BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22332_g1_i1 len=635 path=[674:0-182 1466:183-207 894:208-244
931:245-270 957:271-303 990:304-353 1040:354-377 1833:378-479
1215:480-634]

Length=635
                                                                      Score     E

ref|XP_009380082.1|  PREDICTED: basic blue protein-like                 120   7e-31   
ref|XP_003558311.1|  PREDICTED: chemocyanin-like                        120   1e-30   
ref|XP_008218855.1|  PREDICTED: basic blue protein-like                 117   2e-29   
ref|XP_009803052.1|  PREDICTED: basic blue protein-like                 116   3e-29   
ref|XP_009605938.1|  PREDICTED: basic blue protein-like                 116   3e-29   
ref|XP_009773795.1|  PREDICTED: basic blue protein-like                 115   7e-29   
ref|XP_004290576.1|  PREDICTED: basic blue protein-like                 115   9e-29   
gb|EYU18545.1|  hypothetical protein MIMGU_mgv1a022688mg                114   2e-28   
ref|XP_002464008.1|  hypothetical protein SORBIDRAFT_01g010510          114   2e-28   Sorghum bicolor [broomcorn]
gb|ADP02231.1|  Cu_bind_like domain-containing protein                  114   3e-28   
ref|XP_009403746.1|  PREDICTED: basic blue protein-like                 114   4e-28   
ref|XP_007148487.1|  hypothetical protein PHAVU_006G212900g             113   4e-28   
gb|AAK55122.1|AF172853_1  putative S-RNase binding protein p11 pr...    113   5e-28   Nicotiana alata [flowering tobacco]
tpg|DAA50956.1|  TPA: chemocyanin                                       112   1e-27   
ref|XP_009605936.1|  PREDICTED: chemocyanin-like                        112   1e-27   
ref|XP_009101233.1|  PREDICTED: basic blue protein-like                 112   2e-27   
emb|CDY03030.1|  BnaC07g21970D                                          112   2e-27   
ref|XP_006650480.1|  PREDICTED: chemocyanin-like                        112   2e-27   
ref|NP_001147285.1|  chemocyanin precursor                              112   2e-27   Zea mays [maize]
sp|P60496.1|BABL_LILLO  RecName: Full=Chemocyanin; AltName: Full=...    111   2e-27   Lilium longiflorum [Easter lily]
ref|XP_008237710.1|  PREDICTED: basic blue protein-like                 111   3e-27   
ref|XP_002275987.1|  PREDICTED: basic blue protein                      111   3e-27   Vitis vinifera
ref|NP_001237531.1|  uncharacterized protein LOC100305588 precursor     110   4e-27   
ref|XP_004982012.1|  PREDICTED: chemocyanin-like                        110   5e-27   
gb|AFK43827.1|  unknown                                                 110   5e-27   
gb|KHN23440.1|  Basic blue protein                                      110   7e-27   
gb|AFK38070.1|  unknown                                                 110   8e-27   
ref|XP_007200120.1|  hypothetical protein PRUPE_ppa018507mg             109   1e-26   
ref|XP_010270378.1|  PREDICTED: basic blue protein-like                 109   2e-26   
ref|XP_002464007.1|  hypothetical protein SORBIDRAFT_01g010500          109   2e-26   Sorghum bicolor [broomcorn]
ref|XP_010926149.1|  PREDICTED: chemocyanin-like                        109   2e-26   
ref|XP_010260470.1|  PREDICTED: basic blue protein-like                 109   2e-26   
ref|XP_009341322.1|  PREDICTED: basic blue protein-like                 108   3e-26   
ref|XP_006434344.1|  hypothetical protein CICLE_v10002840mg             108   3e-26   
ref|XP_006472899.1|  PREDICTED: basic blue protein-like                 108   4e-26   
ref|NP_001152423.1|  chemocyanin precursor                              108   4e-26   Zea mays [maize]
ref|XP_006349438.1|  PREDICTED: chemocyanin-like                        110   4e-26   
ref|XP_010932617.1|  PREDICTED: basic blue protein-like                 108   4e-26   
