GI+ S I   +  V N LK KG   YLVGGCVRDLIL R P+DFD++T+A 
Sbjct  67    WKQLSSKDLGISSSMIDKPTRQVFNGLKSKGHDVYLVGGCVRDLILKRTPRDFDILTSAE  126

Query  539   LNEIKKQFYRAEIVGRRFPICRVHI-RGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
             L E+ + F R EIVGRRFPIC VH+    +VEVSSF T A       R      R   G 
Sbjct  127   LREVVRTFSRCEIVGRRFPICHVHVGDDDIVEVSSFSTSAQNSSRNMRSEL---RESTGS  183

Query  716   N-ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
             + + D IR  N L RDFTIN L +DP+   +YDY   + DI+  K+RT+I A  SF++DC
Sbjct  184   DGDEDCIRLNNCLQRDFTINGLMFDPYAKVVYDYLGGIEDIRKAKVRTVIHAGTSFQQDC  243

Query  893   arilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLL  1072
             ARILR +R+AARL F  S ET   I  LS  V  LDK R++ME+NYML+YG+A  SL LL
Sbjct  244   ARILRAIRVAARLGFRISKETAHFIKHLSFLVQRLDKGRILMEMNYMLAYGSAEASLRLL  303

Query  1073  QKYNLLEVLLPFHAAYLTQQADKQSSD-TSMLMKLFSSLDQLVSCERPARESLWVALLAF  1249
              K+ +LE++LP  AAYL +   K+    T+ML+ LF++LD+L++ +RP   SLW+A+LAF
Sbjct  304   WKFGILEIILPIQAAYLARSGFKRRDKRTNMLLSLFANLDKLLAPDRPCHSSLWIAILAF  363

Query  1250  HLTLVNNPQPKLVVLTLASVMYH  1318
             H  L + P+  LVV   +  +++
Sbjct  364   HKALSDQPRSPLVVAAFSLAVHN  386



>emb|CDX88043.1| BnaA06g26340D [Brassica napus]
Length=520

 Score =   273 bits (699),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 208/321 (65%), Gaps = 3/321 (1%)
 Frame = +2

Query  362   RKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARL  541
             ++++++  GI+ S I   +  VLN LK KG   YLVGGCVRDLIL R P+DFD++T+A L
Sbjct  53    KQVNSKDLGISSSMIDKPTRQVLNGLKSKGHDVYLVGGCVRDLILERTPRDFDILTSAEL  112

Query  542   NEIKKQFYRAEIVGRRFPICRVHI-RGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
              E+ + F R EIVGRRFPIC VH+    +VEVSSF T A        +N          +
Sbjct  113   REVVRTFSRCEIVGRRFPICHVHVGDDDIVEVSSFSTSAQNNSSRNMRNELRESSVSDGD  172

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E D IR  N L RDFTIN L +DP+   +YDY   + DI+  K+RT+I A  SF++DCAR
Sbjct  173   E-DCIRLNNCLQRDFTINGLMFDPYAKVVYDYLGGIEDIRKAKVRTVIHAGTSFQQDCAR  231

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL F  S ET   I  LS  V  LDK R++ME+NYML+YG+A  SL LL K
Sbjct  232   ILRAVRVAARLGFRISKETAHFIKHLSFLVQRLDKGRILMEMNYMLAYGSAEASLRLLWK  291

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSD-TSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + +LE++LP  AAYL +   K+    T+ML+ LF++LD+L++ +RP   SLW+A+LAFH 
Sbjct  292   FGILEIILPIQAAYLARSGFKRRDKRTNMLLSLFANLDKLLAPDRPCHSSLWIAILAFHK  351

Query  1256  TLVNNPQPKLVVLTLASVMYH  1318
              L + P+  LVV   +  +++
Sbjct  352   ALSDQPRSPLVVAAFSLAVHN  372



>ref|XP_009604533.1| PREDICTED: uncharacterized protein LOC104099282 isoform X3 [Nicotiana 
tomentosiformis]
Length=491

 Score =   271 bits (693),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 180/475 (38%), Positives = 259/475 (55%), Gaps = 75/475 (16%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL +   GI+ S I+  + VVLN LKKKGF+ YLVGGCVRDL+LN+ PKDFD+IT+A 
Sbjct  68    WKKLSSEELGISTSMIAKPTRVVLNGLKKKGFEVYLVGGCVRDLLLNKTPKDFDIITSAE  127

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSF-VPRMPKGC  715
             L E+ K F R EIVGRRFPIC VH+  ++VEVSSF+T   +     R+NS+ V R P  C
Sbjct  128   LKEVLKTFQRCEIVGRRFPICHVHVDDTIVEVSSFNTTGRRF----RRNSYNVVRRPATC  183

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
             +E+D IRW+N L RDFTIN L +DPF   +YDY   + DI+  K+R +IPA  SF EDCA
Sbjct  184   DEADFIRWKNCLGRDFTINGLMFDPFARIVYDYLGGLEDIRRAKVRCVIPASASFVEDCA  243

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILRG+R+A RL F FS ET   + +L+ S+  LDK+      +Y +S G          
Sbjct  244   RILRGVRIAGRLGFRFSRETAHFVKELASSISRLDKA------SYFISQG----------  287

Query  1076  KYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
                              ++ DK+S   +ML+ LFS+LD L++ +RP   SLW+A+LAFH 
Sbjct  288   ----------------FRRRDKRS---NMLLTLFSTLDNLLAPDRPCHSSLWIAILAFHK  328

Query  1256  TLVNNPQPKLVVLTLASVMYH--RNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELA  1429
              LV+ P+  LVV    SV  H   +    +  AR+  +       E+ D     S++ L 
Sbjct  329   ALVDRPRDPLVVAAF-SVAVHCGGSLSDVLGVARKISQPHDTRFSELLDFRIVESDEALL  387

Query  1430  KRVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTN  1597
               + ++A  V      +TD   +    +++  +  S LVF+   + +K  V+ +F  +  
Sbjct  388   DEMMDLATYVEAALRKMTDEHFISRALTEYPQAPKSDLVFIPWALSQK--VDAIFECVRR  445

Query  1598  DVTSLNEKSCSLKIQNPSPQKGTAHKKGN---------GIAHETRFLLSKIILDT  1735
                                +KG   K+G+         G  HE R + ++++ DT
Sbjct  446   -----------------GKEKGFRRKRGSKIDYESLALGKLHEIRHIFARVVFDT  483



>ref|XP_009779995.1| PREDICTED: uncharacterized protein LOC104229113 isoform X3 [Nicotiana 
sylvestris]
Length=491

 Score =   271 bits (693),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 177/474 (37%), Positives = 260/474 (55%), Gaps = 73/474 (15%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL +   GI+ S I+  + VVLN LKKKGF+ YLVGGCVRDL+LN+ PKDFD+IT+A 
Sbjct  68    WKKLSSEELGISTSMIAKPTRVVLNGLKKKGFEVYLVGGCVRDLLLNKTPKDFDIITSAE  127

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ K F R EIVGRRFPIC VH+  ++VEVSSF+T    G   KR +  V R P  C+
Sbjct  128   LKEVLKTFQRCEIVGRRFPICHVHVDDTIVEVSSFNTT---GRRFKRNSYNVVRRPAMCD  184

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             E+D IRW+N L RDFTIN L +DPF   +YDY   + DI+  K+R +IPA  SF EDCAR
Sbjct  185   EADFIRWKNCLGRDFTINGLMFDPFARIVYDYLGGLEDIRRAKVRCVIPASASFIEDCAR  244

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRG+R+A RL F FS ET   + +L+ S+  LDK+      +Y +S G           
Sbjct  245   ILRGVRIAGRLGFRFSRETAHFVKELASSISKLDKA------SYFISQG-----------  287

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLT  1258
                             ++ DK+S   +ML+ LFS+LD L++ +RP   SLW+A+LAFH  
Sbjct  288   ---------------FRRRDKRS---NMLLSLFSTLDNLLAPDRPCHSSLWIAILAFHKA  329

Query  1259  LVNNPQPKLVVLTLASVMYHRNWKQGV-----EFARQH-VKAASLYVPEISDSDGSMSED  1420
             LV+ P+  LVV   ++ ++       V     + ++ H  + + L    I +SD ++  D
Sbjct  330   LVDRPRDPLVVAAFSAAVHCGGSLSDVLGVAGKISQPHDTRFSELLDFRIVESDEALL-D  388

Query  1421  ELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
             E+      +   +  +TD   + +  +++  +  S LVF+   + +K  V+ +F  +   
Sbjct  389   EMMDLATYVEAALRKMTDEYFISQALTEYPQAPKSDLVFIPWALSQK--VDAIFECVRR-  445

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGN---------GIAHETRFLLSKIILDT  1735
                               +KG   K+G+         G  HE R + ++++ DT
Sbjct  446   ----------------GKEKGFRQKRGSKIDYESLALGKLHEIRHIFARVVFDT  483



>ref|XP_009150898.1| PREDICTED: uncharacterized protein LOC103874237 [Brassica rapa]
Length=537

 Score =   272 bits (695),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/322 (47%), Positives = 211/322 (66%), Gaps = 3/322 (1%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W++++++  GI+ S I   +  VLN LK KG   YLVGG VRDLIL R P+DFD++T+A 
Sbjct  69    WKQVNSKDLGISSSMIDKPTRQVLNGLKSKGHDVYLVGGSVRDLILKRTPRDFDILTSAE  128

Query  539   LNEIKKQFYRAEIVGRRFPICRVHI-RGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
             L E+ + F R EIVGRRFPIC VH+    +VEVSSF T A + + ++   S +       
Sbjct  129   LREVVRTFSRCEIVGRRFPICHVHVGDDDIVEVSSFSTSA-QNNSSRNMRSELRESSVSD  187

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
              + D IR  N L RDFTIN L +DP+   +YDY   + DI+  K+RT+I A  SF++DCA
Sbjct  188   GDEDCIRLNNCLQRDFTINGLMFDPYAKVVYDYLGGIEDIRKAKVRTVIHAGTSFQQDCA  247

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR +R+AARL F  S ET   I  LS  V  LDK R++ME+NYML+YG+A  SL LL 
Sbjct  248   RILRAIRVAARLGFRISKETAHFIKHLSFLVQRLDKGRILMEMNYMLAYGSAEASLRLLW  307

Query  1076  KYNLLEVLLPFHAAYLTQQADKQSSD-TSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             K+ +LE++LP  AAYL +   K+    T+ML+ LF++LD+L++ +RP   SLW+A+LAFH
Sbjct  308   KFGILEIILPIQAAYLARSGFKRRDKRTNMLLSLFANLDKLLAPDRPCHSSLWIAILAFH  367

Query  1253  LTLVNNPQPKLVVLTLASVMYH  1318
               L + P+  LVV   +  +++
Sbjct  368   KALSDQPRSPLVVAAFSLAVHN  389



>gb|EMS57997.1| putative poly(A) polymerase [Triticum urartu]
Length=477

 Score =   267 bits (682),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 182/526 (35%), Positives = 265/526 (50%), Gaps = 113/526 (21%)
 Frame = +2

Query  182   PAILLSSVEQFVEQLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNW  361
             PA LLS +     +L+       ++K+      DG +L +    +A    +PG I+ S+W
Sbjct  16    PAPLLSRLSSAASRLLQ------MRKYGSRKE-DGGRLRNGRSSSAS---RPGFIDPSSW  65

Query  362   RKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARL  541
             +  D+R  GI    I  +   VL +LK+KGF+AYLVGGCVRDL+L R PKDFDVITTA L
Sbjct  66    KYFDSRAVGIPAGAIPRNCMTVLQMLKRKGFEAYLVGGCVRDLLLKRAPKDFDVITTASL  125

Query  542   NEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSF--DTVANKGDETKRKNSFVPRMPKGC  715
              +                            VSSF  +T   KG+E    N        G 
Sbjct  126   KQ----------------------------VSSFKTNTTQVKGNE----NVNCSEETDGH  153

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
             +E D++RW++SL RDFT+NSLF++PF Y++YDY N + D++                   
Sbjct  154   DEGDILRWKDSLRRDFTVNSLFFNPFNYRVYDYVNGVKDLRK------------------  195

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
                                               +K+RL ME+ YMLSYGAA  S+ LL+
Sbjct  196   ----------------------------------NKTRLAMEMKYMLSYGAAESSIRLLR  221

Query  1076  KYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSL-DQLVSCERPARESLWVALLAFH  1252
             KY LL++LLPF AAYL+ Q   +SSD  +++    +  D+  S +RP   SLW+ALLAFH
Sbjct  222   KYGLLDILLPFQAAYLSDQLKGKSSDRGLMLMNLLANLDKFFSADRPCHCSLWLALLAFH  281

Query  1253  LTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAK  1432
               LVN+PQ   V+   A++M+   W   +EF  + V A   YVPE     G+   D L +
Sbjct  282   NALVNSPQDAQVIKAFAALMHFGTWDIAIEFLNEDVGAPVTYVPEAFGRSGA-KVDNLME  340

Query  1433  RVENMA----VQVNMLTDADNLREVTSKFSGSSH-SGLVFVSNKMVKKIVVEEVFGILTN  1597
             R  ++A      V+ LT  + L++   ++ G+S  SGLVFVS +  +K  V  +F  L +
Sbjct  341   RTSHLASLVKSSVDTLTCLNTLKQSVVRYPGASQFSGLVFVSAR--EKGRVLGIFNGLDS  398

