BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22332_g1_i2 len=696 path=[674:0-182 857:183-219 894:220-256
1958:257-282 957:283-315 1760:316-365 1040:366-389 1064:390-540
1215:541-695]

Length=696
                                                                      Score     E

ref|XP_009605938.1|  PREDICTED: basic blue protein-like                 129   4e-34   
ref|XP_009773795.1|  PREDICTED: basic blue protein-like                 129   5e-34   
ref|XP_009403746.1|  PREDICTED: basic blue protein-like                 125   2e-32   
ref|XP_008218855.1|  PREDICTED: basic blue protein-like                 125   3e-32   
ref|XP_007148487.1|  hypothetical protein PHAVU_006G212900g             124   8e-32   
ref|XP_009803052.1|  PREDICTED: basic blue protein-like                 119   3e-30   
gb|AFK43827.1|  unknown                                                 119   3e-30   
ref|XP_009380082.1|  PREDICTED: basic blue protein-like                 118   9e-30   
ref|XP_008237710.1|  PREDICTED: basic blue protein-like                 117   2e-29   
ref|XP_003558311.1|  PREDICTED: chemocyanin-like                        117   2e-29   
ref|NP_001147285.1|  chemocyanin precursor                              117   3e-29   Zea mays [maize]
ref|XP_002464008.1|  hypothetical protein SORBIDRAFT_01g010510          117   4e-29   Sorghum bicolor [broomcorn]
ref|XP_004290576.1|  PREDICTED: basic blue protein-like                 117   4e-29   
ref|XP_007200120.1|  hypothetical protein PRUPE_ppa018507mg             116   5e-29   
ref|XP_009605936.1|  PREDICTED: chemocyanin-like                        116   6e-29   
ref|XP_010926149.1|  PREDICTED: chemocyanin-like                        116   6e-29   
ref|XP_009421112.1|  PREDICTED: basic blue protein-like                 116   7e-29   
gb|KHN23440.1|  Basic blue protein                                      115   8e-29   
gb|AAK55122.1|AF172853_1  putative S-RNase binding protein p11 pr...    115   1e-28   Nicotiana alata [flowering tobacco]
ref|NP_001237531.1|  uncharacterized protein LOC100305588 precursor     115   1e-28   
ref|XP_003562309.1|  PREDICTED: chemocyanin-like                        115   2e-28   
gb|EYU18545.1|  hypothetical protein MIMGU_mgv1a022688mg                115   2e-28   
ref|XP_010932617.1|  PREDICTED: basic blue protein-like                 115   2e-28   
tpg|DAA50956.1|  TPA: chemocyanin                                       115   2e-28   
ref|XP_002520251.1|  Basic blue protein, putative                       115   2e-28   Ricinus communis
ref|XP_007227174.1|  hypothetical protein PRUPE_ppa021383mg             114   3e-28   
emb|CDY03030.1|  BnaC07g21970D                                          114   4e-28   
ref|XP_002275987.1|  PREDICTED: basic blue protein                      114   4e-28   Vitis vinifera
gb|EPS59878.1|  hypothetical protein M569_14927                         114   4e-28   
ref|XP_010270378.1|  PREDICTED: basic blue protein-like                 113   8e-28   
gb|KEH37636.1|  basic blue-like protein                                 113   9e-28   
ref|XP_009404130.1|  PREDICTED: basic blue protein-like                 113   1e-27   
ref|XP_009101233.1|  PREDICTED: basic blue protein-like                 113   1e-27   
ref|XP_004488137.1|  PREDICTED: chemocyanin-like                        112   2e-27   
ref|XP_010425055.1|  PREDICTED: basic blue protein-like                 112   2e-27   
ref|XP_008339291.1|  PREDICTED: basic blue protein-like                 112   2e-27   
ref|XP_006395754.1|  hypothetical protein EUTSA_v10005123mg             112   2e-27   
ref|XP_009368430.1|  PREDICTED: basic blue protein                      111   2e-27   
ref|XP_004982012.1|  PREDICTED: chemocyanin-like                        112   3e-27   
ref|NP_001051044.1|  Os03g0709300                                       112   3e-27   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ84083.1|  unknown                                                 111   4e-27   Medicago truncatula
ref|XP_009341322.1|  PREDICTED: basic blue protein-like                 111   4e-27   
ref|XP_003629993.1|  Basic blue protein                                 111   5e-27   
ref|XP_002298184.1|  basic blue copper family protein                   111   5e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006292005.1|  hypothetical protein CARUB_v10018193mg             112   6e-27   
ref|XP_010916152.1|  PREDICTED: basic blue protein-like                 110   7e-27   
ref|XP_006387908.1|  hypothetical protein POPTR_0487s00220g             110   8e-27   
ref|XP_006650480.1|  PREDICTED: chemocyanin-like                        110   9e-27   
ref|NP_001152423.1|  chemocyanin precursor                              110   9e-27   Zea mays [maize]
ref|XP_010692867.1|  PREDICTED: basic blue protein-like                 110   1e-26   
ref|XP_010502294.1|  PREDICTED: basic blue protein                      110   2e-26   
ref|XP_011087777.1|  PREDICTED: basic blue protein-like                 109   2e-26   
ref|NP_001051910.1|  Os03g0850900                                       109   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008781025.1|  PREDICTED: basic blue protein-like                 109   2e-26   
ref|XP_010260470.1|  PREDICTED: basic blue protein-like                 109   2e-26   
sp|P60496.1|BABL_LILLO  RecName: Full=Chemocyanin; AltName: Full=...    109   3e-26   Lilium longiflorum [Easter lily]
ref|XP_007137515.1|  hypothetical protein PHAVU_009G133600g             109   3e-26   
ref|XP_010514055.1|  PREDICTED: basic blue protein-like                 109   3e-26   
ref|NP_001049610.1|  Os03g0259100                                       108   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008775029.1|  PREDICTED: chemocyanin-like                        109   3e-26   
gb|ADP02231.1|  Cu_bind_like domain-containing protein                  108   4e-26   
ref|XP_002876842.1|  predicted protein                                  108   5e-26   
ref|XP_011014751.1|  PREDICTED: basic blue protein                      108   5e-26   
ref|XP_009404791.1|  PREDICTED: chemocyanin-like                        110   5e-26   
ref|XP_006434344.1|  hypothetical protein CICLE_v10002840mg             108   6e-26   
ref|NP_001265957.1|  basic blue protein-like precursor                  108   6e-26   
emb|CDO97529.1|  unnamed protein product                                108   6e-26   
ref|XP_006472899.1|  PREDICTED: basic blue protein-like                 108   6e-26   
gb|ABZ04879.1|  putative chemocyanin precursor                          108   6e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011027397.1|  PREDICTED: LOW QUALITY PROTEIN: carboxyvinyl...    112   6e-26   
ref|NP_001150703.1|  chemocyanin precursor                              108   8e-26   Zea mays [maize]
ref|XP_009404787.1|  PREDICTED: basic blue protein-like                 108   9e-26   
ref|XP_004165906.1|  PREDICTED: basic blue protein-like                 108   9e-26   
emb|CDY41671.1|  BnaC02g34830D                                          108   9e-26   
gb|KGN47495.1|  Basic blue protein                                      108   9e-26   
ref|XP_009129116.1|  PREDICTED: basic blue protein                      108   1e-25   
gb|AGX45477.1|  chemocyanin-like protein                                107   1e-25   
gb|KHN44270.1|  Basic blue protein                                      107   1e-25   
ref|XP_010548684.1|  PREDICTED: basic blue protein-like                 107   1e-25   
gb|EMS48727.1|  Chemocyanin                                             107   1e-25   
ref|XP_010549226.1|  PREDICTED: LOW QUALITY PROTEIN: basic blue p...    107   1e-25   
ref|XP_006349438.1|  PREDICTED: chemocyanin-like                        109   2e-25   
ref|XP_010063900.1|  PREDICTED: basic blue protein                      107   2e-25   
ref|XP_007023293.1|  Copper binding protein 6, putative                 107   2e-25   
gb|KHN47172.1|  Basic blue protein                                      107   2e-25   
ref|XP_008775007.1|  PREDICTED: basic blue protein-like                 107   2e-25   
gb|KFK33466.1|  hypothetical protein AALP_AA5G016800                    107   2e-25   
gb|KHG19540.1|  Basic blue                                              107   2e-25   
gb|AFK41897.1|  unknown                                                 107   2e-25   
gb|EYU18544.1|  hypothetical protein MIMGU_mgv1a016345mg                107   2e-25   
ref|XP_007041535.1|  Copper binding protein 6                           107   2e-25   
ref|XP_003541507.2|  PREDICTED: chemocyanin-like                        107   2e-25   
ref|XP_006650902.1|  PREDICTED: chemocyanin-like                        107   3e-25   
ref|XP_004982014.1|  PREDICTED: chemocyanin-like                        107   3e-25   
ref|XP_008339290.1|  PREDICTED: basic blue protein-like                 106   3e-25   
ref|XP_009765796.1|  PREDICTED: basic blue protein-like                 106   3e-25   
ref|XP_010692871.1|  PREDICTED: basic blue protein-like                 106   3e-25   
gb|AAM60981.1|  putative basic blue protein plantacyanin                106   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001266663.1|  chemocyanin precursor                              106   4e-25   
ref|XP_002464007.1|  hypothetical protein SORBIDRAFT_01g010500          106   4e-25   Sorghum bicolor [broomcorn]
ref|NP_001235375.1|  uncharacterized protein LOC100305948 precursor     106   4e-25   
gb|AFK38070.1|  unknown                                                 106   6e-25   
ref|NP_178388.1|  plantacyanin                                          106   6e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KHG29325.1|  Basic blue                                              105   6e-25   
gb|ACJ84194.1|  unknown                                                 105   6e-25   Medicago truncatula
ref|XP_010103882.1|  Basic blue protein                                 105   6e-25   
dbj|BAJ96641.1|  predicted protein                                      105   6e-25   
ref|XP_008441659.1|  PREDICTED: basic blue protein-like                 106   7e-25   
gb|EMT21220.1|  Basic blue protein                                      105   7e-25   
ref|XP_006649774.1|  PREDICTED: chemocyanin-like                        105   8e-25   
ref|NP_001149596.1|  chemocyanin precursor                              105   8e-25   Zea mays [maize]
gb|AEC10985.1|  basic blue protein                                      105   8e-25   
ref|XP_010241114.1|  PREDICTED: basic blue protein-like                 105   1e-24   
ref|NP_001237170.1|  uncharacterized protein LOC100499869 precursor     104   1e-24   
ref|XP_002278646.1|  PREDICTED: basic blue protein                      104   1e-24   Vitis vinifera
gb|EMS57005.1|  Basic blue protein                                      104   2e-24   
ref|XP_002447932.1|  hypothetical protein SORBIDRAFT_06g018350          104   2e-24   Sorghum bicolor [broomcorn]
gb|KDO65913.1|  hypothetical protein CISIN_1g039717mg                   104   2e-24   
gb|AFK41143.1|  unknown                                                 104   2e-24   
gb|ACG29532.1|  chemocyanin precursor                                   104   2e-24   Zea mays [maize]
ref|XP_006826881.1|  hypothetical protein AMTR_s00010p00135470          104   2e-24   
ref|XP_004144257.1|  PREDICTED: basic blue protein-like                 103   2e-24   
pdb|2CBP|A  Chain A, Cucumber Basic Protein, A Blue Copper Protein      103   3e-24   
ref|XP_004502569.1|  PREDICTED: basic blue protein-like                 104   3e-24   
gb|AFK36389.1|  unknown                                                 103   3e-24   
gb|KFK33467.1|  hypothetical protein AALP_AA5G016900                    104   3e-24   
gb|AFP73459.1|  early nodulin-like protein                              104   3e-24   
ref|XP_002468153.1|  hypothetical protein SORBIDRAFT_01g040540          103   3e-24   Sorghum bicolor [broomcorn]
gb|ABZ04882.1|  putative chemocyanin precursor                          103   3e-24   Oryza sativa Japonica Group [Japonica rice]
sp|P00303.1|BABL_CUCSA  RecName: Full=Basic blue protein; AltName...    102   4e-24   Cucumis sativus [cucumbers]
gb|EMS53389.1|  Chemocyanin                                             103   4e-24   
gb|AFK38630.1|  unknown                                                 103   4e-24   
ref|XP_007159596.1|  hypothetical protein PHAVU_002G250700g             103   5e-24   
ref|XP_006653392.1|  PREDICTED: basic blue protein-like                 103   6e-24   
ref|XP_006826880.1|  hypothetical protein AMTR_s00010p00134400          103   6e-24   
ref|XP_007019333.1|  Copper binding protein 6                           103   6e-24   
ref|XP_003560817.1|  PREDICTED: basic blue protein-like                 103   7e-24   
gb|EMS53390.1|  Chemocyanin                                             102   9e-24   
gb|EYU18547.1|  hypothetical protein MIMGU_mgv1a016285mg                102   1e-23   
gb|AFW57670.1|  hypothetical protein ZEAMMB73_536294                    102   1e-23   
ref|XP_006443619.1|  hypothetical protein CICLE_v10022827mg             102   1e-23   
ref|XP_006431923.1|  hypothetical protein CICLE_v10003124mg             102   1e-23   
gb|EMT29953.1|  Chemocyanin                                             102   1e-23   
emb|CAB65280.1|  basic blue protein                                     102   1e-23   Medicago sativa subsp. x varia
gb|KDO50927.1|  hypothetical protein CISIN_1g048131mg                   102   2e-23   
ref|XP_004149964.1|  PREDICTED: basic blue protein-like                 102   2e-23   
ref|XP_002266573.1|  PREDICTED: basic blue protein-like                 101   2e-23   Vitis vinifera
ref|XP_009405255.1|  PREDICTED: basic blue protein-like                 101   2e-23   
gb|KEH37639.1|  basic blue-like protein                                 100   2e-23   
ref|XP_008218970.1|  PREDICTED: basic blue protein-like                 101   2e-23   
ref|XP_004230515.1|  PREDICTED: basic blue protein-like                 101   3e-23   
ref|XP_002275963.1|  PREDICTED: basic blue protein                      101   3e-23   Vitis vinifera
ref|NP_001234435.1|  plantacyanin precursor                             101   3e-23   
emb|CBI23865.3|  unnamed protein product                                101   3e-23   
emb|CBI19945.3|  unnamed protein product                                102   4e-23   
gb|EMS53388.1|  Chemocyanin                                             101   4e-23   
ref|XP_010692866.1|  PREDICTED: basic blue protein-like                 100   4e-23   
ref|XP_006349402.1|  PREDICTED: basic blue protein-like                 100   5e-23   
ref|XP_002452607.1|  hypothetical protein SORBIDRAFT_04g028940          100   6e-23   Sorghum bicolor [broomcorn]
ref|XP_004301543.1|  PREDICTED: chemocyanin-like                        100   6e-23   
dbj|BAK02839.1|  predicted protein                                      100   7e-23   
ref|XP_008800754.1|  PREDICTED: basic blue protein-like                 100   9e-23   
dbj|BAJ95771.1|  predicted protein                                    99.8    1e-22   
ref|XP_009414068.1|  PREDICTED: basic blue protein-like               99.8    1e-22   
gb|EPS66274.1|  hypothetical protein M569_08503                       99.8    1e-22   
ref|XP_006826879.1|  hypothetical protein AMTR_s00010p00134160        99.8    1e-22   
ref|XP_004230514.1|  PREDICTED: basic blue protein-like               99.4    1e-22   
ref|XP_004299980.1|  PREDICTED: basic blue protein-like               99.4    2e-22   
gb|ADV57641.1|  copper binding protein 6                              99.4    2e-22   
gb|KHG30077.1|  Basic blue                                            99.4    2e-22   
ref|XP_007159595.1|  hypothetical protein PHAVU_002G250600g           99.4    2e-22   
ref|XP_006493535.1|  PREDICTED: uncharacterized protein LOC102628714    103   2e-22   
ref|NP_001149612.1|  chemocyanin precursor                            99.0    2e-22   Zea mays [maize]
ref|XP_004981033.1|  PREDICTED: chemocyanin-like                      99.4    2e-22   
gb|AFK40327.1|  unknown                                               99.0    2e-22   
ref|XP_002266922.1|  PREDICTED: basic blue protein                    99.4    2e-22   Vitis vinifera
gb|EMT29954.1|  Chemocyanin                                           99.0    2e-22   
gb|ADV57643.1|  copper binding protein 8                              99.0    3e-22   
gb|ABK23767.1|  unknown                                               99.0    3e-22   Picea sitchensis
ref|XP_004984952.1|  PREDICTED: basic blue protein-like               98.2    4e-22   
ref|XP_006349399.1|  PREDICTED: chemocyanin-like                      98.2    4e-22   
ref|XP_006349400.1|  PREDICTED: chemocyanin-like                      98.2    5e-22   
emb|CDP03862.1|  unnamed protein product                              98.2    5e-22   
ref|XP_006349401.1|  PREDICTED: chemocyanin-like                      97.8    6e-22   
ref|XP_006648513.1|  PREDICTED: chemocyanin-like                      97.8    6e-22   
ref|XP_008465594.1|  PREDICTED: basic blue protein-like               97.8    7e-22   
gb|KHG11741.1|  hypothetical protein F383_14857                       97.8    7e-22   
gb|EMS52226.1|  Basic blue protein                                    98.6    7e-22   
gb|ACG32438.1|  chemocyanin precursor                                 97.4    7e-22   Zea mays [maize]
ref|XP_004301545.1|  PREDICTED: chemocyanin-like                      97.4    1e-21   
ref|XP_011087776.1|  PREDICTED: basic blue protein-like               97.4    1e-21   
ref|XP_010109721.1|  Basic blue protein                               97.4    1e-21   
gb|EAY85251.1|  hypothetical protein OsI_06624                        96.3    2e-21   Oryza sativa Indica Group [Indian rice]
gb|ACN37046.1|  unknown                                               96.7    2e-21   Zea mays [maize]
ref|NP_001148389.1|  LOC100282003 precursor                           96.7    2e-21   Zea mays [maize]
gb|ACG40270.1|  blue copper protein precursor                         97.8    2e-21   Zea mays [maize]
gb|EEC73941.1|  hypothetical protein OsI_08810                        95.9    4e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_002275938.1|  PREDICTED: basic blue protein-like               95.1    6e-21   Vitis vinifera
emb|CAN73750.1|  hypothetical protein VITISV_021353                   95.1    6e-21   Vitis vinifera
ref|XP_006349398.1|  PREDICTED: chemocyanin-like                      95.1    7e-21   
dbj|BAK06251.1|  predicted protein                                    95.1    7e-21   
ref|XP_004149974.1|  PREDICTED: basic blue protein-like               94.7    9e-21   
ref|XP_004953818.1|  PREDICTED: chemocyanin-like                      94.7    1e-20   
gb|EMT05500.1|  Chemocyanin                                           94.4    1e-20   
ref|XP_011024698.1|  PREDICTED: basic blue protein-like               94.4    1e-20   
emb|CBI23864.3|  unnamed protein product                              95.1    1e-20   
ref|XP_007148486.1|  hypothetical protein PHAVU_006G212800g           94.4    1e-20   
ref|XP_009599432.1|  PREDICTED: basic blue protein-like               94.0    2e-20   
ref|XP_007201673.1|  hypothetical protein PRUPE_ppa022496mg           94.4    2e-20   
ref|XP_006656866.1|  PREDICTED: chemocyanin-like                      94.4    2e-20   
ref|XP_003571173.1|  PREDICTED: basic blue protein-like               94.0    2e-20   
ref|XP_008456090.1|  PREDICTED: basic blue protein-like               94.0    2e-20   
ref|XP_008789430.1|  PREDICTED: basic blue protein-like               94.0    2e-20   
ref|XP_009605937.1|  PREDICTED: basic blue protein-like               93.6    2e-20   
dbj|BAK04521.1|  predicted protein                                    93.6    2e-20   
ref|XP_004160478.1|  PREDICTED: basic blue protein-like               93.6    3e-20   
ref|NP_001048019.2|  Os02g0731400                                     93.6    3e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001172886.1|  Os02g0257100                                     93.2    3e-20   
ref|XP_002464009.1|  hypothetical protein SORBIDRAFT_01g010520        93.6    3e-20   Sorghum bicolor [broomcorn]
ref|XP_003565597.1|  PREDICTED: basic blue protein-like               93.6    3e-20   
ref|XP_008789579.1|  PREDICTED: mavicyanin-like                       94.4    4e-20   
ref|XP_006386330.1|  hypothetical protein POPTR_0002s07460g           92.4    4e-20   
ref|XP_010905831.1|  PREDICTED: basic blue protein-like               93.2    4e-20   
gb|EMT07779.1|  Mavicyanin                                            94.4    4e-20   
ref|XP_008456091.1|  PREDICTED: basic blue protein-like               92.8    5e-20   
ref|XP_004149963.1|  PREDICTED: basic blue protein-like               92.4    6e-20   
ref|XP_006647843.1|  PREDICTED: chemocyanin-like                      92.8    7e-20   
gb|KHN48106.1|  Basic blue protein                                    92.0    1e-19   
ref|XP_006650478.1|  PREDICTED: chemocyanin-like                      92.0    1e-19   
ref|NP_001141104.1|  uncharacterized protein LOC100273187 precursor   91.7    1e-19   Zea mays [maize]
ref|NP_001051043.1|  Os03g0709100                                     91.7    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001130720.1|  uncharacterized protein LOC100191824 precursor   92.8    1e-19   Zea mays [maize]
gb|EMS49012.1|  Chemocyanin                                           91.3    2e-19   
ref|XP_006826883.1|  hypothetical protein AMTR_s00010p00136250        91.3    2e-19   
ref|XP_009803053.1|  PREDICTED: basic blue protein-like               90.9    2e-19   
ref|XP_003573015.1|  PREDICTED: basic blue protein-like               90.9    2e-19   
gb|EMS61550.1|  Chemocyanin                                           91.7    3e-19   
ref|XP_002303034.1|  hypothetical protein POPTR_0002s24290g           90.5    3e-19   Populus trichocarpa [western balsam poplar]
gb|EMT07777.1|  Blue copper protein                                   91.3    5e-19   
dbj|BAJ96430.1|  predicted protein                                    90.5    5e-19   
ref|XP_003629970.1|  Basic blue protein                               90.1    5e-19   
ref|XP_006345295.1|  PREDICTED: mavicyanin-like                       91.7    5e-19   
gb|EMS62053.1|  Chemocyanin                                           89.7    7e-19   
ref|XP_002438215.1|  hypothetical protein SORBIDRAFT_10g009630        90.1    8e-19   Sorghum bicolor [broomcorn]
ref|XP_009615798.1|  PREDICTED: mavicyanin-like                       90.9    8e-19   
ref|XP_004977875.1|  PREDICTED: chemocyanin-like                      89.0    8e-19   
ref|XP_004982013.1|  PREDICTED: basic blue protein-like               89.0    1e-18   
ref|XP_006648512.1|  PREDICTED: chemocyanin-like                      89.0    1e-18   
gb|EMS50846.1|  Blue copper protein                                   90.1    1e-18   
ref|XP_009420116.1|  PREDICTED: basic blue protein-like               88.2    2e-18   
gb|EMT33682.1|  Blue copper protein                                   89.4    2e-18   
dbj|BAD53512.1|  putative chemocyanin precursor                       88.6    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ00445.1|  hypothetical protein OsI_22465                        88.2    4e-18   Oryza sativa Indica Group [Indian rice]
gb|EMT33683.1|  Blue copper protein                                   89.0    4e-18   
gb|EAY85248.1|  hypothetical protein OsI_06622                        87.4    4e-18   Oryza sativa Indica Group [Indian rice]
emb|CDO98154.1|  unnamed protein product                              89.7    4e-18   
ref|XP_006857363.1|  hypothetical protein AMTR_s00067p00118460        87.4    4e-18   
ref|XP_003533293.1|  PREDICTED: basic blue protein-like               87.4    5e-18   
dbj|BAK00202.1|  predicted protein                                    88.6    5e-18   
ref|XP_008800585.1|  PREDICTED: mavicyanin-like                       88.6    5e-18   
ref|XP_009761758.1|  PREDICTED: basic blue protein-like               87.0    5e-18   
ref|XP_010050212.1|  PREDICTED: basic blue protein-like               87.0    5e-18   
ref|XP_011087775.1|  PREDICTED: basic blue protein-like               87.4    6e-18   
ref|XP_011087774.1|  PREDICTED: basic blue protein-like               87.4    6e-18   
ref|XP_004957077.1|  PREDICTED: blue copper protein-like              87.8    6e-18   
ref|NP_001152010.1|  blue copper protein precursor                    88.2    6e-18   Zea mays [maize]
gb|ACZ74693.1|  basic blue protein                                    87.0    6e-18   Phaseolus vulgaris [French bean]
dbj|BAK01270.1|  predicted protein                                    87.4    7e-18   
ref|XP_003560832.1|  PREDICTED: basic blue protein-like               87.0    7e-18   
ref|XP_009614877.1|  PREDICTED: basic blue protein-like               88.2    7e-18   
ref|XP_002459878.1|  hypothetical protein SORBIDRAFT_02g012920        87.8    8e-18   Sorghum bicolor [broomcorn]
gb|ADP02230.1|  Cu_bind_like domain-containing protein                86.7    8e-18   
ref|XP_007155023.1|  hypothetical protein PHAVU_003G166700g           89.7    1e-17   
ref|XP_008777839.1|  PREDICTED: cucumber peeling cupredoxin-like      88.2    1e-17   
gb|EMS58905.1|  Blue copper protein                                   87.0    2e-17   
gb|EEE68013.1|  hypothetical protein OsJ_25976                        87.4    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82872.1|  hypothetical protein OsI_27745                        87.4    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_009372474.1|  PREDICTED: basic blue protein-like               85.9    2e-17   
gb|ACN28394.1|  unknown                                               87.0    2e-17   Zea mays [maize]
ref|XP_008659439.1|  PREDICTED: basic blue protein-like               86.3    2e-17   
ref|NP_001060957.1|  Os08g0137800                                     87.4    2e-17   
dbj|BAD03003.1|  putative blue copper binding protein                 87.4    2e-17   
ref|XP_006826882.1|  hypothetical protein AMTR_s00010p00136010        85.1    2e-17   
gb|EAZ41457.1|  hypothetical protein OsJ_25979                        87.0    2e-17   
gb|EAZ05531.1|  hypothetical protein OsI_27747                        87.0    2e-17   
ref|XP_010940769.1|  PREDICTED: mavicyanin-like                       86.3    3e-17   
ref|NP_001060958.2|  Os08g0138200                                     86.7    3e-17   
gb|EAZ05532.1|  hypothetical protein OsI_27748                        86.7    3e-17   
ref|XP_003560827.1|  PREDICTED: basic blue protein-like               85.5    3e-17   
ref|XP_002303318.2|  hypothetical protein POPTR_0003s04580g           86.7    3e-17   
ref|XP_006662866.1|  PREDICTED: chemocyanin-like                      85.1    3e-17   
dbj|BAD03006.1|  putative blue copper binding protein                 86.7    3e-17   
ref|XP_009770280.1|  PREDICTED: mavicyanin-like                       85.9    4e-17   
gb|EMT18582.1|  Chemocyanin                                           85.1    4e-17   
ref|XP_002459877.1|  hypothetical protein SORBIDRAFT_02g012910        85.9    4e-17   
ref|NP_001067784.1|  Os11g0428800                                     84.3    7e-17   
ref|NP_001046471.1|  Os02g0256800                                     84.3    7e-17   
ref|XP_004965194.1|  PREDICTED: chemocyanin-like                      84.3    7e-17   
ref|XP_002525715.1|  Mavicyanin, putative                             84.7    7e-17   
ref|XP_007151063.1|  hypothetical protein PHAVU_004G014900g           84.3    7e-17   
ref|XP_011081177.1|  PREDICTED: blue copper protein-like              85.5    8e-17   
emb|CDY45193.1|  BnaA06g33970D                                        83.6    8e-17   
emb|CAE04641.1|  OSJNBa0028I23.23                                     84.3    8e-17   
gb|EMS58903.1|  Blue copper protein                                   86.7    8e-17   
emb|CAH66929.1|  H0525E10.13                                          84.3    8e-17   
gb|EMT26024.1|  Blue copper protein                                   84.7    9e-17   
ref|XP_008778065.1|  PREDICTED: mavicyanin-like                       84.7    1e-16   
ref|XP_006659099.1|  PREDICTED: blue copper protein-like              85.1    1e-16   
ref|XP_011012945.1|  PREDICTED: chemocyanin-like                      85.5    1e-16   
ref|XP_002266874.1|  PREDICTED: cucumber peeling cupredoxin-like ...  84.3    1e-16   
ref|XP_010537537.1|  PREDICTED: basic blue protein                    83.6    1e-16   
ref|XP_006345294.1|  PREDICTED: mavicyanin-like                       83.2    2e-16   
ref|XP_004956273.1|  PREDICTED: blue copper protein-like              84.3    2e-16   
gb|EMS58904.1|  Mavicyanin                                            84.3    2e-16   
ref|XP_007155024.1|  hypothetical protein PHAVU_003G166800g           86.3    2e-16   
ref|XP_003532980.1|  PREDICTED: basic blue protein-like               83.2    2e-16   
ref|XP_007155014.1|  hypothetical protein PHAVU_003G165800g           85.9    2e-16   
ref|XP_002879382.1|  hypothetical protein ARALYDRAFT_482160           85.1    3e-16   
ref|XP_011081178.1|  PREDICTED: chemocyanin-like                      84.0    3e-16   
ref|XP_006421526.1|  hypothetical protein CICLE_v10006935mg           84.0    4e-16   
ref|XP_009803778.1|  PREDICTED: basic blue protein-like               83.2    4e-16   
ref|XP_002449820.1|  hypothetical protein SORBIDRAFT_05g023920        82.0    4e-16   
ref|XP_006358287.1|  PREDICTED: blue copper protein-like              84.7    5e-16   
ref|XP_010534192.1|  PREDICTED: basic blue protein-like               82.0    5e-16   
ref|XP_006358288.1|  PREDICTED: blue copper protein-like              84.7    5e-16   
gb|EMT01941.1|  Basic blue protein                                    82.0    5e-16   
ref|XP_006490063.1|  PREDICTED: blue copper protein-like              83.6    5e-16   
gb|KDO40616.1|  hypothetical protein CISIN_1g039191mg                 83.6    5e-16   
gb|EAZ01602.1|  hypothetical protein OsI_23639                        81.6    6e-16   
gb|EYU18546.1|  hypothetical protein MIMGU_mgv1a024456mg              81.3    6e-16   
ref|XP_010939704.1|  PREDICTED: blue copper protein-like              82.8    7e-16   
ref|XP_011079859.1|  PREDICTED: mavicyanin-like                       82.4    7e-16   
gb|AFK48048.1|  unknown                                               80.9    7e-16   
gb|AAC32448.1|  plantacyanin                                          81.3    8e-16   
gb|KDP39674.1|  hypothetical protein JCGZ_02694                       82.0    1e-15   
ref|XP_004957076.1|  PREDICTED: blue copper protein-like              81.3    1e-15   
ref|XP_011026167.1|  PREDICTED: mavicyanin-like                       81.6    1e-15   
gb|EMS58906.1|  Blue copper protein                                   81.3    1e-15   
ref|NP_180789.1|  uclacyanin 1                                        82.8    2e-15   
ref|XP_002319147.2|  hypothetical protein POPTR_0013s05140g           81.3    2e-15   
dbj|BAK00909.1|  predicted protein                                    81.3    2e-15   
ref|XP_002517636.1|  Blue copper protein precursor, putative          82.0    2e-15   
ref|XP_009782681.1|  PREDICTED: cucumber peeling cupredoxin-like      81.6    2e-15   
dbj|BAF01024.1|  uclacyanin I - like predicted GPI-anchored protein   82.8    2e-15   
ref|XP_011023387.1|  PREDICTED: mavicyanin-like                       81.3    2e-15   
ref|XP_002298440.2|  hypothetical protein POPTR_0001s27560g           81.3    2e-15   
dbj|BAK07364.1|  predicted protein                                    80.1    2e-15   
ref|XP_004974460.1|  PREDICTED: chemocyanin-like                      81.6    2e-15   
ref|XP_008341968.1|  PREDICTED: blue copper protein-like              82.4    2e-15   
ref|XP_001760382.1|  predicted protein                                80.9    2e-15   
ref|XP_006338690.1|  PREDICTED: blue copper protein-like              81.3    2e-15   
ref|XP_009798275.1|  PREDICTED: blue copper protein-like              81.6    2e-15   
gb|AAF75824.1|AF101788_1  phytocyanin homolog                         81.6    2e-15   
ref|XP_010414015.1|  PREDICTED: blue copper protein-like              82.0    2e-15   
ref|XP_002265643.1|  PREDICTED: cucumber peeling cupredoxin-like      81.6    2e-15   
ref|XP_001752399.1|  predicted protein                                80.5    2e-15   
ref|XP_007211224.1|  hypothetical protein PRUPE_ppa013279mg           80.1    3e-15   
gb|KDP27597.1|  hypothetical protein JCGZ_19602                       80.1    3e-15   
ref|XP_006410363.1|  hypothetical protein EUTSA_v10017076mg           82.0    3e-15   
ref|XP_003609366.1|  Blue copper protein                              82.8    3e-15   
ref|XP_009418309.1|  PREDICTED: chemocyanin-like                      80.9    3e-15   
ref|XP_011081176.1|  PREDICTED: stellacyanin-like                     80.1    4e-15   
ref|XP_002443827.1|  hypothetical protein SORBIDRAFT_07g002860        80.1    4e-15   
gb|KHG05969.1|  Chemocyanin                                           79.3    4e-15   
emb|CAN69318.1|  hypothetical protein VITISV_032660                   80.1    5e-15   
ref|XP_008230134.1|  PREDICTED: blue copper protein                   81.3    5e-15   
gb|EMT03203.1|  Blue copper protein                                   80.1    5e-15   
ref|XP_006391201.1|  hypothetical protein EUTSA_v10019549mg           79.3    5e-15   
ref|XP_009780504.1|  PREDICTED: blue copper protein-like              82.0    5e-15   
emb|CAN66124.1|  hypothetical protein VITISV_023425                   80.5    6e-15   
ref|XP_009599506.1|  PREDICTED: cucumber peeling cupredoxin-like      80.5    6e-15   
pdb|1F56|A  Chain A, Spinach Plantacyanin                             77.8    6e-15   
ref|XP_007163468.1|  hypothetical protein PHAVU_001G236700g           79.3    6e-15   
ref|NP_001234429.1|  dicyanin precursor                               81.6    6e-15   
emb|CBI36327.3|  unnamed protein product                              83.6    7e-15   
gb|KDP38892.1|  hypothetical protein JCGZ_05049                       78.2    7e-15   
ref|XP_009342269.1|  PREDICTED: blue copper protein                   80.5    7e-15   
ref|XP_011081179.1|  PREDICTED: blue copper protein-like              80.1    7e-15   
ref|XP_003597041.1|  Blue copper protein                              80.5    7e-15   
gb|AFK47720.1|  unknown                                               80.5    7e-15   
gb|EMT14986.1|  Blue copper protein                                   79.7    8e-15   
gb|EMT21853.1|  Blue copper protein                                   79.3    8e-15   
gb|EYU21648.1|  hypothetical protein MIMGU_mgv1a013921mg              79.7    9e-15   
ref|NP_001236879.1|  uncharacterized protein LOC100305545 precursor   79.3    9e-15   
ref|XP_002528609.1|  Chemocyanin precursor, putative                  78.6    1e-14   
ref|XP_002325851.1|  hypothetical protein POPTR_0019s05370g           79.0    1e-14   
ref|XP_011023469.1|  PREDICTED: blue copper protein-like              80.1    1e-14   
ref|XP_003578265.1|  PREDICTED: blue copper protein-like              79.0    1e-14   
gb|ACL51759.1|  putative phytocyanin                                  79.7    1e-14   
gb|ACJ70298.1|  putative phytocyanin                                  79.7    1e-14   
ref|XP_006653637.1|  PREDICTED: blue copper protein-like              78.2    1e-14   
gb|ACL51762.1|  putative phytocyanin                                  79.7    1e-14   
gb|ACJ70301.1|  putative phytocyanin                                  79.3    1e-14   
ref|XP_003572132.1|  PREDICTED: basic blue protein-like               77.8    1e-14   
ref|NP_001062070.1|  Os08g0482600                                     79.0    1e-14   
gb|KDP28869.1|  hypothetical protein JCGZ_14640                       79.3    1e-14   
ref|XP_007216249.1|  hypothetical protein PRUPE_ppa017076mg           79.7    1e-14   
gb|ABU56004.1|  blue copper-binding protein                           79.0    1e-14   
ref|XP_002961476.1|  hypothetical protein SELMODRAFT_69095            77.4    1e-14   
emb|CDY48260.1|  BnaC04g05190D                                        79.3    1e-14   
emb|CDP10429.1|  unnamed protein product                              79.7    1e-14   
ref|NP_001064000.1|  Os09g0572700                                     78.6    1e-14   
gb|ACJ70311.1|  putative phytocyanin                                  79.0    2e-14   
gb|ACJ70316.1|  putative phytocyanin                                  79.0    2e-14   
gb|ACN54192.1|  blue copper protein                                   78.6    2e-14   
ref|XP_004231787.1|  PREDICTED: mavicyanin                            78.2    2e-14   
ref|XP_008356283.1|  PREDICTED: receptor-like protein kinase FERONIA  82.0    2e-14   
ref|XP_010234087.1|  PREDICTED: mavicyanin-like                       78.6    2e-14   
ref|XP_010922520.1|  PREDICTED: cucumber peeling cupredoxin-like      79.3    2e-14   
gb|ACL51761.1|  putative phytocyanin                                  79.0    2e-14   
ref|XP_010106331.1|  Blue copper protein                              79.3    2e-14   
gb|AFK46705.1|  unknown                                               78.2    2e-14   
emb|CDY12217.1|  BnaC04g12470D                                        79.3    2e-14   
gb|AAU84431.1|  blue copper-binding protein                           79.0    2e-14   
ref|XP_009612880.1|  PREDICTED: blue copper protein-like              80.1    2e-14   
gb|KHN37985.1|  Blue copper protein                                   78.2    2e-14   
ref|XP_008778314.1|  PREDICTED: mavicyanin-like                       78.2    2e-14   
ref|XP_002460378.1|  hypothetical protein SORBIDRAFT_02g027260        77.8    2e-14   
ref|XP_004953983.1|  PREDICTED: blue copper protein-like              79.0    2e-14   
emb|CDX74686.1|  BnaA05g04320D                                        78.6    2e-14   
ref|XP_011081079.1|  PREDICTED: blue copper protein-like              79.0    2e-14   
gb|KHN22113.1|  Stellacyanin                                          79.7    2e-14   
ref|XP_009143067.1|  PREDICTED: uclacyanin-2-like                     78.6    3e-14   
gb|KDP37082.1|  hypothetical protein JCGZ_06138                       78.6    3e-14   
gb|AFK38402.1|  unknown                                               78.6    3e-14   
ref|XP_007030044.1|  Early nodulin 55-2-like protein                  79.0    3e-14   
ref|XP_004956272.1|  PREDICTED: blue copper protein-like              77.8    3e-14   
ref|XP_001762818.1|  predicted protein                                76.6    3e-14   
ref|NP_001149663.1|  uclacyanin-2 precursor                           77.8    3e-14   
gb|KEH23538.1|  plastocyanin-like domain protein                      77.4    3e-14   
ref|XP_001758237.1|  predicted protein                                77.0    3e-14   
ref|XP_008661974.1|  PREDICTED: uclacyanin-2 isoform X1               77.8    3e-14   
gb|EYU19038.1|  hypothetical protein MIMGU_mgv1a026525mg              77.4    3e-14   
ref|XP_010522107.1|  PREDICTED: mavicyanin                            77.8    3e-14   
ref|XP_004508477.1|  PREDICTED: blue copper protein-like              79.7    4e-14   
gb|KHG25479.1|  Blue copper                                           77.8    4e-14   
ref|XP_008238452.1|  PREDICTED: basic blue protein-like               76.6    4e-14   
ref|XP_010469615.1|  PREDICTED: blue copper protein                   78.6    4e-14   
gb|EMS59213.1|  Blue copper protein                                   77.4    4e-14   
ref|XP_004287916.1|  PREDICTED: uncharacterized protein LOC101307724  78.2    4e-14   
ref|XP_009391330.1|  PREDICTED: blue copper protein-like              77.8    4e-14   
gb|EMT07775.1|  Basic blue protein                                    76.3    4e-14   
ref|XP_003542629.1|  PREDICTED: blue copper protein-like              79.3    4e-14   
gb|EEC82871.1|  hypothetical protein OsI_27744                        77.4    4e-14   
gb|EMT31025.1|  Chemocyanin                                           76.3    4e-14   
dbj|BAD03078.1|  putative blue copper binding protein                 77.0    4e-14   
ref|XP_009627024.1|  PREDICTED: mavicyanin-like                       76.6    4e-14   
ref|XP_009116712.1|  PREDICTED: uclacyanin-2-like                     78.2    4e-14   
ref|XP_002265604.2|  PREDICTED: blue copper protein                   79.0    5e-14   
gb|ACL51760.1|  putative phytocyanin                                  77.8    5e-14   
ref|XP_004235960.1|  PREDICTED: cucumber peeling cupredoxin-like      77.8    5e-14   
ref|XP_008379120.1|  PREDICTED: mavicyanin                            77.0    5e-14   
gb|KDP41427.1|  hypothetical protein JCGZ_15834                       77.8    5e-14   
emb|CDX71822.1|  BnaC08g30520D                                        76.6    5e-14   
ref|NP_001168456.1|  uncharacterized protein LOC100382230 precursor   77.8    5e-14   
ref|XP_002299749.2|  hypothetical protein POPTR_0001s19280g           77.8    5e-14   
ref|XP_002300843.2|  hypothetical protein POPTR_0002s05340g           77.0    5e-14   
emb|CAN66123.1|  hypothetical protein VITISV_023424                   79.0    5e-14   
gb|EEC76312.1|  hypothetical protein OsI_13845                        76.3    5e-14   
ref|XP_011020150.1|  PREDICTED: umecyanin-like                        77.0    5e-14   
dbj|BAD46622.1|  blue copper-binding protein -like                    76.6    5e-14   
ref|XP_010510046.1|  PREDICTED: blue copper protein-like              78.2    5e-14   
gb|KDO55610.1|  hypothetical protein CISIN_1g030729mg                 77.0    6e-14   
ref|XP_006447099.1|  hypothetical protein CICLE_v10016947mg           77.0    6e-14   
ref|NP_001060956.1|  Os08g0137400                                     77.0    6e-14   
ref|XP_008373105.1|  PREDICTED: blue copper protein                   77.0    6e-14   
ref|NP_173222.1|  early nodulin-like protein 22                       76.3    6e-14   
ref|XP_007023289.1|  Cupredoxin superfamily protein, putative         77.0    6e-14   
gb|EEC85105.1|  hypothetical protein OsI_32489                        77.0    6e-14   
ref|XP_003624663.1|  Blue copper protein                              76.6    7e-14   
ref|XP_002452517.1|  hypothetical protein SORBIDRAFT_04g027290        77.4    7e-14   
ref|XP_004970211.1|  PREDICTED: blue copper protein-like              77.8    7e-14   
ref|XP_011034452.1|  PREDICTED: mavicyanin-like                       76.6    7e-14   
ref|XP_003575446.1|  PREDICTED: stellacyanin-like                     77.0    7e-14   
ref|XP_003576631.1|  PREDICTED: blue copper protein-like              76.6    7e-14   
ref|XP_010250148.1|  PREDICTED: umecyanin-like                        77.0    8e-14   
ref|XP_011015624.1|  PREDICTED: mavicyanin-like                       76.3    9e-14   
ref|XP_007203021.1|  hypothetical protein PRUPE_ppa018017mg           75.5    9e-14   
ref|XP_004152622.1|  PREDICTED: blue copper protein-like              77.0    9e-14   
ref|XP_006826350.1|  hypothetical protein AMTR_s00004p00119890        75.9    1e-13   
ref|XP_008455830.1|  PREDICTED: blue copper protein-like              77.4    1e-13   
ref|XP_008240514.1|  PREDICTED: stellacyanin-like                     75.9    1e-13   
ref|XP_008379599.1|  PREDICTED: blue copper protein-like              77.0    1e-13   
gb|EMT06003.1|  Stellacyanin                                          77.8    1e-13   
gb|KHG06922.1|  Blue copper                                           76.3    1e-13   
ref|XP_003549750.2|  PREDICTED: blue copper protein-like              77.0    1e-13   
ref|XP_002443828.1|  hypothetical protein SORBIDRAFT_07g002870        75.9    1e-13   
gb|ACU19678.1|  unknown                                               77.0    1e-13   
ref|XP_008341310.1|  PREDICTED: basic blue protein-like               76.3    1e-13   
ref|XP_007018694.1|  Cupredoxin superfamily protein, putative         76.3    1e-13   
ref|XP_002309922.1|  plastocyanin-like domain-containing family p...  75.1    1e-13   
ref|XP_007041533.1|  Early nodulin-like protein 22, putative          75.1    1e-13   
gb|KHN36563.1|  Early nodulin-like protein 1                          76.6    1e-13   
ref|XP_003543376.1|  PREDICTED: blue copper protein-like              76.6    1e-13   
emb|CDY65457.1|  BnaC03g71950D                                        77.0    1e-13   
gb|AAD10251.1|  blue copper-binding protein homolog                   75.9    1e-13   
ref|XP_007214402.1|  hypothetical protein PRUPE_ppa026626mg           76.3    1e-13   
ref|NP_001175373.1|  Os08g0137900                                     76.3    1e-13   
ref|XP_010515443.1|  PREDICTED: uclacyanin-3-like                     76.6    1e-13   
ref|XP_001762823.1|  predicted protein                                75.1    1e-13   