ref|XP_003562309.1|  PREDICTED: chemocyanin-like                        108   5e-26   
ref|XP_002520251.1|  Basic blue protein, putative                       108   5e-26   Ricinus communis
ref|XP_010916152.1|  PREDICTED: basic blue protein-like                 108   5e-26   
ref|NP_001051044.1|  Os03g0709300                                       108   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009421112.1|  PREDICTED: basic blue protein-like                 108   5e-26   
gb|EPS59878.1|  hypothetical protein M569_14927                         108   6e-26   
ref|XP_010425055.1|  PREDICTED: basic blue protein-like                 107   8e-26   
ref|XP_004488137.1|  PREDICTED: chemocyanin-like                        107   8e-26   
ref|XP_006395754.1|  hypothetical protein EUTSA_v10005123mg             107   1e-25   
ref|XP_008339291.1|  PREDICTED: basic blue protein-like                 107   1e-25   
ref|XP_007041535.1|  Copper binding protein 6                           107   1e-25   
ref|XP_006292005.1|  hypothetical protein CARUB_v10018193mg             107   2e-25   
ref|XP_007227174.1|  hypothetical protein PRUPE_ppa021383mg             106   2e-25   
gb|EMT21220.1|  Basic blue protein                                      106   3e-25   
ref|XP_010548684.1|  PREDICTED: basic blue protein-like                 105   3e-25   
ref|NP_001049610.1|  Os03g0259100                                       105   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002468153.1|  hypothetical protein SORBIDRAFT_01g040540          105   4e-25   Sorghum bicolor [broomcorn]
ref|XP_008781025.1|  PREDICTED: basic blue protein-like                 105   4e-25   
ref|XP_006649774.1|  PREDICTED: chemocyanin-like                        105   5e-25   
ref|XP_009368430.1|  PREDICTED: basic blue protein                      105   5e-25   
gb|ABZ04879.1|  putative chemocyanin precursor                          105   6e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001150703.1|  chemocyanin precursor                              105   6e-25   Zea mays [maize]
ref|XP_006826880.1|  hypothetical protein AMTR_s00010p00134400          105   6e-25   
ref|XP_010502294.1|  PREDICTED: basic blue protein                      105   7e-25   
ref|XP_004301543.1|  PREDICTED: chemocyanin-like                        105   7e-25   
gb|EMS57005.1|  Basic blue protein                                      105   8e-25   
gb|KDO65913.1|  hypothetical protein CISIN_1g039717mg                   105   8e-25   
ref|NP_001051910.1|  Os03g0850900                                       104   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008775007.1|  PREDICTED: basic blue protein-like                 104   1e-24   
gb|AFP73459.1|  early nodulin-like protein                              105   1e-24   
gb|EYU18547.1|  hypothetical protein MIMGU_mgv1a016285mg                104   1e-24   
dbj|BAJ95771.1|  predicted protein                                      104   1e-24   
ref|XP_007137515.1|  hypothetical protein PHAVU_009G133600g             104   1e-24   
ref|XP_009404130.1|  PREDICTED: basic blue protein-like                 104   1e-24   
gb|KHN44270.1|  Basic blue protein                                      104   2e-24   
ref|XP_010514055.1|  PREDICTED: basic blue protein-like                 104   2e-24   
ref|XP_011014751.1|  PREDICTED: basic blue protein                      104   2e-24   
ref|XP_008339290.1|  PREDICTED: basic blue protein-like                 103   2e-24   
ref|XP_002298184.1|  basic blue copper family protein                   103   3e-24   Populus trichocarpa [western balsam poplar]
ref|NP_001149596.1|  chemocyanin precursor                              103   3e-24   Zea mays [maize]