Query  1598  DVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             D+TS +++  S  I     +        +G+  E RF+L K+I+DT
Sbjct  399   DLTSYDKRRGSHGIDYKLLE--------DGVTAEVRFVLGKVIMDT  436



>ref|NP_190452.1| polynucleotide adenylyltransferase domain and RNA recognition 
motif-containing protein [Arabidopsis thaliana]
 emb|CAB87911.1| putative protein [Arabidopsis thaliana]
 gb|AEE78461.1| polynucleotide adenylyltransferase domain and RNA recognition 
motif-containing protein [Arabidopsis thaliana]
Length=881

 Score =   276 bits (706),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 166/401 (41%), Positives = 239/401 (60%), Gaps = 12/401 (3%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+++  GIT S IS  + +VLN LK KG+  YLVGGCVRDLIL R PKDFD++T+A 
Sbjct  61    WKKLNSKDLGITTSMISKPTRIVLNGLKSKGYDVYLVGGCVRDLILKRTPKDFDILTSAE  120

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+ + F R EI+G++FPIC VHI   ++EVSSF T A       R  S       G  
Sbjct  121   LREVVRSFSRCEIIGKKFPICHVHIGNDMIEVSSFSTSAQNSLRNTRTGS---GKSNGSY  177

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D IR+ N L RDFTIN L +DP+   IYDY   + DIK  K+RT+  A  SF+ED AR
Sbjct  178   DEDSIRFNNCLQRDFTINGLMFDPYAKVIYDYLGGIEDIKKAKVRTVFHAGTSFQEDSAR  237

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILRG R+AARL F+ S ET   +  LS  V  L + R+++E+NYML+YG+A  SL LL K
Sbjct  238   ILRGTRIAARLGFTISKETAHFLKNLSFLVQRLHRGRILLEMNYMLAYGSAEASLRLLWK  297

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + +LE+LLP  AAYL +   K+    S +L+ LF +LD+L++ ++P   SLW+ +LA H 
Sbjct  298   FGILEILLPIQAAYLVRTGFKRRDKRSNLLLSLFGNLDKLLAPDKPCHSSLWLTILALHK  357

Query  1256  TLVNNPQ-PKLVVLTLASVMYHRNWKQGVEFARQHVKAAS-----LYVPEISDSDGSMSE  1417
              L + P+ P +V     +V    +  + V+  R+  K  +     L  PE  DS   +  
Sbjct  358   ALADQPRYPSVVAAFSLAVHNGGDVLEAVKNTRKVTKPHNRSFFELLEPEEMDSQTLL--  415

Query  1418  DELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFV  1540
             DE+     ++   +  +TD   + +  + +  + +S +VF+
Sbjct  416   DEVMDFDSSIKEALGQMTDGRFISKAMAAYPQAPYSDMVFI  456



>ref|XP_006580624.1| PREDICTED: CCA tRNA nucleotidyltransferase 1, mitochondrial-like 
isoform X2 [Glycine max]
Length=368

 Score =   263 bits (671),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 149/303 (49%), Positives = 204/303 (67%), Gaps = 3/303 (1%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+++  G+  S I+  +  VLNVLKKKG   YLVGGCVRDLIL + PKDFD+IT+A 
Sbjct  67    WKKLNSKEIGLRNSMIAIPTKKVLNVLKKKGHDVYLVGGCVRDLILKQTPKDFDIITSAD  126

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   EIVG+RFPIC VH+ G++VEVSSF+T   K       +      P  C+
Sbjct  127   LKEVRKTFSLCEIVGKRFPICHVHMDGTIVEVSSFNTARCKSSMHFIYDDI--EAPHDCD  184

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D +RWRN L RDFTIN L +DP+   +YDY   M DI   K+RT++PA  SF EDCAR
Sbjct  185   KEDYLRWRNCLRRDFTINGLMFDPYARIVYDYMGGMEDIVKAKVRTVVPAATSFREDCAR  244

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS S ET  ++  LS SV+ LD+SRL+ME+NYML+YG+   SL LL +
Sbjct  245   ILRAIRIAARLGFSISRETAQSVKNLSYSVLRLDRSRLLMEINYMLAYGSGEASLRLLWR  304

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             + LL++LLPF AAY  +    ++   T++L+  FS++D+L++  RP   SL  + +   L
Sbjct  305   FGLLDILLPFQAAYFVRGGFRRRDKRTNLLLSFFSNVDKLLAPNRPCHSSLCSSYVTILL  364

Query  1256  TLV  1264
              L+
Sbjct  365   PLL  367



>ref|XP_006580623.1| PREDICTED: CCA tRNA nucleotidyltransferase 1, mitochondrial-like 
isoform X1 [Glycine max]
Length=369

 Score =   261 bits (668),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 199/291 (68%), Gaps = 3/291 (1%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL+++  G+  S I+  +  VLNVLKKKG   YLVGGCVRDLIL + PKDFD+IT+A 
Sbjct  67    WKKLNSKEIGLRNSMIAIPTKKVLNVLKKKGHDVYLVGGCVRDLILKQTPKDFDIITSAD  126

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E++K F   EIVG+RFPIC VH+ G++VEVSSF+T   K       +      P  C+
Sbjct  127   LKEVRKTFSLCEIVGKRFPICHVHMDGTIVEVSSFNTARCKSSMHFIYDDI--EAPHDCD  184

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
             + D +RWRN L RDFTIN L +DP+   +YDY   M DI   K+RT++PA  SF EDCAR
Sbjct  185   KEDYLRWRNCLRRDFTINGLMFDPYARIVYDYMGGMEDIVKAKVRTVVPAATSFREDCAR  244

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
             ILR +R+AARL FS S ET  ++  LS SV+ LD+SRL+ME+NYML+YG+   SL LL +
Sbjct  245   ILRAIRIAARLGFSISRETAQSVKNLSYSVLRLDRSRLLMEINYMLAYGSGEASLRLLWR  304

Query  1079  YNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESL  1228
             + LL++LLPF AAY  +    ++   T++L+  FS++D+L++  RP   SL
Sbjct  305   FGLLDILLPFQAAYFVRGGFRRRDKRTNLLLSFFSNVDKLLAPNRPCHSSL  355



>gb|KDO44047.1| hypothetical protein CISIN_1g014947mg [Citrus sinensis]
Length=415

 Score =   261 bits (667),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 158/355 (45%), Positives = 225/355 (63%), Gaps = 8/355 (2%)
 Frame = +2

Query  491   ILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDE  670
             +LNRIPKDFD+IT+A L E+ + F + EIVG+RFPIC VH   ++VEVSSF T    G  
Sbjct  1     MLNRIPKDFDIITSAELKEVVRVFSQCEIVGKRFPICHVHFENTIVEVSSFST---SGRR  57

Query  671   TKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKL  850
               R   +    P GC+E D IRWRN L RDFTIN L +DP+   IYDY   + DI+  K+
Sbjct  58    FSRDFKYEFERPIGCDEKDFIRWRNCLQRDFTINGLMFDPYAKIIYDYIGGIEDIRKAKV  117

Query  851   RTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNY  1030
             +T+IPA  SF+EDCARILR +R+AARL F FS ET   +  LSPS++ LD+ RL+ME+NY
Sbjct  118   QTVIPASTSFQEDCARILRAIRIAARLGFRFSRETAHFVKHLSPSILKLDRGRLLMEMNY  177

Query  1031  MLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCE  1207
             ML+YG+A  SL LL K+ LLEVLLP  AAYL +    ++   +++L+ LFS+LD+L++ +
Sbjct  178   MLAYGSAEASLRLLWKFGLLEVLLPIQAAYLVKHGFRRRDKRSNLLLSLFSNLDKLLAPD  237

Query  1208  RPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVP  1384
             RP   SLW+A+LAFH  L + P+  LVV   +  +Y+  +  + V+ AR+  K+      
Sbjct  238   RPCHSSLWIAILAFHKALSDQPRDPLVVAVFSLAVYNGGDMLEAVKIARRINKSHDESFC  297

Query  1385  EI---SDSDGSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFV  1540
             E+    D D    + E+    E+    ++ +TD   + +  + +S +  S LVF+
Sbjct  298   ELLEPRDLDFEALKHEVMDFAESSKGALSKMTDEYFVSQAMAGYSRAPFSDLVFI  352



>gb|EPS62980.1| hypothetical protein M569_11807, partial [Genlisea aurea]
Length=439

 Score =   260 bits (665),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 165/402 (41%), Positives = 233/402 (58%), Gaps = 35/402 (9%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL +   GI+ S+IS ++ VVLN LK+K                     DFDV+T+A 
Sbjct  2     WKKLKSEELGISSSKISRATRVVLNGLKRK---------------------DFDVVTSAE  40

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFV-PRMPKGC  715
             L E+ + F R  I+GRRFPIC VH+  ++VEVSSF T A +      K  F+ P  P GC
Sbjct  41    LKEVMRTFSRCVIIGRRFPICHVHVGDTIVEVSSFSTQAKRVG----KGWFLDPEKPAGC  96

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
             +E D +RWRN L RDFTIN L +DPF   +YDY   + DI+  K+RT+ PA LS  EDCA
Sbjct  97    DEKDYVRWRNCLQRDFTINGLMFDPFAKLVYDYLGGVNDIRKAKIRTIKPAILSLSEDCA  156

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR +R+AARL F FS ET TA+  LS SVM LD+ RL+MEVNYM +YG+   SL LL 
Sbjct  157   RILRAVRIAARLGFRFSRETATAVTALSQSVMRLDRDRLLMEVNYMFAYGSGEASLRLLW  216

Query  1076  KYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             K  LLE+LLP  AAY  +    ++    +ML+ LFS+LD+ ++ +RP   SLW A+LAFH
Sbjct  217   KLGLLEILLPIQAAYFVRHGFRRRDKRYNMLLALFSNLDRFLAPDRPCHSSLWFAVLAFH  276

Query  1253  LTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVPEISDSD------GSM  1411
               L   P+   V+   +  +++  +  + ++ A +  K  +   PEIS         G++
Sbjct  277   EALSERPREAKVIAAFSLAIHNGGDLPEAIDIALRIDKRHATGYPEISKPGNLLLHPGAL  336

Query  1412  SEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVF  1537
             S DE+     ++   +N +TD   +    +K+  + +   VF
Sbjct  337   S-DEVKSLAASVRTSLNRMTDECFVSRAMAKYPKAPYPAPVF  377



>gb|KHN31267.1| Putative poly(A) polymerase [Glycine soja]
Length=480

 Score =   261 bits (667),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 156/375 (42%), Positives = 219/375 (58%), Gaps = 26/375 (7%)
 Frame = +2

Query  452   FKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVE  631
             +  YLVGGCVRDLIL + PKDFD+IT+A L E+ + F  +EIVG+RFP+C VH+  ++VE
Sbjct  60    YDVYLVGGCVRDLILKKTPKDFDIITSAELKEVTRTFSWSEIVGKRFPVCHVHMDDTIVE  119

Query  632   VSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYD  811
             VSSFDT   K      + S     P GC + D +RW N L+RDFTIN L  DP+    YD
Sbjct  120   VSSFDTTKCKAG---MEFSHHIEAPSGCGKKDHLRWMNCLNRDFTINGLMLDPYARIAYD  176

Query  812   YANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVM  991
             Y   + DI+  K+RT+IPA+ SF+EDCARILR +R+AARL FS S ET   I  LS SV+
Sbjct  177   YFGGIEDIRKAKVRTVIPAETSFQEDCARILRAIRIAARLGFSISKETAHFIKNLSSSVL  236

Query  992   SLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMK  1171
             SLDK RL+ME+NYML++G+   SL LL K+ LL++LLPF +                   
Sbjct  237   SLDKGRLLMEMNYMLAFGSGEASLRLLWKFGLLDILLPFQS-------------------  277

Query  1172  LFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFA  1348
             LFS+LD+L++  RP   SLWV +LA H  L + P+  L V   +  +++  N  + V  A
Sbjct  278   LFSNLDKLLAPNRPCHNSLWVGILALHKALSDRPRNPLAVAAFSLAVHNGGNLLEAVSMA  337

Query  1349  RQHVKAASLYVPEISDS---DGSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSS  1519
                 K   +  PE+ D    D    E E+    E++   +  +T+   + +  + +  + 
Sbjct  338   GMINKPHDVRFPELLDPSGLDAEALEAEILDLAESVRGTILQMTNEYFVSQAMADYPQAP  397

Query  1520  HSGLVFVSNKMVKKI  1564
              S LVF+   +  K+
Sbjct  398   RSNLVFIPITLYVKV  412



>gb|KDO44048.1| hypothetical protein CISIN_1g014947mg [Citrus sinensis]
Length=356

 Score =   256 bits (655),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 157/359 (44%), Positives = 226/359 (63%), Gaps = 8/359 (2%)
 Frame = +2

Query  491   ILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDE  670
             +LNRIPKDFD+IT+A L E+ + F + EIVG+RFPIC VH   ++VEVSSF T    G  
Sbjct  1     MLNRIPKDFDIITSAELKEVVRVFSQCEIVGKRFPICHVHFENTIVEVSSFST---SGRR  57