>ref|XP_009605938.1| PREDICTED: basic blue protein-like [Nicotiana tomentosiformis]
Length=120

 Score =   129 bits (325),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 2/111 (2%)
 Frame = +3

Query  129  VIAIVTMLLCGF--AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            +  ++ M+L  F    A TY VG++G WD  V++WPNGK+FK+GDVLVFNY  NVH+VVI
Sbjct  10   IFLVIFMVLFAFETTNATTYNVGDDGGWDMGVSNWPNGKNFKAGDVLVFNYPKNVHSVVI  69

Query  303  VSKENYNSCIDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            V+KENY+SC  SGK L SG+D VTL  GTSY+ICG   HC+   K+AVTA+
Sbjct  70   VNKENYDSCTPSGKTLTSGNDKVTLGKGTSYFICGKPTHCQFDQKIAVTAN  120



>ref|XP_009773795.1| PREDICTED: basic blue protein-like [Nicotiana sylvestris]
Length=120

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
            M   S   +I ++  + +       A TY VG++G WD  V++W NGK+FK+GDVLVFNY
Sbjct  1    MSGKSERSAIFLVIFMVLFTIQITNATTYNVGDDGGWDMGVSNWTNGKNFKTGDVLVFNY  60

Query  276  DPNVHNVVIVSKENYNSCIDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              NVH+VVIV+KENY+SC  SGK L SG+D VTL  GTSY+ICG   HC+   K+AVTA+
Sbjct  61   PKNVHSVVIVNKENYDSCTPSGKTLTSGNDRVTLGKGTSYFICGKPTHCQFDQKIAVTAN  120



>ref|XP_009403746.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=123

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDS  338
            AEA TY+VG N  W   V  WP GKSF++GDVLVFNY+P+VHNVV VS   YNSC     
Sbjct  25   AEAATYVVGGNSGWTFNVASWPRGKSFRAGDVLVFNYNPSVHNVVAVSAAGYNSCSAPKG  84

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             ++  SG D +TL  GT+Y+IC F GHC++GMK+AVTA+
Sbjct  85   SRVYTSGKDRITLARGTNYFICSFAGHCQSGMKIAVTAA  123



>ref|XP_008218855.1| PREDICTED: basic blue protein-like [Prunus mume]
Length=126

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 83/124 (67%), Gaps = 4/124 (3%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVF  269
             G+ S    ++++  +++LL  C +AEA +Y VG+ G W   V  WP GKSF++GDVLVF
Sbjct  3    QGRGSAGVGVVMVMCLSLLLLHCEWAEARSYTVGDAGGWSPNVAGWPKGKSFRAGDVLVF  62

Query  270  NYDPNVHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMA  443
            NY P+ HNVV V+K  Y +C    + K+ ++G D + L  G +++IC F GHC++GMK+A
Sbjct  63   NYAPSAHNVVAVNKAGYQTCSTPRAAKVFQTGKDQIKLAKGQNFFICSFPGHCQSGMKIA  122

Query  444  VTAS  455
            +TA+
Sbjct  123  ITAA  126



>ref|XP_007148487.1| hypothetical protein PHAVU_006G212900g [Phaseolus vulgaris]
 gb|ESW20481.1| hypothetical protein PHAVU_006G212900g [Phaseolus vulgaris]
Length=122

 Score =   124 bits (310),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 79/122 (65%), Gaps = 2/122 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
            M +     ++I+   V +LL   A+A +++VG+N  W     +WPNGK FK+GDVLVFNY
Sbjct  1    MAQGRGFSAMILFCCVLVLLSEMADATSFVVGDNNGWSFNTNNWPNGKKFKAGDVLVFNY  60

Query  276  DPNVHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            DP+ H+V +V    YNSC  S   K   SGHD VTL  GT+Y+IC F GHC+ GMK+A+ 
Sbjct  61   DPSHHDVRVVDVNGYNSCNPSKASKSFHSGHDQVTLAQGTTYFICSFPGHCQQGMKIAIN  120

Query  450  AS  455
            A+
Sbjct  121  AA  122



>ref|XP_009803052.1| PREDICTED: basic blue protein-like [Nicotiana sylvestris]
Length=119

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  117  DSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNV  296
             +I+ +  + +       A  Y VG+   W   V++WPNGK+FK+GDVLVF Y   VHNV
Sbjct  7    SAILWVMFLALFTIQITNAAIYNVGDGNGWTFGVSNWPNGKNFKAGDVLVFKYPKGVHNV  66

Query  297  VIVSKENYNSCIDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            VIV+K NY SC  SGKIL SG+D VTL  GT Y+ICG  GHC  G K++VTA
Sbjct  67   VIVNKANYGSCNASGKILSSGNDRVTLGKGTYYFICGIPGHCNGGQKISVTA  118



>gb|AFK43827.1| unknown [Lotus japonicus]
Length=124

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 80/122 (66%), Gaps = 2/122 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLL-CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFN  272
             G+ ++  S++V+   T +L    A A TY VG+ G W   V +WP GKSFK+GD+LVFN
Sbjct  3    QGRGNSALSVLVLLFFTFVLNWDMANAITYKVGDAGGWRYNVDNWPQGKSFKTGDILVFN  62

Query  273  YDPNVHNVVIVSKENYNSC-IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            Y+P  H+VV V +  YN+C + +GK+  SGHD +TL  G SY+IC   GHCK  MK+AV 
Sbjct  63   YNPLFHDVVAVDEAGYNNCSVQNGKVYRSGHDSITLPQGQSYFICSLPGHCKASMKIAVN  122

Query  450  AS  455
            A+
Sbjct  123  AA  124



>ref|XP_009380082.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=127

 Score =   118 bits (296),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 2/113 (2%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            ++ +A++++LL   AEA TY VG+   W   +  WP GK F++GDVLVF Y+P VHNVV 
Sbjct  15   VLWVAVLSLLLAQVAEAATYTVGDTRGWSFNMDSWPRGKRFRAGDVLVFKYNPLVHNVVA  74

Query  303  VSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            V+   YN C      ++L SG D VTL  G +Y+IC   GHC++GMKMA+ A+
Sbjct  75   VNAAGYNGCSTPRGSRVLTSGKDRVTLARGRNYFICNSVGHCQSGMKMAIVAA  127



>ref|XP_008237710.1| PREDICTED: basic blue protein-like [Prunus mume]
Length=125

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 76/121 (63%), Gaps = 2/121 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
             G+ S     +V+ +  M+  G + A TY VG +G W      WPNGK F++GDVL+FNY
Sbjct  4    QGRGSAGTIGVVVVLCLMVQLGCSNAATYKVGESGGWSFNTDSWPNGKQFRAGDVLLFNY  63

Query  276  DPNVHNVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            DP +HNVV V K  Y+SC   +  K+ +SG D + L  G +Y+IC F GHC++GMK+A+ 
Sbjct  64   DPTLHNVVAVDKGGYSSCTTPNGAKVFKSGKDRIRLGRGQNYFICNFPGHCESGMKIAIN  123

Query  450  A  452
            A
Sbjct  124  A  124



>ref|XP_003558311.1| PREDICTED: chemocyanin-like [Brachypodium distachyon]
Length=120

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 77/123 (63%), Gaps = 6/123 (5%)
 Frame = +3

Query  90   LFMGKMSTHDSIIVIAIVTMLLCG--FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVL  263
            +  G+ S    +++  +V  LL G   A A TY V     W      W  GK+F++GD+L
Sbjct  1    MAQGRGSAMQGLVIGLLVPCLLLGADIAGAATYKV----DWSMGADSWSGGKNFRAGDIL  56

Query  264  VFNYDPNVHNVVIVSKENYNSCIDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMA  443
            VFNY+P+VHNVV V    Y+SC  SG    SG+DHVTL +GT+Y+ICG +GHC  GMKMA
Sbjct  57   VFNYNPSVHNVVAVDAGGYDSCRGSGTTYSSGNDHVTLGAGTNYFICGLSGHCGAGMKMA  116

Query  444  VTA  452
            VTA
Sbjct  117  VTA  119



>ref|NP_001147285.1| chemocyanin precursor [Zea mays]
 gb|ACG26574.1| chemocyanin precursor [Zea mays]
 gb|AFW67855.1| chemocyanin [Zea mays]
Length=132

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 66/100 (66%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--ID  335
            FAE+  Y VG+ G W      WPNGK F++GDVLVF YD   HNVV VS   Y+SC   +
Sbjct  33   FAESAVYTVGDRGGWSFNTASWPNGKRFRAGDVLVFRYDARAHNVVPVSAAGYSSCSAPE  92

Query  336  SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              + L +G+D VTL  G +Y+IC F GHC+ GMK+AVTA+
Sbjct  93   GARALATGNDRVTLRRGANYFICSFPGHCQAGMKVAVTAA  132



>ref|XP_002464008.1| hypothetical protein SORBIDRAFT_01g010510 [Sorghum bicolor]
 gb|EER91006.1| hypothetical protein SORBIDRAFT_01g010510 [Sorghum bicolor]
Length=129

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 67/100 (67%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG  341
            FAE+  Y VG+ G W     +WP GK F++GDVLVF Y+P  HNVV VS   YNSC    
Sbjct  30   FAESAVYTVGDRGGWSFNTANWPKGKRFRAGDVLVFKYNPKAHNVVPVSAAGYNSCSAPR  89

Query  342  --KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              + L +G+D VTL  GT+Y+IC F GHC+ GMK+AVTA+
Sbjct  90   GVRALTTGNDRVTLKRGTNYFICSFPGHCQAGMKVAVTAA  129



>ref|XP_004290576.1| PREDICTED: basic blue protein-like [Fragaria vesca subsp. vesca]
Length=127

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 75/114 (66%), Gaps = 6/114 (5%)
 Frame = +3

Query  129  VIAIVTMLLC----GFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNV  296
            V+ +V +LLC     + +A TY VG++G W      WPNGK F++GDVL+FNYD  +HNV
Sbjct  13   VVQVVAVLLCLMAVQYVDAATYTVGDSGGWSFNTGKWPNGKQFRAGDVLIFNYDSTLHNV  72

Query  297  VIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            V V +  Y+SC      K+L SG+D V L  G +Y+IC F GHC++GMK+A+ A
Sbjct  73   VAVGRGGYSSCTTPRGAKVLTSGNDRVKLAKGQNYFICNFPGHCESGMKVAINA  126



>ref|XP_007200120.1| hypothetical protein PRUPE_ppa018507mg [Prunus persica]
 gb|EMJ01319.1| hypothetical protein PRUPE_ppa018507mg [Prunus persica]
Length=125

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 75/121 (62%), Gaps = 2/121 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
             G+ S     +V+ +  M+  G + A TY VG +G W      WPNGK F++GDVL FNY
Sbjct  4    QGRGSAGTIGVVVVLCLMVQLGCSNAATYKVGESGGWSFNTDSWPNGKQFRAGDVLSFNY  63

Query  276  DPNVHNVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            DP +HNVV V K  Y+SC   +  K+ +SG D + L  G +Y+IC F GHC++GMK+A+ 
Sbjct  64   DPTLHNVVAVDKGGYSSCTTPNGAKVYKSGKDQIRLGRGQNYFICNFPGHCQSGMKIAIN  123

Query  450  A  452
            A
Sbjct  124  A  124



>ref|XP_009605936.1| PREDICTED: chemocyanin-like [Nicotiana tomentosiformis]
Length=119

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = +3

Query  114  HDSIIVIAIVTMLLC-GFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVH  290
              S I+ AI  +L       A  Y VG+   W   V++WPNGK+FK+GDVLVF Y   +H
Sbjct  5    QGSAILWAIFMVLFTIQITNAAIYNVGDGNGWTLGVSNWPNGKNFKTGDVLVFKYPKGIH  64

Query  291  NVVIVSKENYNSCIDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            NVVIV+K NY +C  SGK L SG+D VTL  GT Y+ICG  GHC  G K++VTA+
Sbjct  65   NVVIVNKANYGTCKASGKTLSSGNDRVTLGKGTYYFICGIPGHCNGGQKISVTAN  119



>ref|XP_010926149.1| PREDICTED: chemocyanin-like [Elaeis guineensis]
Length=123

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DS  338
            AE+ TY VG++  W   V +WP GK F++GDVLVF Y P+ HNVV VS   YN C+    
Sbjct  25   AESATYNVGDSRGWTFNVVNWPRGKRFRAGDVLVFKYSPSAHNVVAVSAAAYNRCLTPRG  84

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             ++  SG+D +TL  GT+Y+IC F GHC+ GMK+AVTA+
Sbjct  85   SRVFRSGNDRITLARGTNYFICSFAGHCQAGMKIAVTAA  123



>ref|XP_009421112.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=123

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDS  338
            A+A TY+VG++G W   V  WP+GK F+ GDVLVF Y+P+VHNVV VS   Y+ C     
Sbjct  25   ADAATYVVGDSGGWTFNVVGWPSGKRFRPGDVLVFRYNPSVHNVVAVSAAGYSGCSAPTG  84

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             ++  SG+D +TL  GT+Y+IC F GHC+ GMK+AVTA
Sbjct  85   SRVFTSGNDRITLARGTNYFICSFPGHCQAGMKIAVTA  122



>gb|KHN23440.1| Basic blue protein [Glycine soja]
Length=124

 Score =   115 bits (289),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 71/121 (59%), Gaps = 2/121 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
             G+ S    I+V  +  + L   A A TY VG  G W      WPNGK F++GDVL+FNY
Sbjct  3    QGRGSASLPIVVTVVSLLCLLERANAATYSVGGPGGWTFNTNAWPNGKRFRAGDVLIFNY  62

Query  276  DPNVHNVVIVSKENYNSCIDSG--KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            D   HNVV V +  YNSC   G  K+  SG D + L  G +Y+IC + GHC++GMK+A+ 
Sbjct  63   DSTTHNVVAVDRSGYNSCKTPGGAKVFSSGKDQIKLARGQNYFICNYPGHCESGMKVAIN  122