ref|NP_001266663.1|  chemocyanin precursor                              103   3e-24   
ref|XP_003560817.1|  PREDICTED: basic blue protein-like                 103   3e-24   
ref|XP_002278646.1|  PREDICTED: basic blue protein                      103   4e-24   Vitis vinifera
gb|ACJ84083.1|  unknown                                                 103   4e-24   Medicago truncatula
ref|XP_006387908.1|  hypothetical protein POPTR_0487s00220g             103   4e-24   
gb|EMS48727.1|  Chemocyanin                                             103   4e-24   
gb|AGX45477.1|  chemocyanin-like protein                                103   4e-24   
ref|XP_003629993.1|  Basic blue protein                                 103   4e-24   
ref|XP_006443619.1|  hypothetical protein CICLE_v10022827mg             103   5e-24   
ref|XP_009129116.1|  PREDICTED: basic blue protein                      103   5e-24   
emb|CDY41671.1|  BnaC02g34830D                                          103   5e-24   
ref|XP_006650902.1|  PREDICTED: chemocyanin-like                        102   6e-24   
ref|XP_004982014.1|  PREDICTED: chemocyanin-like                        102   7e-24   
ref|XP_007023293.1|  Copper binding protein 6, putative                 102   8e-24   
ref|XP_002447932.1|  hypothetical protein SORBIDRAFT_06g018350          102   8e-24   Sorghum bicolor [broomcorn]
gb|ACG29532.1|  chemocyanin precursor                                   102   9e-24   Zea mays [maize]
emb|CDO97529.1|  unnamed protein product                                102   1e-23   
ref|XP_004301545.1|  PREDICTED: chemocyanin-like                        102   1e-23   
ref|XP_009404791.1|  PREDICTED: chemocyanin-like                        102   2e-23   
ref|XP_009404787.1|  PREDICTED: basic blue protein-like                 101   2e-23   
gb|AFK41897.1|  unknown                                                 101   2e-23   
ref|XP_002876842.1|  predicted protein                                  101   2e-23   
dbj|BAJ96641.1|  predicted protein                                      101   2e-23   
gb|KEH37636.1|  basic blue-like protein                                 101   2e-23   
ref|NP_001265957.1|  basic blue protein-like precursor                  100   3e-23   
gb|KFK33467.1|  hypothetical protein AALP_AA5G016900                    101   3e-23   
gb|KFK33466.1|  hypothetical protein AALP_AA5G016800                    101   3e-23   
ref|XP_008218970.1|  PREDICTED: basic blue protein-like                 100   3e-23   
gb|AFK36389.1|  unknown                                                 100   3e-23   
gb|ABK23767.1|  unknown                                                 100   3e-23   Picea sitchensis
ref|XP_010692867.1|  PREDICTED: basic blue protein-like                 100   3e-23   
ref|NP_001149612.1|  chemocyanin precursor                              100   4e-23   Zea mays [maize]
ref|XP_007019333.1|  Copper binding protein 6                           100   4e-23   
gb|ABZ04882.1|  putative chemocyanin precursor                          100   4e-23   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001235375.1|  uncharacterized protein LOC100305948 precursor     100   4e-23   
ref|XP_010692871.1|  PREDICTED: basic blue protein-like                 100   4e-23   
gb|ADV57641.1|  copper binding protein 6                                100   5e-23   
gb|EYU18544.1|  hypothetical protein MIMGU_mgv1a016345mg                100   6e-23   
gb|ACJ84194.1|  unknown                                                 100   7e-23   Medicago truncatula
gb|AFW57670.1|  hypothetical protein ZEAMMB73_536294                  99.4    8e-23   
ref|XP_008775029.1|  PREDICTED: chemocyanin-like                      99.8    9e-23   