Query  671   TKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKL  850
               R   +    P GC+E D IRWRN L RDFTIN L +DP+   IYDY   + DI+  K+
Sbjct  58    FSRDFKYEFERPIGCDEKDFIRWRNCLQRDFTINGLMFDPYAKIIYDYIGGIEDIRKAKV  117

Query  851   RTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNY  1030
             +T+IPA  SF+EDCARILR +R+AARL F FS ET   +  LSPS++ LD+ RL+ME+NY
Sbjct  118   QTVIPASTSFQEDCARILRAIRIAARLGFRFSRETAHFVKHLSPSILKLDRGRLLMEMNY  177

Query  1031  MLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-DKQSSDTSMLMKLFSSLDQLVSCE  1207
             ML+YG+A  SL LL K+ LLEVLLP  AAYL +    ++   +++L+ LFS+LD+L++ +
Sbjct  178   MLAYGSAEASLRLLWKFGLLEVLLPIQAAYLVKHGFRRRDKRSNLLLSLFSNLDKLLAPD  237

Query  1208  RPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKAASLYVP  1384
             RP   SLW+A+LAFH  L + P+  LVV   +  +Y+  +  + V+ AR+  K+      
Sbjct  238   RPCHSSLWIAILAFHKALSDQPRDPLVVAVFSLAVYNGGDMLEAVKIARRINKSHDESFC  297

Query  1385  EI---SDSDGSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKM  1552
             E+    D D    + E+    E+    ++ +TD   + +  + +S +  S L   ++K+
Sbjct  298   ELLEPRDLDFEALKHEVMDFAESSKGALSKMTDEYFVSQAMAGYSRAPFSDLYHSASKL  356



>ref|XP_010066436.1| PREDICTED: uncharacterized protein LOC104453547 isoform X2 [Eucalyptus 
grandis]
Length=539

 Score =   262 bits (670),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 163/425 (38%), Positives = 243/425 (57%), Gaps = 35/425 (8%)
 Frame = +2

Query  356   NWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTA  535
              W+KL +   GI  S IS  + VVLN LKKKG++ YLVGGCVRDLIL R PKDFD+IT+A
Sbjct  70    QWKKLSSVELGIRSSMISKPTRVVLNALKKKGYEVYLVGGCVRDLILKRTPKDFDIITSA  129

Query  536   RLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
              L +++  F R E++GRRFPIC VH+  +++EVSSF T         R N    + P GC
Sbjct  130   ELKQVRNTFSRCEVIGRRFPICHVHVDETIIEVSSFSTSGRNSFGGLRNNV---KRPPGC  186

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
              E D +RW+N L RDFT+N LF+DP+   IYDY   M DIK  K+RT+IPA LSF EDCA
Sbjct  187   GERDFMRWKNCLKRDFTVNGLFFDPYAKIIYDYVGGMEDIKKAKVRTVIPANLSFVEDCA  246

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKS-----------------RLMMEV  1024
             RILR  R+A+RL F F+ E   ++  L  SV+ LDK+                  ++ME+
Sbjct  247   RILRAFRVASRLGFRFTREIALSLRVLYRSVLRLDKNSHGGELYVGIWIRGSFFEIVMEI  306

Query  1025  NYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSC  1204
              +       +PS+  L ++     L P     +++ A K  + + ++  LF+SLD++V  
Sbjct  307   -WTSRIAFTLPSMQSLSRH---RTLFP----NVSRDAIKDQTCSWLVWSLFASLDKVVGP  358

Query  1205  ERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWK--QGVEFARQHVKAASLY  1378
             +RP   SLW+A+LAFH  LV+ P+  L+V    S+  H +    + +E AR   +     
Sbjct  359   DRPCHSSLWLAILAFHKALVDKPRDPLIVAAF-SIALHSSGSLLEAIEIARGINQPHDSS  417

Query  1379  VPEISDSDGSMSEDELAKRVENMAVQV-NMLTDADNLREVT---SKFSGSSHSGLVFVSN  1546
               E+ +S   +S+  +   V ++A  + ++L    ++R V+   S +  +  + LVFV  
Sbjct  418   YMELQESPVLLSKLAMRDEVVDLAASIKDILFKMTSVRYVSQAMSMYPQAPRTDLVFVPE  477

Query  1547  KMVKK  1561
              ++++
Sbjct  478   ALLQR  482



>ref|XP_010066435.1| PREDICTED: uncharacterized protein LOC104453547 isoform X1 [Eucalyptus 
grandis]
Length=540

 Score =   262 bits (670),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 163/425 (38%), Positives = 243/425 (57%), Gaps = 35/425 (8%)
 Frame = +2

Query  356   NWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTA  535
              W+KL +   GI  S IS  + VVLN LKKKG++ YLVGGCVRDLIL R PKDFD+IT+A
Sbjct  71    QWKKLSSVELGIRSSMISKPTRVVLNALKKKGYEVYLVGGCVRDLILKRTPKDFDIITSA  130

Query  536   RLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
              L +++  F R E++GRRFPIC VH+  +++EVSSF T         R N    + P GC
Sbjct  131   ELKQVRNTFSRCEVIGRRFPICHVHVDETIIEVSSFSTSGRNSFGGLRNNV---KRPPGC  187

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
              E D +RW+N L RDFT+N LF+DP+   IYDY   M DIK  K+RT+IPA LSF EDCA
Sbjct  188   GERDFMRWKNCLKRDFTVNGLFFDPYAKIIYDYVGGMEDIKKAKVRTVIPANLSFVEDCA  247

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKS-----------------RLMMEV  1024
             RILR  R+A+RL F F+ E   ++  L  SV+ LDK+                  ++ME+
Sbjct  248   RILRAFRVASRLGFRFTREIALSLRVLYRSVLRLDKNSHGGELYVGIWIRGSFFEIVMEI  307

Query  1025  NYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSC  1204
              +       +PS+  L ++     L P     +++ A K  + + ++  LF+SLD++V  
Sbjct  308   -WTSRIAFTLPSMQSLSRH---RTLFP----NVSRDAIKDQTCSWLVWSLFASLDKVVGP  359

Query  1205  ERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWK--QGVEFARQHVKAASLY  1378
             +RP   SLW+A+LAFH  LV+ P+  L+V    S+  H +    + +E AR   +     
Sbjct  360   DRPCHSSLWLAILAFHKALVDKPRDPLIVAAF-SIALHSSGSLLEAIEIARGINQPHDSS  418

Query  1379  VPEISDSDGSMSEDELAKRVENMAVQV-NMLTDADNLREVT---SKFSGSSHSGLVFVSN  1546
               E+ +S   +S+  +   V ++A  + ++L    ++R V+   S +  +  + LVFV  
Sbjct  419   YMELQESPVLLSKLAMRDEVVDLAASIKDILFKMTSVRYVSQAMSMYPQAPRTDLVFVPE  478

Query  1547  KMVKK  1561
              ++++
Sbjct  479   ALLQR  483



>ref|XP_008464384.1| PREDICTED: uncharacterized protein LOC103502286 isoform X2 [Cucumis 
melo]
Length=461

 Score =   259 bits (662),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 164/473 (35%), Positives = 236/473 (50%), Gaps = 86/473 (18%)
 Frame = +2

Query  356   NWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTA  535
             NW++  + H GI  S I   +  VLN LKK G++ YLVGGCVRDLIL+R PKDFD+IT+A
Sbjct  58    NWKRFSSNHLGIVTSMIPKPTRKVLNGLKKAGYEVYLVGGCVRDLILDRPPKDFDIITSA  117

Query  536   RLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
             +L E+ + F   EIVGRRFPIC VHI G++VEVSSF T +   D  +  NS        C
Sbjct  118   QLKEVSRIFLWCEIVGRRFPICHVHIDGTIVEVSSFSTSSKPFD--RHLNSAAIEKSMNC  175

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
              E D +RW+N L RDFTIN + YDP+   +YDY   M DI+  K+RT++PA  SF+EDC 
Sbjct  176   EEIDFVRWKNCLQRDFTINGMMYDPYNNVVYDYLGGMEDIRQAKVRTVVPACTSFQEDC-  234

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
                                                                A  SL LL 
Sbjct  235   ---------------------------------------------------AEASLRLLW  243

Query  1076  KYNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFH  1252
             KY LLE+LLP  AAY  +   ++S+  S ML+ LFSSLD+L++  RP   SLWVA+LA H
Sbjct  244   KYGLLEILLPIQAAYFIRNGFRRSNKRSNMLLSLFSSLDKLLAPNRPCHSSLWVAVLALH  303

Query  1253  LTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKA--ASLY-VPEISDSDGSMSED  1420
             + L + P+  LVV T    +++  N  + +  A+   +A  A+ Y + E  + +     D
Sbjct  304   VALSDQPRSPLVVATFGLAVHNGGNMMEAISIAKSINRAHNANFYELLEPQNMEVQALID  363

Query  1421  ELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTND  1600
             E+     ++ V ++ +TD   +      +  +  S LVF+   +V  + V ++F  +   
Sbjct  364   EVMDLTTSVKVALHKMTDEHFVSLALESYPQAPASDLVFI--PLVVYLKVCKIFECVVEG  421

Query  1601  VTSLNEKSCSLKIQNPSPQKGTAHKKGN--------GIAHETRFLLSKIILDT  1735
                               ++G   K+G         G   E R + ++I+ DT
Sbjct  422   A-----------------ERGFVPKRGKINYECLALGNVPELRHVFARIVFDT  457



>ref|XP_010100048.1| putative poly(A) polymerase [Morus notabilis]
 gb|EXB81219.1| putative poly(A) polymerase [Morus notabilis]
Length=487

 Score =   248 bits (632),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 149/401 (37%), Positives = 213/401 (53%), Gaps = 55/401 (14%)
 Frame = +2

Query  359   WRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTAR  538
             W+KL ++  GI  S I   + ++L+ L++KG++ YLVGGCVRDLIL R PKDFD+IT+A 
Sbjct  72    WKKLSSKELGIKMSSIPKPTRLILSGLRQKGYEVYLVGGCVRDLILKRTPKDFDIITSAE  131

Query  539   LNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCN  718
             L E+KK F R EIVG+RFPIC VH+  + VEVSSF T       +K+ +S   R P GCN
Sbjct  132   LKEVKKTFLRCEIVGKRFPICHVHVNDATVEVSSFSTCERHS--SKKFDSL--RRPPGCN  187

Query  719   ESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCar  898
               D IRWRN L RDFTIN L +DPF   +YDY   + DI+  K+RT+IPA +SF EDC  
Sbjct  188   RHDYIRWRNCLQRDFTINGLMFDPFDKIVYDYMGGIRDIRKSKMRTVIPANISFAEDC--  245

Query  899   ilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQK  1078
                        K     E   +IW     V       ++ME+     +   VPS      
Sbjct  246   ----------GKDPHGNELYASIWVFGGIV------EVIMEI-----WAPRVPS------  278

Query  1079  YNLLEVLLPFHAAYLTQQADKQSSDTS-MLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
                            T+   ++  ++S ML+ LFS+LD+ V+  +P   SLW+A+LAFH 
Sbjct  279   ---------------TRPGFRRRDESSNMLLSLFSNLDKYVAPNQPCHSSLWIAILAFHK  323

Query  1256  TLVNNPQPKLVVLTLA-SVMYHRNWKQGVEFARQHVKAASLYVPEISDS-DGSMSEDELA  1429
              L + P+  LV+   + +V    +  + VE  R   +   +   EI +    + S++ L 
Sbjct  324   ALYDKPRDPLVIAAFSLAVSNGGSLPEAVEIVRTMSQPHVMTFHEILEPVTTTRSKNALI  383

Query  1430  KRVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLVFV  1540
               V ++A  V      +TD D + +   KF  +  S LVF+
Sbjct  384   NEVVDLAASVKAMLRKMTDPDYVSQAMMKFRKAPCSDLVFI  424



>dbj|BAA97232.1| unnamed protein product [Arabidopsis thaliana]
Length=499

 Score =   245 bits (626),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 177/509 (35%), Positives = 266/509 (52%), Gaps = 63/509 (12%)
 Frame = +2

Query  257   KFNQTSAG-------DGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGSRISPS  415
             +FN  +A        DG   +S  DR    + +P   E   W++L+++  G++ S I+ S
Sbjct  28    RFNTVAAAIETMDESDGFATDS--DRQDKVSDEPRDRE---WKQLNSKDLGLSSSMIAKS  82

Query  416   SWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFP  595
             +  VLN LK KG   YLVGGCVRDLIL R PKDFD++T+A L                  
Sbjct  83    TRKVLNGLKSKGHDVYLVGGCVRDLILKRTPKDFDILTSAELR-----------------  125

Query  596   ICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINS  775
                        EVSSF T A       R          G  + D IR  N L RDFTIN 
Sbjct  126   -----------EVSSFSTSAQNSSRNTRTECKESSGSDG--DEDCIRLNNCLQRDFTING  172

Query  776   LFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMET  955
             L +DP+   +YDY   M DI+  K+RT+I A  SF +DCARILR +R+AARL F  S ET
Sbjct  173   LMFDPYAKVVYDYLGGMEDIRKAKVRTVIHAGTSFHQDCARILRAIRIAARLGFRMSKET  232