Query  450  A  452
            A
Sbjct  123  A  123



>gb|AAK55122.1|AF172853_1 putative S-RNase binding protein p11 precursor [Nicotiana alata]
Length=123

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  117  DSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNV  296
             +I+ +  + +       A  Y VG+   W   V++WPNGK+FK+GDVLVF Y   VHNV
Sbjct  7    SAILWVIFMVLFTIQITNAAIYNVGDGNGWTFGVSNWPNGKNFKAGDVLVFKYPKGVHNV  66

Query  297  VIVSKENYNSCIDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            VIV+K NY +C  SG+ L SG+D VTL  GT Y+ICG  GHC  G K++VTA
Sbjct  67   VIVNKANYGTCNASGRTLSSGNDRVTLGKGTYYFICGIPGHCNGGQKISVTA  118



>ref|NP_001237531.1| uncharacterized protein LOC100305588 precursor [Glycine max]
 gb|ACU13343.1| unknown [Glycine max]
Length=124

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 71/121 (59%), Gaps = 2/121 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
             G+ S    I+V  +  + L   A A TY VG  G W      WPNGK F++GD+L+FNY
Sbjct  3    QGRGSASLPIVVTVVSLLCLLERANAATYSVGGPGGWTFNTNAWPNGKRFRAGDILIFNY  62

Query  276  DPNVHNVVIVSKENYNSCIDSG--KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            D   HNVV V +  YNSC   G  K+  SG D + L  G +Y+IC + GHC++GMK+A+ 
Sbjct  63   DSTTHNVVAVDRSGYNSCKTPGGAKVFSSGKDQIKLARGQNYFICNYPGHCESGMKVAIN  122

Query  450  A  452
            A
Sbjct  123  A  123



>ref|XP_003562309.1| PREDICTED: chemocyanin-like [Brachypodium distachyon]
Length=129

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 76/129 (59%), Gaps = 6/129 (5%)
 Frame = +3

Query  87   LLFMGKMSTHDSIIVIA---IVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGD  257
            +   G+ S  +  IV     +V ++  G AE+  Y VG+NG W      WP GK FK+GD
Sbjct  1    MAAQGRGSAKNMAIVAVLGMVVVLVSAGMAESAVYNVGDNGGWTFNANSWPAGKRFKAGD  60

Query  258  VLVFNYDPNVHNVVIVSKENYNSCID---SGKILESGHDHVTLTSGTSYYICGFTGHCKT  428
            VLVF YD   H+V  VS   Y +C     + K+ +SG D VTL  GT+Y+ICG  GHC+ 
Sbjct  61   VLVFKYDSTAHDVTAVSAAAYKACAKPARAAKVYKSGSDRVTLARGTNYFICGVPGHCQA  120

Query  429  GMKMAVTAS  455
            GMK+AVTA+
Sbjct  121  GMKIAVTAA  129



>gb|EYU18545.1| hypothetical protein MIMGU_mgv1a022688mg [Erythranthe guttata]
Length=119

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPN  284
            MS   +I+++  V MLL   A A +Y VG++  W   +  W NGKSF++GD LVFNY   
Sbjct  1    MSQQKTIVMLVAVMMLLSNKAYATSYNVGDSSGWAFGIAGWENGKSFRAGDSLVFNYGAG  60

Query  285  VHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             HNVV+V K +Y+SC    S     SG D++ L  G +Y+ICGF GHC+ GMK+A  AS
Sbjct  61   AHNVVVVDKASYDSCSVPASAPTYTSGQDNIVLNKGANYFICGFNGHCQAGMKIAANAS  119



>ref|XP_010932617.1| PREDICTED: basic blue protein-like [Elaeis guineensis]
Length=126

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 73/117 (62%), Gaps = 3/117 (3%)
 Frame = +3

Query  114  HDSIIVIAIVTMLL-CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVH  290
            H   + +A++ +L+ C  AE+  Y VG  G W      WPNGK F++GDVLVF Y+P  H
Sbjct  10   HSVALGVALLCLLIHCELAESALYTVGGGGGWTFNTVSWPNGKRFRAGDVLVFKYNPAAH  69

Query  291  NVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            NVV V+   YN C      K+ +SG+D + L  G +Y+IC F GHC+ GMK++VTA+
Sbjct  70   NVVAVNAVGYNRCTTPRGSKVFKSGNDRIRLRRGRNYFICNFVGHCQAGMKISVTAT  126



>tpg|DAA50956.1| TPA: chemocyanin [Zea mays]
Length=131

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 66/100 (66%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG  341
            FAE+  Y VG+ G W     +WP GK F++GDVLVF YDP  HNVV VS   Y+SC    
Sbjct  32   FAESAVYTVGDRGGWSFNTANWPKGKRFRAGDVLVFKYDPKAHNVVPVSAAGYSSCSAPR  91

Query  342  --KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              + L +G+D VTL  G +Y+IC F GHC+ GMK+AVTA+
Sbjct  92   GVRALTTGNDRVTLKRGVNYFICSFPGHCQAGMKVAVTAA  131



>ref|XP_002520251.1| Basic blue protein, putative [Ricinus communis]
 gb|EEF42037.1| Basic blue protein, putative [Ricinus communis]
Length=126

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 72/117 (62%), Gaps = 7/117 (6%)
 Frame = +3

Query  126  IVIAIVTMLLCGFA-----EAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVH  290
            + IA V  LLC         A TY VG +G W   V  WP GK FK+GD LVFNYD  VH
Sbjct  10   LAIATVVALLCLLTLTKQVRAATYTVGGSGGWTFNVDSWPKGKRFKAGDTLVFNYDSTVH  69

Query  291  NVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            NVV V+K +Y SC      K+  SG D + L  G +++ICG +GHC++GMK+A+TA+
Sbjct  70   NVVAVNKGSYTSCSAPAGAKVYTSGRDQIKLAKGQNFFICGISGHCQSGMKIAITAA  126



>ref|XP_007227174.1| hypothetical protein PRUPE_ppa021383mg [Prunus persica]
 gb|EMJ28373.1| hypothetical protein PRUPE_ppa021383mg [Prunus persica]
Length=126

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 70/102 (69%), Gaps = 2/102 (2%)
 Frame = +3

Query  156  CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--  329
            C +AEA +Y VG+ G W   V  WP GKSF++GDVLVFNY  + HNVV V+K  Y +C  
Sbjct  25   CEWAEARSYTVGDAGGWTFNVAGWPKGKSFRAGDVLVFNYASSAHNVVAVNKAGYQTCSS  84

Query  330  IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              + K+ ++G D + L  G +++IC F GHC++GMK+A+TA+
Sbjct  85   PRAAKVFQTGKDQIKLAKGQNFFICNFPGHCQSGMKIAITAA  126



>emb|CDY03030.1| BnaC07g21970D [Brassica napus]
Length=129

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 78/115 (68%), Gaps = 4/115 (3%)
 Frame = +3

Query  120  SIIVIAIVTMLLCG--FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            +I+ + +V++L+    + +A TYIVG++ KW   V DWP GK FK+GDVLVFNY+P+ HN
Sbjct  14   AIVALMVVSVLVLQSYYVQASTYIVGDSLKWAFNVVDWPKGKHFKAGDVLVFNYNPSFHN  73

Query  294  VVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            VV+V    YN+C          SG DH+TL+ G +++IC F GHC+  MK+AVTA
Sbjct  74   VVVVDSGGYNNCKTPAGATTYTSGKDHLTLSKGQNFFICNFPGHCEGNMKIAVTA  128



>ref|XP_002275987.1| PREDICTED: basic blue protein [Vitis vinifera]
 emb|CBI23866.3| unnamed protein product [Vitis vinifera]
Length=123

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIV  305
            IV+ +  +L C   +A T+ VG    W      WP GK FK+GDVLVFNY P+ HNVV V
Sbjct  12   IVLVLCLVLPCDMVDAATFTVGGASGWAFNAVGWPKGKRFKAGDVLVFNYSPSAHNVVAV  71

Query  306  SKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            +K  YN C      K+ ++G D + L  G +Y++C F GHC++GMK+AVTA+
Sbjct  72   NKAGYNGCTTPRGSKVYQTGKDQIKLVKGANYFLCNFPGHCQSGMKIAVTAT  123



>gb|EPS59878.1| hypothetical protein M569_14927, partial [Genlisea aurea]
Length=127

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 70/103 (68%), Gaps = 2/103 (2%)
 Frame = +3

Query  150  LLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC  329
               G AEA TY VG++G W   V  WP+GK+F++GD LVFNYDP++HNVV V+   YN C
Sbjct  25   FFSGAAEAATYKVGDDGGWTFNVNAWPSGKAFRAGDTLVFNYDPSMHNVVAVNNVGYNRC  84

Query  330  IDSGK--ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
                +  + +SG D VTL  G +Y+IC F GHC++GMK+A+ A
Sbjct  85   STPYRSPVYQSGGDRVTLRKGANYFICNFPGHCQSGMKIAINA  127



>ref|XP_010270378.1| PREDICTED: basic blue protein-like [Nelumbo nucifera]
Length=126

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 66/102 (65%), Gaps = 2/102 (2%)
 Frame = +3

Query  156  CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI-  332
            C    A T++VG+ G W      WPNGKSF++GDVLVF Y P +HNVV V +  YNSC  
Sbjct  25   CEMVHAATFMVGDAGGWTFNTAAWPNGKSFRAGDVLVFRYSPAIHNVVAVDRNGYNSCTT  84

Query  333  -DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
                ++L +G+D + L  G +Y+IC   GHC+ GMK+AVTA+
Sbjct  85   PRGARVLTTGNDQIKLARGQNYFICTIAGHCQAGMKIAVTAA  126



>gb|KEH37636.1| basic blue-like protein [Medicago truncatula]
Length=125

 Score =   113 bits (282),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVF  269
             G++S+  SII+++++ ML+     + AE +IVG+   W   V +WP GK+FK+GD LVF
Sbjct  3    QGRVSS-TSIILMSLLCMLVFHSNMSFAEEHIVGDGKGWSFGVQNWPAGKTFKAGDTLVF  61

Query  270  NYDPNVHNVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMA  443
            NY P  HNVV+V+K  Y+SC+     K+  SG D +TL  G +Y++CGF GHC  G K+A
Sbjct  62   NYSPTSHNVVVVNKSGYDSCVAPKGSKVYTSGADRITLAKGGNYFLCGFPGHCNLGQKIA  121

Query  444  VTAS  455
            V A+
Sbjct  122  VNAN  125



>ref|XP_009404130.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=131

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDS  338
            AEA TY VG++G W   +  W  GK F++GDVLVF Y+P+VHNVV V+   YN C     
Sbjct  33   AEAATYTVGDSGGWSFNMASWSRGKRFRAGDVLVFKYNPSVHNVVAVNAAGYNGCSTPRG  92

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             ++  SG+D +TL  G +YYIC FTGHC++GMK+A+ A+
Sbjct  93   SRVFTSGNDRITLARGRNYYICNFTGHCQSGMKIAIVAA  131



>ref|XP_009101233.1| PREDICTED: basic blue protein-like [Brassica rapa]
Length=129

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 4/115 (3%)
 Frame = +3

Query  120  SIIVIAIVTMLLCG--FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            +I+ + +V++L+    + EA TYIVG++ KW     DWP GK F +GDVLVFNY+P+ HN
Sbjct  14   AIVALMVVSVLVLQSYYVEASTYIVGDSLKWAFNAVDWPKGKHFNAGDVLVFNYNPSFHN  73

Query  294  VVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            VV+V    YNSC          SG DH+TL+ G +++IC F GHC+  MK+AVTA
Sbjct  74   VVVVDSGGYNSCKTPAGATTYTSGKDHLTLSKGQNFFICNFPGHCEGNMKIAVTA  128



>ref|XP_004488137.1| PREDICTED: chemocyanin-like [Cicer arietinum]
Length=126

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 78/117 (67%), Gaps = 5/117 (4%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            SIIV+ + +M +  C   +A+TY VG+   W   V +WP+GK+FK GD+LVFNY P VHN
Sbjct  10   SIIVMVLFSMFVFHCKKIDADTYTVGDESGWTFDVQNWPSGKTFKEGDILVFNYTPEVHN  69

Query  294  VVIVSKENYNSCIDSG--KILESGHDHVTLTSGTSYYICGFTGHCKTG-MKMAVTAS  455
            VV V++  YNSC+  G  K  ESG D +TL  G +Y+IC   GHC +G MK+A+ A+
Sbjct  70   VVRVNEYGYNSCVALGGSKFYESGADRITLAKGPNYFICSIPGHCNSGMMKIALNAN  126



>ref|XP_010425055.1| PREDICTED: basic blue protein-like [Camelina sativa]
Length=130

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 78/115 (68%), Gaps = 4/115 (3%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            +I+V+  V++LL    +A+A TY VG++G W      WP GK+F++GDVLVFNY+P+VHN
Sbjct  15   AIVVLMAVSVLLLHADYAQAATYTVGDSGVWTFNAVGWPKGKNFRAGDVLVFNYNPSVHN  74

Query  294  VVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            VV V   +YNSC      +   SG D +TL+ G +++IC F  HC++ MK+AVTA
Sbjct  75   VVKVDSGSYNSCKTPAGARTYTSGKDRITLSRGQNFFICNFPNHCESNMKIAVTA  129



>ref|XP_008339291.1| PREDICTED: basic blue protein-like [Malus domestica]
Length=124

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = +3

Query  156  CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCID  335
            C +A+A+TY VG+ G W   V  WP+GK+F++GD+LVFNY    HNVV V+K  Y +C  
Sbjct  23   CEWADAKTYTVGDRGGWTFNVAGWPSGKTFRAGDILVFNYGAAAHNVVAVNKAGYQTCNT  82

Query  336  SG--KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             G  K+ ++G D + L  G +++IC F GHC++GMK+A+TA+
Sbjct  83   PGAAKVYQTGRDQIRLAKGQNFFICNFPGHCQSGMKIAITAA  124



>ref|XP_006395754.1| hypothetical protein EUTSA_v10005123mg [Eutrema salsugineum]
 gb|ESQ33040.1| hypothetical protein EUTSA_v10005123mg [Eutrema salsugineum]
Length=129

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 76/118 (64%), Gaps = 3/118 (3%)
 Frame = +3

Query  108  STHDSIIVIAIVTMLL-CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPN  284
            +T   + ++A+  MLL   + +A TY VG +  W      WP GK FK+GDVLVFNY+P+
Sbjct  11   TTRAIVALMAVSVMLLQADYVQAATYTVGESNGWTFNAVGWPRGKHFKAGDVLVFNYNPS  70

Query  285  VHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            +HNVV+V    YN+C      K+  +G D +TL+ G +++IC F GHC++ MK+AVTA
Sbjct  71   IHNVVVVDSGGYNNCKTPAGAKVYTTGKDRITLSKGQNFFICNFPGHCESAMKIAVTA  128



>ref|XP_009368430.1| PREDICTED: basic blue protein [Pyrus x bretschneideri]
Length=113

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 70/110 (64%), Gaps = 2/110 (2%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            ++V+ +  ML   +  A    VG++G W      WPNGK F++GDVL+FNYDPN+HNVV 
Sbjct  1    MVVVVLCLMLHLEYTHAAPQAVGDSGGWTFNSDSWPNGKHFRAGDVLLFNYDPNLHNVVA  60

Query  303  VSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAV  446
            V +  Y+SC      K+  SG D V L  G +Y+IC F GHC++GMK+A+
Sbjct  61   VDRGGYSSCTTPSGAKVFRSGKDRVRLGRGQNYFICSFPGHCESGMKVAI  110



>ref|XP_004982012.1| PREDICTED: chemocyanin-like [Setaria italica]
Length=130

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG-  341
            AE+  Y VG+ G W     +WP GK F++GDVLVF Y P  HNVV VS   Y SC     
Sbjct  32   AESAVYTVGDRGGWSFNTANWPRGKRFRAGDVLVFRYSPKAHNVVPVSAAGYRSCSAPRG  91

Query  342  -KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             + L SG+D VTL  G +Y+IC F GHC+ GMK+AVTA+
Sbjct  92   VRALTSGNDRVTLKRGVNYFICSFQGHCQAGMKVAVTAA  130



>ref|NP_001051044.1| Os03g0709300 [Oryza sativa Japonica Group]
 gb|AAX95667.1| Plastocyanin-like domain, putative [Oryza sativa Japonica Group]
 gb|ABF98494.1| Chemocyanin precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12958.1| Os03g0709300 [Oryza sativa Japonica Group]
 gb|EAY91593.1| hypothetical protein OsI_13228 [Oryza sativa Indica Group]
 gb|EAZ28326.1| hypothetical protein OsJ_12301 [Oryza sativa Japonica Group]
 dbj|BAG94468.1| unnamed protein product [Oryza sativa Japonica Group]
Length=129

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 73/115 (63%), Gaps = 3/115 (3%)
 Frame = +3

Query  120  SIIVIAIVTMLLCG-FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNV  296
            +++ + ++ +LL G  AE+  Y VG+ G W      W  GK F++GDVLVF Y P+ HNV
Sbjct  15   AVLAMVLLCVLLHGELAESAVYTVGDRGGWGFNSGGWLRGKRFRAGDVLVFKYSPSAHNV  74

Query  297  VIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            V V+   Y SC      K+ +SG D VTL  GT+Y+IC F GHC+ GMK+AVTA+
Sbjct  75   VAVNAAGYKSCSAPRGAKVYKSGSDRVTLARGTNYFICSFPGHCQAGMKIAVTAA  129



>gb|ACJ84083.1| unknown [Medicago truncatula]
Length=121

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPN  284
            +    +++++    +L    A A TY VG  G W      WPNGK F++GD LVFNY P+
Sbjct  3    LGRASALVLLVCFFVLNSELAHAATYTVGGPGGWTFNTVGWPNGKRFRAGDTLVFNYSPS  62

Query  285  VHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             HNVV V+K  Y+SC      K+  SG D + L  G +Y+IC F GHC++GMK+A+ A+
Sbjct  63   AHNVVAVNKGGYDSCKTPRGAKVYRSGKDQIRLARGQNYFICNFVGHCESGMKIAINAA  121



>ref|XP_009341322.1| PREDICTED: basic blue protein-like [Pyrus x bretschneideri]
Length=124

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVV  299
            ++IVI +   L  G A A+T+ VG++  W   V DWP GK+F + D LVF Y+ + HNVV
Sbjct  13   AVIVIGLCMALHGGIAHAKTFTVGDDAGWTFNVEDWPKGKTFAADDTLVFKYNKDQHNVV  72

Query  300  IVSKENYNSCIDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            +V +  Y +C  SGK   SG+D + L  G  Y+ICG  GHC  G K+AVTA+
Sbjct  73   VVDENGYKTCTASGKEFSSGNDEIKLARGQYYFICGVPGHCDRGQKIAVTAN  124



>ref|XP_003629993.1| Basic blue protein [Medicago truncatula]
 gb|AET04469.1| basic blue-like protein [Medicago truncatula]
Length=121

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPN  284
            +    +++++    +L    A A TY VG  G W      WPNGK F++GD LVFNY P+
Sbjct  3    LGRGSALVLLVCFFVLNSELAHAATYTVGGPGGWTFNTVGWPNGKRFRAGDTLVFNYSPS  62

Query  285  VHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             HNVV V+K  Y+SC      K+  SG D + L  G +Y+IC F GHC++GMK+A+ A+
Sbjct  63   AHNVVAVNKGGYDSCKTPRGAKVYRSGKDQIRLARGQNYFICNFVGHCESGMKIAINAA  121



>ref|XP_002298184.1| basic blue copper family protein [Populus trichocarpa]
 gb|EEE82989.1| basic blue copper family protein [Populus trichocarpa]
Length=125

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 71/113 (63%), Gaps = 4/113 (4%)
 Frame = +3

Query  129  VIAIVTMLLCGF--AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            V  ++ MLL  F  A A TY VG  G W   V+ WP GKSFK+GD+LVFNY    HNVV 
Sbjct  13   VAVMLCMLLLHFDMAHAATYTVGGPGGWTFNVSGWPKGKSFKAGDILVFNYSTAAHNVVA  72

Query  303  VSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            V+K  Y+SC      K+  SG D + L  G +++IC F GHC++GMK+AV A+
Sbjct  73   VNKAGYSSCTSPRGAKVYTSGKDQIKLVKGQNFFICSFAGHCQSGMKIAVNAA  125



>ref|XP_006292005.1| hypothetical protein CARUB_v10018193mg, partial [Capsella rubella]
 gb|EOA24903.1| hypothetical protein CARUB_v10018193mg, partial [Capsella rubella]
Length=149

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 80/129 (62%), Gaps = 8/129 (6%)
 Frame = +3

Query  75   RNSCLLFMGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSG  254
            R S   F+G      +I+ +  + +L   +A+A TY VG++G W      WP GK FK+G
Sbjct  27   RGSASWFVG------AIVALMSLLLLHADYAQAATYTVGDSGVWSFNAVGWPKGKHFKAG  80

Query  255  DVLVFNYDPNVHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKT  428
            DVLVFNY+P++HNVV V   +YNSC      +   SG D +TL+ G +++IC F  HC++
Sbjct  81   DVLVFNYNPSMHNVVKVDGGSYNSCKTPAGARPYTSGKDRITLSRGQNFFICNFPNHCES  140

Query  429  GMKMAVTAS  455
             MK+AVTA+
Sbjct  141  NMKIAVTAA  149



>ref|XP_010916152.1| PREDICTED: basic blue protein-like [Elaeis guineensis]
Length=123

 Score =   110 bits (276),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DS  338
            AE+ TY VG+   W      WP GK F++GDVLVFNY+P+ HNVV V++  Y+ C     
Sbjct  25   AESATYTVGDGNGWTFNTDTWPRGKRFRAGDVLVFNYNPSAHNVVAVNRGGYSGCTTPRG  84

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             ++  SG+D +TL+ GT+Y+IC F GHC++GMK+A TA
Sbjct  85   SRVFRSGNDRITLSKGTNYFICNFAGHCQSGMKIAATA  122



>ref|XP_006387908.1| hypothetical protein POPTR_0487s00220g [Populus trichocarpa]
 gb|ERP46822.1| hypothetical protein POPTR_0487s00220g [Populus trichocarpa]
Length=126

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 69/105 (66%), Gaps = 2/105 (2%)
 Frame = +3

Query  147  MLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNS  326
            M+L G   A TY VG +G W   +  WP GK FK+GD LVF YDP +HNVV V++  Y+S
Sbjct  22   MVLTGHVHAATYTVGGSGGWTLNMDSWPKGKRFKAGDTLVFTYDPTIHNVVAVNRGGYSS  81

Query  327  CIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            CI     K+ +SG D + L+ G +++IC   GHC++GMK+A+ A+
Sbjct  82   CITPAGAKVYKSGKDQIKLSKGQNFFICNVAGHCESGMKIAINAA  126



>ref|XP_006650480.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=127

 Score =   110 bits (276),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 5/103 (5%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSA---VTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC-  329
             AE+  Y VG+ G W         WP GK F++GDVLVF Y P+ HNVV V+   YNSC 
Sbjct  25   LAESAVYTVGDRGGWSFRSFTTGGWPRGKRFRAGDVLVFKYSPSAHNVVAVNAAGYNSCS  84

Query  330  -IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
                 ++ +SG+D VTL  GT+Y+IC F GHC++GMK+A+TA+
Sbjct  85   APRGARVFKSGNDRVTLARGTNYFICSFPGHCQSGMKIAITAA  127



>ref|NP_001152423.1| chemocyanin precursor [Zea mays]
 gb|ACG47536.1| chemocyanin precursor [Zea mays]
Length=131

 Score =   110 bits (276),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG  341
            FAE+  Y VG+ G W     + P GK F++GDVLVF YDP  HNVV VS   Y+SC    
Sbjct  32   FAESAVYTVGDRGGWSFNTANLPKGKRFRAGDVLVFKYDPKAHNVVPVSAAGYSSCSAPR  91

Query  342  --KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              + L +G+D VTL  G +Y+IC F GHC+ GMK+AVTA+
Sbjct  92   GVRALTTGNDRVTLKRGVNYFICSFPGHCQAGMKVAVTAA  131



>ref|XP_010692867.1| PREDICTED: basic blue protein-like [Beta vulgaris subsp. vulgaris]
Length=126

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 74/124 (60%), Gaps = 4/124 (3%)
 Frame = +3

Query  96   MGKMSTHDSIIV-IAIVTML-LCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVF  269
             G+ S   +++V +AI+ +L L     A  Y VG  G W   V  WP GKSFK+GD+L F
Sbjct  3    QGRGSARPTMVVGVAILCLLALTHSTFAAIYTVGAGGGWTYNVQSWPRGKSFKAGDILAF  62

Query  270  NYDPNVHNVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMA  443
            NY    HNV  VS+  +NSCI     ++ +SG D + L  G +Y+IC F GHCK GM++A
Sbjct  63   NYARGSHNVAGVSRRGFNSCIAPRGARVYQSGRDRIRLRRGVNYFICTFPGHCKGGMRIA  122

Query  444  VTAS  455
            + AS
Sbjct  123  INAS  126



>ref|XP_010502294.1| PREDICTED: basic blue protein [Camelina sativa]
Length=130

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 77/115 (67%), Gaps = 4/115 (3%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            +I+ +  V++LL    +A+A TY VG++G W      WP GK+F++GDVLVFNY+P++HN
Sbjct  15   AIVALMAVSVLLLHADYAQAATYTVGDSGVWTFNAVGWPKGKNFRAGDVLVFNYNPSMHN  74

Query  294  VVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            VV V   +YNSC      +   SG D +TL+ G +++IC F  HC++ MK+AVTA
Sbjct  75   VVKVDSGSYNSCKTPAGARTYTSGKDRITLSRGQNFFICNFPNHCESNMKIAVTA  129



>ref|XP_011087777.1| PREDICTED: basic blue protein-like [Sesamum indicum]
Length=126

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 61/101 (60%), Gaps = 2/101 (2%)
 Frame = +3

Query  156  CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCID  335
            C  AEA TY VG  G W   V  WP GK FK+GD LVFNY P  HNVV V+K  Y  C  
Sbjct  25   CEVAEAATYTVGGAGGWTFNVATWPTGKRFKAGDTLVFNYSPTAHNVVAVNKGGYQGCAS  84

Query  336  S--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
                K+  +G D + L  G +++IC F GHC+ GMK+AVTA
Sbjct  85   PRGAKLYTTGKDQIKLAKGQNFFICNFPGHCQAGMKIAVTA  125



>ref|NP_001051910.1| Os03g0850900 [Oryza sativa Japonica Group]
 gb|AAO20055.1| putative basic blue copper protein [Oryza sativa Japonica Group]
 gb|ABF99923.1| Chemocyanin precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13824.1| Os03g0850900 [Oryza sativa Japonica Group]
 gb|EAY92604.1| hypothetical protein OsI_14346 [Oryza sativa Indica Group]
 gb|EAZ29321.1| hypothetical protein OsJ_13385 [Oryza sativa Japonica Group]
 dbj|BAG88354.1| unnamed protein product [Oryza sativa Japonica Group]
Length=125

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 65/101 (64%), Gaps = 3/101 (3%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDS-  338
             AE+  + VG+ G W      W NGK FK+GDVLVF YD + HNVV V+   Y  C  + 
Sbjct  25   MAESAVFTVGDRGGWGMGAGSWANGKRFKAGDVLVFKYDSSAHNVVAVNAAGYKGCTAAP  84

Query  339  --GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
               K+ +SG+D VTL  GT+Y+IC F GHC+ GMK+AVTA+
Sbjct  85   RGAKVYKSGNDRVTLARGTNYFICNFPGHCQAGMKIAVTAA  125



>ref|XP_008781025.1| PREDICTED: basic blue protein-like [Phoenix dactylifera]
Length=123

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DS  338
            AE+ TY VG++  W     +WP GK F++GDVLVF Y  + HNVV V+   YN C+    
Sbjct  25   AESATYTVGDSRGWTFNTVNWPRGKRFRAGDVLVFKYSRSAHNVVAVNAAAYNRCLTPRG  84

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             ++  SG+D +TL  GT+Y+IC F GHC+ GMK+AVTA
Sbjct  85   SRVFRSGNDRITLARGTNYFICNFPGHCQAGMKIAVTA  122



>ref|XP_010260470.1| PREDICTED: basic blue protein-like [Nelumbo nucifera]
Length=126

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 63/102 (62%), Gaps = 2/102 (2%)
 Frame = +3

Query  156  CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI-  332
            C  A A T+ VG+ G W      WP GK F +GD+LVF Y+P +HNVV V +  YNSC  
Sbjct  25   CEMARAATFTVGDAGGWTFNTAAWPRGKRFLAGDLLVFKYNPAIHNVVAVDRNGYNSCTA  84

Query  333  -DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
                + L SG+D + L  G +Y+IC   GHC+ GMK+AVTA+
Sbjct  85   PRGARTLRSGNDQIKLARGQNYFICTVAGHCQAGMKIAVTAA  126



>sp|P60496.1|BABL_LILLO RecName: Full=Chemocyanin; AltName: Full=Basic blue protein; 
AltName: Full=Plantacyanin; Flags: Precursor [Lilium longiflorum]
 gb|AAR84219.1| chemocyanin [Lilium longiflorum]
Length=126

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = +3

Query  156  CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCID  335
            C  AE+  Y VG+ G W    + WP GK+F++GDVLVF Y+P VHNVV V    Y SC  
Sbjct  25   CEVAESVVYTVGDGGGWTFGTSGWPAGKTFRAGDVLVFKYNPAVHNVVSVPAGGYKSCTA  84

Query  336  S--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            S   ++ +SG D +TL+ GT+Y+IC   GHC+ G+K+AVTA+
Sbjct  85   SPGSRVFKSGDDRITLSRGTNYFICSVPGHCQGGLKIAVTAA  126