ref|XP_011087777.1|  PREDICTED: basic blue protein-like               99.8    9e-23   
ref|XP_010241114.1|  PREDICTED: basic blue protein-like               99.8    9e-23   
gb|ACG32438.1|  chemocyanin precursor                                 99.4    1e-22   Zea mays [maize]
gb|AAM60981.1|  putative basic blue protein plantacyanin              99.8    1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006653392.1|  PREDICTED: basic blue protein-like               99.8    1e-22   
gb|KHG19540.1|  Basic blue                                            99.4    1e-22   
emb|CDP03862.1|  unnamed protein product                              99.4    1e-22   
ref|XP_009765796.1|  PREDICTED: basic blue protein-like               99.4    1e-22   
ref|XP_011024698.1|  PREDICTED: basic blue protein-like               99.4    1e-22   
gb|EMS53389.1|  Chemocyanin                                           99.0    2e-22   
gb|KHN47172.1|  Basic blue protein                                    99.0    2e-22   
ref|XP_004149964.1|  PREDICTED: basic blue protein-like               99.0    2e-22   
ref|NP_178388.1|  plantacyanin                                        99.0    2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004981033.1|  PREDICTED: chemocyanin-like                      99.0    2e-22   
ref|XP_004299980.1|  PREDICTED: basic blue protein-like               98.6    2e-22   
ref|XP_003541507.2|  PREDICTED: chemocyanin-like                      98.6    2e-22   
gb|KHG11741.1|  hypothetical protein F383_14857                       98.6    2e-22   
gb|AFK41143.1|  unknown                                               98.6    3e-22   
ref|XP_010549226.1|  PREDICTED: LOW QUALITY PROTEIN: basic blue p...  98.6    3e-22   
ref|XP_008441659.1|  PREDICTED: basic blue protein-like               99.0    3e-22   
ref|XP_002266573.1|  PREDICTED: basic blue protein-like               98.2    3e-22   Vitis vinifera
ref|XP_004149974.1|  PREDICTED: basic blue protein-like               98.2    3e-22   
ref|XP_009405255.1|  PREDICTED: basic blue protein-like               98.2    3e-22   
ref|XP_004984952.1|  PREDICTED: basic blue protein-like               98.2    3e-22   
ref|XP_010109721.1|  Basic blue protein                               98.2    3e-22   
ref|NP_001237170.1|  uncharacterized protein LOC100499869 precursor   97.8    4e-22   
gb|KHG29325.1|  Basic blue                                            98.2    4e-22   
ref|XP_006826879.1|  hypothetical protein AMTR_s00010p00134160        97.8    4e-22   
ref|XP_008465594.1|  PREDICTED: basic blue protein-like               97.8    4e-22   
ref|XP_002275963.1|  PREDICTED: basic blue protein                    97.8    5e-22   Vitis vinifera
emb|CBI23865.3|  unnamed protein product                              98.2    5e-22   
gb|EMS53390.1|  Chemocyanin                                           97.8    5e-22   
gb|EMT29953.1|  Chemocyanin                                           97.4    6e-22   
ref|XP_010063900.1|  PREDICTED: basic blue protein                    97.8    6e-22   
ref|XP_007159595.1|  hypothetical protein PHAVU_002G250600g           97.4    6e-22   
emb|CBI19945.3|  unnamed protein product                              98.6    7e-22   
ref|XP_009414068.1|  PREDICTED: basic blue protein-like               97.4    7e-22   
ref|NP_001048019.2|  Os02g0731400                                     97.4    8e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004502569.1|  PREDICTED: basic blue protein-like               97.1    8e-22   
ref|XP_008456091.1|  PREDICTED: basic blue protein-like               97.1    9e-22   
ref|XP_004160478.1|  PREDICTED: basic blue protein-like               97.1    9e-22   