Query  956   ETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA  1135
                I  LS  V  LDK R++ME+NYML+YG+A  SL LL K+ +LE+LLP  AAYL +  
Sbjct  233   AHFIKNLSLLVQRLDKGRILMEMNYMLAYGSAEASLRLLWKFGILEILLPIQAAYLARSG  292

Query  1136  -DKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVM  1312
               ++   T+ML+ LF++LD+L++ +RP   SLW+A+LAFH  L + P+  +VV   +  +
Sbjct  293   FRRRDKRTNMLLSLFANLDKLLAPDRPCHSSLWIAILAFHKALADKPRSPIVVAAFSLAV  352

Query  1313  YH-RNWKQGVE----FARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQVNMLTDA  1477
             ++  +  + VE      R H K+    V    + D     DE+     ++   +N +TDA
Sbjct  353   HNCGDILEAVEITKKITRPHDKSFFELVEPEENLDFQTLLDEVMDLDASIEDALNQMTDA  412

Query  1478  DNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQ  1657
               + +  S +  + +S LVF+  ++  +     +F  + N+ T +  ++          +
Sbjct  413   YFISKAMSAYPQAPYSDLVFIPLQLYLR--AGRIFDCVKNEETRIGFEA----------K  460

Query  1658  KGTAHKKG---NGIAHETRFLLSKIILDT  1735
             +G+  + G   +G   E R + ++++ DT
Sbjct  461   QGSKIEYGSLNSGYFPEIRHVFARVVFDT  489



>gb|EMS63215.1| putative poly(A) polymerase [Triticum urartu]
Length=407

 Score =   240 bits (613),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 142/297 (48%), Positives = 186/297 (63%), Gaps = 14/297 (5%)
 Frame = +2

Query  338   GKIEFSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDF  517
             G  +   W+K+ A+ FG   S I   +W VL+ L+ +G+  YLVGGCVRDLI+ +IPKDF
Sbjct  62    GDADGPEWKKVSAKRFGYKESMIPDEAWNVLHQLRSRGYDVYLVGGCVRDLIMKKIPKDF  121

Query  518   DVITTARLNEIKKQFY-RAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFV  694
             D+ITTA L ++K  F   A IVGRRFPI  VH   S+VEVSSF+T        +   S  
Sbjct  122   DIITTADLRQVKDTFVGSAVIVGRRFPIVHVHDNNSIVEVSSFNTYVRGSTGNQMPTSKS  181

Query  695   PRMPKGCNESDVIRWRNSLHRDFTINSL--------FYDPFVYQIYDYANAMADIKSQKL  850
             P     C+++D +RW+N   RDFTIN L        F+     +IYDY   + DIK  K+
Sbjct  182   PH----CSKNDYLRWKNCQGRDFTINGLVFLYMITGFHTASCEKIYDYLGGIEDIKKAKV  237

Query  851   RTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNY  1030
             RT+IPA  SF EDCARILR +R+AARL FSF  ET   +  L+ SV  LDK RL+MEVNY
Sbjct  238   RTVIPAATSFHEDCARILRAIRIAARLGFSFPKETAYYVRNLACSVARLDKGRLLMEVNY  297

Query  1031  MLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSD-TSMLMKLFSSLDQLV  1198
             ML+YG+A  SL LL ++ LLE LLPF AAY +    K+  + T+ML++ +   + LV
Sbjct  298   MLAYGSAEASLRLLWRFGLLEHLLPFQAAYFSSTLFKRKDNGTNMLLQSYHHQELLV  354



>gb|EYU32917.1| hypothetical protein MIMGU_mgv1a007724mg [Erythranthe guttata]
Length=397

 Score =   236 bits (603),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 164/406 (40%), Positives = 231/406 (57%), Gaps = 32/406 (8%)
 Frame = +2

Query  554   KQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVI  733
             + F R E++GRRFPIC VHI  ++VEVSSF T A K     R+ SF P  P GC E D  
Sbjct  2     RTFSRCEMIGRRFPICHVHIDDTIVEVSSFSTRATK---FGRELSFDPERPDGCEERDYA  58

Query  734   RWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrgl  913
             RW+N L RDFTIN L +DP+   +YDY   + DI+  K+RT+ PA LS  EDCARILR +
Sbjct  59    RWKNCLQRDFTINGLMFDPYAKLVYDYIGGVNDIRKAKVRTIKPANLSLTEDCARILRAV  118

Query  914   rlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLE  1093
             R+AARL F  S ET  AI KLS SV+ LD+ RL+MEVNYM++YG+A  SL LL K  LLE
Sbjct  119   RIAARLGFGLSRETALAIKKLSTSVLRLDRGRLLMEVNYMMAYGSAEASLRLLWKLGLLE  178

Query  1094  VLLPFHAAYLT----QQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTL  1261
             +LLP  AAY      ++ DKQ    +ML+ LFS+LD+L++ +RP   SLW +LLAFH  L
Sbjct  179   ILLPIQAAYFVGSGFRRRDKQ---YNMLLSLFSNLDKLLAPDRPCHTSLWFSLLAFHEAL  235

Query  1262  VNNPQPKLVVLTLA-SVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRV  1438
                P+  LVV   +  V    +  + +  AR+  K   +   E+++S   +  D+L   V
Sbjct  236   SEVPRDPLVVAAFSLGVHNGGDLSEALSIARRINKQHDISFQELTESK-YIDSDKLLAEV  294

Query  1439  ENMAVQV----NMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVT  1606
              ++A  V      +TD  ++ +  +++  + +S LVF    M   + V ++F      V 
Sbjct  295   RSLAASVQSALTRMTDEYSVSQAMAQYPKAPYSDLVFFP--MALYLRVRKIFEC----VK  348

Query  1607  SLNEKSCSLKIQNPSPQKGTA---HKKGNGIAHETRFLLSKIILDT  1735
             S  E+          P+ G+       G G   E R + ++++ DT
Sbjct  349   SGRERGF-------VPKHGSKIDYELLGMGSLREVRHVFARVVFDT  387



>gb|KDO44049.1| hypothetical protein CISIN_1g014947mg [Citrus sinensis]
Length=268

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 160/236 (68%), Gaps = 3/236 (1%)
 Frame = +2

Query  491   ILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDE  670
             +LNRIPKDFD+IT+A L E+ + F + EIVG+RFPIC VH   ++VEVSSF T    G  
Sbjct  1     MLNRIPKDFDIITSAELKEVVRVFSQCEIVGKRFPICHVHFENTIVEVSSFST---SGRR  57

Query  671   TKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKL  850
               R   +    P GC+E D IRWRN L RDFTIN L +DP+   IYDY   + DI+  K+
Sbjct  58    FSRDFKYEFERPIGCDEKDFIRWRNCLQRDFTINGLMFDPYAKIIYDYIGGIEDIRKAKV  117

Query  851   RTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNY  1030
             +T+IPA  SF+EDCARILR +R+AARL F FS ET   +  LSPS++ LD+ RL+ME+NY
Sbjct  118   QTVIPASTSFQEDCARILRAIRIAARLGFRFSRETAHFVKHLSPSILKLDRGRLLMEMNY  177

Query  1031  MLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLV  1198
             ML+YG+A  SL LL K+ LLEVLLP  AAYL +   ++    S L+ + S+   L+
Sbjct  178   MLAYGSAEASLRLLWKFGLLEVLLPIQAAYLVKHGFRRRDKRSNLLLVISTYLLLI  233



>gb|KHN23951.1| Poly(A) polymerase [Glycine soja]
Length=379

 Score =   230 bits (587),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 141/328 (43%), Positives = 190/328 (58%), Gaps = 23/328 (7%)
 Frame = +2

Query  452   FKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVE  631
             +  YLVGGCV DLIL + PKDFDV  T         F   EIVG+RFP+C VHI  ++VE
Sbjct  47    YDVYLVGGCVWDLILKQTPKDFDVTRT---------FSLCEIVGKRFPVCHVHIDDTIVE  97

Query  632   VSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYD  811
             VSSFDT   K      + S     P GC++ D +RW N L+RDFTIN L  DP+   +YD
Sbjct  98    VSSFDTTKCKA---GMEFSHHIEAPNGCDKKDQLRWMNCLNRDFTINGLMLDPYARIVYD  154

Query  812   YANAMADIKSQKL---------RTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETA  964
             Y   + DI+  K+         RT+IP + SF+EDCA ILR +R+AARL FS S ET   
Sbjct  155   YFGGIEDIRKAKMCMYLISSVVRTVIPTETSFQEDCAGILRAIRIAARLGFSISKETAHF  214

Query  965   IWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQ  1144
             I  LS SV+SLDK RL+ME+NYML+YG+   SL LL K  LL++LLPF + + +   +  
Sbjct  215   IKNLSSSVLSLDKGRLLMEMNYMLAYGSGEASLRLLWKSGLLDILLPFQSLF-SNLDNLL  273

Query  1145  SSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH-R  1321
             + +   L+ LFS LD+L++  RP + SLWV +LA H  L +  +  L V   +  +++  
Sbjct  274   TPNRPFLLDLFSKLDKLLAPNRPCQNSLWVGILALHKALSDRLRDPLAVAAFSLAVHNGG  333

Query  1322  NWKQGVEFARQHVKAASLYVPEISDSDG  1405
             N  + +       K      PE+ D  G
Sbjct  334   NLLEAINITGMINKPHDARFPELLDPSG  361



>ref|XP_001759217.1| predicted protein [Physcomitrella patens]
 gb|EDQ75901.1| predicted protein [Physcomitrella patens]
Length=583

 Score =   231 bits (588),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 149/370 (40%), Positives = 215/370 (58%), Gaps = 43/370 (12%)
 Frame = +2

Query  362   RKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARL  541
             R L     G+    I  SSW VL  L   G+++YLVGG VRD+++ ++PKDFD++TTA  
Sbjct  79    RILKKDEHGLRDKLIPASSWRVLTRLLDAGYRSYLVGGSVRDMLVKQVPKDFDILTTAEP  138

Query  542   NEIKKQFY-RAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRM-PKGC  715
              ++K  F  R  IVGRRFP+C V    +VVEVSSF T  N G+   ++ ++ P +  +G 
Sbjct  139   KQVKAAFSGRCIIVGRRFPVCHVTSLNTVVEVSSFST--NSGN--IKRITYEPVVGTEGW  194

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
             +E D  RW NSL RDFT+N + YDPF   IYDY   + D++  K+RT+IPA  SFEED A
Sbjct  195   SEDDFSRWDNSLRRDFTVNGIMYDPFKCIIYDYVGGLRDLRRCKIRTVIPALESFEEDSA  254

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
             RILR +R+AARL+FSF+  T  AI +L  S+++L+K+RL +EVN M++YG++  S+ LL 
Sbjct  255   RILRAIRIAARLEFSFATSTANAIRQLKSSILTLNKTRLQLEVNTMMAYGSSERSVRLLW  314

Query  1076  KYNLLEVLLPFHAA---------YLTQQADKQSSDTSMLM--------------------  1168
             +Y +LE LLPF A          +      +Q+  + +L+                    
Sbjct  315   RYGVLEYLLPFQARQHFGLLARYFSNTNLKRQARRSDILLIIFKAQSVCLVIYLVFFRSA  374

Query  1169  -----KLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQ  1333
                  KL ++LD++ +  RP    LWVA+LAFHL LV  P    V  T+A  +   ++  
Sbjct  375   FVAIQKLLANLDKVTAPNRPCHGGLWVAILAFHLALVERPWSLTVGPTVALAL---SFGT  431

Query  1334  GVEFARQHVK  1363
             G+E A   V+
Sbjct  432   GLEKAITQVQ  441



>gb|EEE60916.1| hypothetical protein OsJ_14629 [Oryza sativa Japonica Group]
Length=555

 Score =   228 bits (581),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 160/431 (37%), Positives = 230/431 (53%), Gaps = 39/431 (9%)
 Frame = +2

Query  341   KIEFSNWRKLDARHFGITGSRISPSSWVVLNV------LKKKGFKAYLVGGCVRDLILNR  502
             K ++  W+    R F I G   +P +  + +       +KK   +  +  G         
Sbjct  81    KNDYIRWKNCQGRDFTINGLMFNPYAEKIYDYFGGIEDIKKAKVRTVIPAG-------TS  133

Query  503   IPKDFD----VITTARLNEIKKQFY-RAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGD  667
               +D +    V+T   L E+K  F   A IVGRRFPIC V+   S+VEVSSF+T A    
Sbjct  134   FQEDCEGGSVVLTLIFLAEVKDTFSGSAVIVGRRFPICHVYENNSIVEVSSFNTYARGST  193

Query  668   ETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQK  847
               +   S  P     C+++D IRW+N   RDFTIN L ++P+  +IYDY   + DIK  K
Sbjct  194   SNQIYTSKSPH----CSKNDYIRWKNCQGRDFTINGLMFNPYAEKIYDYFGGIEDIKKAK  249

Query  848   LRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVN  1027
             +RT+IPA  SF+EDCARILR +R+AARL F+F  ET   +  L+ SV  LDK R++ME+N
Sbjct  250   VRTVIPAGTSFQEDCARILRAIRIAARLGFNFPKETAYYVRTLACSVARLDKGRILMEIN  309