>ref|XP_007137515.1| hypothetical protein PHAVU_009G133600g [Phaseolus vulgaris]
 gb|ESW09509.1| hypothetical protein PHAVU_009G133600g [Phaseolus vulgaris]
Length=127

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 77/127 (61%), Gaps = 7/127 (6%)
 Frame = +3

Query  90   LFMGKMSTHDSIIVIAIVTML----LCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGD  257
            +F G+ S   S++++ ++++L    L   A A TY VG  G W      WP+GK F++GD
Sbjct  1    MFQGRGSAL-SLVLVTVISLLCLLVLVERANAATYTVGGPGGWTFNTDTWPSGKRFRAGD  59

Query  258  VLVFNYDPNVHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTG  431
            VL+FNYD   HNVV V K  YNSC      K+  SG D + L  G +Y+IC + GHC++G
Sbjct  60   VLIFNYDSTNHNVVAVDKSGYNSCKTPAGAKVFRSGKDQIKLARGQNYFICNYPGHCESG  119

Query  432  MKMAVTA  452
            MK+++ A
Sbjct  120  MKVSMNA  126



>ref|XP_010514055.1| PREDICTED: basic blue protein-like [Camelina sativa]
Length=130

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 77/115 (67%), Gaps = 4/115 (3%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            +I+ +  V++LL    +A+A TY VG++G W      WP GK+F++GDVLVFNY+P++HN
Sbjct  15   AIVALMAVSVLLLHADYAQAVTYTVGDSGVWTFNAVGWPKGKNFRAGDVLVFNYNPSMHN  74

Query  294  VVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            VV V   +YNSC      +   SG D +TL+ G +++IC F  HC++ MK+AVTA
Sbjct  75   VVKVDSGSYNSCKTPAGARTYTSGKDRITLSRGQNFFICNFPNHCESNMKIAVTA  129



>ref|NP_001049610.1| Os03g0259100 [Oryza sativa Japonica Group]
 gb|ABF95068.1| Chemocyanin precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11524.1| Os03g0259100 [Oryza sativa Japonica Group]
 gb|EAY89315.1| hypothetical protein OsI_10818 [Oryza sativa Indica Group]
 gb|EAZ12895.1| hypothetical protein OsJ_02816 [Oryza sativa Japonica Group]
Length=120

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 64/97 (66%), Gaps = 4/97 (4%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSGK  344
            A A TY V     W      W  GK+F++GDVLVF+YDP+VHNVV V    Y+ C +SG 
Sbjct  28   AAAATYNV----DWSFGADSWSKGKNFRAGDVLVFSYDPSVHNVVAVDAGGYSGCRESGT  83

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
               SG+D +TL  GTSY+IC F+GHC  GMKMAVTAS
Sbjct  84   KYSSGNDRITLGRGTSYFICSFSGHCGAGMKMAVTAS  120



>ref|XP_008775029.1| PREDICTED: chemocyanin-like [Phoenix dactylifera]
Length=127

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 81/126 (64%), Gaps = 7/126 (6%)
 Frame = +3

Query  96   MGKMSTHDSIIV-IAIVTMLLCGFA--EAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLV  266
             G+ +T  ++ + + ++ + +C F   E++ YIVG+   W   V +WPNGK+F++GDVLV
Sbjct  3    QGRGTTSSTVALGLVLICLFVCQFEIIESKEYIVGDALGWTFGVANWPNGKNFQAGDVLV  62

Query  267  FNYDPNVHNVVIVSKENYNSC---IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMK  437
            F YDP  HNVV V    YNSC   ++S K+ +SG+D ++L  G +Y+ C F  HC+  +K
Sbjct  63   FRYDPQAHNVVAVDAAGYNSCKVGLNS-KVYDSGNDRISLQKGANYFFCSFANHCQMNLK  121

Query  438  MAVTAS  455
            +AV A+
Sbjct  122  IAVKAA  127



>gb|ADP02231.1| Cu_bind_like domain-containing protein [Aegilops tauschii]
 gb|EMT13062.1| Chemocyanin [Aegilops tauschii]
Length=124

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 62/100 (62%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--ID  335
            FAE++ Y VG+   W  +   WP GK F++GDVL+F Y    HNVV VS   Y SC    
Sbjct  25   FAESKVYTVGDRNGWALSSGGWPRGKRFRAGDVLLFRYGRGAHNVVAVSAAGYRSCSAAR  84

Query  336  SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             G+   SG D VTL  GT+Y+IC   GHC+ GMKMAVTA+
Sbjct  85   GGRTYNSGSDRVTLARGTNYFICSVPGHCQAGMKMAVTAA  124



>ref|XP_002876842.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53101.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=129

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            +I+ + +V++LL    + +A TY VG++G W      WP GK F++GDVLVFNY+P +HN
Sbjct  14   AIVTLMVVSVLLLQADYVQAATYTVGDSGVWTFNAVGWPKGKHFRAGDVLVFNYNPRMHN  73

Query  294  VVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            VV V   +YN+C      K   +G D +TL+ G  ++IC F GHC+  MK+AVTA
Sbjct  74   VVKVDSGSYNNCQTPAGAKTYTTGKDRITLSKGQHFFICNFPGHCENAMKIAVTA  128



>ref|XP_011014751.1| PREDICTED: basic blue protein [Populus euphratica]
Length=125

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 69/112 (62%), Gaps = 4/112 (4%)
 Frame = +3

Query  129  VIAIVTMLLCGF--AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            V  ++ MLL  F  A A TY VG  G W    + WP GKSFK+GD+L+FNY    HNVV 
Sbjct  13   VAVMLCMLLLHFDMAHAATYTVGGPGGWTFNASGWPKGKSFKAGDILIFNYSTAAHNVVA  72

Query  303  VSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            V+K  Y+SC      K+  SG D + L  G +++IC F GHC++GMK+AV A
Sbjct  73   VNKAGYSSCTSPRGAKVYTSGKDRIKLVKGQNFFICSFAGHCQSGMKIAVNA  124



>ref|XP_009404791.1| PREDICTED: chemocyanin-like [Musa acuminata subsp. malaccensis]
Length=175

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 73/114 (64%), Gaps = 7/114 (6%)
 Frame = +3

Query  132  IAIVTMLLCGFAEAE-----TYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNV  296
            +A+   LLC    +E     T++VG++G W  +   WP+GK F++GDVL F Y+P  HNV
Sbjct  61   VAMGLALLCLLVHSEVAGAATFVVGDSGGWTFSTAGWPSGKRFRAGDVLEFRYNPWAHNV  120

Query  297  VIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            V VS   Y SC  S   ++  SG+D VTL  GT+++IC   GHC++GMK+AVTA
Sbjct  121  VAVSAAGYRSCSASPAARVFTSGNDRVTLARGTNHFICSLAGHCESGMKIAVTA  174



>ref|XP_006434344.1| hypothetical protein CICLE_v10002840mg [Citrus clementina]
 gb|ESR47584.1| hypothetical protein CICLE_v10002840mg [Citrus clementina]
 gb|KDO83564.1| hypothetical protein CISIN_1g033108mg [Citrus sinensis]
Length=127

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 74/123 (60%), Gaps = 5/123 (4%)
 Frame = +3

Query  99   GKMSTHDSIIVIAIVTMLLCGFAE---AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVF  269
            G+ S   + I+ A++  LL  + E   A TY VG++G W   +  W  GK FK+GD LVF
Sbjct  4    GRGSARCATIMAALLICLLLVYIEIVDATTYTVGDSGGWSFNMASWAKGKRFKAGDTLVF  63

Query  270  NYDPNVHNVVIVSKENYNSCIDSG--KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMA  443
            NYDP +HNVV V++  Y SC   G  K+  SG D + L  G +++IC   GHC +GMK+A
Sbjct  64   NYDPTLHNVVAVNRAGYRSCTAPGGAKVYSSGKDRIKLVRGQNFFICNSAGHCGSGMKIA  123

Query  444  VTA  452
            + A
Sbjct  124  INA  126



>ref|NP_001265957.1| basic blue protein-like precursor [Cicer arietinum]
 emb|CAA10134.1| basic blue copper protein [Cicer arietinum]
Length=122

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--ID  335
             A+A  Y VG  G W      WPNGK+FK+GD LVFNY P  HNVV VSK  Y SC    
Sbjct  23   LAQAAIYTVGGAGGWTFNTIAWPNGKNFKAGDTLVFNYSPGAHNVVAVSKAGYGSCKTPR  82

Query  336  SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
              K+  SG D + L  G +Y+IC + GHC++GMK+A+ A
Sbjct  83   GAKVYRSGKDQIRLARGQNYFICNYVGHCESGMKIAINA  121



>emb|CDO97529.1| unnamed protein product [Coffea canephora]
Length=123

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
             G+ S   +  ++  + +L  G AEA  Y VG  G W+     WP+GK F++GD LVF+Y
Sbjct  3    QGRCSATFATAMMLCLLVLHSGVAEAAIYRVGGAGGWNFNTVSWPSGKRFRAGDTLVFSY  62

Query  276  DPNVHNVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAV  446
            +P +HNVV V+K  Y+SC      K+  +G+D + L  G +Y+IC + GHC++GMK+AV
Sbjct  63   NPAIHNVVAVNKAGYDSCTAPRGSKVYHTGNDQIKLVKGANYFICSYQGHCQSGMKIAV  121



>ref|XP_006472899.1| PREDICTED: basic blue protein-like [Citrus sinensis]
Length=127

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 74/123 (60%), Gaps = 5/123 (4%)
 Frame = +3

Query  99   GKMSTHDSIIVIAIVTMLLCGFAE---AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVF  269
            G+ S   + I+ A++  LL  + E   A T+ VG++G W   +  W  GK FK+GD LVF
Sbjct  4    GRRSARCATIMAALLICLLLVYIEIVDATTFTVGDSGGWSFNMASWAKGKRFKAGDTLVF  63

Query  270  NYDPNVHNVVIVSKENYNSCIDSG--KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMA  443
            NYDP +HNVV V++  Y SC   G  K+  SG D + L  G +++IC   GHC +GMK+A
Sbjct  64   NYDPTLHNVVAVNRAGYRSCTAPGGAKVYSSGKDRIKLVRGQNFFICNSAGHCGSGMKIA  123

Query  444  VTA  452
            + A
Sbjct  124  INA  126



>gb|ABZ04879.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04880.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04881.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04883.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04884.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04885.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04886.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04887.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04888.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04889.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04890.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04891.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04892.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04893.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04894.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04895.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04896.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04897.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04898.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04899.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04900.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04901.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04902.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04903.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04904.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04905.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04906.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04907.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04908.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04909.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04910.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04911.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04912.1| putative chemocyanin precursor [Oryza sativa Indica Group]
Length=127

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 64/97 (66%), Gaps = 4/97 (4%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSGK  344
            A A TY V     W      W  GK+F++GDVLVF+YDP+VHNVV V    Y+ C +SG 
Sbjct  35   AAAATYNV----DWSFGADSWSKGKNFRAGDVLVFSYDPSVHNVVAVDAGGYSGCRESGT  90

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
               SG+D +TL  GTSY+IC F+GHC  GMKMAVTAS
Sbjct  91   KYSSGNDRITLGRGTSYFICSFSGHCGAGMKMAVTAS  127



>ref|XP_011027397.1| PREDICTED: LOW QUALITY PROTEIN: carboxyvinyl-carboxyphosphonate 
phosphorylmutase, chloroplastic [Populus euphratica]
Length=290

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 78/127 (61%), Gaps = 5/127 (4%)
 Frame = +3

Query  90   LFMGKMSTHDSIIV---IAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDV  260
            L+M    + D ++V     +  M+L G   A TYIVG +G W   +  WP GK FK+GD 
Sbjct  164  LYMEGRGSADLVMVNVAALLCLMVLTGHVHAATYIVGGSGGWTLNMDSWPKGKRFKAGDT  223

Query  261  LVFNYDPNVHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGM  434
            LVF YDP +HNVV V++  Y+SCI     K+ +SG D + L+ G + +IC   GHC++GM
Sbjct  224  LVFTYDPTIHNVVAVNRGGYSSCITPAGAKVYKSGKDLIKLSKGQNLFICNVAGHCESGM  283

Query  435  KMAVTAS  455
            K+AV A+
Sbjct  284  KIAVNAA  290



>ref|NP_001150703.1| chemocyanin precursor [Zea mays]
 gb|ACG40061.1| chemocyanin precursor [Zea mays]
Length=132

 Score =   108 bits (270),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG  341
             AE+  Y VG+ G W     +WP GK F++GDVL F Y+   HNVV VS   Y SC    
Sbjct  33   LAESAVYTVGDRGGWSFNTANWPKGKRFRAGDVLAFRYNAKAHNVVPVSAAGYKSCSAPK  92

Query  342  --KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              + L +G+D VTL  GT+Y+IC F GHC+ GMK+AVTA+
Sbjct  93   GVRALTTGNDRVTLKRGTNYFICSFPGHCQAGMKIAVTAA  132



>ref|XP_009404787.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=122

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAE-----TYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            + A+  + LC F   E      + VG++  W   V +WPNGKSFK+GDVLVF Y    HN
Sbjct  7    IAALALICLCLFYHLEITAATEFTVGDSAGWSFNVQNWPNGKSFKAGDVLVFKYGLGTHN  66

Query  294  VVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            VV+V  E YNSC      K   SG+D +TL +GTSY+IC + GHC+ G+K+ VTAS
Sbjct  67   VVVVDAEGYNSCKPKSDSKTYTSGNDKITLAAGTSYFICSYPGHCEAGVKIKVTAS  122



>ref|XP_004165906.1| PREDICTED: basic blue protein-like [Cucumis sativus]
Length=132

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVS  308
            VI +V M      EA  Y VG +G W      WP GK F++GD+L FNY+P VHNVV+V+
Sbjct  22   VIGLVMMSQLESVEAAVYDVGGSGGWTFNTESWPKGKRFRAGDILRFNYNPLVHNVVVVN  81

Query  309  KENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            +  +++C      K+ +SG D + L  G SY+IC F GHC++GMK+AV A
Sbjct  82   QGGFSTCNTPAGAKVYKSGSDQIKLPKGQSYFICNFPGHCQSGMKIAVNA  131



>emb|CDY41671.1| BnaC02g34830D [Brassica napus]
Length=129

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 72/115 (63%), Gaps = 4/115 (3%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            +I+ + +V++L+    + +A TY VG +  W      WP GK FK+GDVLVFNY+P +HN
Sbjct  14   AIVALMLVSVLVLQADYVQAATYTVGESNSWAFNAVGWPTGKHFKAGDVLVFNYNPRIHN  73

Query  294  VVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            VV V    YN+C      +   SG D +TL+ G +++IC F GHC+  MK+AVTA
Sbjct  74   VVAVDSGGYNNCKTPARARTYTSGKDRITLSKGQNFFICNFPGHCEAAMKIAVTA  128



>gb|KGN47495.1| Basic blue protein [Cucumis sativus]
Length=132

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVS  308
            VI +V M      EA  Y VG +G W      WP GK F++GD+L FNY+P VHNVV+V+
Sbjct  22   VIGLVMMSQLESVEAAVYDVGGSGGWTFNTESWPKGKRFRAGDILRFNYNPLVHNVVVVN  81

Query  309  KENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            +  +++C      K+ +SG D + L  G SY+IC F GHC++GMK+AV A
Sbjct  82   QGGFSTCNTPAGAKVYKSGSDQIKLPKGQSYFICNFPGHCQSGMKIAVNA  131



>ref|XP_009129116.1| PREDICTED: basic blue protein [Brassica rapa]
 emb|CDY09351.1| BnaA02g26590D [Brassica napus]
Length=129

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 73/116 (63%), Gaps = 4/116 (3%)
 Frame = +3

Query  117  DSIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVH  290
             +I+ + +V++L+    + +A TY VG +  W      WP+GK FK+GDVLVFNY+P +H
Sbjct  13   QAIVALMLVSVLVLQADYVQAATYTVGESNGWAFNAVGWPSGKHFKAGDVLVFNYNPRIH  72

Query  291  NVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            NVV V    YN+C      +   SG D +TL+ G +++IC F GHC+  MK+AVTA
Sbjct  73   NVVAVDSGGYNNCKTPARARTYTSGKDRITLSKGQNFFICNFPGHCEAAMKIAVTA  128



>gb|AGX45477.1| chemocyanin-like protein [Triticum aestivum]
Length=126

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 3/100 (3%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDS--  338
            A+A  + VG+ G W      WP GK FK+GDVLVF YD   H+VV VS   Y +C     
Sbjct  27   AQAAVFNVGDRGGWSFDTNSWPTGKRFKAGDVLVFKYDATAHDVVAVSAAGYRACAKPAK  86

Query  339  -GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              K+ +SG D VTL  GT+Y+IC   GHC++GMK+AVTA+
Sbjct  87   GAKVYKSGADRVTLARGTNYFICSIPGHCQSGMKIAVTAA  126



>gb|KHN44270.1| Basic blue protein [Glycine soja]
Length=127

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG-  341
            A+A TY VG  G W      WP GK F++GD+L+FNYD   HNVV V +  YNSC   G 
Sbjct  29   ADAATYTVGGPGGWTFNTNAWPKGKRFRAGDILIFNYDSTTHNVVAVDRSGYNSCKTPGG  88

Query  342  -KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             K+  SG D + L  G +Y+IC + GHC++GMK+A+ A
Sbjct  89   AKVFSSGKDQIKLARGQNYFICNYPGHCESGMKVAINA  126



>ref|XP_010548684.1| PREDICTED: basic blue protein-like [Tarenaya hassleriana]
Length=121

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            I  +++  +L    A +  Y+VG++  W   V+ WPNGK+FK+GDVL F YD  +H+VV 
Sbjct  9    IAAMSVCVLLQSQVALSTNYVVGDSSGWFFGVSAWPNGKTFKAGDVLEFKYDVTMHSVVE  68

Query  303  VSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            V K +Y SC          SG D +TL++GTSY++CGF GHC  GMK+A+TA
Sbjct  69   VGKSDYESCNIPSDATTYNSGDDKITLSNGTSYFVCGFPGHCAAGMKIAITA  120



>gb|EMS48727.1| Chemocyanin [Triticum urartu]
Length=136

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVS  308
            V+ +   L  G AE+  + VG+ G W  +   WPNGK FK  DVLVFNYDP  H+VV VS
Sbjct  17   VLLVCAFLHAGVAESAEFTVGDGGGWSVSAGSWPNGKRFKGRDVLVFNYDPTAHDVVAVS  76

Query  309  KENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             E Y +C      K+ +SG D VTL  G +Y+I    G C+ GMK+ VTA+
Sbjct  77   AEGYRACAAPSGAKVYKSGADRVTLALGPNYFISSVPGDCQAGMKITVTAA  127



>ref|XP_010549226.1| PREDICTED: LOW QUALITY PROTEIN: basic blue protein-like [Tarenaya 
hassleriana]
Length=129

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDS--  338
            A A  Y VG++G W   V  WP GK F++GDVLVF Y P +HNVV V +  Y+SC     
Sbjct  31   ASAAVYTVGDSGGWTFNVVGWPRGKRFRAGDVLVFKYGPTLHNVVAVDRRGYSSCRAPAG  90

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             K   SG+D +TL  G +++IC F GHC++GMK+AV A+
Sbjct  91   AKTYRSGNDRITLKKGLNFFICSFPGHCESGMKIAVNAA  129



>ref|XP_006349438.1| PREDICTED: chemocyanin-like [Solanum tuberosum]
Length=203

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 72/110 (65%), Gaps = 3/110 (3%)
 Frame = +3

Query  129  VIAIVTMLLCGFA---EAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVV  299
            +  ++ M+L        + TY VG++  W   V++WPNGK+FK GDVLVFNY   +HNVV
Sbjct  10   IFLVIFMMLFAIQISNASTTYNVGDSNGWTFGVSNWPNGKNFKVGDVLVFNYPREIHNVV  69

Query  300  IVSKENYNSCIDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            IV+K +YN+C   GK+  SG D +TL  GT+Y+ICG  GHC    K+A+T
Sbjct  70   IVNKVDYNNCNPLGKMFNSGKDVITLKKGTTYFICGVPGHCDGAQKIAIT  119



>ref|XP_010063900.1| PREDICTED: basic blue protein [Eucalyptus grandis]
 gb|KCW71186.1| hypothetical protein EUGRSUZ_F04279 [Eucalyptus grandis]
Length=129

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 65/100 (65%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG  341
            +A A TY VG +G W   V  WP GK F++GD L+F YD  +HNVV ++K  Y+SC   G
Sbjct  30   YARAATYTVGGSGGWTLNVASWPKGKRFRAGDTLIFKYDRTLHNVVALNKGGYDSCRTPG  89

Query  342  --KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              K+  SG+D + L  G +Y+IC F GHC++ MK+AV A+
Sbjct  90   GAKVYSSGNDQIKLVKGPNYFICNFPGHCESAMKIAVNAA  129



>ref|XP_007023293.1| Copper binding protein 6, putative [Theobroma cacao]
 gb|EOY25915.1| Copper binding protein 6, putative [Theobroma cacao]
Length=123

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +3

Query  171  AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DSGK  344
            A T+ VG++  W   V+DWPNGKSFK+GD+L F Y+   HNV +V K+ ++SC   D+  
Sbjct  27   AATFKVGDDDGWRFGVSDWPNGKSFKAGDILEFVYNRANHNVAVVDKDGHDSCTVPDNAT  86

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            + ++G D +TL  G +Y+ICGFTGHC  GM +A+TA+
Sbjct  87   VFQTGDDKITLEKGENYFICGFTGHCANGMNLAITAA  123



>gb|KHN47172.1| Basic blue protein [Glycine soja]
Length=124

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 76/123 (62%), Gaps = 3/123 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
            M +  +  + +++  + +L      A TY+VG+   W   V +WPNGKSFK+GD+L F Y
Sbjct  1    MAQGRSSAATMLLLCMLVLYSEMVHAATYVVGDATGWAYNVNNWPNGKSFKAGDILEFKY  60

Query  276  DPNVHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKT-GMKMAV  446
             P  HNV+ V +  YN+CI +   ++  SG DH+ L  G +Y+ICGF GHC+  GM++AV
Sbjct  61   SPFAHNVIQVDEFGYNTCIPTFNSRLFFSGDDHIQLAKGLNYFICGFPGHCQLHGMRIAV  120

Query  447  TAS  455
             A+
Sbjct  121  NAT  123



>ref|XP_008775007.1| PREDICTED: basic blue protein-like [Phoenix dactylifera]
Length=125

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DS  338
            AE+ TY VG+   W      W  GK F++GDVLVF Y+P+ HNVV+V+   Y  C     
Sbjct  27   AESATYTVGDTNGWTFNTDTWTRGKRFRAGDVLVFKYNPSAHNVVVVNAAGYRGCTTPRG  86

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             ++L SG+D VTL  GT+Y+IC F GHC++GMK+A TA
Sbjct  87   SRVLSSGNDQVTLAKGTNYFICNFAGHCQSGMKIAATA  124



>gb|KFK33466.1| hypothetical protein AALP_AA5G016800 [Arabis alpina]
Length=130

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 72/116 (62%), Gaps = 5/116 (4%)
 Frame = +3

Query  120  SIIVIAIVTMLLCG---FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVH  290
            +I+ +  V++LL        A+TY VG++  W      WP GK FK+GDVLVFNY P+ H
Sbjct  14   AIVALMAVSVLLLQADYVQAAKTYTVGDSRGWAFNTVGWPRGKQFKAGDVLVFNYSPSFH  73

Query  291  NVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            N+V+V+ E Y  C+     K   SG D +TL+ G  ++IC F GHC++ MK+AVTA
Sbjct  74   NLVVVNSEGYKKCVTPALAKKYTSGKDRITLSKGQHFFICDFPGHCESDMKIAVTA  129



>gb|KHG19540.1| Basic blue [Gossypium arboreum]
Length=123

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 69/112 (62%), Gaps = 8/112 (7%)
 Frame = +3

Query  144  TMLLCGF------AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIV  305
            T+LLC        A++ ++ VG  G W      WP  K FK+GD LVFNY+P++HNVV V
Sbjct  12   TVLLCCLLLHFEVAQSASFTVGGRGGWTFNAAAWPKRKRFKAGDTLVFNYNPSIHNVVAV  71

Query  306  SKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            ++  Y SC      K+ +SG D + L  G +++IC + GHC+ GMK+AVTA+
Sbjct  72   NRAGYKSCKAPKGAKVFKSGKDQIKLKKGQNFFICNYIGHCQAGMKIAVTAA  123



>gb|AFK41897.1| unknown [Medicago truncatula]
Length=126

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG-  341
            A A TY VG  G W      WPNGK FK+GDVL FNYD   HNVV V K  YN+C   G 
Sbjct  28   ANAATYTVGGTGGWTYNTDTWPNGKKFKAGDVLSFNYDSTTHNVVAVDKSGYNNCKTPGG  87

Query  342  -KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             K+  SG D + L+ G +Y+IC + GHC++GMK+++ A
Sbjct  88   AKVFSSGSDQIRLSRGQNYFICSYPGHCQSGMKVSIYA  125



>gb|EYU18544.1| hypothetical protein MIMGU_mgv1a016345mg [Erythranthe guttata]
Length=125

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 2/101 (2%)
 Frame = +3

Query  156  CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCID  335
            C  AEA T+ VG  G W      WP GK F++GD LVFNY    HNVV V++  YN C  
Sbjct  24   CEVAEAATFAVGGGGGWTYNTVGWPKGKRFRAGDTLVFNYGSGYHNVVAVNRAGYNGCAT  83

Query  336  --SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
                K+ +SG+D + L  GT+Y+IC + GHC+ GMK+AVTA
Sbjct  84   PAGAKVYQSGNDQIKLAKGTNYFICNYPGHCEGGMKIAVTA  124



>ref|XP_007041535.1| Copper binding protein 6 [Theobroma cacao]
 gb|EOX97366.1| Copper binding protein 6 [Theobroma cacao]
Length=124

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 64/100 (64%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--D  335
             A+A TY VG +  W      WP GK FK+GD LVFNY+P++HNVV V++  Y SC    
Sbjct  25   LAQAATYTVGGSNGWAFNSAGWPKGKRFKAGDTLVFNYNPSIHNVVAVNRAGYKSCTTPK  84

Query  336  SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
               + +SG D + L  G +++IC + GHC+ GMK+A+TA+
Sbjct  85   GATVFQSGKDQIKLAKGQNFFICNYIGHCQAGMKVAITAA  124



>ref|XP_003541507.2| PREDICTED: chemocyanin-like [Glycine max]
Length=128

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 76/123 (62%), Gaps = 3/123 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
            M +  +  + +++  + +L      A TY+VG+   W   V +WPNGKSFK+GD+L F Y
Sbjct  5    MAQGRSSAATMLLLCMLVLYSEMVHAATYVVGDATGWAYNVNNWPNGKSFKAGDILEFKY  64

Query  276  DPNVHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKT-GMKMAV  446
             P  HNV+ V +  YN+CI +   ++  SG DH+ L  G +Y+ICGF GHC+  GM++AV
Sbjct  65   SPFAHNVIQVDEFGYNTCIPTFNSRLFFSGDDHIQLAKGLNYFICGFPGHCQLHGMRIAV  124

Query  447  TAS  455
             A+
Sbjct  125  NAT  127



>ref|XP_006650902.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=123

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 62/99 (63%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DS  338
            AE+  + VG+ G W      W +GK FK+GDVLVF YD + HNVV V    Y  C     
Sbjct  25   AESAVFTVGDRGGWGMGAGSWASGKRFKAGDVLVFKYDSSAHNVVAVDAAGYKGCTAPRG  84

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             ++ +SG D VTL  GT+Y+IC F GHC+ GMK+AVTA+
Sbjct  85   ARVFKSGSDRVTLARGTNYFICNFPGHCQAGMKIAVTAA  123



>ref|XP_004982014.1| PREDICTED: chemocyanin-like [Setaria italica]
Length=129

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 62/99 (63%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDS  338
            AE+  Y VG++  W     +WP GK F++GDVLVF Y P  HNVV V+   Y SC     
Sbjct  31   AESAVYTVGDSSGWGFNTVNWPRGKRFRAGDVLVFRYSPKAHNVVAVNAAGYGSCGAPRG  90

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             + L SG+D VTL  G +Y+IC F GHC+ GMK+AV A+
Sbjct  91   ARALTSGNDRVTLKRGANYFICSFPGHCQAGMKIAVNAA  129



>ref|XP_008339290.1| PREDICTED: basic blue protein-like [Malus domestica]
Length=122

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 0/109 (0%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVS  308
            VIAI  +L    A A+ + VG    W+  V DWPNGK+F + D LVF Y+   HNV +V 
Sbjct  14   VIAIGLVLHGEIAHAKXFTVGEGDGWNFKVHDWPNGKNFTANDTLVFKYNNAFHNVAVVD  73

Query  309  KENYNSCIDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            +  Y +C   GK+L +G+D + +  G +Y+ICGF GHC  GMK+AVTA 
Sbjct  74   ENGYRTCTVGGKLLSTGNDVIKIXQGQNYFICGFPGHCAAGMKIAVTAK  122



>ref|XP_009765796.1| PREDICTED: basic blue protein-like [Nicotiana sylvestris]
Length=125

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 69/122 (57%), Gaps = 2/122 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
             G+ S    ++V+ IV ++    A+A  Y VG+ G W      WP GK F++GD L FNY
Sbjct  4    QGRSSAMKVVLVLCIVALIQTEMAQAAVYNVGDAGGWTFNTVSWPGGKRFRAGDTLAFNY  63

Query  276  DPNVHNVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
                HNVV V+K  YN C      K+   G D + L  G +Y+IC F GHC++GMK++V 
Sbjct  64   QSGAHNVVAVNKYGYNKCRTPRGSKVYTKGGDKIKLVKGQNYFICNFPGHCESGMKISVF  123