gb|AEC10985.1|  basic blue protein                                    97.1    9e-22   
gb|EEC73941.1|  hypothetical protein OsI_08810                        97.1    1e-21   Oryza sativa Indica Group [Indian rice]
emb|CAB65280.1|  basic blue protein                                   96.3    1e-21   Medicago sativa subsp. x varia
ref|XP_006431923.1|  hypothetical protein CICLE_v10003124mg           96.3    2e-21   
ref|XP_011027397.1|  PREDICTED: LOW QUALITY PROTEIN: carboxyvinyl...  99.8    2e-21   
gb|KDO50927.1|  hypothetical protein CISIN_1g048131mg                 95.9    2e-21   
ref|XP_006349402.1|  PREDICTED: basic blue protein-like               95.5    3e-21   
gb|EMS53388.1|  Chemocyanin                                           95.5    3e-21   
ref|XP_002266922.1|  PREDICTED: basic blue protein                    95.5    3e-21   Vitis vinifera
ref|XP_002303034.1|  hypothetical protein POPTR_0002s24290g           95.5    3e-21   Populus trichocarpa [western balsam poplar]
gb|AFK38630.1|  unknown                                               95.1    4e-21   
ref|XP_004165906.1|  PREDICTED: basic blue protein-like               95.5    4e-21   
gb|KGN47495.1|  Basic blue protein                                    95.5    4e-21   
ref|XP_007159596.1|  hypothetical protein PHAVU_002G250700g           95.1    5e-21   
dbj|BAK02839.1|  predicted protein                                    95.1    5e-21   
ref|XP_004230515.1|  PREDICTED: basic blue protein-like               94.7    5e-21   
ref|XP_002452607.1|  hypothetical protein SORBIDRAFT_04g028940        95.1    6e-21   Sorghum bicolor [broomcorn]
ref|XP_010103882.1|  Basic blue protein                               94.4    8e-21   
gb|EMS62053.1|  Chemocyanin                                           94.4    8e-21   
ref|XP_006826881.1|  hypothetical protein AMTR_s00010p00135470        94.4    8e-21   
ref|NP_001234435.1|  plantacyanin precursor                           94.4    9e-21   
ref|XP_002438215.1|  hypothetical protein SORBIDRAFT_10g009630        94.7    1e-20   Sorghum bicolor [broomcorn]
ref|XP_006648513.1|  PREDICTED: chemocyanin-like                      94.4    1e-20   
gb|KEH37639.1|  basic blue-like protein                               93.6    1e-20   
gb|EMT29954.1|  Chemocyanin                                           93.6    1e-20   
ref|XP_006493535.1|  PREDICTED: uncharacterized protein LOC102628714  97.1    2e-20   
gb|EMS52226.1|  Basic blue protein                                    94.4    2e-20   
ref|NP_001051043.1|  Os03g0709100                                     93.2    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011087776.1|  PREDICTED: basic blue protein-like               93.2    3e-20   
gb|KHG30077.1|  Basic blue                                            93.2    3e-20   
ref|XP_006650478.1|  PREDICTED: chemocyanin-like                      92.8    3e-20   
ref|XP_007201673.1|  hypothetical protein PRUPE_ppa022496mg           92.8    3e-20   
ref|XP_006656866.1|  PREDICTED: chemocyanin-like                      92.8    4e-20   
gb|ADV57643.1|  copper binding protein 8                              92.4    4e-20   
ref|XP_008800754.1|  PREDICTED: basic blue protein-like               92.4    4e-20   
ref|XP_002464009.1|  hypothetical protein SORBIDRAFT_01g010520        92.0    7e-20   Sorghum bicolor [broomcorn]
pdb|2CBP|A  Chain A, Cucumber Basic Protein, A Blue Copper Protein    90.9    8e-20   
ref|NP_001148389.1|  LOC100282003 precursor                           92.0    9e-20   Zea mays [maize]
gb|ACN37046.1|  unknown                                               92.0    9e-20   Zea mays [maize]
ref|XP_004144257.1|  PREDICTED: basic blue protein-like               90.9    9e-20   