Query  1028  YMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQ-QADKQSSDTSMLMKLFSSLDQLVSC  1204
             YML+YG+A  SL LL ++ LLE LLPF AAY +  +  ++   T+ML+ LFS LD  ++ 
Sbjct  310   YMLAYGSAEASLRLLWRFGLLEHLLPFQAAYFSSTRFKRKDKGTNMLLVLFSKLDNFLAP  369

Query  1205  ERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRN-----WKQGVEFARQHVKAA  1369
              RP   SLW+++LA H  LV  P+  LVV T A  +Y           G    RQH    
Sbjct  370   NRPCHNSLWISILALHEALVRQPRDPLVVATFALALYLGGDMSLALDIGKSINRQHNTGF  429

Query  1370  S-LYVPEISDSDGSMSEDELAKRVENMAVQVNM----LTDADNLREVTSKFSGSSHSGLV  1534
             S L  P++ D      +  L   V+++AV +      +TD   +    +K   +  S LV
Sbjct  430   SELLEPQVWD------DKHLVGEVQSLAVSMRRALTEMTDEYFVANAMAKIPQAPSSDLV  483

Query  1535  FVSNKMVKKIV  1567
             F+  +   K++
Sbjct  484   FIPLQAYLKVL  494


 Score =   112 bits (281),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 70/108 (65%), Gaps = 4/108 (4%)
 Frame = +2

Query  569  AEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNS  748
            A IVGRRFPIC V+   S+VEVSSF+T A      +   S  P     C+++D IRW+N 
Sbjct  35   AVIVGRRFPICHVYENNSIVEVSSFNTYARGSTSNQIYTSKSPH----CSKNDYIRWKNC  90

Query  749  LHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
              RDFTIN L ++P+  +IYDY   + DIK  K+RT+IPA  SF+EDC
Sbjct  91   QGRDFTINGLMFNPYAEKIYDYFGGIEDIKKAKVRTVIPAGTSFQEDC  138



>dbj|BAJ92580.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=340

 Score =   219 bits (559),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 144/337 (43%), Positives = 193/337 (57%), Gaps = 31/337 (9%)
 Frame = +2

Query  569   AEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNS  748
             A IVGRRFPI  VH   S+VEVSSF+T        +   S  P     C+++D +RW+N 
Sbjct  9     AVIVGRRFPIVHVHDNNSIVEVSSFNTYVRGSSGNQMPASKSPH----CSKNDYLRWKNC  64

Query  749   LHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaar  928
               RDFTIN L ++P+  +IYDY   + DIK  K+RT+IPA  SF EDCARILR +R+AAR
Sbjct  65    QGRDFTINGLMFNPYSEKIYDYLGGIEDIKKAKVRTVIPAATSFHEDCARILRAIRIAAR  124

Query  929   lKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPF  1108
             L FSF  ET   +  L+ SV  LDK RL+MEVNYML+YG+A  SL LL ++ LLE LLPF
Sbjct  125   LGFSFPKETAYYVRNLACSVARLDKGRLLMEVNYMLAYGSAEASLRLLWRFGLLEHLLPF  184

Query  1109  HAAYLTQQADKQSSD-TSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKL  1285
              AAY +    K+  + T+ML+ LFS LD  ++  RP   SLW+++LAFH  LV  P+  L
Sbjct  185   QAAYFSSTLFKRKDNGTNMLLVLFSKLDSFLAPNRPCHNSLWISILAFHEALVRKPRDPL  244

Query  1286  VVLTLASVMYHRN-----WKQGVEFARQHVKAAS-LYVPEISDSDGSMSEDELAKRVENM  1447
             VV T A  +Y           G    RQH    S L  P +    G ++E      V+++
Sbjct  245   VVATFALAVYLGGDLPLAVDIGQSINRQHDAGFSELLEPRVRGKKGLLAE------VKDL  298

Query  1448  AVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVK  1558
             A+ +        L E+T ++         +V+N M K
Sbjct  299   AISMR-----QALTEMTDEY---------YVANAMAK  321



>emb|CAN80033.1| hypothetical protein VITISV_007071 [Vitis vinifera]
Length=693

 Score =   225 bits (574),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 139/307 (45%), Positives = 168/307 (55%), Gaps = 90/307 (29%)
 Frame = +2

Query  350   FSNWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVIT  529
              S W+KLD+R FGIT S IS  SW VL +L+++GF+AYLVGGCVRDLILN+ PKDFDVIT
Sbjct  1     MSKWKKLDSRTFGITRSMISSPSWFVLKLLQREGFEAYLVGGCVRDLILNKTPKDFDVIT  60

Query  530   TARLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPK  709
             TA+L +IKK+F RA+IVGRRFPICRVH++GSV+EVSSF+TVA  G+E K K SF  +MP 
Sbjct  61    TAKLKQIKKRFRRAQIVGRRFPICRVHVKGSVIEVSSFETVAKHGEE-KEKVSF-SQMPS  118

Query  710   GCNESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTL-IPAQLSFEE  886
             GC+ESD  RWRN                               S+ LR L I A+L    
Sbjct  119   GCDESDFNRWRN-------------------------------SRMLRGLRIAARLG---  144

Query  887   DCarilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLC  1066
                              SFS ETETAI  L+ SV SLDK                     
Sbjct  145   ----------------LSFSRETETAIRSLASSVKSLDK---------------------  167

Query  1067  LLQKYNLLEVLLPFHAAYLTQQADKQSSDTSML-MKLFSSLDQLVSCERPARESLWVALL  1243
                             AYL QQ  + S+  SM+ MKLF +LD+LV+C+RP   SLW    
Sbjct  168   ---------------GAYLAQQTTEPSAQHSMMFMKLFFNLDKLVTCDRPCDCSLWAGXE  212

Query  1244  AFHLTLV  1264
                L LV
Sbjct  213   EERLDLV  219


 Score =   102 bits (255),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 92/183 (50%), Gaps = 24/183 (13%)
 Frame = +2

Query  1229  WVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPEISDSDGS  1408
             WV LLAFH+ LVN PQ   VV TL+SV+YH  W +GV+FAR+H  A   + PEI     S
Sbjct  343   WVGLLAFHMALVNKPQDASVVWTLSSVLYHGKWTEGVKFARKHALAPISFSPEILVECDS  402

Query  1409  MSEDELAKRVENMAVQVNML----TDADNLREVTSKFSGSSHSGL----------VFVSN  1546
              S++ELA+RV  +A  V       T   +L    S +     +GL          VFV  
Sbjct  403   KSDEELAERVSELASLVQDCAISSTKTGDLSASMSDYPDYPCTGLLIWLKNVVLQVFVQK  462

Query  1547  KMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKII  1726
             +M +++    +F +L N + S  E   S  I          +  G G   ETRF+L K+I
Sbjct  463   RMAERVA--HIFNVLVNGIESYEEGRESPDID--------YYLLGKGDLRETRFVLGKVI  512

Query  1727  LDT  1735
             +DT
Sbjct  513   MDT  515



>dbj|BAJ87006.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   217 bits (553),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 152/397 (38%), Positives = 210/397 (53%), Gaps = 34/397 (9%)
 Frame = +2

Query  584   RRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDF  763
             RRFPI  VH   S+VEVSSF+T        +   S  P     C+++D +RW+N   RDF
Sbjct  1     RRFPIVHVHDNNSIVEVSSFNTYVRGSSGNQMPASKSPH----CSKNDYLRWKNCQGRDF  56

Query  764   TINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSF  943
             TIN L ++P+  +IYDY   + DIK  K+RT+IPA  SF EDCARILR +R+AARL FSF
Sbjct  57    TINGLMFNPYSEKIYDYLGGIEDIKKAKVRTVIPAATSFHEDCARILRAIRIAARLGFSF  116

Query  944   SMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYL  1123
               ET   +  L+ SV  LDK RL+MEVNYML+YG+A  SL LL ++ LLE LLPF AAY 
Sbjct  117   PKETAYYVRNLACSVARLDKGRLLMEVNYMLAYGSAEASLRLLWRFGLLEHLLPFQAAYF  176

Query  1124  TQQADKQSSD-TSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTL  1300
             +    K+  + T+ML+ LFS LD  ++  RP   SLW+++LAFH  LV  P+  LVV T 
Sbjct  177   SSTLFKRKDNGTNMLLVLFSKLDSFLAPNRPCHNSLWISILAFHEALVRKPRDPLVVATF  236

Query  1301  ASVMYHRN-----WKQGVEFARQHVKAAS-LYVPEISDSDGSMSEDELAKRVENMAVQVN  1462
             A  +Y           G    RQH    S L  P +    G ++E      V+++A+ + 
Sbjct  237   ALAVYLGGDLPLAVDIGQSINRQHDAGFSELLEPRVRGKKGLLAE------VKDLAISMR  290

Query  1463  M----LTDADNLREVTSKFSGSSHSGLVFVSNKMVKKI--VVEEVFGILTNDVTSLNEKS  1624
                  +TD   +    +K   +  S LVF+  +   K+  +VE V               
Sbjct  291   QALTEMTDEYYVANAMAKIPQAPSSDLVFIPLQAYLKVLKLVERV-----------QHGK  339

Query  1625  CSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
               +  +  S      +   NG   E R L + ++ DT
Sbjct  340   KEIGYEPKSDGNIDYYNLANGTPAEVRNLFTLVVFDT  376



>gb|KDO71448.1| hypothetical protein CISIN_1g005593mg [Citrus sinensis]
Length=437

 Score =   214 bits (544),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 162/255 (64%), Gaps = 21/255 (8%)
 Frame = +2

Query  974   LSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSD  1153
             LS S+  LDKSR+MME+NYMLSYGAA  S+CLL++YNLL++LLPFHAAYL QQA K +++
Sbjct  4     LSSSIERLDKSRIMMELNYMLSYGAAESSICLLRRYNLLKILLPFHAAYLDQQAGKITAE  63

Query  1154  TSM-LMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWK  1330
               M LM+LF +LD+LVSC+RPA  +LWV LL+FH  LV++PQ   VV   ASV+YH  WK
Sbjct  64    NPMMLMRLFFNLDKLVSCDRPADYTLWVGLLSFHQALVSDPQDAFVVWVFASVLYHGKWK  123

Query  1331  QGVEFARQHVKAASLYVPEISDSDGSMSEDELAKRVENMAVQVNMLTDADNLREVTSKFS  1510
             +GV+FAR   K    +VPEIS      S+++LA +V  +A+ V      D + ++T    
Sbjct  124   EGVKFARDRAKEPVKFVPEISGFSEIESDEQLAVKVTELALSVQ-----DCVNDLT----  174

Query  1511  GSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGI  1690
               + SG VFVS K+ +   V+++F +L N + S N    S  I             G G 
Sbjct  175   -KASSGYVFVSKKIERN--VQQIFDVLVNSIESYNSGKRSHIIDYDML--------GKGN  223

Query  1691  AHETRFLLSKIILDT  1735
               ETRF+L KIIL T
Sbjct  224   LVETRFVLGKIILKT  238



>gb|ADN33864.1| poly(A) polymerase [Cucumis melo subsp. melo]
Length=439

 Score =   209 bits (533),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 150/472 (32%), Positives = 218/472 (46%), Gaps = 98/472 (21%)
 Frame = +2

Query  356   NWRKLDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTA  535
             NW++  + H GI  S I   +  VLN LKK G++ YLVGGCVRDLIL+R PKDFD+IT+A
Sbjct  50    NWKRFSSNHLGIVTSMIPKPTRKVLNGLKKAGYEVYLVGGCVRDLILDRPPKDFDIITSA  109

Query  536   RLNEIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGC  715
             +L E+ + F   EIVGRRFPIC VHI G++VEVSSF T +   D  +  NS        C
Sbjct  110   QLKEVSRIFLWCEIVGRRFPICHVHIDGTIVEVSSFSTSSKPFD--RHLNSAAIEKSMNC  167

Query  716   NESDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCa  895
              E D +RW+N L RDFTIN + YDP+   +YDY   M DI+  K R              
Sbjct  168   EEIDFVRWKNCLQRDFTINGMMYDPYNNVVYDYLGGMEDIRQAKAR--------------  213

Query  896   rilrglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQ  1075
                                                   L ME+NY+LSYG+A  SL LL 
Sbjct  214   --------------------------------------LQMEMNYLLSYGSAEASLRLLW  235

Query  1076  KYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHL  1255
             KY LLE+LLP     +  ++        +         Q V   R       VA+LA H+
Sbjct  236   KYGLLEILLPIQIGLIHLESHFFGFSPGV------KRSQTVLSYR-------VAVLALHV  282

Query  1256  TLVNNPQPKLVVLTLASVMYH-RNWKQGVEFARQHVKA--ASLY-VPEISDSDGSMSEDE  1423
              L + P+  LVV T    +++  N  + +  A+   +A  A+ Y + E  + +     DE
Sbjct  283   ALSDQPRSPLVVATFGLAVHNGGNMMEAISIAKSINRAHNANFYELLEPQNMEVQALIDE  342

Query  1424  LAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDV  1603
             +     ++ V ++ +TD   +      +  +  S LVF+   +V  + V ++F       
Sbjct  343   VMDLTTSVKVALHKMTDEHFVSLALESYPQAPASDLVFIP--LVVYLKVCKIF-------  393