Query  450  AS  455
            AS
Sbjct  124  AS  125



>ref|XP_010692871.1| PREDICTED: basic blue protein-like [Beta vulgaris subsp. vulgaris]
Length=123

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 70/119 (59%), Gaps = 5/119 (4%)
 Frame = +3

Query  114  HDSIIVIAIVTMLLCGFAE---AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPN  284
              S +V+ +  + L    +   A  Y VG  G W   V +WP GKSF++GD+L FNY   
Sbjct  5    RGSAMVVGVAILCLLALTQPTFAAIYSVGGAGGWTYNVQNWPRGKSFRAGDLLAFNYGRT  64

Query  285  VHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            +HNVV VSK  Y+SC      ++ ++G D V L+ G +Y+IC   GHC+ GMK+A+ A+
Sbjct  65   LHNVVAVSKRGYDSCSAPRGARVYQTGKDRVRLSRGQNYFICTLPGHCQAGMKIAINAA  123



>gb|AAM60981.1| putative basic blue protein plantacyanin [Arabidopsis thaliana]
Length=129

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            +I+ +  V++LL    + +A TY VG++G W      WP GK F++GDVLVFNY+P +HN
Sbjct  14   AIVTLMAVSVLLLQADYVQAATYTVGDSGIWTFNAVGWPKGKHFRAGDVLVFNYNPRMHN  73

Query  294  VVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            VV V   +YN+C      K   SG D +TL+ G +++IC F  HC++ MK+AVTA
Sbjct  74   VVXVDSGSYNNCKTPTGAKPYTSGKDRITLSKGQNFFICNFPNHCESDMKIAVTA  128



>ref|NP_001266663.1| chemocyanin precursor [Zea mays]
 gb|ACG40792.1| chemocyanin precursor [Zea mays]
 gb|ACR37830.1| unknown [Zea mays]
 tpg|DAA50958.1| TPA: chemocyanin [Zea mays]
Length=130

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 62/100 (62%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG  341
             AE+  Y VG+ G W     +WP GK F++GDVL F Y+   HNVV VS   Y SC    
Sbjct  31   LAESAVYTVGDRGGWSFNTANWPKGKRFRAGDVLAFRYNAKAHNVVPVSAAGYKSCSAPK  90

Query  342  --KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              + L +G+D VTL  G +Y+IC F GHC+ GMK+AVTA+
Sbjct  91   GVRALTTGNDRVTLKRGANYFICSFPGHCQAGMKIAVTAA  130



>ref|XP_002464007.1| hypothetical protein SORBIDRAFT_01g010500 [Sorghum bicolor]
 gb|EER91005.1| hypothetical protein SORBIDRAFT_01g010500 [Sorghum bicolor]
Length=128

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG  341
            FAE+  Y VG+   W     +WP GK F++GDVLVF Y+   HNVV VS   Y SC    
Sbjct  29   FAESAVYTVGDRSGWSFNTANWPKGKRFRAGDVLVFKYNAKAHNVVPVSAAGYRSCSAPR  88

Query  342  --KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              + L +G+D VTL  G +Y+IC F GHC+ GMK+AVTA+
Sbjct  89   GVRALTTGNDRVTLKRGANYFICSFPGHCQGGMKIAVTAA  128



>ref|NP_001235375.1| uncharacterized protein LOC100305948 precursor [Glycine max]
 gb|ACU13882.1| unknown [Glycine max]
Length=121

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 61/100 (61%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--ID  335
             A A TY VG++  W      WP GK F++GD L FNY P  HNVV VSK  Y+SC    
Sbjct  22   MARAATYRVGDSRGWTFNTVTWPQGKRFRAGDTLAFNYSPGAHNVVAVSKAGYDSCKTPR  81

Query  336  SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              K+  SG D + L  G +Y+IC + GHC++GMK+A+ A+
Sbjct  82   GAKVYRSGKDQIRLARGQNYFICNYVGHCESGMKIAINAA  121



>gb|AFK38070.1| unknown [Lotus japonicus]
Length=130

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 69/126 (55%), Gaps = 8/126 (6%)
 Frame = +3

Query  99   GKMSTHDSIIVIAIVTMLLCGFA------EAETYIVGNNGKWDSAVTDWPNGKSFKSGDV  260
            G+ S     +V+ +   LLC  A       A TY VG    W      WPNGK F++GDV
Sbjct  4    GRGSASLPTVVVTVGISLLCLLALQVEHANAATYTVGGPAGWSFNTDTWPNGKKFRAGDV  63

Query  261  LVFNYDPNVHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGM  434
            L+FNYD   HNVV V +  Y SC      K+L SG D + L  G +Y+IC   GHC++GM
Sbjct  64   LIFNYDSTTHNVVAVDQSGYKSCTTPAGAKVLSSGKDQIRLGRGQNYFICNCPGHCQSGM  123

Query  435  KMAVTA  452
            K+A+ A
Sbjct  124  KVAINA  129



>ref|NP_178388.1| plantacyanin [Arabidopsis thaliana]
 sp|Q8LG89.2|BABL_ARATH RecName: Full=Basic blue protein; AltName: Full=Plantacyanin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK17131.1|AF325063_1 putative basic blue protein (plantacyanin) [Arabidopsis thaliana]
 gb|AAC32449.1| plantacyanin [Arabidopsis thaliana]
 gb|AAC32906.1| putative basic blue protein (plantacyanin) [Arabidopsis thaliana]
 gb|AAL36048.1| At2g02850/T17M13.2 [Arabidopsis thaliana]
 gb|AAM19923.1| At2g02850/T17M13.2 [Arabidopsis thaliana]
 gb|AEC05633.1| plantacyanin [Arabidopsis thaliana]
Length=129

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            +I+ +  V++LL    + +A TY VG++G W      WP GK F++GDVLVFNY+P +HN
Sbjct  14   AIVTLMAVSVLLLQADYVQAATYTVGDSGIWTFNAVGWPKGKHFRAGDVLVFNYNPRMHN  73

Query  294  VVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            VV V   +YN+C      K   SG D +TL+ G +++IC F  HC++ MK+AVTA
Sbjct  74   VVKVDSGSYNNCKTPTGAKPYTSGKDRITLSKGQNFFICNFPNHCESDMKIAVTA  128



>gb|KHG29325.1| Basic blue [Gossypium arboreum]
Length=127

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 64/100 (64%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--D  335
             A+A TY VG  G W   V  W   K FK+GD LVF Y+P++HNVV V++  Y+SC    
Sbjct  28   LAQAATYTVGGTGGWAINVAGWTKDKRFKAGDTLVFKYNPSIHNVVAVNRAGYSSCTTPK  87

Query  336  SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              K+ +SG D + L  G +Y+IC + GHC+ GMK+AVTA+
Sbjct  88   GAKVYQSGKDQIKLVKGQNYFICNYAGHCQAGMKIAVTAA  127



>gb|ACJ84194.1| unknown [Medicago truncatula]
 gb|KEH35401.1| basic blue-like protein [Medicago truncatula]
Length=126

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG-  341
            A A +Y VG  G W      WPNGK FK+GDVL FNYD   HNVV V K  YN+C   G 
Sbjct  28   ANAASYTVGGTGGWTYNTDTWPNGKKFKAGDVLSFNYDSTTHNVVAVDKSGYNNCKTPGG  87

Query  342  -KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             K+  SG D + L+ G +Y+IC + GHC++GMK+++ A
Sbjct  88   AKVFSSGSDQIRLSRGQNYFICSYPGHCQSGMKVSIYA  125



>ref|XP_010103882.1| Basic blue protein [Morus notabilis]
 gb|EXB97323.1| Basic blue protein [Morus notabilis]
Length=125

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 61/101 (60%), Gaps = 3/101 (3%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC---I  332
             A A TY VG  G W   V  WP GK F++GD LVFNY    HNVV V+K  Y +C    
Sbjct  25   LARAATYTVGGAGGWTFNVAGWPKGKRFRAGDTLVFNYGRGAHNVVAVNKAGYQTCRTVP  84

Query  333  DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
               K+  SG D + L  G +++IC F GHC++GMK+AVTA+
Sbjct  85   KGAKVYTSGKDQIKLVKGQNFFICNFPGHCESGMKIAVTAA  125



>dbj|BAJ96641.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=126

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 3/100 (3%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDS--  338
            A+A  + VG+ G W      WP GK FK+GDVLVF YD   H+VV VS   Y +C     
Sbjct  27   ADAAVFNVGDRGGWSFNTNSWPAGKRFKAGDVLVFKYDATAHDVVAVSAAGYKTCAKPAK  86

Query  339  -GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              K+ +SG D VTL  GT+Y+IC   GHC++GMK+AVTA+
Sbjct  87   GAKVYKSGADRVTLARGTNYFICSIPGHCQSGMKIAVTAA  126



>ref|XP_008441659.1| PREDICTED: basic blue protein-like, partial [Cucumis melo]
Length=147

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 67/110 (61%), Gaps = 2/110 (2%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVS  308
            VI +V M      EA  Y VG +  W   V +WP G  F++GD+L FNYD ++HNVV+V+
Sbjct  37   VIGLVMMSQLESVEAAVYDVGGSSGWTFNVQNWPKGIRFRAGDILKFNYDSSIHNVVVVN  96

Query  309  KENYNSCIDSG--KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            K  Y SC   G  K+  +G D + L  G SY+IC F GHC+ GMK+AV A
Sbjct  97   KAGYASCKTPGGAKVYNTGSDQIKLPKGQSYFICNFPGHCEAGMKIAVNA  146



>gb|EMT21220.1| Basic blue protein [Aegilops tauschii]
Length=122

 Score =   105 bits (262),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 63/98 (64%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSGK  344
            A A TY V     W  A   WP+GKSF++GDVLVF+Y+P VHNVV V    YNSC  SG 
Sbjct  28   AGAATYNV----DWSFAAGSWPSGKSFRAGDVLVFSYNPAVHNVVAVDAGGYNSCRGSGA  83

Query  345  --ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
                 SG D VTL  GT+Y+IC  +GHC  GMKMAVTA
Sbjct  84   THTYTSGSDRVTLVPGTNYFICSLSGHCGLGMKMAVTA  121



>ref|XP_006649774.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=121

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSGK  344
            A A TY V     W      W  GK+F++GDVLVF+YDP+VHNVV V    Y+ C +SG 
Sbjct  29   AAAATYNV----DWSFGADSWSKGKNFRAGDVLVFSYDPSVHNVVEVDAGGYSGCRESGT  84

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
               SG+D VTL  GTSY+IC  +GHC  GMKMAVTAS
Sbjct  85   KYSSGNDRVTLGRGTSYFICSISGHCGAGMKMAVTAS  121



>ref|NP_001149596.1| chemocyanin precursor [Zea mays]
 gb|ACG35999.1| chemocyanin precursor [Zea mays]
 gb|AFW58439.1| chemocyanin [Zea mays]
Length=129

 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDS  338
            AE+  + VG+ G W  +   W NGK FK+GDVLVF YD   HNVV+V+   Y  C     
Sbjct  31   AESAVFTVGDRGGWSFSTGTWTNGKRFKAGDVLVFKYDSTAHNVVVVNAAGYKGCSAPRG  90

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             K+  SG+D VTL  GT+Y+IC   GHC++GMK+AVTA+
Sbjct  91   AKVYTSGNDRVTLARGTNYFICSIPGHCQSGMKIAVTAA  129



>gb|AEC10985.1| basic blue protein [Camellia sinensis]
Length=122

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 62/99 (63%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDS  338
            AEA TYIVG  G W      WP GK F++GD+L FNY+   HNVV V+K  Y+SC     
Sbjct  24   AEAATYIVGGAGGWTFNSVGWPKGKRFRAGDILAFNYNAQAHNVVSVNKAGYDSCKAPAG  83

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             ++  SG D + L  G +++IC   GHC +GMK+AVTA+
Sbjct  84   ARVFSSGKDQIKLVKGQNFFICSLPGHCGSGMKIAVTAA  122



>ref|XP_010241114.1| PREDICTED: basic blue protein-like [Nelumbo nucifera]
Length=129

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 2/96 (2%)
 Frame = +3

Query  171  AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDS--GK  344
            A +Y+VG++  W   V +WP+GK+FK+GD LVF+YDP +HNVV V    Y SC+ +    
Sbjct  33   ATSYVVGDDAGWTYNVQNWPDGKTFKAGDTLVFSYDPMLHNVVEVDNNGYYSCMPAVGST  92

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            I  SG+D +TL+ G  Y+ICGF GHC+  M++AV A
Sbjct  93   IYTSGNDQITLSEGPHYFICGFPGHCEAAMRIAVNA  128



>ref|NP_001237170.1| uncharacterized protein LOC100499869 precursor [Glycine max]
 gb|ACU13981.1| unknown [Glycine max]
 gb|KHN06504.1| Basic blue protein [Glycine soja]
Length=121

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 63/100 (63%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--ID  335
             A A TY VG++G W      WP GK F++GD L FNY P  HNVV V+K  Y+SC    
Sbjct  22   MARAATYTVGDSGGWTFNTVAWPKGKLFRAGDTLAFNYSPGTHNVVAVNKAGYDSCKTPR  81

Query  336  SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              K+ +SG D + L  G +Y+IC + GHC++GMK+A+ A+
Sbjct  82   GAKVYKSGTDQIRLAKGQNYFICNYVGHCESGMKIAINAA  121



>ref|XP_002278646.1| PREDICTED: basic blue protein [Vitis vinifera]
Length=126

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = +3

Query  123  IIVIAIVTMLL-CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVV  299
            +I++A++ +L+      A TY VG+   W   V +WPNGK+FK+GDVLVFNY P VHNVV
Sbjct  13   LIMVALLCLLVHSAPVHAATYTVGDADGWIYDVVNWPNGKTFKAGDVLVFNYLPEVHNVV  72

Query  300  IVSKENYNSCIDSG--KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             V    YN C      K+  SG+D +TL  GT+ +IC F GHC  GMK+ VTA 
Sbjct  73   EVDINGYNRCKAPAGSKVHNSGNDKITLVKGTNSFICTFEGHCLQGMKITVTAK  126



>gb|EMS57005.1| Basic blue protein [Triticum urartu]
Length=122

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 63/98 (64%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSGK  344
            A A TY V     W  A   WP+GK+F++GDVLVF+Y+P VHNVV V    YNSC  SG 
Sbjct  28   AGAATYNV----DWSFAAGSWPSGKTFRAGDVLVFSYNPAVHNVVAVDAGGYNSCRGSGA  83

Query  345  --ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
                 SG D VTL  GT+Y+IC  +GHC  GMKMAVTA
Sbjct  84   THTYTSGSDRVTLVPGTNYFICSLSGHCGLGMKMAVTA  121



>ref|XP_002447932.1| hypothetical protein SORBIDRAFT_06g018350 [Sorghum bicolor]
 gb|EES12260.1| hypothetical protein SORBIDRAFT_06g018350 [Sorghum bicolor]
Length=130

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 63/99 (64%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDS  338
            AE+  + VG+ G W      W NGK FK+GDVLVF YD   HNVV V+   Y  C     
Sbjct  32   AESAVFTVGDRGGWSFNTNTWTNGKRFKAGDVLVFKYDSTAHNVVAVNAAGYKGCSAPRG  91

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             K+ +SG+D VTL  GT+Y+IC   GHC++GMK+AVTA+
Sbjct  92   AKVYKSGNDRVTLARGTNYFICSIPGHCQSGMKIAVTAA  130



>gb|KDO65913.1| hypothetical protein CISIN_1g039717mg [Citrus sinensis]
Length=131

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 71/126 (56%), Gaps = 6/126 (5%)
 Frame = +3

Query  96   MGKMSTHDSIIVIA-IVTMLLCGFAEAE---TYIVGNNGKWDSAVTDWPNGKSFKSGDVL  263
             G+ S   +  V A ++ +L   F   E   T+ VG+   W   +  W NGK FK+GD L
Sbjct  6    QGRCSASQATTVAATLIVLLFLRFHSTEATSTFTVGDTSGWTYNIQSWANGKQFKAGDTL  65

Query  264  VFNYDPNVHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMK  437
            +FNYD ++HNV +V   NY SC  S   K   SG D + L+ G +Y+IC   GHC+ G+K
Sbjct  66   IFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCEAGLK  125

Query  438  MAVTAS  455
            +AV AS
Sbjct  126  LAVDAS  131



>gb|AFK41143.1| unknown [Medicago truncatula]
 gb|KEH35398.1| basic blue-like protein [Medicago truncatula]
Length=126

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 73/119 (61%), Gaps = 3/119 (3%)
 Frame = +3

Query  108  STHDSIIVIAIV-TMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPN  284
            +  + +IVI+++  M+L     AETY VG    W   +  WPNGKSF +GDVL F Y+P 
Sbjct  8    AAMNMVIVISLLCLMVLAKSTNAETYTVGGPKGWTFGIKKWPNGKSFVAGDVLDFGYNPK  67

Query  285  VHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            +HNVV+V +  Y+ C   +  K+  +G D + L  G +Y+IC   GHC++GMK+ + A+
Sbjct  68   MHNVVLVDQTGYDKCKTPEGSKVFRTGSDQIELVKGDNYFICNLPGHCQSGMKIYINAA  126



>gb|ACG29532.1| chemocyanin precursor [Zea mays]
Length=129

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 63/99 (64%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDS  338
            AE+  + VG+ G W  +   W NGK FK+GDVLVF YD   HNVV V+   Y  C     
Sbjct  31   AESAVFTVGDRGGWSFSTGTWTNGKRFKAGDVLVFKYDSTAHNVVAVNAAGYKGCSAPRG  90

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             K+  SG+D VTL  GT+Y+IC   GHC++GMK+AVTA+
Sbjct  91   AKVYTSGNDRVTLARGTNYFICSIPGHCQSGMKIAVTAA  129



>ref|XP_006826881.1| hypothetical protein AMTR_s00010p00135470 [Amborella trichopoda]
 gb|ERM94118.1| hypothetical protein AMTR_s00010p00135470 [Amborella trichopoda]
Length=123

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 2/113 (2%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            ++ +  V   L   + A TY VG++G W   V+DWP GK F +GDVLVFNY    HNVV 
Sbjct  11   LVALVFVFFGLLELSTATTYTVGDSGGWTFGVSDWPKGKKFVAGDVLVFNYPAGNHNVVP  70

Query  303  VSKENYNSC-IDSG-KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            V+ + YNSC +  G K   SG D VTL  G ++YICGF  HC  GM++   A+
Sbjct  71   VNADGYNSCSVPPGSKTYTSGEDRVTLNKGDNFYICGFADHCDAGMQIQANAA  123



>ref|XP_004144257.1| PREDICTED: basic blue protein-like [Cucumis sativus]
Length=106

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 2/97 (2%)
 Frame = +3

Query  168  EAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDSG  341
            EA  Y VG +G W      WP GK F++GD+L FNY+P VHNVV+V++  +++C      
Sbjct  9    EAAVYDVGGSGGWTFNTESWPKGKRFRAGDILRFNYNPLVHNVVVVNQGGFSTCNTPAGA  68

Query  342  KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            K+ +SG D + L  G SY+IC F GHC++GMK+AV A
Sbjct  69   KVYKSGSDQIKLPKGQSYFICNFPGHCQSGMKIAVNA  105



>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein
Length=96

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = +3

Query  180  YIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDSGKILE  353
            Y+VG +G W      WP GK F++GD+L+FNY+P++HNVV+V++  +++C      K+  
Sbjct  3    YVVGGSGGWTFNTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAGAKVYT  62

Query  354  SGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            SG D + L  G SY+IC F GHC++GMK+AV A
Sbjct  63   SGRDQIKLPKGQSYFICNFPGHCQSGMKIAVNA  95



>ref|XP_004502569.1| PREDICTED: basic blue protein-like [Cicer arietinum]
Length=126

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG-  341
            A A TY VG  G W      WP+GK FK+GDVL+F YD   HNVV V K  Y+ C   G 
Sbjct  28   ANAATYTVGGPGGWTFNTNTWPDGKKFKAGDVLIFKYDSTTHNVVAVDKSGYSGCKTPGG  87

Query  342  -KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             K+  +G D + L  G +Y+IC F GHC++GMK+A+ AS
Sbjct  88   AKVFSTGSDQIRLGRGLNYFICNFPGHCESGMKVAINAS  126



>gb|AFK36389.1| unknown [Lotus japonicus]
Length=124

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 2/123 (2%)
 Frame = +3

Query  90   LFMGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVF  269
            + +GK S    + V+++  +L    A A T+ VG+   W      WP GK F++GD LVF
Sbjct  1    MVLGKGSAMVDLAVLSLCLVLHFEMAHAATFTVGDANGWTFNTVGWPKGKRFRAGDTLVF  60

Query  270  NYDPNVHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMA  443
            NY P  HNVV V+K +Y++C      K   SG D + L  G +Y+IC F GHC++G K+A
Sbjct  61   NYSPGAHNVVAVNKASYSACKTPKGAKTYNSGSDQIKLAKGPNYFICNFAGHCESGTKVA  120

Query  444  VTA  452
            V A
Sbjct  121  VNA  123



>gb|KFK33467.1| hypothetical protein AALP_AA5G016900 [Arabis alpina]
Length=130

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 73/116 (63%), Gaps = 5/116 (4%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGF---AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVH  290
            +I+ +  V++LL       +A TY VG++  W      WP+GK FK+GDVLVFNY+P+ H
Sbjct  14   AIVALMAVSVLLLQADHNVQAATYTVGDSSGWALNAVGWPSGKQFKAGDVLVFNYNPSFH  73

Query  291  NVVIVSKENYNSCID--SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            NVV+V    Y +C+   S     SG D +TL++G  Y+IC F  HC++ MK+AVTA
Sbjct  74   NVVVVDSGGYKNCVTPASASTYTSGKDRMTLSTGPHYFICNFPSHCESDMKIAVTA  129



>gb|AFP73459.1| early nodulin-like protein [Citrus trifoliata]
 gb|AFP73460.1| early nodulin-like protein [Citrus trifoliata]
Length=131

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 71/126 (56%), Gaps = 6/126 (5%)
 Frame = +3

Query  96   MGKMSTHDSIIVIA-IVTMLLCGFAEAE---TYIVGNNGKWDSAVTDWPNGKSFKSGDVL  263
             G+ S   +  V A ++ +L  GF   E   T  VG+   W   +  W NGK FK+GD L
Sbjct  6    QGRCSASQATTVAATLLVLLFLGFHSTEATSTITVGDTSGWTYNIQSWTNGKQFKAGDTL  65

Query  264  VFNYDPNVHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMK  437
            +FNYD ++HNV +V   NY SC  S   K   SG D + L+ G +Y+IC   GHC+ G+K
Sbjct  66   IFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCEAGLK  125

Query  438  MAVTAS  455
            +AV AS
Sbjct  126  LAVDAS  131



>ref|XP_002468153.1| hypothetical protein SORBIDRAFT_01g040540 [Sorghum bicolor]
 gb|EER95151.1| hypothetical protein SORBIDRAFT_01g040540 [Sorghum bicolor]
Length=119

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 62/106 (58%), Gaps = 4/106 (4%)
 Frame = +3

Query  138  IVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKEN  317
            +   LL G A+A T+ V     W      W  GKSF++GDVL FNYDP+VHNVV V    
Sbjct  18   LAVCLLLGVADAATHRV----DWSFNADGWSKGKSFRAGDVLEFNYDPSVHNVVAVDAGG  73

Query  318  YNSCIDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            Y  C  SG    SG D +TL SGTSY+IC   GHC  GMKM V AS
Sbjct  74   YYGCRPSGTSYGSGSDRITLGSGTSYFICSLNGHCGMGMKMIVNAS  119



>gb|ABZ04882.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
Length=127

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSGK  344
            A A TY V     W         GK+F++GDVLVF+YDP+VHNVV V    Y+ C +SG 
Sbjct  35   AAAATYNV----DWSFGADSXSKGKNFRAGDVLVFSYDPSVHNVVAVDAGGYSGCRESGT  90

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
               SG+D +TL  GTSY+IC F+GHC  GMKMAVTAS
Sbjct  91   KYSSGNDRITLGRGTSYFICSFSGHCGAGMKMAVTAS  127



>sp|P00303.1|BABL_CUCSA RecName: Full=Basic blue protein; AltName: Full=CBP; AltName: 
Full=Cusacyanin; AltName: Full=Plantacyanin [Cucumis sativus]
 prf||0811264A protein,blue
Length=96

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = +3

Query  180  YIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDSGKILE  353
            Y+VG +G W      WP GK F++GD+L+FNY+P +HNVV+V++  +++C      K+  
Sbjct  3    YVVGGSGGWTFNTESWPKGKRFRAGDILLFNYNPXMHNVVVVNQGGFSTCNTPAGAKVYT  62

Query  354  SGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            SG D + L  G SY+IC F GHC++GMK+AV A
Sbjct  63   SGRDQIKLPKGQSYFICNFPGHCQSGMKIAVNA  95



>gb|EMS53389.1| Chemocyanin [Triticum urartu]
Length=129

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 61/98 (62%), Gaps = 3/98 (3%)
 Frame = +3

Query  171  AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDS---G  341
            A  + VG+ G W      WP GK FK+GDVLVF YD   H+VV VS   Y +C       
Sbjct  32   AAVFNVGDRGGWSFNTNSWPTGKRFKAGDVLVFKYDATAHDVVAVSAAGYKACAKPAKGA  91

Query  342  KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            K+ +SG D VTL  GT+Y+IC   GHC++GMK+AVTA+
Sbjct  92   KVYKSGADRVTLARGTNYFICSIPGHCQSGMKIAVTAA  129



>gb|AFK38630.1| unknown [Lotus japonicus]
Length=122

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 68/115 (59%), Gaps = 8/115 (7%)
 Frame = +3

Query  135  AIVTMLLC------GFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNV  296
            AI+ +L+C        A A TY VG  G W      WP GK F++GD LVF Y    HNV
Sbjct  8    AIMVLLVCFLALHSEMAHAATYTVGGAGGWTFNTVGWPKGKRFRAGDTLVFKYGAGAHNV  67

Query  297  VIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            V V+K  Y++C      K+  SG+D + LT G +Y+IC + GHC++GMK+A+ A+
Sbjct  68   VAVNKAAYDTCKTPRGAKVYRSGNDQIRLTRGQNYFICNYVGHCESGMKIAINAA  122



>ref|XP_007159596.1| hypothetical protein PHAVU_002G250700g [Phaseolus vulgaris]
 gb|ESW31590.1| hypothetical protein PHAVU_002G250700g [Phaseolus vulgaris]
Length=123

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 73/123 (59%), Gaps = 3/123 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLL-CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFN  272
            MG       +++I++  ++L    A A TY VG +G W      WPNGK F++GD LVF 
Sbjct  1    MGLGRGSAVVLLISLCFLVLHSQMAHAATYTVGGSGGWTFNTVGWPNGKRFRAGDTLVFK  60

Query  273  YDPNVHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAV  446
            Y    HNVV V+K  Y SC      ++ +SG+D + L  G +Y+IC + GHC++GMK+A+
Sbjct  61   YSSGAHNVVAVNKVGYGSCKTPRGARVYQSGNDQIKLVKGQNYFICNYVGHCESGMKIAI  120

Query  447  TAS  455
             A+
Sbjct  121  NAA  123



>ref|XP_006653392.1| PREDICTED: basic blue protein-like [Oryza brachyantha]
Length=136

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIV  305
            +V+A+   +    A    + VG++  W   V  WPN K FKSGDVLVF YDP+ HNVV V
Sbjct  25   VVLALRRGVQPAAASQREWPVGDSSGWTFGVVGWPNYKPFKSGDVLVFTYDPSSHNVVAV  84

Query  306  SKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            S  +Y  C    +     SG D VTL+ G +++ICGF GHC  GMK+AVTA
Sbjct  85   SDVDYALCKVPANATTYSSGDDRVTLSRGVAFFICGFPGHCDKGMKIAVTA  135



>ref|XP_006826880.1| hypothetical protein AMTR_s00010p00134400 [Amborella trichopoda]
 gb|ERM94117.1| hypothetical protein AMTR_s00010p00134400 [Amborella trichopoda]
Length=123

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 71/113 (63%), Gaps = 2/113 (2%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            ++ + +V   L   + A TY VG++G W   V+DWPNGK+F +GDVLVF Y    HNVV 
Sbjct  11   LVALVLVVFGLLELSTATTYTVGDSGGWIFGVSDWPNGKNFLAGDVLVFQYSAVHHNVVA  70

Query  303  VSKENYNSC-IDSGK-ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            V+ + YNSC +  G     SG+D +TL  G ++++CGF GHC  GMK+   A+
Sbjct  71   VNADGYNSCSVPPGSTTYTSGNDSITLQKGANFFLCGFPGHCSGGMKIQANAA  123



>ref|XP_007019333.1| Copper binding protein 6 [Theobroma cacao]
 gb|EOY16558.1| Copper binding protein 6 [Theobroma cacao]
Length=127

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = +3

Query  168  EAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDS--G  341
            +A TY VG  G W   +  WP GKSF++GDVLVFNYD  +HNVV V++E Y  C      
Sbjct  30   DAATYTVGGPGGWTFNMATWPKGKSFRAGDVLVFNYDATIHNVVAVNREAYTGCTTPAGA  89

Query  342  KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            K+  SG D + L  G +++IC   GHC++GMK+A+ A
Sbjct  90   KVYSSGKDQIKLVKGLNFFICNTAGHCESGMKIAINA  126



>ref|XP_003560817.1| PREDICTED: basic blue protein-like [Brachypodium distachyon]
Length=130

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 60/100 (60%), Gaps = 2/100 (2%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--ID  335
            FAE+  Y VG+ G W      WP GK F++GDVL F Y    HNVV V+   Y SC    
Sbjct  31   FAESAVYTVGDRGGWTLNSGGWPRGKRFRAGDVLQFKYGRGAHNVVAVNAAGYKSCSAPR  90