ref|XP_006349398.1|  PREDICTED: chemocyanin-like                      91.3    1e-19   
ref|XP_011087775.1|  PREDICTED: basic blue protein-like               91.3    2e-19   
dbj|BAJ96430.1|  predicted protein                                    91.3    2e-19   
ref|XP_010905831.1|  PREDICTED: basic blue protein-like               90.9    2e-19   
ref|NP_001130720.1|  uncharacterized protein LOC100191824 precursor   92.0    2e-19   Zea mays [maize]
ref|NP_001141104.1|  uncharacterized protein LOC100273187 precursor   90.5    2e-19   Zea mays [maize]
gb|EMS61550.1|  Chemocyanin                                           91.7    2e-19   
ref|XP_010692866.1|  PREDICTED: basic blue protein-like               90.5    2e-19   
dbj|BAK06251.1|  predicted protein                                    90.1    3e-19   
ref|XP_006647843.1|  PREDICTED: chemocyanin-like                      90.9    3e-19   
sp|P00303.1|BABL_CUCSA  RecName: Full=Basic blue protein; AltName...  89.4    3e-19   Cucumis sativus [cucumbers]
ref|XP_006345294.1|  PREDICTED: mavicyanin-like                       90.1    4e-19   
ref|XP_006349399.1|  PREDICTED: chemocyanin-like                      89.7    4e-19   
gb|EMT07777.1|  Blue copper protein                                   90.9    4e-19   
dbj|BAD53512.1|  putative chemocyanin precursor                       90.5    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AFK40327.1|  unknown                                               89.4    6e-19   
ref|XP_006349400.1|  PREDICTED: chemocyanin-like                      89.4    6e-19   
ref|XP_011087774.1|  PREDICTED: basic blue protein-like               89.7    6e-19   
gb|EAZ00445.1|  hypothetical protein OsI_22465                        89.7    6e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_006349401.1|  PREDICTED: chemocyanin-like                      89.4    6e-19   
gb|EMT33682.1|  Blue copper protein                                   90.5    7e-19   
gb|EPS66274.1|  hypothetical protein M569_08503                       89.0    8e-19   
ref|XP_004977875.1|  PREDICTED: chemocyanin-like                      88.6    9e-19   
gb|EMT07779.1|  Mavicyanin                                            90.1    9e-19   
ref|XP_004230514.1|  PREDICTED: basic blue protein-like               88.6    1e-18   
ref|XP_003571173.1|  PREDICTED: basic blue protein-like               88.6    1e-18   
ref|NP_001152010.1|  blue copper protein precursor                    89.4    2e-18   Zea mays [maize]
ref|XP_004149963.1|  PREDICTED: basic blue protein-like               88.2    2e-18   
gb|EMS50846.1|  Blue copper protein                                   89.4    2e-18   
gb|ACG40270.1|  blue copper protein precursor                         89.4    2e-18   Zea mays [maize]
ref|XP_008789430.1|  PREDICTED: basic blue protein-like               88.2    2e-18   
ref|XP_003560827.1|  PREDICTED: basic blue protein-like               88.2    2e-18   
gb|ACN28394.1|  unknown                                               89.0    2e-18   Zea mays [maize]
dbj|BAK00202.1|  predicted protein                                    89.0    2e-18   
ref|XP_004953818.1|  PREDICTED: chemocyanin-like                      88.2    2e-18   
dbj|BAK01270.1|  predicted protein                                    88.2    2e-18   
gb|KHN48106.1|  Basic blue protein                                    87.8    3e-18   
ref|XP_008659439.1|  PREDICTED: basic blue protein-like               88.2    3e-18   
gb|EMT33683.1|  Blue copper protein                                   89.0    3e-18   
ref|XP_002275938.1|  PREDICTED: basic blue protein-like               87.4    3e-18   Vitis vinifera
emb|CAN73750.1|  hypothetical protein VITISV_021353                   87.4    3e-18   Vitis vinifera