Query  1604  TSLNEKSCSLKIQNPSPQKGTAHKKGN--------GIAHETRFLLSKIILDT  1735
                    C ++      ++G   K+G         G   E R + ++I+ DT
Sbjct  394   ------ECVVE----GAERGFVPKRGKINYECLALGNVPELRHVFARIVFDT  435



>ref|XP_010490382.1| PREDICTED: uncharacterized protein LOC104768153 [Camelina sativa]
Length=450

 Score =   204 bits (520),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 151/239 (63%), Gaps = 19/239 (8%)
 Frame = +2

Query  221  QLVTALLMSLLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKLDARHFGITGS  400
            Q +TA+  S LQ+ N T A   ++  ST  +  D +     ++ S W+K+ A   GI  S
Sbjct  16   QTLTAVY-SKLQRSNCTLAEGVMEKCSTIRQVIDDDI--NSVDTSKWKKVRASDAGIRNS  72

Query  401  RISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIV  580
             I  SS  VL +L+++GF AYLVGGCVRDLIL+R+PKD+DVITTA L +I++ F+RA+++
Sbjct  73   MIPESSMNVLRLLRRQGFDAYLVGGCVRDLILHRVPKDYDVITTANLKQIRRLFHRAQVI  132

Query  581  GRRFPICRVHIRGSVVEVSSFDTVANKGDETKR-------------KNSFVPRMPKGCNE  721
            G+RFPIC V +RGS++EVSSFDTVA+   E +              KN  + ++  GC+ 
Sbjct  133  GKRFPICHVWMRGSIIEVSSFDTVAHSDSELENDLEKPFPLAIEADKNKSLFKLYSGCDV  192

Query  722  SDVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQK--LRTLIPAQLSFEEDC  892
             D  RWRNS  RDFTINSLFYDPF  +IYDY N M D+  +K   +  +PA    E+ C
Sbjct  193  KDFNRWRNSFQRDFTINSLFYDPFELKIYDYTNGMEDLTDRKSTSKQTVPAAC-LEKKC  250



>ref|XP_009607925.1| PREDICTED: uncharacterized protein LOC104102017 isoform X5 [Nicotiana 
tomentosiformis]
 ref|XP_009607932.1| PREDICTED: uncharacterized protein LOC104102017 isoform X5 [Nicotiana 
tomentosiformis]
Length=408

 Score =   202 bits (513),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 145/418 (35%), Positives = 217/418 (52%), Gaps = 47/418 (11%)
 Frame = +2

Query  545   EIKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNES  724
             ++++ F R EIVGRRFPIC VH+   VVEVSSF T    G  ++R  S     P  C+E 
Sbjct  6     KVRRTFSRCEIVGRRFPICHVHVDNEVVEVSSFHT---SGIRSERGLSLSFEKPVDCDEK  62

Query  725   DVIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCaril  904
             D  RWRN LHRDFTIN L +DP+   +YDY   + DI+  K+RT+ PA  S  EDCARIL
Sbjct  63    DHFRWRNCLHRDFTINGLMFDPYSKFVYDYMGGVDDIRKAKVRTIGPASFSLIEDCARIL  122

Query  905   rglrlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYN  1084
             R +R+AARL F F  ET  +I  LS SV+ LD+ RL+ME+NYML+YG+A  SL LL K+ 
Sbjct  123   RAIRIAARLGFRFGRETALSIKNLSSSVLRLDRGRLLMEMNYMLAYGSAEASLRLLWKFG  182

Query  1085  LLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLW------VALLA  1246
             LLE+LLP  AAY  +   ++  D S+      S   L+     A   +       VA+LA
Sbjct  183   LLEILLPVQAAYFVRYGFRR-RDKSLCFPTSISYWPLIGHATVAYGKILCTGFSKVAILA  241

Query  1247  FHLTLVNNPQPKLVVLTLASVMYH-RNWKQGVEFAR----QHVKAASLYVPEISDSDGSM  1411
             FH  + + P+  LVV      +++  +  + +  A+    QH    S +  E  D D + 
Sbjct  242   FHKAISDQPRDPLVVAAFGLGIHNGGDLSEALSIAKRISTQH--DGSFHELESQDLDLAA  299

Query  1412  SEDELAKRVENMAVQVNMLTDADNLREVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGIL  1591
              ++E+ +   ++   +  +TD   +    + +  + +S LVF+                 
Sbjct  300   LKEEVVELATSVQRALTNMTDEYFVSRAMTNYPKAPYSDLVFIP----------------  343

Query  1592  TNDVTSLNEKSCSL-KIQNPSPQKGTAHKKGNGIAH---------ETRFLLSKIILDT  1735
                  +L  ++C + +      +KG   K+G+ I +         E R + ++I+ DT
Sbjct  344   ----LALYLRTCKVFQCVRMGKEKGFVAKQGSKIDYELLALGSLQEVRHVFARIVFDT  397



>emb|CCI55441.1| PH01B031C15.24 [Phyllostachys edulis]
Length=736

 Score =   198 bits (504),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/264 (41%), Positives = 150/264 (57%), Gaps = 67/264 (25%)
 Frame = +2

Query  386   GITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQ-F  562
             G+   R SP+         + GF AYLVGGCVRDL+L R PKDFDVITTA L +IK++ F
Sbjct  8     GLRNGRSSPAP--------RPGFDAYLVGGCVRDLLLKRAPKDFDVITTASLQQIKRRVF  59

Query  563   YRAEIVGRRFPICRVHIRGSVVEVSSFDTVAN--KGDETKRKNSFVPRMPKGCNESDVIR  736
              R  I+GRRFPIC++++ GS++EVSSF T  N  KG E    +  +     G +E D++R
Sbjct  60    KRCIIIGRRFPICQINMHGSIIEVSSFRTNDNYVKGSEEVDCSDDL----NGYDEGDILR  115

Query  737   WRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglr  916
             W+NS+ RDFTINSLF++P +++IYDY N + D+++ K R                     
Sbjct  116   WKNSMKRDFTINSLFFNPSIHRIYDYVNGVRDVRNNKTR---------------------  154

Query  917   laarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEV  1096
                                            LMME+ YMLS+GAA  S+ LL+KY LL++
Sbjct  155   -------------------------------LMMEMKYMLSHGAAESSVRLLRKYGLLDI  183

Query  1097  LLPFHAAYLTQQADKQSSDTSMLM  1168
             LLPF AAYL+ Q   +SSD  +++
Sbjct  184   LLPFQAAYLSDQIKGKSSDRDLML  207



>tpg|DAA43184.1| TPA: hypothetical protein ZEAMMB73_451476, partial [Zea mays]
Length=248

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 141/217 (65%), Gaps = 5/217 (2%)
 Frame = +2

Query  209  QFVEQLVTALLMSLLQKFNQTSAGD--GIQLESTTDRAADSNFQPGKIEFSNWRKLDARH  382
            Q + +L +     L ++++    GD  G         +A  + +PG ++ S+W+  D+R 
Sbjct  21   QLLSRLRSGASSFLARQYSTGKGGDNTGPSKPKGGGSSAPRHLRPGFVDPSSWKHFDSRA  80

Query  383  FGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQ-  559
             GI    I   +W VL  L+++GF+AYLVGGCVRDL+L R+PKDFDVITTA L ++KK  
Sbjct  81   VGIKPGAIHTDAWAVLKKLRREGFQAYLVGGCVRDLLLKRVPKDFDVITTASLEQLKKNI  140

Query  560  FYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRW  739
            F R+ IVG+RFPIC + +R SV+E+SSF TVAN G+ ++  + +V  +  G +  D++RW
Sbjct  141  FRRSRIVGKRFPICLLKMRDSVIEISSFRTVANYGNRSEVVD-YVAEL-NGSDVRDILRW  198

Query  740  RNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKL  850
            ++S+ RDFTIN LF++P   +IYDY N + D++  K+
Sbjct  199  KDSMRRDFTINGLFFNPMNCKIYDYVNGVRDMRKNKV  235



>gb|AAD32915.1| putative poly(A) polymerase [Arabidopsis thaliana]
Length=241

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 105/151 (70%), Gaps = 14/151 (9%)
 Frame = +2

Query  449  GFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICRVHIRGSVV  628
            GF AYLVGGCVRDLILNR+PKD+DVITTA L +I++ F+RA+++G+RFPIC V + GS++
Sbjct  18   GFDAYLVGGCVRDLILNRVPKDYDVITTADLKQIRRLFHRAQVIGKRFPICHVWMGGSII  77

Query  629  EVSSFDTVANKG--------------DETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFT  766
            EVSSFDTVA+                D    KN+ + +M  G +  D  RWRNSL RDFT
Sbjct  78   EVSSFDTVAHSDSDLEKSKEKSGVSLDTKANKNNSLFKMYSGWDIKDCKRWRNSLQRDFT  137

Query  767  INSLFYDPFVYQIYDYANAMADIKSQKLRTL  859
            INSLFY+PF + IYDYAN M D+   K + L
Sbjct  138  INSLFYNPFDFTIYDYANGMEDLTDLKFKVL  168



>ref|XP_005844969.1| hypothetical protein CHLNCDRAFT_58740 [Chlorella variabilis]
 gb|EFN52867.1| hypothetical protein CHLNCDRAFT_58740 [Chlorella variabilis]
Length=911

 Score =   181 bits (459),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 178/302 (59%), Gaps = 19/302 (6%)
 Frame = +2

Query  404   ISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVG  583
             IS  +W+VL+ L+  G +AY+VGG +RDL+L   PKD+D++TTA L++IK+ F R  IVG
Sbjct  270   ISRPAWLVLSRLRAAGHEAYVVGGTIRDLLLGGTPKDYDLLTTAELHQIKRLFGRCNIVG  329

Query  584   RRFPICRVHIRGSVVEVSSFDTVAN----KGDET-----KRKNSFVPRMPKGCNESDVIR  736
             R FP+C+VH  G+++EVSSF T A+      D +     ++K   V R  +        R
Sbjct  330   RSFPVCQVHAEGTMIEVSSFTTNADLRLIPADASTHMIGRQKPKRVARQ-EAGATWAAAR  388

Query  737   WRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglr  916
               N+  RDFT+N L YDPF   ++D    +AD ++++LRT+ P Q SF  D ARILRG+R
Sbjct  389   ADNAARRDFTVNGLLYDPFSRLLFDSVGGVADCQARRLRTICPPQQSFAADPARILRGVR  448

Query  917   laarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEV  1096
             LAAR       ET   + + + ++  L + RL ME+  +L YGA+  SL L+ +  LL++
Sbjct  449   LAARAGLELEPETAAEMEEAAATIGLLPQGRLQMELGSLLGYGASERSLALMWRLGLLDM  508

Query  1097  LLPFHAAYLTQQ---------ADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAF  1249
             LLP HA YL +          + K+     +L +L   LD+ V  ++P   S+WVALLA 
Sbjct  509   LLPQHALYLKRHRVPRAPRAPSSKRRHKRDLLFELAGELDRHVHPQKPVDPSVWVALLAA  568

Query  1250  HL  1255
              L
Sbjct  569   PL  570



>gb|KEH20979.1| tRNA nucleotidyltransferase/poly(A) polymerase [Medicago truncatula]
Length=323

 Score =   171 bits (434),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 116/323 (36%), Positives = 179/323 (55%), Gaps = 15/323 (5%)
 Frame = +2

Query  782   YDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETET  961
             +DPF   +YDY   M DI   K+RT++PA  SF+EDCARILR +R+AARL FS S ET  
Sbjct  2     FDPFAKIVYDYMGGMEDIIKAKVRTMVPAATSFQEDCARILRAIRIAARLGFSISTETAR  61

Query  962   AIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQA-D  1138
             ++  LS S++ LDK RL+ME+NYML+YG+   SL LL K+ LL++LLPF A Y  +    
Sbjct  62    SVKHLSYSILRLDKGRLLMEMNYMLAYGSGEASLRLLWKFGLLDILLPFQALYFVRHGFR  121

Query  1139  KQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH  1318
             ++   T+ML+ LF +LD+L++   P   SLWV +LA H +L + P+  LV+   +  +++
Sbjct  122   RRDKRTNMLLSLFFNLDKLLAPNSPCHSSLWVGILALHKSLSDQPRNPLVIAAFSLAVHN  181

Query  1319  -RNWKQGVEFARQHVKAASLYVPEISDS---DGSMSEDELAKRVENMAVQVNMLTDADNL  1486
               N  + V+ AR+  K   +  PE+SD    +    E+E+   VE++ V +  +T   ++
Sbjct  182   GGNLLEAVDIARRINKPHDIRFPELSDPCDLNAKALENEILDLVESVKVSLLQMTSRHSV  241

Query  1487  REVTSKFSGSSHSGLVFVSNKMVKKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGT  1666
                   +  + HS +VF+   M  K +   +F         L   SC  K  +   +K  
Sbjct  242   ARAMVDYPQAPHSDMVFIPLGMYLKAL--SIF-------DCLKVSSCK-KFLSKKSRKID  291

Query  1667  AHKKGNGIAHETRFLLSKIILDT  1735
                   G   E R L ++++ DT
Sbjct  292   YESLARGDLPEIRHLFARVVFDT  314