Query  336  SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              K+  SG+D V L+ GT+Y+IC   GHC  GMKMAVTA+
Sbjct  91   GAKVYSSGNDSVKLSRGTNYFICSIPGHCGAGMKMAVTAA  130



>gb|EMS53390.1| Chemocyanin [Triticum urartu]
Length=127

 Score =   102 bits (255),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 3/95 (3%)
 Frame = +3

Query  180  YIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC---IDSGKIL  350
            + VG+ G W      WP GK FK+GDVLVF YD   H+VV VS   Y +C    +  K+ 
Sbjct  33   FNVGDRGGWSFNTNSWPTGKRFKAGDVLVFKYDATAHDVVAVSAAGYKACAKPANGAKVY  92

Query  351  ESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            +SG D VTL  GT+Y+IC   GHC++GMK+AVTA+
Sbjct  93   KSGSDRVTLARGTNYFICSIPGHCQSGMKIAVTAA  127



>gb|EYU18547.1| hypothetical protein MIMGU_mgv1a016285mg [Erythranthe guttata]
Length=127

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 68/110 (62%), Gaps = 2/110 (2%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVS  308
            V   + MLLC  A A +Y VG++  WD  V+ W NGKSFKSGD LVFNY   +H+VV V 
Sbjct  17   VTTSIVMLLCNKACATSYTVGDSSGWDYDVSGWENGKSFKSGDTLVFNYPAGLHSVVAVD  76

Query  309  KENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            K +Y+ C    +     SG D++ L  G +Y+ICG  GHC+ GMK+A  A
Sbjct  77   KSSYDLCSVPANAPTYTSGQDNIVLNKGANYFICGIDGHCEFGMKIAANA  126



>gb|AFW57670.1| hypothetical protein ZEAMMB73_536294 [Zea mays]
Length=111

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  168  EAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDSG  341
            E+  + VG+ G W  + + W NGK FK+GDVLVF YD   HNVV V+   Y  C    S 
Sbjct  6    ESAVFTVGDRGGWSFSTSTWTNGKRFKAGDVLVFKYDSTAHNVVAVNAAGYKGCSAPRSA  65

Query  342  KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS*SIVL  470
            K+  SG+D VTL  GT+Y+IC   GHC++GMK+AV  +  I L
Sbjct  66   KVYTSGNDRVTLARGTNYFICSIPGHCQSGMKIAVPRATYIYL  108



>ref|XP_006443619.1| hypothetical protein CICLE_v10022827mg [Citrus clementina]
 ref|XP_006479305.1| PREDICTED: chemocyanin-like [Citrus sinensis]
 gb|ESR56859.1| hypothetical protein CICLE_v10022827mg [Citrus clementina]
Length=131

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 70/124 (56%), Gaps = 5/124 (4%)
 Frame = +3

Query  99   GKMSTHDSIIVIAIVTMLLCGFAEAE---TYIVGNNGKWDSAVTDWPNGKSFKSGDVLVF  269
            G  ++  + +   ++ +L   F   E   T+ VG+   W   +  W NGK FK+GD L+F
Sbjct  8    GCSASQATTVAATLLVLLFLRFHSTEATSTFTVGDTSGWTYNIQSWTNGKQFKAGDTLIF  67

Query  270  NYDPNVHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMA  443
            NYD ++HNV +V   NY SC  S   K   SG D + L+ G +Y+IC   GHC+ G+K+A
Sbjct  68   NYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCEAGLKLA  127

Query  444  VTAS  455
            V AS
Sbjct  128  VDAS  131



>ref|XP_006431923.1| hypothetical protein CICLE_v10003124mg [Citrus clementina]
 gb|ESR45163.1| hypothetical protein CICLE_v10003124mg [Citrus clementina]
Length=124

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 70/114 (61%), Gaps = 5/114 (4%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            +II +A V +LL  C    A T+ VG++G W   V +WP GK+FK GD+L FNYDP  HN
Sbjct  8    AIIAVATVLLLLMHCNIGSATTFKVGDDGGWVFGVQNWPEGKTFKCGDILEFNYDPQRHN  67

Query  294  VVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKT-GMKMAV  446
            V+IV +E ++SC      K  ++G D + L  G +++ICG   HC   GMK+ +
Sbjct  68   VIIVDQEGHDSCKPASDAKKFQTGKDQIMLNHGKNFFICGVPTHCSDHGMKLEI  121



>gb|EMT29953.1| Chemocyanin [Aegilops tauschii]
Length=127

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = +3

Query  180  YIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDS---GKIL  350
            + VG+ G W      WP GK FK+GDVLVF YD   H+VV VS   Y +C       K+ 
Sbjct  33   FNVGDRGGWSFNTNSWPTGKRFKAGDVLVFKYDATAHDVVAVSAAGYKACAKPAKGAKVY  92

Query  351  ESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            +SG D VTL  GT+Y+IC   GHC++GMK+AVTA+
Sbjct  93   KSGADRVTLARGTNYFICSIPGHCQSGMKIAVTAA  127



>emb|CAB65280.1| basic blue protein [Medicago sativa subsp. x varia]
Length=117

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = +3

Query  123  IIVIAIVTML-LCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVV  299
            + VI+++ +L L     AETY VG    W   +  WPNGKSF +GDVL F Y+P +HNVV
Sbjct  4    VTVISLLGLLFLAKSTNAETYTVGGPKGWTFGIKKWPNGKSFVAGDVLDFGYNPKMHNVV  63

Query  300  IVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            +V +  Y+ C   +  K+  +G D + L  G +Y+IC   GHC++GMK+ + A+
Sbjct  64   LVDQTGYDKCKTPEGSKVFRTGSDQIELVKGDNYFICNLPGHCQSGMKIYINAA  117



>gb|KDO50927.1| hypothetical protein CISIN_1g048131mg [Citrus sinensis]
Length=124

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 72/121 (60%), Gaps = 7/121 (6%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLL----CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFN  272
            M+      +IA+VT+LL    C    A T+ VG++G W   V +WP GK+FK GD+L FN
Sbjct  1    MAQARGSAIIAVVTVLLLLMHCNIGSATTFKVGDDGGWVFGVQNWPEGKTFKCGDILEFN  60

Query  273  YDPNVHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKT-GMKMA  443
            YDP  HNV+IV +E ++SC      K  ++G D + L  G +++ICG   HC   GMK+ 
Sbjct  61   YDPQRHNVIIVDQEGHDSCKPASDAKKFQTGKDQIVLNHGKNFFICGVPTHCSDHGMKLE  120

Query  444  V  446
            +
Sbjct  121  I  121



>ref|XP_004149964.1| PREDICTED: basic blue protein-like [Cucumis sativus]
 ref|XP_004170027.1| PREDICTED: LOW QUALITY PROTEIN: basic blue protein-like [Cucumis 
sativus]
 gb|KGN57571.1| hypothetical protein Csa_3G215590 [Cucumis sativus]
Length=125

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 70/121 (58%), Gaps = 3/121 (2%)
 Frame = +3

Query  99   GKMSTHDSIIVIAIVTMLLCG-FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
            G+ S    ++++ ++ ML     A A  Y VG    W   V  WP GK F++GD LVFNY
Sbjct  4    GRGSAMVCVVMVCMLLMLQYSHMAHAAVYTVGGAQGWTFNVASWPKGKRFRAGDTLVFNY  63

Query  276  DPNVHNVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
             P+ HNVV V++  Y+ CI     K+ ++G D + L  G +++IC   GHC+ GMK+AV 
Sbjct  64   SPSAHNVVGVNRLGYSRCITPRGSKVFQTGKDQIKLVKGQNFFICNIPGHCQGGMKIAVN  123

Query  450  A  452
            A
Sbjct  124  A  124



>ref|XP_002266573.1| PREDICTED: basic blue protein-like [Vitis vinifera]
Length=129

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 4/114 (4%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFA--EAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNV  296
            +I++A++ +L+   A     TY VG +  W     +WP GK F++GDVL FNYD  VHNV
Sbjct  15   LIMVAVIYLLIQYSAPVHGATYTVGGSAGWTFNSANWPKGKRFRAGDVLAFNYDSKVHNV  74

Query  297  VIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            V V++  Y+SC      K+ +SG + + L  G +++IC + GHC++GMK+AV A
Sbjct  75   VAVNEGGYSSCTTPAGAKVYQSGKEQIKLVKGQNFFICNYAGHCESGMKIAVNA  128



>ref|XP_009405255.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=122

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 70/121 (58%), Gaps = 5/121 (4%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAE---AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
            M+    I  +A+V + L    E   A    VG++  W   V +WPNGK+FK+GDVLVF Y
Sbjct  1    MAGRSYIAALALVCLCLFYHLEITAAAEIPVGDSDGWSFDVGNWPNGKTFKAGDVLVFKY  60

Query  276  DPNVHNVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            D   HNVV+V  E Y+SC      K   SG D +TL  GTSY+IC + GHC  GMK+ V 
Sbjct  61   DEGSHNVVVVDAEGYDSCTAKSGSKTYTSGTDKITLAKGTSYFICSYPGHCDGGMKIKVV  120

Query  450  A  452
            A
Sbjct  121  A  121



>gb|KEH37639.1| basic blue-like protein [Medicago truncatula]
Length=100

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = +3

Query  171  AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG--K  344
            A  YIVG+   W   V +W  GK+FK GD+LVFNY P +HNVVIV++  YNSC+  G  K
Sbjct  4    AAEYIVGDGKGWSFHVQNWTLGKTFKEGDILVFNYTPVIHNVVIVNELQYNSCVAIGGSK  63

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
                G D +TL  G +Y+ICG   HC  GMK+AV AS
Sbjct  64   FYYKGADRITLAKGANYFICGTPFHCNLGMKIAVNAS  100



>ref|XP_008218970.1| PREDICTED: basic blue protein-like [Prunus mume]
Length=111

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 67/111 (60%), Gaps = 1/111 (1%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKS-FKSGDVLVFNYDPNVHNVVI  302
            +++  + +  C  + A  Y VG++  W+  V DWP GK  F S D LVF Y+   HNV +
Sbjct  1    MLLLCIMLPCCEISYATNYTVGDDDGWNFKVHDWPTGKKLFHSHDTLVFKYNNGQHNVAV  60

Query  303  VSKENYNSCIDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            V +  Y +C  S ++  SG+D + L  G +Y+ICGF GHC  GMKMAVTA+
Sbjct  61   VDENGYTTCTISDQVFSSGNDEIKLQHGQNYFICGFPGHCAAGMKMAVTAT  111



>ref|XP_004230515.1| PREDICTED: basic blue protein-like [Solanum lycopersicum]
Length=120

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 63/112 (56%), Gaps = 2/112 (2%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            + V+ IV ++      A  Y VG  G W      WP GK F++GDVL FNY    HNVV 
Sbjct  8    VFVLCIVVLIQAEITHAAVYNVGGTGGWTFNTVGWPKGKRFRAGDVLTFNYSSGAHNVVA  67

Query  303  VSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            V+K  YNSC      K+   G D V L  G +Y+IC F GHC++GMK++V A
Sbjct  68   VNKGGYNSCSTPRGAKVYNKGGDKVKLVKGQNYFICNFPGHCQSGMKISVFA  119



>ref|XP_002275963.1| PREDICTED: basic blue protein [Vitis vinifera]
Length=124

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVS  308
            V+    +L C  A A TY VG    W   V  WP GK F +GD+LVFNY+   H+VV V+
Sbjct  13   VLLFCLLLHCDTAHATTYAVGGAKGWTLDVVGWPYGKRFMAGDILVFNYNAAAHDVVSVN  72

Query  309  KENYNSCI---DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            K  YN+C     + K+  +G D + L  G +++IC F GHC++GMK+A+TA
Sbjct  73   KVGYNTCTMPRGASKVYHTGKDQIKLVKGQNFFICSFPGHCQSGMKIAITA  123



>ref|NP_001234435.1| plantacyanin precursor [Solanum lycopersicum]
 gb|AAF66243.1|AF243181_1 plantacyanin [Solanum lycopersicum]
Length=122

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 69/112 (62%), Gaps = 1/112 (1%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            +IV+ +  +L    + A TY  G+   W   +  WPNGK+F +GDV+ F Y  + HNVV 
Sbjct  11   VIVMILCILLQSNISNAATYPAGDGKGWGFNMNGWPNGKTFNAGDVIEFKYKVDEHNVVK  70

Query  303  VSKENYNSCIDS-GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            VS+E Y+SC  S G++  SG D + L  GTSY+IC F  HC  G+K A+TA+
Sbjct  71   VSQEEYDSCKTSGGQVFNSGDDQIPLEKGTSYFICTFGPHCSEGVKAAITAN  122



>emb|CBI23865.3| unnamed protein product [Vitis vinifera]
Length=135

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVS  308
            V+    +L C  A A TY VG    W   V  WP GK F +GD+LVFNY+   H+VV V+
Sbjct  24   VLLFCLLLHCDTAHATTYAVGGAKGWTLDVVGWPYGKRFMAGDILVFNYNAAAHDVVSVN  83

Query  309  KENYNSCI---DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            K  YN+C     + K+  +G D + L  G +++IC F GHC++GMK+A+TA
Sbjct  84   KVGYNTCTMPRGASKVYHTGKDQIKLVKGQNFFICSFPGHCQSGMKIAITA  134



>emb|CBI19945.3| unnamed protein product [Vitis vinifera]
Length=175

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 4/114 (4%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAE--AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNV  296
            +I++A++ +L+   A     TY VG +  W     +WP GK F++GDVL FNYD  VHNV
Sbjct  61   LIMVAVIYLLIQYSAPVHGATYTVGGSAGWTFNSANWPKGKRFRAGDVLAFNYDSKVHNV  120

Query  297  VIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            V V++  Y+SC      K+ +SG + + L  G +++IC + GHC++GMK+AV A
Sbjct  121  VAVNEGGYSSCTTPAGAKVYQSGKEQIKLVKGQNFFICNYAGHCESGMKIAVNA  174



>gb|EMS53388.1| Chemocyanin [Triticum urartu]
Length=127

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYD---PNVHNVVIVSKENYNSCI-  332
            AEA  + VG+ G W      WP GK FK+GDVLVF YD      H+VV V    Y +C  
Sbjct  25   AEAAVFNVGDRGGWSFNTNSWPTGKRFKAGDVLVFKYDRADARAHDVVAVGAAGYKACAK  84

Query  333  --DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              +  K+ +SG D VTL  GT+Y+IC   GHC++GMK+AVTA+
Sbjct  85   PANGAKVYKSGADRVTLARGTNYFICSIPGHCQSGMKIAVTAA  127



>ref|XP_010692866.1| PREDICTED: basic blue protein-like [Beta vulgaris subsp. vulgaris]
Length=126

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query  180  YIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--IDSGKILE  353
            Y VG  G W   V +W  GK FK+GD+L FNYD   HNVV VSK+ Y+SC      K+ +
Sbjct  33   YTVGGAGGWAFNVNNWSTGKPFKAGDMLAFNYDKTTHNVVPVSKKGYDSCSSPRGAKVYQ  92

Query  354  SGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            SG D + L+ G SY+IC   GHC++GMK+A+ A+
Sbjct  93   SGKDRIKLSKGPSYFICTLPGHCQSGMKIAINAA  126



>ref|XP_006349402.1| PREDICTED: basic blue protein-like [Solanum tuberosum]
Length=120

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 66/112 (59%), Gaps = 2/112 (2%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            + V+ IV ++    A A  Y VG++G W      WP GK F++GD+L FNY    HNVV 
Sbjct  8    VFVLCIVVLIQTEMAHAVEYKVGDSGGWTFNTVGWPKGKRFRAGDILTFNYPNGAHNVVA  67

Query  303  VSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            V+K+ YN C      K+   G D V L  G +Y+IC + GHC++GMK++V A
Sbjct  68   VNKDGYNKCSTPRGAKVYSKGGDKVKLVKGQNYFICNYAGHCESGMKISVFA  119



>ref|XP_002452607.1| hypothetical protein SORBIDRAFT_04g028940 [Sorghum bicolor]
 gb|EES05583.1| hypothetical protein SORBIDRAFT_04g028940 [Sorghum bicolor]
Length=135

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 73/134 (54%), Gaps = 12/134 (9%)
 Frame = +3

Query  87   LLFMGKMSTHDSIIVIAIVTMLLCGFAEA----------ETYIVGNNGKWDSAVTDWPNG  236
            ++  G  S     +V+A+  +L+ G   A           +Y+VG+ G W   V  W  G
Sbjct  1    MMARGSGSAIGGSVVLALAALLMVGLFVATSAPVAEAAAASYMVGDYGGWKFNVDRWAKG  60

Query  237  KSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGF  410
            ++F++GDVLVFNY+  VH+V +V+   Y SC      K+L SG D V L  GT Y+ C  
Sbjct  61   RTFRAGDVLVFNYNRAVHDVAVVNAAAYRSCAVPKGAKVLRSGRDKVRLGRGTHYFACTV  120

Query  411  TGHCKTGMKMAVTA  452
             GHC+ GMK+AV A
Sbjct  121  RGHCQAGMKIAVRA  134



>ref|XP_004301543.1| PREDICTED: chemocyanin-like [Fragaria vesca subsp. vesca]
Length=123

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 1/123 (1%)
 Frame = +3

Query  90   LFMGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVF  269
            +   ++S   +++++    ++    A A TY VG+   W   +  WP GK F +GD+LVF
Sbjct  1    MAQARVSARINVMLLVFCVLIHYKIASATTYTVGDAAGWTFGIQSWPTGKQFHAGDILVF  60

Query  270  NYDPNVHNVVIVSKENYNSC-IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAV  446
             Y+ NVHNV++  +  + +C   +G+   SG+D + L  G +Y+IC   GHC  GMKMA+
Sbjct  61   KYNKNVHNVIVTDENGFKACNTATGQKFISGNDQIKLKKGQNYFICSTPGHCAGGMKMAI  120

Query  447  TAS  455
            +A+
Sbjct  121  SAA  123



>dbj|BAK02839.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=122

 Score =   100 bits (248),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 58/88 (66%), Gaps = 2/88 (2%)
 Frame = +3

Query  195  NGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSGK--ILESGHDH  368
            N  W  A   W +GKSF++GDVLVF+Y+P VHNVV V    YNSC  S       SG DH
Sbjct  34   NVDWSFAADSWSSGKSFRAGDVLVFSYNPAVHNVVAVDAGGYNSCRGSSAAYTYTSGSDH  93

Query  369  VTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            VTL  GT+Y+IC  +GHC  GMKMAVTA
Sbjct  94   VTLVPGTNYFICSLSGHCGLGMKMAVTA  121



>ref|XP_008800754.1| PREDICTED: basic blue protein-like [Phoenix dactylifera]
Length=126

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 63/99 (64%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DS  338
            AE+  Y VG +G W      WPNGK F++GDVLVF Y+P  HNV  V+   YN C     
Sbjct  28   AESAIYTVGGSGGWSLNTVSWPNGKRFRAGDVLVFKYNPKAHNVAAVNAAGYNRCTMPRG  87

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             KI +SG+D + L  G +Y+IC F GHC+ GMK+AVTA+
Sbjct  88   SKIFKSGNDSIRLRRGRNYFICSFVGHCQAGMKIAVTAA  126



>dbj|BAJ95771.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=121

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 61/100 (61%), Gaps = 6/100 (6%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC--ID  335
            FAE++ Y VG    W  +   WP GK F++GDVL+F Y    HNVV V+   Y SC    
Sbjct  26   FAESKVYTVG----WAVSSGGWPRGKRFRAGDVLLFKYGRGAHNVVAVNAAGYKSCSAAR  81

Query  336  SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              +   SG D VTL+ GT+Y+IC   GHC+ GMKMAVTA+
Sbjct  82   GSRTYNSGSDRVTLSRGTNYFICSVPGHCQAGMKMAVTAA  121



>ref|XP_009414068.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=126

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +3

Query  168  EAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DSG  341
            EA  Y VG++  W      WP GK F++GDVLVF Y    HNVV V+   Y+ C      
Sbjct  29   EAAVYTVGDSQGWTFNTVGWPKGKRFRAGDVLVFKYSSTAHNVVAVNAAGYSRCTTPRGS  88

Query  342  KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            ++ ++G+D + L  GT+Y+IC F GHC+ GMK+AVTA+
Sbjct  89   RVSKTGNDRIRLRKGTNYFICNFAGHCQAGMKIAVTAA  126



>gb|EPS66274.1| hypothetical protein M569_08503 [Genlisea aurea]
Length=127

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 67/113 (59%), Gaps = 2/113 (2%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            I ++ +   LL G  +A T IVG +  W   V+ W NGK FK GD+LVF Y+P  HNVV+
Sbjct  15   IPLVVLTAFLLSGEVDAVTCIVGGSSGWTFGVSSWTNGKHFKVGDILVFKYNPKYHNVVV  74

Query  303  VSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             + ++Y  C      K+ +SG D + L  GT+Y +C   GHCK GM +A TAS
Sbjct  75   TNSKDYPICTAPAGAKVYKSGDDQIKLVKGTTYILCTVPGHCKDGMHIAATAS  127



>ref|XP_006826879.1| hypothetical protein AMTR_s00010p00134160 [Amborella trichopoda]
 gb|ERM94116.1| hypothetical protein AMTR_s00010p00134160 [Amborella trichopoda]
Length=124

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 69/114 (61%), Gaps = 5/114 (4%)
 Frame = +3

Query  129  VIAIVTMLLCGF---AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVV  299
            ++A+V +++C       A TY VG++  W   +  WP GK F++GDVLVF YD + HNVV
Sbjct  11   LVALVFVMICLLEVSTAATTYTVGDSRGWTFNMVSWPAGKRFRAGDVLVFQYDNSAHNVV  70

Query  300  IVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             V+   Y SC+     +   SG D +TL  G ++++C   GHC++GMK+ V A+
Sbjct  71   AVNAAGYKSCLVPRGSRTYRSGSDRITLRRGANFFLCSIPGHCQSGMKVQVNAA  124



>ref|XP_004230514.1| PREDICTED: basic blue protein-like [Solanum lycopersicum]
Length=122

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 6/116 (5%)
 Frame = +3

Query  126  IVIAIVTMLLCGF-----AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVH  290
            + I    M+LC F     ++A+T++ G    W   +  WPNGK+FK+GDV+ F Y    H
Sbjct  7    VTIVAFAMMLCIFLQTNISKADTFLAGGANGWGFQLNGWPNGKTFKTGDVIEFKYPAGAH  66

Query  291  NVVIVSKENYNSCIDS-GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            NVV V +  +NSC  + G++  SG D +TLT GTSY+IC    HC  G+K AV A+
Sbjct  67   NVVKVDQAGFNSCNGAGGQVFSSGDDKITLTKGTSYFICTIGQHCANGVKAAVIAN  122



>ref|XP_004299980.1| PREDICTED: basic blue protein-like [Fragaria vesca subsp. vesca]
Length=124

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 65/100 (65%), Gaps = 3/100 (3%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDS-  338
            +A+A TY VG+   W   V  WP GK+F++GD LVFNY    HNVV V+K  Y  C  + 
Sbjct  24   WADAATYTVGDKRGWTFNVAGWPKGKTFRAGDTLVFNYGSAAHNVVAVNKVGYQKCSTTP  83

Query  339  --GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
               ++ ++G+D + L  G +++IC F GHC++GM++A+TA
Sbjct  84   GNARVYQTGNDKIRLAKGQNFFICNFPGHCQSGMQVAITA  123



>gb|ADV57641.1| copper binding protein 6 [Gossypium hirsutum]
Length=127

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 66/113 (58%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVV  299
            S I + +  M+     +A TY VG +  W      WP GK F++GDVLVFNYD  +HNVV
Sbjct  14   SAIALLLCLMVCLETIDAATYTVGGSNGWTFNTATWPKGKRFRAGDVLVFNYDATIHNVV  73

Query  300  IVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             V++  Y +C      K+  SG D + L  G ++++C   GHC++GMK+A+ A
Sbjct  74   AVNRRGYTNCTTPAGAKVYNSGKDKIKLAKGLNFFMCSTAGHCESGMKIAINA  126



>gb|KHG30077.1| Basic blue [Gossypium arboreum]
Length=126

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 65/111 (59%), Gaps = 7/111 (6%)
 Frame = +3

Query  141  VTMLLCGF-----AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIV  305
            V +L C        +A TY VG +  W   +  WP GK F++GD L+F YD  +HNVV V
Sbjct  15   VALLFCFLFFWENVDAATYTVGGSNGWTFNMATWPRGKRFRAGDTLLFEYDATIHNVVAV  74

Query  306  SKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            ++  Y SCI     K+ +SG D V L  G +Y+IC   GHC++GMK+A+ A
Sbjct  75   NRGGYRSCITPAGAKVYKSGKDEVKLGKGMNYFICNIAGHCESGMKIAINA  125



>ref|XP_007159595.1| hypothetical protein PHAVU_002G250600g [Phaseolus vulgaris]
 gb|ESW31589.1| hypothetical protein PHAVU_002G250600g [Phaseolus vulgaris]
Length=123

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = +3

Query  120  SIIVIAIVTMLL---CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVH  290
            S+IV+  +++ L   C  A + TY VG+   W      W  GK F++GD LVFNY P  H
Sbjct  7    SVIVVLTLSLWLVLHCEMAHSATYTVGDANGWTFNTVAWTKGKRFRAGDTLVFNYGPGTH  66

Query  291  NVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            NVV V+K  Y +C   +  K   SG D + L  G +Y+IC F GHC++G K+A+ A
Sbjct  67   NVVAVNKAGYKACTTPNGAKTYNSGSDQIKLVKGQNYFICNFVGHCESGTKIAINA  122



>ref|XP_006493535.1| PREDICTED: uncharacterized protein LOC102628714 [Citrus sinensis]
Length=360

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 73/121 (60%), Gaps = 7/121 (6%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLL----CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFN  272
            M+      +IA+VT+LL    C    A T+ VG++G W   V +WP GK+FK GD+L FN
Sbjct  237  MAQARGSAIIAVVTVLLLLMHCNIGSATTFKVGDDGGWVFGVQNWPQGKTFKCGDILEFN  296

Query  273  YDPNVHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKT-GMKMA  443
            YDP  HNV+IV +E ++SC  +   K  ++G D + L  G +++ICG   HC   GMK+ 
Sbjct  297  YDPQRHNVIIVDQEGHDSCKPASDAKKFQTGKDQIVLNHGKNFFICGVPTHCSDHGMKLE  356

Query  444  V  446
            +
Sbjct  357  I  357



>ref|NP_001149612.1| chemocyanin precursor [Zea mays]
 gb|ACG36081.1| chemocyanin precursor [Zea mays]
 tpg|DAA44473.1| TPA: chemocyanin [Zea mays]
Length=121

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +3

Query  204  WDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSGKILESGHDHVTLTS  383
            W      W  GKSF++GDVL FNYDP+VHNVV V    YN C  SG    SG D +TL  
Sbjct  38   WSFNADSWSKGKSFRAGDVLEFNYDPSVHNVVAVDAGGYNGCRPSGTSYGSGSDRITLGP  97

Query  384  GTSYYICGFTGHCKTGMKMAVTAS  455
            GTSY+IC   GHC  GMKM V AS
Sbjct  98   GTSYFICSLNGHCGMGMKMVVNAS  121



>ref|XP_004981033.1| PREDICTED: chemocyanin-like [Setaria italica]
Length=128

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DS  338
            AE+  + VG+ G W      W NGK FK+GDVLVF YD + HNV  V+   Y  C     
Sbjct  30   AESAVFTVGDRGGWTFNSNTWTNGKRFKAGDVLVFKYDSSAHNVASVNAAGYKGCAAPRG  89

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             +   SG+D VTL  GT+Y+IC   GHC+ GMK+AVTA+
Sbjct  90   ARTYTSGNDRVTLARGTNYFICSIPGHCQAGMKIAVTAA  128



>gb|AFK40327.1| unknown [Lotus japonicus]
Length=125

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC-IDSG  341
            A A TY VG+   W   +T+W  GKSF++GD+LVFNY P  HNVV+V    Y +C    G
Sbjct  27   AYATTYTVGDQYGWKFFITNWTEGKSFEAGDILVFNYSPLNHNVVVVDANGYKNCNAAGG  86

Query  342  KILESGHDHVTLTSGTSYYICGFTGHCKTG-MKMAVTAS  455
            K+  SGHD +TL  G SYYI  FT  C+ G MKMAV A+
Sbjct  87   KVYNSGHDSITLPKGQSYYISSFTDQCQYGSMKMAVYAA  125



>ref|XP_002266922.1| PREDICTED: basic blue protein [Vitis vinifera]
 emb|CBI37323.3| unnamed protein product [Vitis vinifera]
Length=128

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 77/128 (60%), Gaps = 5/128 (4%)
 Frame = +3

Query  87   LLFMGKMSTHDSIIVIAIVTMLL--CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDV  260
            +   G+ S + +I +  I+  +L     ++A T++VG++  W   + +W +GK FK+GD 
Sbjct  1    MALQGRCSANHAIALTTILVFVLLHVKASQATTFMVGDSSGWTFNINNWASGKKFKAGDK  60

Query  261  LVFNYDPNVHNVVIVSKENYNSC---IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTG  431
            LVF Y+P+ HNVV + ++ YN C     S KI  +G+D V L  G +Y+ICG  GHC  G
Sbjct  61   LVFKYNPSFHNVVAIDEDGYNGCSTASPSSKIYSTGNDAVKLLKGHNYFICGVPGHCDMG  120

Query  432  MKMAVTAS  455
            +K+ V AS
Sbjct  121  LKIRVNAS  128



>gb|EMT29954.1| Chemocyanin [Aegilops tauschii]
Length=123

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC---ID  335
            AEA  + VG+ G W      WP GK FK+GDVLVF YD   H+V  VS   Y +C    +
Sbjct  25   AEAAVFNVGDRGGWSFNTNSWPTGKHFKAGDVLVFKYDATAHDVA-VSAAGYKACAKPAN  83