ref|XP_009599432.1|  PREDICTED: basic blue protein-like               87.4    3e-18   
ref|XP_011023387.1|  PREDICTED: mavicyanin-like                       88.2    4e-18   
gb|EMT05500.1|  Chemocyanin                                           87.0    4e-18   
ref|XP_009420116.1|  PREDICTED: basic blue protein-like               87.0    4e-18   
ref|XP_009605937.1|  PREDICTED: basic blue protein-like               86.7    6e-18   
gb|EMS58905.1|  Blue copper protein                                   87.8    6e-18   
emb|CBI23864.3|  unnamed protein product                              87.4    7e-18   
ref|XP_008456090.1|  PREDICTED: basic blue protein-like               86.7    7e-18   
ref|XP_009372474.1|  PREDICTED: basic blue protein-like               86.3    7e-18   
ref|XP_006386330.1|  hypothetical protein POPTR_0002s07460g           85.9    8e-18   
ref|XP_002528609.1|  Chemocyanin precursor, putative                  86.7    8e-18   Ricinus communis
ref|XP_007148486.1|  hypothetical protein PHAVU_006G212800g           86.3    8e-18   
ref|XP_006826883.1|  hypothetical protein AMTR_s00010p00136250        86.3    9e-18   
gb|EMT18582.1|  Chemocyanin                                           86.7    9e-18   
ref|XP_006345295.1|  PREDICTED: mavicyanin-like                       87.8    9e-18   
gb|EAZ05532.1|  hypothetical protein OsI_27748                        87.8    9e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001060958.2|  Os08g0138200                                     87.8    9e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565597.1|  PREDICTED: basic blue protein-like               86.7    9e-18   
ref|XP_006659099.1|  PREDICTED: blue copper protein-like              87.4    9e-18   
gb|EAZ41457.1|  hypothetical protein OsJ_25979                        87.8    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003573015.1|  PREDICTED: basic blue protein-like               85.9    1e-17   
dbj|BAK04521.1|  predicted protein                                    85.5    1e-17   
gb|EMS58903.1|  Blue copper protein                                   88.2    1e-17   
ref|XP_009615798.1|  PREDICTED: mavicyanin-like                       87.0    2e-17   
ref|XP_004982013.1|  PREDICTED: basic blue protein-like               85.1    2e-17   
ref|XP_004965194.1|  PREDICTED: chemocyanin-like                      85.5    2e-17   
gb|EMS49012.1|  Chemocyanin                                           84.7    3e-17   
ref|XP_008778065.1|  PREDICTED: mavicyanin-like                       85.9    3e-17   
gb|EAY85248.1|  hypothetical protein OsI_06622                        84.7    3e-17   Oryza sativa Indica Group [Indian rice]
dbj|BAD03006.1|  putative blue copper binding protein                 86.3    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009586697.1|  PREDICTED: blue copper protein-like              86.3    3e-17   
gb|EAZ05531.1|  hypothetical protein OsI_27747                        86.3    4e-17   Oryza sativa Indica Group [Indian rice]
gb|EMT26024.1|  Blue copper protein                                   85.5    4e-17   
ref|XP_003629970.1|  Basic blue protein                               84.3    4e-17   
gb|EEE68013.1|  hypothetical protein OsJ_25976                        85.5    5e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82872.1|  hypothetical protein OsI_27745                        85.5    5e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_006421526.1|  hypothetical protein CICLE_v10006935mg           86.3    5e-17   
ref|XP_002459878.1|  hypothetical protein SORBIDRAFT_02g012920        85.5    5e-17   Sorghum bicolor [broomcorn]
ref|XP_006648512.1|  PREDICTED: chemocyanin-like                      84.0    5e-17   