>ref|NP_001183670.1| uncharacterized protein LOC100502264 [Zea mays]
 gb|ACR37922.1| unknown [Zea mays]
Length=215

 Score =   159 bits (403),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 124/192 (65%), Gaps = 5/192 (3%)
 Frame = +2

Query  209  QFVEQLVTALLMSLLQKFNQTSAGD--GIQLESTTDRAADSNFQPGKIEFSNWRKLDARH  382
            Q + +L +     L ++++    GD  G         +A  + +PG ++ S+W+  D+R 
Sbjct  21   QLLSRLRSGASSFLARQYSTGKGGDNTGPSKPKGGGSSAPRHLRPGFVDPSSWKHFDSRA  80

Query  383  FGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQ-  559
             GI    I   +W VL  L+++GF+AYLVGGCVRDL+L R+PKDFDVITTA L ++KK  
Sbjct  81   VGIKPGAIHTDAWAVLKKLRREGFQAYLVGGCVRDLLLKRVPKDFDVITTASLEQLKKNI  140

Query  560  FYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRW  739
            F R+ IVG+RFPIC + +R SV+E+SSF TVAN G+ ++  + +V  +  G +  D++RW
Sbjct  141  FRRSRIVGKRFPICLLKMRDSVIEISSFRTVANYGNRSEVVD-YVAEL-NGSDVRDILRW  198

Query  740  RNSLHRDFTINS  775
            ++S+ RDFTIN 
Sbjct  199  KDSMRRDFTING  210



>gb|KHN41830.1| hypothetical protein glysoja_003570 [Glycine soja]
Length=247

 Score =   159 bits (401),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 126/198 (64%), Gaps = 19/198 (10%)
 Frame = +2

Query  560   FYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRM-PKGCNESDVIR  736
             F RAE+VGR FPIC VHI+GSVVEV+SF+TVA   +   RK  F+  + PK  N+ D+ R
Sbjct  57    FSRAEVVGRCFPICLVHIKGSVVEVTSFETVARTSN---RKEQFLHSLLPKCSNKKDLFR  113

Query  737   WRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglr  916
              +NSL RDFTINSLFYDPF  +IY Y + MAD++S K    + ++L              
Sbjct  114   CKNSLRRDFTINSLFYDPFANKIYHYTDGMADLRSLKGEFCVASKLQL------------  161

Query  917   laarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEV  1096
                 L +  S ETE A+WK S  V SLDK+++M+E+NYMLSYGA+ PSL LL K  LLE 
Sbjct  162   ---GLVYHLSRETEAAMWKYSSLVKSLDKNKIMIELNYMLSYGASEPSLRLLWKLKLLEF  218

Query  1097  LLPFHAAYLTQQADKQSS  1150
             LLP H   + +++ K  S
Sbjct  219   LLPVHHILMNKRSKKMCS  236



>ref|XP_006409278.1| hypothetical protein EUTSA_v10022674mg [Eutrema salsugineum]
 gb|ESQ50731.1| hypothetical protein EUTSA_v10022674mg [Eutrema salsugineum]
Length=470

 Score =   164 bits (414),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 138/240 (58%), Gaps = 15/240 (6%)
 Frame = +2

Query  1028  YMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCE  1207
             YML+YGAA PS+ LL K+ L   LLPF AAYL Q +      +SML++LFS++D+LVSC+
Sbjct  4     YMLAYGAAAPSILLLMKFKLPHFLLPFQAAYLDQASKTSPPSSSMLVRLFSNMDKLVSCD  63

Query  1208  RPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYHRNWKQGVEFARQHVKAASLYVPE  1387
             +PA   LW+A+LAFH  LV +PQ  +V+   AS++YHRNW + V+FAR+H  +   Y  E
Sbjct  64    QPADSRLWIAVLAFHTALVRSPQEAIVLHAFASLLYHRNWSRAVKFAREHENSVLGYASE  123

Query  1388  ISDSDGSMSEDELAKRVENMAVQVN----MLTDADNLREVTSKFSGSSHSGLVFVSNKMV  1555
             IS S    S+ +LA+ V   A  V     +LT+ + LRE    +     SGLVF+     
Sbjct  124   ISKSSSKRSDKDLAEAVSEFAYLVRKTLIVLTEMEALREALHLYPDFKCSGLVFIPK--T  181

Query  1556  KKIVVEEVFGILTNDVTSLNEKSCSLKIQNPSPQKGTAHKKGNGIAHETRFLLSKIILDT  1735
             K+  V + F  L+ DV S   K     I   S  KG+  + G        F+L KII+DT
Sbjct  182   KRKDVADWFARLS-DVESYESKKEGFSIDYISLGKGSPCEIG--------FVLGKIIMDT  232



>ref|XP_010463896.1| PREDICTED: uncharacterized protein LOC104744526 isoform X3 [Camelina 
sativa]
Length=337

 Score =   158 bits (400),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 133/216 (62%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  LLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKL-DARHFGITGSRISPSSWV  424
            L +K +Q S  + I +E  TD A+    +         RK+ D+R  GI  S I  SS++
Sbjct  121  LQRKPSQQSINERI-VEDNTDSASQKTIEDD----VPLRKIFDSRSVGIKRSMIPTSSYI  175

Query  425  VLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICR  604
            VL  L+ KGF +YLVGGCVRD +++R P+DFD++TTA L++++  F  A  VG+ +PIC 
Sbjct  176  VLRTLQFKGFHSYLVGGCVRDRLMSRKPRDFDIVTTASLDQVEGLFSEASTVGKAYPICH  235

Query  605  VHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFY  784
            V+I  +++EVS+    A   + T    +F   +P   +E D I ++NS  RDFT+NSLF 
Sbjct  236  VYIGKTLIEVSAAVPAAEAEESTSDDMAFSVVVPCSWDEVDTILYKNSQKRDFTVNSLFL  295

Query  785  DPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
            DP  +++YD+   + DIKS+ +RT+I A  SF EDC
Sbjct  296  DPINFKLYDFNRGIEDIKSRMIRTVIDANQSFNEDC  331



>ref|XP_010463895.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02490, 
mitochondrial-like isoform X2 [Camelina sativa]
Length=421

 Score =   159 bits (401),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 133/216 (62%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  LLQKFNQTSAGDGIQLESTTDRAADSNFQPGKIEFSNWRKL-DARHFGITGSRISPSSWV  424
            L +K +Q S  + I +E  TD A+    +         RK+ D+R  GI  S I  SS++
Sbjct  205  LQRKPSQQSINERI-VEDNTDSASQKTIEDD----VPLRKIFDSRSVGIKRSMIPTSSYI  259

Query  425  VLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGRRFPICR  604
            VL  L+ KGF +YLVGGCVRD +++R P+DFD++TTA L++++  F  A  VG+ +PIC 
Sbjct  260  VLRTLQFKGFHSYLVGGCVRDRLMSRKPRDFDIVTTASLDQVEGLFSEASTVGKAYPICH  319

Query  605  VHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFTINSLFY  784
            V+I  +++EVS+    A   + T    +F   +P   +E D I ++NS  RDFT+NSLF 
Sbjct  320  VYIGKTLIEVSAAVPAAEAEESTSDDMAFSVVVPCSWDEVDTILYKNSQKRDFTVNSLFL  379

Query  785  DPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
            DP  +++YD+   + DIKS+ +RT+I A  SF EDC
Sbjct  380  DPINFKLYDFNRGIEDIKSRMIRTVIDANQSFNEDC  415



>tpg|DAA38071.1| TPA: hypothetical protein ZEAMMB73_877949 [Zea mays]
Length=329

 Score =   155 bits (391),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 154/273 (56%), Gaps = 17/273 (6%)
 Frame = +2

Query  782   YDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFSMETET  961
             ++P+  +IYDY   + DIK  K+RT+IPA  SF+EDCARILR +R+AARL FSF  ET  
Sbjct  2     FNPYSEKIYDYLGGIEDIKKAKVRTVIPAGTSFQEDCARILRAIRIAARLGFSFPKETAY  61

Query  962   AIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYLTQ-QAD  1138
              +  L+ SV  LDK+R++ME+NYML+YG+A  SL LL ++ LLE LLPF AAY +  +  
Sbjct  62    YVRTLACSVARLDKARILMEMNYMLAYGSAEASLRLLWRFGLLEHLLPFQAAYFSSTRFK  121

Query  1139  KQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNPQPKLVVLTLASVMYH  1318
             ++   T+ML+ LFS LD  ++  RP   SLW++LLAFH  L   P   L+V T A   Y 
Sbjct  122   RKDKGTNMLLVLFSKLDNFLAPNRPCHNSLWISLLAFHEALARKPCDPLIVATFALAFYL  181

Query  1319  RN-----WKQGVEFARQH-VKAASLYVPEISDSDGSMSEDELAKRVENMAV----QVNML  1468
                       G    RQH      L  P++       ++  LA  V++ A      +  +
Sbjct  182   GGDMSLAVDIGKSINRQHDTGFRELLEPKV------WTDKHLAGEVQSFAALMKQALTEM  235

Query  1469  TDADNLREVTSKFSGSSHSGLVFVSNKMVKKIV  1567
             TD  ++    +K   +  S LVF+  +   K++
Sbjct  236   TDEYHVANAMAKIPQAPSSDLVFIPLQAYLKVL  268



>ref|XP_010463894.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02490, 
mitochondrial-like isoform X1 [Camelina sativa]
Length=532

 Score =   158 bits (399),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 115/175 (66%), Gaps = 0/175 (0%)
 Frame = +2

Query  368  LDARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNE  547
             D+R  GI  S I  SS++VL  L+ KGF +YLVGGCVRD +++R P+DFD++TTA L++
Sbjct  352  FDSRSVGIKRSMIPTSSYIVLRTLQFKGFHSYLVGGCVRDRLMSRKPRDFDIVTTASLDQ  411

Query  548  IKKQFYRAEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESD  727
            ++  F  A  VG+ +PIC V+I  +++EVS+    A   + T    +F   +P   +E D
Sbjct  412  VEGLFSEASTVGKAYPICHVYIGKTLIEVSAAVPAAEAEESTSDDMAFSVVVPCSWDEVD  471

Query  728  VIRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDC  892
             I ++NS  RDFT+NSLF DP  +++YD+   + DIKS+ +RT+I A  SF EDC
Sbjct  472  TILYKNSQKRDFTVNSLFLDPINFKLYDFNRGIEDIKSRMIRTVIDANQSFNEDC  526



>ref|WP_038089618.1| poly(A) polymerase [Thiobacillus prosperus]
Length=442

 Score =   149 bits (377),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 160/291 (55%), Gaps = 14/291 (5%)
 Frame = +2

Query  389   ITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYR  568
             I+ +RISP++  VL  LK  G++AYLVGG VRDL+L R PKDFD+ T+AR  E++  F  
Sbjct  20    ISRARISPNALKVLYRLKDAGYEAYLVGGGVRDLLLGREPKDFDIATSARPEELQTLFRN  79

Query  569   AEIVGRRFPICRVHIRGSVVEVSSF----DTVANKGDETKRKNSFVPR-MPKGCNESDVI  733
               ++GRRF +  V     ++EV++F    D   ++GD    +   + R    G  E D  
Sbjct  80    CRLIGRRFRLAHVRFGREIIEVATFRAPHDIAEDEGDAALSEEGRILRDNVYGTFEQDA-  138

Query  734   RWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrgl  913
              WR    RDFTIN+L+YD   + + D+   + DI+   LR +   ++ + ED  R+LR +
Sbjct  139   -WR----RDFTINALYYDIRDFSVVDHTGGVGDIREGVLRLIGDPEVRYREDPVRMLRAV  193

Query  914   rlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLE  1093
             R AA+L F     +E  +++L+P +  +  +RL  EV  +   GAAV S  LL+ Y L  
Sbjct  194   RFAAKLGFRIEAASEAPLFELAPLLADVAPARLFDEVLKLFQGGAAVQSFELLRHYGLFG  253

Query  1094  VLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARES-LWVALL  1243
             VL P   A L ++ D      + L++   + D+ V+  +P   + L+ ALL
Sbjct  254   VLFPATEAALAREVD--GFPLTFLLRALENTDRRVNEGKPVTPAFLFAALL  302



>gb|EPP34871.1| poly(A) polymerase family protein [Chlamydia psittaci 10_1398_11]
Length=414

 Score =   149 bits (375),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/234 (39%), Positives = 137/234 (59%), Gaps = 11/234 (5%)
 Frame = +2

Query  407   SPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGR  586
             SP++  V+  LKK G  AY+VGGC+RDLILN  PKDFD+ T+A+  EIK  F    +VG+
Sbjct  28    SPNALAVVKTLKKAGHIAYIVGGCIRDLILNITPKDFDISTSAKPEEIKAAFKNCILVGK  87

Query  587   RFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFT  766
             RF +  +     ++EVS+F +   + D    K++       G  E DV+R      RDFT
Sbjct  88    RFRLAHIRFTNQIIEVSTFRSGGIEEDVLITKDNLW-----GTPEEDVLR------RDFT  136

Query  767   INSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFS  946
             IN LFYDP    I DY + ++D++++ LRT+    + F++D  R+LR L++ +R  F+  
Sbjct  137   INGLFYDPSEEAIIDYTDGISDLQNRYLRTIGDPYVRFKQDPVRMLRLLKILSRFPFTVD  196