Query  336  SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              K+ +SG D V L  GT+Y+IC   GHC++GMK+AVTA+
Sbjct  84   GAKVYKSGADRVILARGTNYFICSIPGHCQSGMKIAVTAA  123



>gb|ADV57643.1| copper binding protein 8 [Gossypium hirsutum]
Length=126

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 64/111 (58%), Gaps = 7/111 (6%)
 Frame = +3

Query  141  VTMLLCGFA-----EAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIV  305
            V +L C        +A TY VG +  W   +  WP GK F++GD L F YD  +HNVV V
Sbjct  15   VALLFCFLVFWENVDAATYTVGGSNGWTFNMATWPRGKRFRAGDTLFFKYDATIHNVVAV  74

Query  306  SKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            ++  Y SCI     K+ +SG D V L  G +Y+IC   GHC++GMK+A+ A
Sbjct  75   NRGGYRSCITPAGAKVYKSGKDEVKLGKGMNYFICNIAGHCESGMKIAINA  125



>gb|ABK23767.1| unknown [Picea sitchensis]
Length=131

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 58/97 (60%), Gaps = 1/97 (1%)
 Frame = +3

Query  168  EAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG-K  344
            E  TY VG    W      W  GK F++GD LVFNY+P+ HN+V+V    Y SC   G +
Sbjct  35   EGATYTVGGRQGWGFQTNSWTAGKRFRAGDTLVFNYNPSAHNLVVVGAGAYRSCSTGGSR  94

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             L SG D VTL  G +Y+IC   GHC +GMK+AV A+
Sbjct  95   PLTSGSDKVTLRKGVNYFICSIPGHCTSGMKIAVPAT  131



>ref|XP_004984952.1| PREDICTED: basic blue protein-like [Setaria italica]
Length=120

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +3

Query  204  WDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSGKILESGHDHVTLTS  383
            W      W  GKSF++GDVL FNYDP++HNVV V    Y  C  SG+   SG D +TL  
Sbjct  37   WSFNADSWSRGKSFRAGDVLEFNYDPSLHNVVAVDAGGYYGCSSSGRAYGSGSDRITLGP  96

Query  384  GTSYYICGFTGHCKTGMKMAVTAS  455
            GT+Y+IC   GHC  GMKMAV AS
Sbjct  97   GTNYFICSLNGHCGMGMKMAVNAS  120



>ref|XP_006349399.1| PREDICTED: chemocyanin-like [Solanum tuberosum]
Length=122

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 74/123 (60%), Gaps = 7/123 (6%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLC-----GFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVF  269
            MS  + + ++A   M+LC       ++A+T++ G+   W   +  WPNGK+FK+GDV+ F
Sbjct  1    MSGVNKVTIVAFA-MMLCILLQTNISKADTFLAGDANGWGFQLNGWPNGKTFKTGDVIKF  59

Query  270  NYDPNVHNVVIVSKENYNSCIDS-GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAV  446
             Y    HNVV V +  ++SC  + G+   SG D +TLT GTSY+IC    HC  G+K AV
Sbjct  60   KYPAGAHNVVKVDQAGFDSCNGAGGQAFTSGDDKITLTQGTSYFICTIGPHCANGIKAAV  119

Query  447  TAS  455
            TA+
Sbjct  120  TAN  122



>ref|XP_006349400.1| PREDICTED: chemocyanin-like [Solanum tuberosum]
Length=122

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 74/123 (60%), Gaps = 7/123 (6%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLC-----GFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVF  269
            MS  + + ++A   M+LC       ++A+T++ G+   W   +  WPNGK+FK+GDV+ F
Sbjct  1    MSGVNKVTIVAFA-MMLCILLQTNISKADTFLAGDANGWGFQLNGWPNGKTFKTGDVIEF  59

Query  270  NYDPNVHNVVIVSKENYNSCIDS-GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAV  446
             Y    HNVV V +  ++SC  + G+   SG D +TLT GTSY+IC    HC  G+K AV
Sbjct  60   KYPAGAHNVVKVDQAGFDSCNGAGGQAFTSGDDKITLTQGTSYFICTIGPHCANGIKAAV  119

Query  447  TAS  455
            TA+
Sbjct  120  TAN  122



>emb|CDP03862.1| unnamed protein product [Coffea canephora]
Length=129

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 76/128 (59%), Gaps = 7/128 (5%)
 Frame = +3

Query  90   LFMGKMSTHDSIIVIAIVTMLLCGFA-----EAETYIVGNNGKWDSAVTDWPNGKSFKSG  254
            +++   S+       A++ +LL  F+     +A TY VG++  W+  + +W  GK F +G
Sbjct  1    MYVQGRSSARQATAFAVLMILLSLFSRLRATQATTYAVGDSSGWNFNMGNWTEGKRFNAG  60

Query  255  DVLVFNYDPNVHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKT  428
            D+L FNYD ++HNVV+V  + Y +C  S   KI  SG+D + L+ G  Y+IC F GHC  
Sbjct  61   DILTFNYDSSLHNVVMVDAKGYENCTASSKAKIYNSGNDKIKLSRGRYYFICTFPGHCDG  120

Query  429  GMKMAVTA  452
            G+K+ ++A
Sbjct  121  GLKIQLSA  128



>ref|XP_006349401.1| PREDICTED: chemocyanin-like [Solanum tuberosum]
Length=122

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 74/123 (60%), Gaps = 7/123 (6%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLC-----GFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVF  269
            MS  + + ++A   M+LC       ++A+T++ G+   W   +  WPNGK+FK+GDV+ F
Sbjct  1    MSGVNKVTIVAFA-MMLCILLQTNISKADTFLAGDANGWGFQLNGWPNGKTFKTGDVIEF  59

Query  270  NYDPNVHNVVIVSKENYNSCIDS-GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAV  446
             Y    HNVV V +  ++SC  + G+   SG D +TLT GTSY+IC    HC  G+K AV
Sbjct  60   KYPAGAHNVVKVDQAGFDSCNGAGGQAFTSGDDKITLTQGTSYFICTIGPHCANGVKAAV  119

Query  447  TAS  455
            TA+
Sbjct  120  TAN  122



>ref|XP_006648513.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=125

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 62/99 (63%), Gaps = 2/99 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG-  341
            A A  + VG+   W   V  W NGK+F +GDVLVF+YDP +HNVV V +  Y+ C  +  
Sbjct  27   AGATEWTVGDGNGWSFGVAGWENGKAFSAGDVLVFHYDPAMHNVVQVDQAGYDGCTAAAG  86

Query  342  -KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
                 SG+D +TL +G +++IC F GHC+ GMK+AV A 
Sbjct  87   DTTYASGNDKITLAAGKAFFICSFPGHCQNGMKIAVAAQ  125



>ref|XP_008465594.1| PREDICTED: basic blue protein-like [Cucumis melo]
Length=125

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 58/98 (59%), Gaps = 2/98 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DS  338
            A A  Y VG    W   V  WP GK F++GD LVFNY P+ HNVV V++  Y+ C     
Sbjct  27   AHAAVYTVGGAQGWTFNVASWPKGKRFRAGDTLVFNYSPSAHNVVGVNRLGYSRCTTPRG  86

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             K+ ++G D + L  G +++IC   GHC+ GMK+AV A
Sbjct  87   SKVFQTGKDQIKLVKGQNFFICSLPGHCQGGMKIAVNA  124



>gb|KHG11741.1| hypothetical protein F383_14857 [Gossypium arboreum]
Length=127

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 66/113 (58%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVV  299
            S I + +  M+     +A TY VG +  W      WP GK F++GDVLVFNY+  +HNVV
Sbjct  14   SAIALLLCLMVCLETIDAATYTVGGSNGWTFNTATWPKGKRFRAGDVLVFNYNATIHNVV  73

Query  300  IVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             V++  Y SC      K+  SG D + L  G ++++C   GHC++GMK+A+ A
Sbjct  74   AVNRGEYTSCTAPAGAKVYNSGKDKIKLAKGLNFFMCNTAGHCESGMKIAINA  126



>gb|EMS52226.1| Basic blue protein [Triticum urartu]
Length=161

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 2/101 (2%)
 Frame = +3

Query  159  GFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--  332
            G A A TY VG+ G W  +   WPNGK F++GDVLVF Y+P +HNVV V ++ YN C   
Sbjct  61   GVASAATYYVGDVGGWSLSSGSWPNGKQFRAGDVLVFRYNPLMHNVVAVGEDGYNGCTTP  120

Query  333  DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
               +  ESG+D VTL  G + ++C    HC  GMKM V A+
Sbjct  121  PGSRTYESGNDAVTLARGANRFMCTRFYHCNFGMKMVVNAA  161



>gb|ACG32438.1| chemocyanin precursor [Zea mays]
Length=121

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 57/97 (59%), Gaps = 4/97 (4%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSGK  344
            A+A T+ V     W      W  GKSF++GDVL FNYDP+VHNVV V    YN C  SG 
Sbjct  29   ADAATHRV----DWSFNADSWSKGKSFRAGDVLEFNYDPSVHNVVAVDAGGYNGCRPSGT  84

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
               SG D +TL  GTSY+IC    HC  GMKM V AS
Sbjct  85   SYGSGSDRITLGPGTSYFICSLNRHCGMGMKMVVNAS  121



>ref|XP_004301545.1| PREDICTED: chemocyanin-like [Fragaria vesca subsp. vesca]
Length=123

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 69/113 (61%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVV  299
            +++++    ++    A A TYIVG+   W   +  WP GK F +GD+LVF Y+ NVH+V+
Sbjct  11   NVMLLVFCVLIHYKIASATTYIVGDKAGWTFGIQSWPTGKQFHAGDILVFKYNMNVHSVI  70

Query  300  IVSKENYNSC-IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            +  +  + +C   +G+   SG+D + L  G +Y+ICG  GHC  GMKM ++A+
Sbjct  71   VTDENGFKTCNTVTGQKFVSGNDQIKLRMGQNYFICGTPGHCVGGMKMTISAA  123



>ref|XP_011087776.1| PREDICTED: basic blue protein-like [Sesamum indicum]
Length=131

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 78/123 (63%), Gaps = 3/123 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLL-CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFN  272
            M +   + ++ +I +++ML+    A+A+ Y VG +  W   V+ W  GK FK+GD LVF 
Sbjct  5    MSEEKGYANLAMIMVLSMLIYIHSADAKIYTVGGSTGWIFNVSGWETGKPFKAGDKLVFK  64

Query  273  YDPNVHNVVIVSKENYNSC-IDSG-KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAV  446
            Y    HNVV+V K +Y+SC + +G     SG+D +TL  GT+Y+ICGFTGHC  GMK+A 
Sbjct  65   YAVGRHNVVVVDKGSYDSCSVPAGAPTYGSGNDKLTLKEGTNYFICGFTGHCHAGMKIAA  124

Query  447  TAS  455
             A+
Sbjct  125  NAA  127



>ref|XP_010109721.1| Basic blue protein [Morus notabilis]
 gb|EXC24191.1| Basic blue protein [Morus notabilis]
Length=130

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 76/121 (63%), Gaps = 5/121 (4%)
 Frame = +3

Query  108  STHDSIIV-IAIVTMLLCGF--AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYD  278
            ++H +I+  I  +++ L  F  A+A T +VG++  W   V  W NGK FK+GD+LVFNYD
Sbjct  10   ASHIAILATILRLSLFLPIFVTAKATTQMVGDSSGWTFNVESWTNGKKFKAGDILVFNYD  69

Query  279  PNVHNVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             ++H+VV+V  + Y SC  S   +   SG D V L+ G +Y+IC   GHC  G+K++V A
Sbjct  70   TSLHDVVVVDAKGYKSCTSSSGAQTYSSGKDQVKLSKGQNYFICSIPGHCDGGVKISVNA  129

Query  453  S  455
            S
Sbjct  130  S  130



>gb|EAY85251.1| hypothetical protein OsI_06624 [Oryza sativa Indica Group]
Length=121

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 70/113 (62%), Gaps = 5/113 (4%)
 Frame = +3

Query  126  IVIAIVTMLLCG---FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNV  296
            + IA++  + C     A A  + VG++  W   VT W NGK+FK GDVLVF Y P +HNV
Sbjct  7    VCIAVLLAVCCAEILVAGATEWHVGDDKGWTFGVTGWENGKAFKVGDVLVFKYSPMMHNV  66

Query  297  VIVSKENYNSC-IDSG-KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            V V +  Y+ C + +G K   SG+D +TL +G  ++ICGF+ HC  GMK+AV 
Sbjct  67   VQVDQAGYDGCKVGAGDKKYASGNDRITLAAGKVFFICGFSRHCANGMKIAVA  119



>gb|ACN37046.1| unknown [Zea mays]
 gb|AFW73253.1| chemocyanin [Zea mays]
Length=135

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = +3

Query  171  AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI---DSG  341
            A +Y+VG+ G W   V  W  G++F++GDVLVF+Y+  VH+V +V+   Y SC       
Sbjct  38   AASYMVGDYGGWKFNVDRWAKGRTFRAGDVLVFSYNRAVHDVAVVNAAAYRSCAVPNKGA  97

Query  342  KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            ++L SG D V L  GT Y+ C   GHC+ GMK+AV A
Sbjct  98   RVLRSGRDKVRLGRGTHYFACTVRGHCQAGMKLAVRA  134



>ref|NP_001148389.1| LOC100282003 precursor [Zea mays]
 gb|ACG31278.1| chemocyanin precursor [Zea mays]
Length=133

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = +3

Query  171  AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI---DSG  341
            A +Y+VG+ G W   V  W  G++F++GDVLVF+Y+  VH+V +V+   Y SC       
Sbjct  36   AASYMVGDYGGWKFNVDRWAKGRTFRAGDVLVFSYNRAVHDVAVVNAAAYRSCAVPNKGA  95

Query  342  KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            ++L SG D V L  GT Y+ C   GHC+ GMK+AV A
Sbjct  96   RVLRSGRDKVRLGRGTHYFACTVRGHCQAGMKLAVRA  132



>gb|ACG40270.1| blue copper protein precursor [Zea mays]
Length=176

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 71/119 (60%), Gaps = 4/119 (3%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVT--DWPNGKSFKSGDVLVFNYD  278
            M+   S ++  +V +     A A T+ VG++  W  +V   +W +GK+F  GD LVFN+ 
Sbjct  1    MAASRSALITLLVLVSSVAAASATTFTVGDSSGWSRSVNYDNWASGKTFTDGDQLVFNFA  60

Query  279  PNVHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
               H+VV V K  Y+ C   ++   +++G   V LTSGT YYICGFTGHC  GMK+AVT
Sbjct  61   TGNHDVVEVDKSGYDGCSTTNAANTIQNGPATVNLTSGTHYYICGFTGHCSAGMKLAVT  119



>gb|EEC73941.1| hypothetical protein OsI_08810 [Oryza sativa Indica Group]
Length=134

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 61/107 (57%), Gaps = 2/107 (2%)
 Frame = +3

Query  138  IVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKEN  317
             + M     AEA  Y VG++G W      W  GK+F++GDVL F Y+  VH+V  V    
Sbjct  27   FLVMSAAPLAEAARYTVGDSGGWRFYAEGWAKGKTFRAGDVLEFKYNAVVHDVAAVDLAA  86

Query  318  YNSC-IDSG-KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            Y SC +  G + + SG D VTL  GT Y+IC   GHCK GMK+AV A
Sbjct  87   YRSCTVPKGVRKMRSGRDKVTLRKGTHYFICTEPGHCKAGMKLAVRA  133



>ref|XP_002275938.1| PREDICTED: basic blue protein-like [Vitis vinifera]
Length=126

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DS  338
            A A TY VG +  W   V  W +GKSF++GDVLVFNYDP  H+VV V + +Y++C   + 
Sbjct  28   AHAATYTVGGSSGWTFNVESWTDGKSFRAGDVLVFNYDPKDHDVVAVDQYSYDTCTVGEG  87

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             K+ ESG+D + L  G + +IC F  HC +GMK+ + A
Sbjct  88   AKVYESGNDSIELVKGENCFICSFLSHCDSGMKIHMIA  125



>emb|CAN73750.1| hypothetical protein VITISV_021353 [Vitis vinifera]
Length=124

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DS  338
            A A TY VG +  W   V  W +GKSF++GDVLVFNYDP  H+VV V + +Y++C   + 
Sbjct  26   AHAATYTVGGSSGWTFNVESWTDGKSFRAGDVLVFNYDPKDHDVVAVDQYSYDTCTVGEG  85

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             K+ ESG+D + L  G + +IC F  HC +GMK+ + A
Sbjct  86   AKVYESGNDSIELVKGENCFICSFLSHCDSGMKIHMIA  123



>ref|XP_006349398.1| PREDICTED: chemocyanin-like [Solanum tuberosum]
Length=122

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 69/112 (62%), Gaps = 1/112 (1%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            ++V+ +  +L    + A T+  G++  W   +  WPNGK+F +GDV+ F Y  ++HNVV 
Sbjct  11   VLVMMLCILLQSNISNAATFPAGDDKGWGFNMNGWPNGKTFNTGDVIEFKYKVDMHNVVK  70

Query  303  VSKENYNSCIDS-GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            VSK  Y+SC  S G++  SG D + L  GTSY+IC    HC  G+K A+TA+
Sbjct  71   VSKGEYDSCKTSGGQVYNSGDDKIPLEKGTSYFICTIGPHCSEGVKTAITAN  122



>dbj|BAK06251.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=122

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 3/92 (3%)
 Frame = +3

Query  186  VGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG--KILESG  359
            VG+N  W   V+ W NGK  +SGDVLVF Y+P++HNVV V + +YNSC  SG  +   SG
Sbjct  31   VGDNKGWSFGVSGWENGKRIQSGDVLVFKYNPSMHNVVQVGEGDYNSCTVSGPSRTYTSG  90

Query  360  HDHVTLT-SGTSYYICGFTGHCKTGMKMAVTA  452
            +DH+ L   G ++++C   GHC+ GMK+AVTA
Sbjct  91   NDHIQLAHGGKAFFLCSVPGHCQKGMKIAVTA  122



>ref|XP_004149974.1| PREDICTED: basic blue protein-like [Cucumis sativus]
 gb|KGN57570.1| hypothetical protein Csa_3G214590 [Cucumis sativus]
Length=127

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIV  305
            +V  ++ +       A  Y VG    W   V+ WP GK+F +GD+L F+Y+P++HNVV+V
Sbjct  14   VVFCLLLLQQLKMGYATIYNVGEELGWTFNVSSWPIGKNFHAGDILAFSYNPSMHNVVVV  73

Query  306  SKENYNSCID---SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             K  YN C+       +  SG D + L  G +YYIC   GHC+ GMK+A+ A+
Sbjct  74   DKVGYNWCLTHPIEATVHRSGKDQIKLVEGMNYYICSRPGHCQMGMKLAINAT  126



>ref|XP_004953818.1| PREDICTED: chemocyanin-like [Setaria italica]
Length=131

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +3

Query  171  AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DSGK  344
            A +++VG+ G W   V  W  G++F++GD LVF Y+  VH+V +V    Y SC+     K
Sbjct  35   AASHMVGDYGGWKFNVDRWTKGRTFRAGDQLVFRYNRAVHDVAVVDAAAYRSCVVPRGAK  94

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            +L SG D V L  GT Y++C   GHC+ GMK+AV A
Sbjct  95   VLRSGRDKVRLGRGTHYFVCTVRGHCQAGMKIAVRA  130



>gb|EMT05500.1| Chemocyanin [Aegilops tauschii]
Length=121

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 3/98 (3%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG  341
                + +IV + G W   ++ W NGK FKSGDVLVF Y+  +HN+V V + +YNSC+  G
Sbjct  23   LVHGKEWIVDDKG-WTIGISGWENGKRFKSGDVLVFKYESAMHNLVQVEERDYNSCLVVG  81

Query  342  --KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
              K  +SG+DH+ L  G ++++C    HC+ GMKMAVT
Sbjct  82   PSKFHDSGNDHIQLAGGKAFFLCSVMRHCEQGMKMAVT  119



>ref|XP_011024698.1| PREDICTED: basic blue protein-like [Populus euphratica]
Length=130

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 71/129 (55%), Gaps = 9/129 (7%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLC-------GFAEAETYIVGNNGKWDSAVTDWPNGKSFKSG  254
            MG+     +I V+ + T+L+          A+A T+ VG+   W   +  W +GK FK+G
Sbjct  1    MGRQGRCSAIYVVLVSTLLVILSLQFKIAIAKAATFTVGDTSGWTFNIQSWTDGKKFKAG  60

Query  255  DVLVFNYDPNVHNVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKT  428
            D L+FNYDP++H+V  V  + Y+ C    S     SG+D + L  G +Y+IC    HC  
Sbjct  61   DSLIFNYDPSLHDVATVDVDGYDGCTVSQSSNTYTSGNDTIKLQEGQNYFICSIPSHCDW  120

Query  429  GMKMAVTAS  455
            G+K+AV AS
Sbjct  121  GLKIAVNAS  129



>emb|CBI23864.3| unnamed protein product [Vitis vinifera]
Length=155

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = +3

Query  165  AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DS  338
            A A TY VG +  W   V  W +GKSF++GDVLVFNYDP  H+VV V + +Y++C   + 
Sbjct  57   AHAATYTVGGSSGWTFNVESWTDGKSFRAGDVLVFNYDPKDHDVVAVDQYSYDTCTVGEG  116

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
             K+ ESG+D + L  G + +IC F  HC +GMK+ + A
Sbjct  117  AKVYESGNDSIELVKGENCFICSFLSHCDSGMKIHMIA  154



>ref|XP_007148486.1| hypothetical protein PHAVU_006G212800g [Phaseolus vulgaris]
 gb|ESW20480.1| hypothetical protein PHAVU_006G212800g [Phaseolus vulgaris]
Length=121

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 71/121 (59%), Gaps = 3/121 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
            MG+  +    +V+  + +L    A A TY+VG    W   +T W NGK +K+GD L+F Y
Sbjct  1    MGEGRSMSVTVVLLCMLVLYSEMAHASTYVVGGRTGWSGDMTAW-NGKVYKAGDTLLFYY  59

Query  276  DPNVHNVVIVSKENYNSCIDSG--KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            +   HNVV+V +  YNSC  S   K  ++GHD++ L  G S++I    G C+ G+K++VT
Sbjct  60   NATQHNVVVVDEGGYNSCSASAGSKTYQTGHDYIQLPKGPSFFISSLAGQCQGGLKLSVT  119

Query  450  A  452
            A
Sbjct  120  A  120



>ref|XP_009599432.1| PREDICTED: basic blue protein-like [Nicotiana tomentosiformis]
Length=122

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLL----CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFN  272
            MS    + +IA+  ML        + A T+  G    W   +  WPNG++FK GDV+ F 
Sbjct  1    MSGGKGVTIIAVAVMLCILLQTSISSAATFPAGGANGWGFNMNGWPNGQTFKVGDVIEFK  60

Query  273  YDPNVHNVVIVSKENYNSCIDS-GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            Y   +HNVV VSK  ++SC  + G++  SG D VTL  GT Y+IC    HC  G+K AVT
Sbjct  61   YMAGMHNVVKVSKAGFDSCDGTGGQVFSSGDDKVTLVQGTQYFICTIGPHCSNGVKAAVT  120

Query  450  AS  455
            A+
Sbjct  121  AN  122



>ref|XP_007201673.1| hypothetical protein PRUPE_ppa022496mg [Prunus persica]
 gb|EMJ02872.1| hypothetical protein PRUPE_ppa022496mg [Prunus persica]
Length=128

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 66/117 (56%), Gaps = 2/117 (2%)
 Frame = +3

Query  111  THDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVH  290
            T     +   + +++    +  T+ VG N  W   V +W +GK FK+GD+LVFNYDP+ H
Sbjct  12   TEKPATIFLFLFLIIVSAQKTTTFTVGGNSGWTFNVENWTDGKKFKAGDILVFNYDPSSH  71

Query  291  NVVIVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            +V +V    + SC  S   K   +G D V L+ G +Y+IC   GHC  G+K++V AS
Sbjct  72   DVAVVDANEFTSCSASSNSKTFSTGKDRVKLSKGLNYFICTVPGHCNGGVKISVNAS  128



>ref|XP_006656866.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=132

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 69/125 (55%), Gaps = 7/125 (6%)
 Frame = +3

Query  99   GKMSTHDSIIVIAIVTMLLC-GFAEAE----TYIVGNNGKWDSAVTDWPNGKSFKSGDVL  263
            G+ S    +++  +V  LL   F  AE    TY VG+ G W   +  W  GK+F +GDVL
Sbjct  7    GRSSASGVVLLSCLVVALLTESFPAAEAAGTTYYVGDAGGWGRNLDWWLAGKTFYAGDVL  66

Query  264  VFNYDPNVHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMK  437
            VF Y+   H+V +V  + Y  C    S  +L SG+D VTL  G +Y+ICG   HC  GMK
Sbjct  67   VFKYNREYHDVAVVGGKGYRRCKVPRSTVVLRSGYDQVTLRRGNNYFICGMPAHCDAGMK  126

Query  438  MAVTA  452
            +AV A
Sbjct  127  LAVKA  131



>ref|XP_003571173.1| PREDICTED: basic blue protein-like [Brachypodium distachyon]
Length=123

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 71/121 (59%), Gaps = 3/121 (2%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNY  275
            M ++S    ++ + I        A ++ + VG+   W   V  W +G +  +GD LVF Y
Sbjct  1    MARISIGTMVLGLLIAICCTATIAHSKEWTVGDAKGWSFRVAGWESGLAIHTGDTLVFKY  60

Query  276  DPNVHNVVIVSKENYNSCIDSGKI---LESGHDHVTLTSGTSYYICGFTGHCKTGMKMAV  446
            +P  HNVV V +++YN+C  SG++     SG+DH+ +  G S++IC F GHC+ GMK+A+
Sbjct  61   NPKEHNVVQVDEKSYNACSVSGRLSGDYNSGNDHIRVGRGKSFFICSFAGHCEQGMKIAI  120

Query  447  T  449
            T
Sbjct  121  T  121



>ref|XP_008456090.1| PREDICTED: basic blue protein-like [Cucumis melo]
Length=124

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 67/113 (59%), Gaps = 9/113 (8%)
 Frame = +3

Query  141  VTMLLCGF------AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            +T+LLC F      A+A+ Y VG+   W   VT W  GK F++GD+LVF Y    HNVV 
Sbjct  11   ITLLLCIFLIQSEIAQAKVYTVGDANGWTFNVTTWTKGKIFRAGDILVFKYPRLGHNVVA  70

Query  303  VS-KENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
               K  YN C+   + K+ ++G D + L  G +Y+IC + GHCK GMK+A+ A
Sbjct  71   FKNKVAYNWCLKPKNSKVYQTGKDRIKLVKGYNYFICSYPGHCKAGMKIAIKA  123



>ref|XP_008789430.1| PREDICTED: basic blue protein-like [Phoenix dactylifera]
Length=126

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 71/125 (57%), Gaps = 8/125 (6%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCG--FAEAETYIVGNNGKWDSAV--TDWPNGKSFKSGDVL  263
            MG+ S   +I V   + ++LC      A T++VG++  W  ++  TDW N K+F +GD L
Sbjct  3    MGRGSC--TIAVFLALFLILCAPFHTLAATHVVGDSQGWGFSMSYTDWANEKTFAAGDTL  60

Query  264  VFNYDPNVHNVVIVSKENYNSCIDSG--KILESGHDHVTLTSGTSYYICGFTGHCKTGMK  437
            VFNY    HNVV VS   Y +C  SG  K   +G D  TL  G +Y+IC F GHC  GM+
Sbjct  61   VFNYQAGAHNVVPVSAAGYKTCKASGSSKAATTGDDQFTLKKGANYFICSFPGHCAAGMR  120

Query  438  MAVTA  452
            + V A
Sbjct  121  LQVIA  125



>ref|XP_009605937.1| PREDICTED: basic blue protein-like [Nicotiana tomentosiformis]
Length=119

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 67/118 (57%), Gaps = 6/118 (5%)
 Frame = +3

Query  120  SIIVIAIVTMLLC-----GFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPN  284
             I+ I  V M+LC       + A T+  G    W   +  WPNG++FK GDV+ F Y   
Sbjct  2    EIVTIIAVAMMLCVLLQTNISNAATFPAGGANGWGFNMNGWPNGQTFKVGDVIEFKYMAG  61

Query  285  VHNVVIVSKENYNSCIDS-GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            +HNVV VSK  ++SC  + G++  SG D VTL  GT Y+IC    HC  G+K+AV A+
Sbjct  62   MHNVVRVSKAGFDSCDGTGGQVFSSGDDKVTLVQGTQYFICTIGPHCSNGVKVAVIAN  119



>dbj|BAK04521.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=122

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 71/117 (61%), Gaps = 9/117 (8%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAET------YIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVH  290
            +I  + +LL     A T      + VG++  W   V+ W   K  +SGDVLVF Y+P++H
Sbjct  6    IIPTLQLLLLAVCCATTVVHGKEWTVGDSKGWTFGVSGWERAKRIQSGDVLVFKYNPSMH  65

Query  291  NVVIVSKENYNSCIDSG--KILESGHDHVTLTS-GTSYYICGFTGHCKTGMKMAVTA  452
            NVV V + +YNSC  SG  +   SG+DH+ L   G +++IC F GHC+ GMK+AVTA
Sbjct  66   NVVQVGEGDYNSCKVSGPSRTHTSGNDHIKLAPGGKAFFICSFPGHCQQGMKIAVTA  122



>ref|XP_004160478.1| PREDICTED: basic blue protein-like [Cucumis sativus]
Length=127