Query  947   METETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPF  1108
              ET TA+ +    +    K+R+  E+  MLS G A P   LL ++ LLE+L P+
Sbjct  197   TETLTALKECRHELTKSSKARVFEELIKMLSSGVAAPFFKLLVEHELLEILFPY  250



>ref|WP_032125128.1| poly(A) polymerase [Chlamydia sp. 'Diamant']
Length=426

 Score =   149 bits (376),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 96/277 (35%), Positives = 142/277 (51%), Gaps = 23/277 (8%)
 Frame = +2

Query  374   ARHFGITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIK  553
             A+  GI  + I P +  VL  L++ GF AYLVGG VRDL+L R+PKDFD+ T+AR  +IK
Sbjct  8     AKDHGIDPTLIDPDALYVLERLRQAGFTAYLVGGSVRDLLLRRVPKDFDISTSARPEQIK  67

Query  554   KQFYRAEI-VGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDV  730
               F R  I +GRRF +  +     ++EVS+F T  N      + N +      G  E DV
Sbjct  68    TIFQRQCILIGRRFRLAHIRFGHKIIEVSTFRTGENDSGLILQDNEW------GSPEEDV  121

Query  731   IRWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrg  910
             +R      RDFTIN LFYD   + I DY     D++   LRT+      F++D   +   
Sbjct  122   LR------RDFTINGLFYDSSNHSIIDYVGGWEDVQEHLLRTIGDPDKRFKQD--PVRLL  173

Query  911   lrlaarlKFSFSME--TETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYN  1084
               L    +F+F ME  TE +I++    ++    +R++ E+  ML  G++ P + LL +Y 
Sbjct  174   RLLKFHARFAFKMEENTEQSIYRCREEIVKSSPARILEEILRMLESGSSAPFIRLLAEYG  233

Query  1085  LLEVLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQL  1195
             +L +L P    +L     K      M+    +  DQL
Sbjct  234   MLAILFPVLTQFLRIPQGK------MIFHYLACADQL  264



>dbj|BAP55861.1| poly(A) polymerase [Thioploca ingrica]
Length=473

 Score =   149 bits (376),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 154/271 (57%), Gaps = 12/271 (4%)
 Frame = +2

Query  404   ISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVG  583
             IS S+  VL  L+  G++A+LVGG VRD++L RIPKDFDV+T A   EIKK F    ++G
Sbjct  57    ISQSALTVLYQLRHAGYQAFLVGGGVRDVLLGRIPKDFDVVTNALPEEIKKLFRSCRLIG  116

Query  584   RRFPICRVHIRGSVVEVSSFDTVANK-GDETKRKNSFVPRMPKGCNESDVIRWRNSLHRD  760
             RRF +  V +   +VEV++F    +K GD    +   +     G  + D   WR    RD
Sbjct  117   RRFLLAHVRLNKDIVEVATFRAHHDKGGDGVMEEGRILRDNVYGTIDEDA--WR----RD  170

Query  761   FTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFS  940
             FTIN+L+YD   + + DYAN MAD+++  +R +   Q  +EED  R+LR +R AA+L F+
Sbjct  171   FTINALYYDISDFSLLDYANGMADLRAGIIRVIGNPQRRYEEDPVRMLRAVRFAAKLGFT  230

Query  941   FSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAY  1120
              +  T T I +L   + ++  +RL+ EV  +   G AV +   L++YNL + L P+    
Sbjct  231   IAPTTATPIQQLGGLLANIPPARLLEEVQKLFLSGYAVQAFIQLREYNLFKQLFPY----  286

Query  1121  LTQQADKQSSDTSMLMKLFSSLDQLVSCERP  1213
              T +  + +   +++ ++  + D+ +   +P
Sbjct  287   -TDECLEDAQTLALIKQVLHNTDERLKDNKP  316



>ref|WP_016352934.1| poly(A) polymerase [Spiribacter salinus]
 ref|YP_008046092.1| poly(A) polymerase [Spiribacter salinus M19-40]
 gb|AGM40627.1| poly(A) polymerase [Spiribacter salinus M19-40]
Length=444

 Score =   149 bits (375),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 104/305 (34%), Positives = 154/305 (50%), Gaps = 13/305 (4%)
 Frame = +2

Query  389   ITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYR  568
             I+ S IS  +  VL  LK  G+ AYLVGG VRDL L R PKDFDV T A  +E+K  F  
Sbjct  25    ISRSHISERALTVLYRLKNAGYGAYLVGGGVRDLSLGREPKDFDVATDATPDEVKALFRN  84

Query  569   AEIVGRRFPICRVHIRGSVVEVSSFDTV-----ANKGDETKRKNSFVPRMPKGCNESDVI  733
               ++GRRF +  VH    ++EV++F  +      + GD        +     G  E D +
Sbjct  85    CRLIGRRFRLAHVHWGPEIIEVATFRALHPPEAEDDGDRVLEDGMILRDNVYGTIEEDAL  144

Query  734   RWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrgl  913
             R      RDFTIN+L+YD   + + DYA  MAD+K+ +LR +   ++ + ED  R+LR +
Sbjct  145   R------RDFTINALYYDIATFSVVDYAGGMADLKAGRLRLIGDPEVRYREDPVRMLRAV  198

Query  914   rlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLE  1093
             R AA+L F     T   I +++ S+  +  +RL  EV  +L  G  V +   L+++ L  
Sbjct  199   RFAAKLGFVIDEATAQPIPRMADSLDDIPPARLFDEVLKLLMAGQGVETFESLRQHGLFR  258

Query  1094  VLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALLAFHLTLVNNP  1273
              L P     L    D+     + L +   S DQ V+ +RP   +   A L +   L   P
Sbjct  259   YLFPATDTALDD--DEHGQFITFLARALESTDQRVNADRPVTPAFLFAALLWPAILAQLP  316

Query  1274  QPKLV  1288
             + K+V
Sbjct  317   RGKMV  321



>ref|WP_021119631.1| MULTISPECIES: poly(A) polymerase family protein [Chlamydia]
 gb|EQM62505.1| poly(A) polymerase family protein [Chlamydia ibidis 10-1398/6]
Length=428

 Score =   148 bits (374),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/234 (39%), Positives = 137/234 (59%), Gaps = 11/234 (5%)
 Frame = +2

Query  407   SPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVGR  586
             SP++  V+  LKK G  AY+VGGC+RDLILN  PKDFD+ T+A+  EIK  F    +VG+
Sbjct  42    SPNALAVVKTLKKAGHIAYIVGGCIRDLILNITPKDFDISTSAKPEEIKAAFKNCILVGK  101

Query  587   RFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDFT  766
             RF +  +     ++EVS+F +   + D    K++       G  E DV+R      RDFT
Sbjct  102   RFRLAHIRFTNQIIEVSTFRSGGIEEDVLITKDNLW-----GTPEEDVLR------RDFT  150

Query  767   INSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSFS  946
             IN LFYDP    I DY + ++D++++ LRT+    + F++D  R+LR L++ +R  F+  
Sbjct  151   INGLFYDPSEEAIIDYTDGISDLQNRYLRTIGDPYVRFKQDPVRMLRLLKILSRFPFTVD  210

Query  947   METETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPF  1108
              ET TA+ +    +    K+R+  E+  MLS G A P   LL ++ LLE+L P+
Sbjct  211   TETLTALKECRHELTKSSKARVFEELIKMLSSGVAAPFFKLLVEHELLEILFPY  264



>gb|KFZ90448.1| poly(A) polymerase [Thiobacillus prosperus]
Length=470

 Score =   149 bits (375),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 160/291 (55%), Gaps = 14/291 (5%)
 Frame = +2

Query  389   ITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYR  568
             I+ +RISP++  VL  LK  G++AYLVGG VRDL+L R PKDFD+ T+AR  E++  F  
Sbjct  48    ISRARISPNALKVLYRLKDAGYEAYLVGGGVRDLLLGREPKDFDIATSARPEELQTLFRN  107

Query  569   AEIVGRRFPICRVHIRGSVVEVSSF----DTVANKGDETKRKNSFVPR-MPKGCNESDVI  733
               ++GRRF +  V     ++EV++F    D   ++GD    +   + R    G  E D  
Sbjct  108   CRLIGRRFRLAHVRFGREIIEVATFRAPHDIAEDEGDAALSEEGRILRDNVYGTFEQDA-  166

Query  734   RWRNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrgl  913
              WR    RDFTIN+L+YD   + + D+   + DI+   LR +   ++ + ED  R+LR +
Sbjct  167   -WR----RDFTINALYYDIRDFSVVDHTGGVGDIREGVLRLIGDPEVRYREDPVRMLRAV  221

Query  914   rlaarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLE  1093
             R AA+L F     +E  +++L+P +  +  +RL  EV  +   GAAV S  LL+ Y L  
Sbjct  222   RFAAKLGFRIEAASEAPLFELAPLLADVAPARLFDEVLKLFQGGAAVQSFELLRHYGLFG  281

Query  1094  VLLPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARES-LWVALL  1243
             VL P   A L ++ D      + L++   + D+ V+  +P   + L+ ALL
Sbjct  282   VLFPATEAALAREVD--GFPLTFLLRALENTDRRVNEGKPVTPAFLFAALL  330



>ref|WP_008733349.1| poly(A) polymerase [Alcanivorax pacificus]
 gb|AJD49598.1| poly(A) polymerase [Alcanivorax pacificus W11-5]
Length=474

 Score =   148 bits (373),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/288 (34%), Positives = 156/288 (54%), Gaps = 7/288 (2%)
 Frame = +2

Query  389   ITGSRISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYR  568
             I+    S ++  VL  LK  GF+AYLVGGC+RD++    PKDFDV+T A   EI++ F  
Sbjct  38    ISRQDFSRAALHVLYGLKDAGFEAYLVGGCLRDILTGIKPKDFDVVTNAHPEEIERVFRG  97

Query  569   AEIVGRRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRW---  739
             A I+GRRF +  V  +G V+EV++F  V   G E    +    R   G    D +     
Sbjct  98    ARIIGRRFRLVHVRFKGEVIEVATFRAVT--GQEEDEDDRHSRRSAGGQILRDNVYGTIE  155

Query  740   RNSLHRDFTINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrl  919
              ++L RDFT N+L+YD   + ++D+A+++ DI+ + LR +   +  + ED  R++R +R 
Sbjct  156   EDALRRDFTCNALYYDIRDFSLHDFADSLRDIEHRTLRLIGDPEQRYREDPVRMIRAVRF  215

Query  920   aarlKFSFSMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVL  1099
             AA+L FS    TE  + +L+P +  +  +RL  EV  +   G    +  LLQK++L + L
Sbjct  216   AAKLDFSIDPATEEPLARLAPLLQQVPSARLFEEVLKLFLSGQGQRTFALLQKHHLFDAL  275

Query  1100  LPFHAAYLTQQADKQSSDTSMLMKLFSSLDQLVSCERPARESLWVALL  1243
              P  A  L    D  +SD  ++     + D+ ++ E+P   +   A+L
Sbjct  276   FPATAEALDD--DDGASDLKLIHAAMRNTDRRLAQEKPVTPAFLFAVL  321



>gb|KHD05926.1| hypothetical protein OT06_44810 [Candidatus Thiomargarita nelsonii]
Length=427

 Score =   147 bits (370),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/240 (38%), Positives = 143/240 (60%), Gaps = 7/240 (3%)
 Frame = +2

Query  404   ISPSSWVVLNVLKKKGFKAYLVGGCVRDLILNRIPKDFDVITTARLNEIKKQFYRAEIVG  583
             IS ++  VL  L + G++A+LVGG VRD+++ R+PKDFDV+T A   ++K  F+   ++G
Sbjct  23    ISQAALDVLYHLNRAGYQAFLVGGGVRDVLIGRVPKDFDVVTNAHPEQVKSLFHHCRLIG  82

Query  584   RRFPICRVHIRGSVVEVSSFDTVANKGDETKRKNSFVPRMPKGCNESDVIRWRNSLHRDF  763
             RRF +  VH+RG +VEV++F   A+ GD+   +N  + R     +  D     ++L RDF
Sbjct  83    RRFLLAHVHLRGEMVEVATFR--AHHGDDAT-ENGRIVRDNVYASSVD----EDALRRDF  135

Query  764   TINSLFYDPFVYQIYDYANAMADIKSQKLRTLIPAQLSFEEDCarilrglrlaarlKFSF  943
             TIN+L+YD   + + DYAN MAD+++  +R +    L ++ED  R+LR +R AA+L F  
Sbjct  136   TINALYYDIRDFSVLDYANGMADLRAGLIRLVGSPLLRYQEDPVRMLRAVRFAAKLGFRI  195

Query  944   SMETETAIWKLSPSVMSLDKSRLMMEVNYMLSYGAAVPSLCLLQKYNLLEVLLPFHAAYL  1123
               +T   I +L   + ++  +RL  EV  +   G AV S   LQ Y+L + L P+  A L
Sbjct  196   EPQTAAPISELGGLLSNIPPARLFEEVLKLFLSGHAVQSFVQLQHYDLFKQLFPYTEACL  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7655697445440