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = +3

Query  132  IAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSK  311
            + ++  L  G+A    Y VG    W   V+ WP GK+F +GD+L F+Y+P++HNVV+V K
Sbjct  18   LLLLQQLKMGYAT--IYNVGEELGWTFNVSSWPIGKNFHAGDILAFSYNPSMHNVVVVDK  75

Query  312  ENYNSCID---SGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
              YN C+       +  SG D + L  G +YYIC   GHC+ GMK+A+ A+
Sbjct  76   VGYNWCLTHPIEATVHRSGKDQIKLVEGMNYYICSRPGHCQMGMKLAINAT  126



>ref|NP_001048019.2| Os02g0731400 [Oryza sativa Japonica Group]
 dbj|BAH01435.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57747.1| hypothetical protein OsJ_08265 [Oryza sativa Japonica Group]
 dbj|BAF09933.2| Os02g0731400 [Oryza sativa Japonica Group]
Length=134

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 60/107 (56%), Gaps = 2/107 (2%)
 Frame = +3

Query  138  IVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKEN  317
             + M     AEA  Y VG++  W      W  GK+F++GDVL F Y+  VH+V  V    
Sbjct  27   FLVMSAAPLAEAARYTVGDSSGWRFYAEGWAKGKTFRAGDVLEFKYNAVVHDVAAVDLAA  86

Query  318  YNSC-IDSG-KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            Y SC +  G + + SG D VTL  GT Y+IC   GHCK GMK+AV A
Sbjct  87   YRSCTVPKGVRKMRSGRDKVTLRKGTHYFICTEPGHCKAGMKLAVRA  133



>ref|NP_001172886.1| Os02g0257100 [Oryza sativa Japonica Group]
 dbj|BAD27961.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|EAZ22463.1| hypothetical protein OsJ_06132 [Oryza sativa Japonica Group]
 dbj|BAH91615.1| Os02g0257100 [Oryza sativa Japonica Group]
Length=122

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 68/114 (60%), Gaps = 6/114 (5%)
 Frame = +3

Query  126  IVIAIVTMLLCG----FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHN  293
            + +A++  + C      A A  + VG++  W   V  W NGK+FK GDVLVF Y P +HN
Sbjct  7    VCVAVLLAVCCAETILVAGATEWHVGDDKGWTFGVAGWENGKAFKVGDVLVFKYSPMMHN  66

Query  294  VVIVSKENYNSC-IDSG-KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            V+ V    Y+ C + +G K   SG+D +TL +G  ++ICGF GHC  GMK+AV 
Sbjct  67   VLQVDHAGYDGCKVGAGDKKYASGNDRITLAAGKVFFICGFPGHCANGMKIAVA  120



>ref|XP_002464009.1| hypothetical protein SORBIDRAFT_01g010520 [Sorghum bicolor]
 gb|EER91007.1| hypothetical protein SORBIDRAFT_01g010520 [Sorghum bicolor]
Length=130

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = +3

Query  171  AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DSGK  344
            A TY VG++  W  +   WPNGK F++GD LVF Y P +HNVV VS++ YN C      +
Sbjct  34   ATTYYVGDSNGWSFSSPSWPNGKHFRAGDTLVFRYIPWIHNVVAVSEDGYNGCTTPPGSR  93

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
               SG D VTL  G +++IC   GHC  GMK+ V A+
Sbjct  94   TYTSGADSVTLAKGDNFFICTRFGHCNLGMKLVVYAA  130



>ref|XP_003565597.1| PREDICTED: basic blue protein-like [Brachypodium distachyon]
Length=140

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 73/118 (62%), Gaps = 10/118 (8%)
 Frame = +3

Query  126  IVIAIVTMLLCG--FAEAETYIVGNNGKWDSAVTDWPNG---KSFKSGDVLVFNYDPNVH  290
            +++AIV ML  G   A A  ++VG++  W   V  WPN    K F+ GDVLVFNYDPN+H
Sbjct  20   LLLAIVLMLQVGSELAAAREWVVGDSSGWTFGVMTWPNKPDFKRFRVGDVLVFNYDPNLH  79

Query  291  NVVIVSKENYNSCI---DSGKILESGHDHVTL-TSGTSYYICGFTGHC-KTGMKMAVT  449
            NV++V    + +C    D+  +  SG+D +TL +SG   +ICG   HC K GMKM++T
Sbjct  80   NVIMVDSFGFGTCTRHPDNATVYSSGNDRITLGSSGVINFICGKGEHCYKQGMKMSLT  137



>ref|XP_008789579.1| PREDICTED: mavicyanin-like [Phoenix dactylifera]
Length=169

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 15/127 (12%)
 Frame = +3

Query  150  LLCGFAEAETYIVGNNGKWDSAV--TDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYN  323
            +L   A A  Y+VG++  W+  V  TDW  GK F+ GD LVF YDP  HNV+ VS  ++ 
Sbjct  19   ILPAMARATEYVVGDDMGWNLGVNYTDWARGKVFRVGDSLVFRYDPENHNVLRVSGPDFQ  78

Query  324  SC--IDSGKILESGHDHVTLTS-GTSYYICGFTGHCKTGMKMAVTAS*SIVLPKG*IPTL  494
            +C  + +   L SG D V L+S G  +Y CG TGHC++G K+ +T           +P+L
Sbjct  79   ACNKVSAQGPLASGDDAVPLSSPGKRWYFCGKTGHCESGQKLVITV----------LPSL  128

Query  495  RAPTPLP  515
            +AP   P
Sbjct  129  QAPAASP  135



>ref|XP_006386330.1| hypothetical protein POPTR_0002s07460g [Populus trichocarpa]
 ref|XP_006387905.1| hypothetical protein POPTR_0487s00200g [Populus trichocarpa]
 gb|ERP46819.1| hypothetical protein POPTR_0487s00200g [Populus trichocarpa]
 gb|ERP64127.1| hypothetical protein POPTR_0002s07460g [Populus trichocarpa]
Length=103

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 2/100 (2%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIV  305
            +   +  M+L G   A TY VG +G W   +  WP  K FK+GD LVF YDP +HNVV V
Sbjct  4    VAALLCLMVLTGHVHAATYTVGGSGGWTLNMDSWPKDKRFKAGDTLVFTYDPTIHNVVAV  63

Query  306  SKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGH  419
            ++  Y+SCI     K+ +SG D + L+ G +++IC   GH
Sbjct  64   NRGGYSSCITPAGAKVYKSGKDQIKLSKGQNFFICNVAGH  103



>ref|XP_010905831.1| PREDICTED: basic blue protein-like [Elaeis guineensis]
Length=126

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 69/123 (56%), Gaps = 4/123 (3%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVT--DWPNGKSFKSGDVLVF  269
            MG+ S   ++ +  ++ M       A T++VG++  W  +++  DW N  +F +GD LVF
Sbjct  3    MGRGSCTTAVFLALLLIMCAPFHTLAATHVVGDSQGWGFSLSYADWANENTFAAGDTLVF  62

Query  270  NYDPNVHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMA  443
            NY P  HNVV VS   Y +C   D+ K   +G+D  TL  G +Y+IC   GHC  GMK+ 
Sbjct  63   NYQPGAHNVVPVSAAGYKTCKASDTSKAATTGNDKFTLKKGANYFICSLPGHCAAGMKLQ  122

Query  444  VTA  452
            V A
Sbjct  123  VVA  125



>gb|EMT07779.1| Mavicyanin [Aegilops tauschii]
Length=170

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 6/113 (5%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYIVGN-NGKWDSAVT--DWPNGKSFKSGDVLVFNYDPNVHNV  296
            I++A+ +M +   A A  Y VG   G WD +     W + ++F++GD +VF Y P  H+V
Sbjct  7    ILLAMASMAILSTASAAIYNVGEPGGAWDLSTNYGTWASSRNFQTGDQIVFKYSPQAHDV  66

Query  297  VIVSKENYNSCIDSGKI--LESGHDHVTL-TSGTSYYICGFTGHCKTGMKMAV  446
            + VSK +Y+SC  +  +    SG+D VTL T+GTSYYICGF GHC  GMK+ +
Sbjct  67   LEVSKADYDSCSTASPVTTFNSGNDVVTLTTTGTSYYICGFPGHCAGGMKVKI  119



>ref|XP_008456091.1| PREDICTED: basic blue protein-like [Cucumis melo]
Length=129

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVI  302
            +  + +V  L  G+A    Y VG+   W   V+ WP GK+F +GD+L FNY P+ HNVV 
Sbjct  15   VFCLFLVQQLKMGYAT--IYNVGDELGWTFNVSSWPIGKNFHAGDILAFNYTPSTHNVVE  72

Query  303  VSKENYNSCIDS---GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            V K  YN C+ +     +  SG D + L  G +YYIC   GHC+ GMK+A+ A+
Sbjct  73   VDKVGYNWCLINPIEATVHHSGKDQMKLVEGMNYYICSLPGHCQMGMKLAINAT  126



>ref|XP_004149963.1| PREDICTED: basic blue protein-like [Cucumis sativus]
 ref|XP_004160463.1| PREDICTED: basic blue protein-like [Cucumis sativus]
 gb|KGN57569.1| hypothetical protein Csa_3G214580 [Cucumis sativus]
Length=124

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 67/113 (59%), Gaps = 9/113 (8%)
 Frame = +3

Query  141  VTMLLCGF------AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVV-  299
            +T+LLC F      A+A+ Y VG+   W   V  W  GK F++GD++VF Y    HNVV 
Sbjct  11   ITLLLCIFLIQSEIAQAKVYTVGDALGWTFNVNTWTKGKIFRAGDIIVFKYPRMAHNVVS  70

Query  300  IVSKENYNSCIDS--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            + +K  YN C+     K+ ++G D + L  G +Y+IC + GHCK GMK+A+ A
Sbjct  71   LKNKVAYNWCLKPKGSKVYQTGKDRIKLVKGYNYFICSYPGHCKAGMKIAIKA  123



>ref|XP_006647843.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=138

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 64/116 (55%), Gaps = 12/116 (10%)
 Frame = +3

Query  141  VTMLLCGF----------AEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVH  290
            V +L+ GF          A A  Y VG++G W      W  GK+F++GDVL F Y+  VH
Sbjct  22   VQLLMVGFLVMSAAPLAAAAAARYTVGDSGGWRFYAEGWAKGKTFRAGDVLEFKYNAAVH  81

Query  291  NVVIVSKENYNSCIDSGKI--LESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            +V  V   +Y SC+    +  + SGHD VTL  G  Y+IC   GHCK GMK+AV A
Sbjct  82   DVAAVDLASYRSCVAPKGVRKMRSGHDKVTLHKGAHYFICTEPGHCKAGMKLAVRA  137



>gb|KHN48106.1| Basic blue protein [Glycine soja]
Length=122

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 61/101 (60%), Gaps = 3/101 (3%)
 Frame = +3

Query  162  FAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPN-VHNVVIVSKENYNSC--I  332
             A A TY VG++  W      WP GK F++GD LV+ +  +  HNVV V+K  Y+SC   
Sbjct  22   MARAATYRVGDSRGWTFNTVTWPQGKRFRAGDTLVWGWQRSGTHNVVAVNKAGYDSCKTP  81

Query  333  DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
               K+  SG D + L  G +Y+IC + GHC++GMK+A+ A+
Sbjct  82   RGAKVYRSGKDQIRLARGQNYFICNYVGHCESGMKIAINAA  122



>ref|XP_006650478.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=132

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 66/117 (56%), Gaps = 8/117 (7%)
 Frame = +3

Query  126  IVIAIVTMLLC------GFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNV  287
            + +A ++ + C      G A+A TY VG++  W      WP+GK F +GDVLVF Y P +
Sbjct  15   VAVAFLSAVSCFLLSGVGVADAATYYVGDSLGWSLGSGSWPSGKKFHAGDVLVFRYLPWM  74

Query  288  HNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            HNVV V ++ Y  C    S +   SG D V L  G ++++C   GHC  GMKM +TA
Sbjct  75   HNVVAVDEDGYADCNPPPSSRYYTSGSDSVKLARGDNFFVCTRYGHCNLGMKMVITA  131



>ref|NP_001141104.1| uncharacterized protein LOC100273187 precursor [Zea mays]
 gb|ACF85403.1| unknown [Zea mays]
 gb|ACG38124.1| basic blue protein precursor [Zea mays]
 tpg|DAA50955.1| TPA: basic blue protein [Zea mays]
Length=127

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +3

Query  171  AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DSGK  344
            A TY VG++  W  +   WPNGK F++GD LVF Y P +HNVV V ++ YN C      +
Sbjct  31   ATTYYVGDSNGWSFSSPSWPNGKHFRAGDTLVFRYIPWIHNVVAVDEDGYNGCTTPPGSR  90

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
               SG D VTL  G +++IC   GHC  GMK+ V A+
Sbjct  91   TYTSGADSVTLARGDNFFICTRFGHCNLGMKLVVYAA  127



>ref|NP_001051043.1| Os03g0709100 [Oryza sativa Japonica Group]
 gb|AAX95669.1| Plastocyanin-like domain, putative [Oryza sativa Japonica Group]
 gb|ABF98492.1| Plastocyanin-like domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12957.1| Os03g0709100 [Oryza sativa Japonica Group]
 gb|EAY91591.1| hypothetical protein OsI_13226 [Oryza sativa Indica Group]
 gb|EAZ28324.1| hypothetical protein OsJ_12299 [Oryza sativa Japonica Group]
 dbj|BAG88030.1| unnamed protein product [Oryza sativa Japonica Group]
Length=131

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 59/101 (58%), Gaps = 2/101 (2%)
 Frame = +3

Query  156  CGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCID  335
            CG A+A TY VG++  W      WP+GK F +GD+LVF Y P +HNVV V ++ Y  C  
Sbjct  30   CGVADAATYYVGDSLGWSLGSGSWPSGKKFHAGDILVFRYLPWMHNVVAVDEDGYADCNP  89

Query  336  S--GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
                +   SG D V L  G ++++C   GHC  GMKM VTA
Sbjct  90   PPFSRYYTSGSDSVRLARGDNFFVCTRYGHCNLGMKMVVTA  130



>ref|NP_001130720.1| uncharacterized protein LOC100191824 precursor [Zea mays]
 gb|ACF79053.1| unknown [Zea mays]
 tpg|DAA47751.1| TPA: blue copper protein [Zea mays]
Length=178

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 70/119 (59%), Gaps = 4/119 (3%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVT--DWPNGKSFKSGDVLVFNYD  278
            M+   S ++  +V +     A A T+ VG++  W  +V   +W +GK+F  GD LVFN+ 
Sbjct  1    MAASRSALITLLVLVSSVAAASATTFTVGDSSGWSRSVNYDNWASGKTFTDGDQLVFNFA  60

Query  279  PNVHNVVIVSKENYNSC--IDSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
               H+VV V K  Y+ C   ++   +++G   V LTSGT YYICG +GHC  GMK+AVT
Sbjct  61   TGNHDVVEVDKSGYDGCSTTNAANTIQNGPATVNLTSGTHYYICGISGHCSGGMKLAVT  119



>gb|EMS49012.1| Chemocyanin [Triticum urartu]
Length=122

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 3/97 (3%)
 Frame = +3

Query  171  AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG--K  344
             + + VG+N  W   V+ W +GK  +S DVLVF Y+P++HNVV V + +YNSC  SG  +
Sbjct  26   GKEWTVGDNKGWSFGVSGWESGKHIQSDDVLVFKYNPSMHNVVQVGEGDYNSCRVSGPSR  85

Query  345  ILESGHDHVTLT-SGTSYYICGFTGHCKTGMKMAVTA  452
               SG+DH+ L   G +++IC   GHC+ GMK+AVTA
Sbjct  86   TYTSGNDHIQLAREGKTFFICSHPGHCQQGMKIAVTA  122



>ref|XP_006826883.1| hypothetical protein AMTR_s00010p00136250 [Amborella trichopoda]
 gb|ERM94120.1| hypothetical protein AMTR_s00010p00136250 [Amborella trichopoda]
Length=125

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 63/94 (67%), Gaps = 2/94 (2%)
 Frame = +3

Query  171  AETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCI--DSGK  344
            A TY VG++  W   V +WP+GK+FK+GDVLVF YDP +HNVV V+   + +C+  +  K
Sbjct  27   ATTYTVGDSQGWTFYVANWPDGKTFKAGDVLVFKYDPALHNVVQVNGAGFTTCVIPEHSK  86

Query  345  ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAV  446
              ++G DH+ L SG ++++ G +G C+ GM + +
Sbjct  87   TYQTGLDHILLQSGGNFFVSGVSGDCQKGMLIEI  120



>ref|XP_009803053.1| PREDICTED: basic blue protein-like [Nicotiana sylvestris]
Length=122

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLC----GFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFN  272
            MS  +   +IA   ML        + A T+  G    W   +  WPNG++FK GDV+ F 
Sbjct  1    MSGGNRATIIAAAVMLCVLLQTSISSAATFPAGGANGWGFNMNGWPNGQTFKVGDVIEFK  60

Query  273  YDPNVHNVVIVSKENYNSCIDS-GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            Y   +HNVV VSK  +++C  + G++  SG D VTL  GT Y+IC    HC  G+K AVT
Sbjct  61   YMAGMHNVVKVSKAGFDACDGTGGQVFSSGDDKVTLVQGTQYFICTIGPHCSNGVKAAVT  120

Query  450  AS  455
            A+
Sbjct  121  AN  122



>ref|XP_003573015.1| PREDICTED: basic blue protein-like [Brachypodium distachyon]
Length=122

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 66/112 (59%), Gaps = 2/112 (2%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEA-ETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNV  296
            +++++ I+   + G AEA  TY VG+ G W   V  W  GK+F++GDVL F Y+  VH+V
Sbjct  9    AVLLLLILGARMSGGAEAARTYTVGDYGGWKFNVRGWARGKTFRAGDVLEFRYNRAVHDV  68

Query  297  VIVSKENYNSCIDSG-KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
              V    Y SC     K L SGHD V L  GT Y+IC   GHCK  MK+AVT
Sbjct  69   AAVDAAAYRSCSPGRWKALRSGHDKVRLVKGTHYFICTVRGHCKANMKIAVT  120



>gb|EMS61550.1| Chemocyanin [Triticum urartu]
Length=160

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = +3

Query  174  ETYIVGNNGKWDSAVTDW-PNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC---IDSG  341
             TY+VG++  W   +  W PNGK+F +GDVLVF YD  +H+V +V  + Y  C     S 
Sbjct  61   RTYVVGDDKGWGRDLNSWWPNGKTFYAGDVLVFKYDKELHDVSVVGGKGYQRCEVPRHSA  120

Query  342  K--ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            K  ++ +G+D VTL  G +Y+ICG  GHC   MK+AV A
Sbjct  121  KSWVMRTGNDQVTLRRGNNYFICGLPGHCDKNMKLAVKA  159



>ref|XP_002303034.1| hypothetical protein POPTR_0002s24290g [Populus trichocarpa]
 gb|EEE82307.1| hypothetical protein POPTR_0002s24290g [Populus trichocarpa]
Length=130

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 63/114 (55%), Gaps = 2/114 (2%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVV  299
            S +++ +        A+A T+ VG+   W   +  W +GK FK+GD L+FNYDP++H+V 
Sbjct  16   STLLVILSLQFKIAIAKAATFTVGDTSGWTFNIQSWTDGKKFKAGDSLIFNYDPSLHDVA  75

Query  300  IVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             V  + Y+ C    S     SG D + L  G +Y+IC    HC  G+K+AV AS
Sbjct  76   TVDVDGYDGCTLSPSSSTYTSGKDTIKLKEGQNYFICSLPSHCDWGLKIAVNAS  129



>gb|EMT07777.1| Blue copper protein [Aegilops tauschii]
Length=168

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYIVGN-NGKWDSAVT--DWPNGKSFKSGDVLVFNYDPNVHNVV  299
            ++A+  M +   A A  Y VG   G WD +     W + ++FK+ D +VF Y P  H+V+
Sbjct  7    ILAVAVMAILSTASAAIYNVGEPGGAWDLSTNYGTWASSRNFKADDQIVFKYSPQAHDVL  66

Query  300  IVSKENYNSCIDSGKI--LESGHDHVTLT-SGTSYYICGFTGHCKTGMKMAV  446
             VSK +Y+SC  +  I  L SG+D VTLT SGT Y+ICGF GHC  GMK+ +
Sbjct  67   EVSKADYDSCSTASPITTLNSGNDIVTLTASGTRYFICGFPGHCAGGMKVKI  118



>dbj|BAJ96430.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=138

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 69/120 (58%), Gaps = 11/120 (9%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAE-----AETYIVGNNGKWDSAVTDW-PNGKSFKSGDVLVFNYDPNV  287
            +V+  V + + G A        TY+VG++  W   +  W PNGK+F +GDVLVF YD  +
Sbjct  18   VVLLCVLLPITGAAAMAGRAPRTYVVGDDKGWARDLNSWWPNGKTFYAGDVLVFKYDKEL  77

Query  288  HNVVIVSKENYNSC---IDSGK--ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
            H+V ++  + Y  C     S K  ++ +G+D VTL  G +Y+ICG  GHC   MK+AV A
Sbjct  78   HDVTVLGGKGYRRCEVPRHSSKSWVMRTGNDQVTLRRGNNYFICGLPGHCDKNMKLAVKA  137



>ref|XP_003629970.1| Basic blue protein [Medicago truncatula]
 gb|AET04446.1| basic blue-like protein [Medicago truncatula]
Length=122

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +3

Query  168  EAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSC---IDS  338
             A TY VG    W      W  GK F++GD LVFNY    HNVV V+KE Y+ C      
Sbjct  24   HAATYNVGGTVGWTFNTVGWSRGKRFRAGDTLVFNYRQGTHNVVAVTKEVYDKCSTPRRG  83

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
             K+  SG D V L  G +Y++C F GHC +G+K+A+ A+
Sbjct  84   SKVYRSGKDRVRLAKGQNYFMCNFPGHCGSGVKIAINAA  122



>ref|XP_006345295.1| PREDICTED: mavicyanin-like [Solanum tuberosum]
Length=200

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 73/140 (52%), Gaps = 6/140 (4%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYIVGNNGKW--DSAVTDWPNGKSFKSGDVLVFNYDPNVHNV  296
            ++V+ +V M   G   A  Y VG++  W  +     W   K F+ GDVL+FNYDP+ HNV
Sbjct  9    LLVMLVVMMATLGSNTAAVYEVGDSSGWTFNYNYEQWAASKHFQLGDVLIFNYDPHFHNV  68

Query  297  VIVSKENYNSCIDSGKI--LESGHDHVTL-TSGTSYYICGFTGHCKTGMKMAVTAS*SIV  467
              V K+NYN C D   +    +G D +TL T G  Y++C   GHC +G++  +      V
Sbjct  69   RQVDKKNYNDCTDHNPMASFNTGSDTLTLETPGIYYFMCDIPGHCASGLRFQIKIDMPRV  128

Query  468  LPKG*IPTLRAPTPLPDKSI  527
            LP     T   P+P P KS 
Sbjct  129  LPAD-PETPHPPSPDPYKSF  147



>gb|EMS62053.1| Chemocyanin [Triticum urartu]
Length=125

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 59/100 (59%), Gaps = 6/100 (6%)
 Frame = +3

Query  168  EAETYIVGNNGKWDSAVT--DWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG  341
             A TY+VG+   W   V    W  GK+F++GDVLVF Y+   H+V  VSK  Y  C  S 
Sbjct  24   SATTYLVGDAAGWTRNVDYGGWLAGKTFRAGDVLVFKYNSTFHDVAWVSKGGYKKCTVSP  83

Query  342  K----ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
            K    +  +G+D VTL  GT Y+ICG  GHC  GMK+AVT
Sbjct  84   KGFAPVYRNGYDAVTLPRGTHYFICGVPGHCSAGMKLAVT  123



>ref|XP_002438215.1| hypothetical protein SORBIDRAFT_10g009630 [Sorghum bicolor]
 gb|EER89582.1| hypothetical protein SORBIDRAFT_10g009630 [Sorghum bicolor]
Length=146

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 69/120 (58%), Gaps = 14/120 (12%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEA-ETYIVGNNGKWDSAVT----DWPNGKSFKSGDVLVFNYDPN  284
            +++++A+ T      AEA  TY+VG+   W          W  GK+F +GD+LVF Y+  
Sbjct  29   AVLLLAVATPA----AEAGTTYLVGDAAGWTLRPKVDYGQWVAGKTFHAGDILVFKYNTT  84

Query  285  VHNVVIVSKENYNSCIDSGK-----ILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVT  449
             H+V  VSK  Y +CI S K     +  +GHD VTL  GT Y+ICG  GHC  GMK+AVT
Sbjct  85   YHDVAWVSKGGYRNCIVSPKGGRAPVYHTGHDAVTLPRGTHYFICGTPGHCSAGMKLAVT  144



>ref|XP_009615798.1| PREDICTED: mavicyanin-like [Nicotiana tomentosiformis]
Length=187

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 70/119 (59%), Gaps = 5/119 (4%)
 Frame = +3

Query  114  HDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAV--TDWPNGKSFKSGDVLVFNYDPNV  287
              +++ + +V M + G   AE Y VG+   WD  V    W + K FK GD LVFNY+P +
Sbjct  5    RKAMMFLLVVIMTIAGSTMAEVYEVGDFAGWDFNVDYNQWVSSKKFKLGDSLVFNYNPRL  64

Query  288  HNVVIVSKENYNSCIDSGKIL--ESGHDHVTL-TSGTSYYICGFTGHCKTGMKMAVTAS  455
            HNV+ V   +YN+C D+  I+   +G D +TL T G  +++CGF GHC +G+K  +  S
Sbjct  65   HNVMQVDSNDYNACTDNHPIVIYNTGGDTLTLETPGDYFFLCGFPGHCASGLKFHIKIS  123



>ref|XP_004977875.1| PREDICTED: chemocyanin-like [Setaria italica]
Length=113

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 61/98 (62%), Gaps = 3/98 (3%)
 Frame = +3

Query  168  EAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIV-SKENYNSC--IDS  338
            ++  + VG++  W   V  WPN K FK+GDVL+F+Y    HNVV V S   Y+ C    +
Sbjct  15   DSRLWPVGDSAGWSFGVLGWPNYKPFKAGDVLLFSYKHGAHNVVQVNSVAQYSMCEVPRN  74

Query  339  GKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
              +  SG+D VTL  G S+++CG  GHC+ GMK+AVTA
Sbjct  75   ATVWSSGNDRVTLARGMSFFVCGIPGHCQKGMKIAVTA  112



>ref|XP_004982013.1| PREDICTED: basic blue protein-like [Setaria italica]
Length=124

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 63/124 (51%), Gaps = 2/124 (2%)
 Frame = +3

Query  90   LFMGKMSTHDSIIVIAIVTMLLCGFAEAETYIVGNNGKWDSAVTDWPNGKSFKSGDVLVF  269
            +  G+ S   S  +   V   +       TY VG+N  W  +   WPNGK F +GD LVF
Sbjct  1    MARGRGSASASRAMAFAVACCILAADAGTTYYVGDNNGWSFSSPSWPNGKHFHAGDTLVF  60

Query  270  NYDPNVHNVVIVSKENYNSCI--DSGKILESGHDHVTLTSGTSYYICGFTGHCKTGMKMA  443
             Y P +HNVV V +  Y+ C      +   SG D VTL  G +++IC   GHC  GMK+ 
Sbjct  61   RYVPWIHNVVAVDEGGYDGCTTPPGSRTYTSGDDRVTLARGDNFFICTRFGHCNLGMKLV  120

Query  444  VTAS  455
            V A+
Sbjct  121  VYAA  124



>ref|XP_006648512.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=122

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +3

Query  180  YIVGNNGKWDSAVTDWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG--KILE  353
            + VG++  W   V  W NGK  + GDVLVF YD  +HNVV V +  Y+ C  +G  K+  
Sbjct  29   WTVGDDKGWTFGVAGWENGKRIRPGDVLVFKYDGKIHNVVEVDRAGYDGCKVTGPSKVRS  88

Query  354  SGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTAS  455
            SG D V L  G +++ICG   HC  GMK+AVT +
Sbjct  89   SGDDRVELAGGEAFFICGVGDHCSEGMKIAVTTA  122



>gb|EMS50846.1| Blue copper protein [Triticum urartu]
Length=171

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYIVGN-NGKWDSAVT--DWPNGKSFKSGDVLVFNYDPNVHNV  296
            I++A+  M +   A A TY VG   G WD +     W + ++F++ D +VF Y P  H+V
Sbjct  7    ILLAMAAMAVLSTASAATYNVGEPGGAWDLSTNYGTWASSRNFQTSDQIVFKYSPQAHDV  66

Query  297  VIVSKENYNSCIDSGKI--LESGHDHVTLTS-GTSYYICGFTGHCKTGMKMAV  446
            + VSK +Y+SC  +  I    SG+D VT T+ GT Y+ICGF GHC  GMK+ +
Sbjct  67   LEVSKADYDSCSTANPITTFNSGNDVVTFTATGTRYFICGFPGHCAGGMKVKI  119



>ref|XP_009420116.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=127

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 60/99 (61%), Gaps = 5/99 (5%)
 Frame = +3

Query  171  AETYIVGNNGKWDSAVT--DWPNGKSFKSGDVLVFNYDPNVHNVVIVSKENYNSCIDSG-  341
            A T++VG++  W  +++  +W NGKSF  GD LVFNY   +HNVV V+   Y SC  SG 
Sbjct  28   ATTHVVGDSQGWGFSMSYANWANGKSFAPGDTLVFNYQAGLHNVVPVNAAGYRSCKASGS  87

Query  342  --KILESGHDHVTLTSGTSYYICGFTGHCKTGMKMAVTA  452
              K   +G D  TL  G +Y+IC   GHC+ GMK+ V A
Sbjct  88   ASKAATTGDDKFTLKKGANYFICSIPGHCEAGMKIQVIA  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1092032152992