ref|XP_006490063.1|  PREDICTED: blue copper protein-like              86.3    5e-17   
gb|KDO40616.1|  hypothetical protein CISIN_1g039191mg                 86.3    5e-17   
ref|XP_009803053.1|  PREDICTED: basic blue protein-like               84.0    6e-17   
gb|KHG06922.1|  Blue copper                                           85.1    6e-17   
ref|XP_011074212.1|  PREDICTED: blue copper protein                   85.5    7e-17   
ref|XP_003533293.1|  PREDICTED: basic blue protein-like               84.0    7e-17   
gb|EAY85251.1|  hypothetical protein OsI_06624                        83.6    7e-17   
ref|NP_001060957.1|  Os08g0137800                                     85.1    7e-17   
ref|XP_007018694.1|  Cupredoxin superfamily protein, putative         85.1    8e-17   
dbj|BAD03003.1|  putative blue copper binding protein                 85.1    8e-17   
ref|XP_002459877.1|  hypothetical protein SORBIDRAFT_02g012910        84.7    9e-17   
ref|XP_006662866.1|  PREDICTED: chemocyanin-like                      83.2    1e-16   
gb|EMS58906.1|  Blue copper protein                                   84.3    1e-16   
ref|NP_001172886.1|  Os02g0257100                                     83.2    1e-16   
ref|XP_007041533.1|  Early nodulin-like protein 22, putative          83.2    2e-16   
ref|XP_002303318.2|  hypothetical protein POPTR_0003s04580g           84.3    2e-16   
gb|KHG25479.1|  Blue copper                                           84.0    2e-16   
ref|XP_010939704.1|  PREDICTED: blue copper protein-like              84.0    2e-16   
ref|XP_009614877.1|  PREDICTED: basic blue protein-like               84.0    2e-16   
gb|AAC32448.1|  plantacyanin                                          82.4    2e-16   
gb|EMS58904.1|  Mavicyanin                                            83.6    2e-16   
ref|XP_002449820.1|  hypothetical protein SORBIDRAFT_05g023920        82.4    2e-16   
gb|ADP02230.1|  Cu_bind_like domain-containing protein                82.4    2e-16   
ref|XP_003560832.1|  PREDICTED: basic blue protein-like               82.4    3e-16   
ref|XP_002298440.2|  hypothetical protein POPTR_0001s27560g           83.2    3e-16   
ref|NP_001046471.1|  Os02g0256800                                     82.0    3e-16   
emb|CDY45193.1|  BnaA06g33970D                                        81.6    3e-16   
gb|EMT03203.1|  Blue copper protein                                   83.2    3e-16   
ref|XP_007155024.1|  hypothetical protein PHAVU_003G166800g           84.7    3e-16   
ref|XP_007155023.1|  hypothetical protein PHAVU_003G166700g           84.7    4e-16   
emb|CAE04641.1|  OSJNBa0028I23.23                                     82.0    4e-16   
emb|CAH66929.1|  H0525E10.13                                          82.0    4e-16   
ref|XP_011012945.1|  PREDICTED: chemocyanin-like                      83.2    5e-16   
gb|KDP28869.1|  hypothetical protein JCGZ_14640                       82.8    6e-16   
ref|XP_006338690.1|  PREDICTED: blue copper protein-like              82.4    6e-16   
ref|XP_007155014.1|  hypothetical protein PHAVU_003G165800g           84.0    6e-16   
ref|XP_007041532.1|  Early nodulin-like protein 22                    81.6    7e-16   
ref|XP_002879382.1|  hypothetical protein ARALYDRAFT_482160           83.2    7e-16   
gb|EAZ01602.1|  hypothetical protein OsI_23639                        80.9    7e-16   
ref|XP_006857363.1|  hypothetical protein AMTR_s00067p00118460        80.9    9e-16   
ref|XP_004957077.1|  PREDICTED: blue copper protein-like              81.6    9e-16   
gb|ABK26526.1|  unknown                                               82.0    9e-16   
pdb|1F56|A  Chain A, Spinach Plantacyanin                             79.7    9e-16   
ref|XP_011023469.1|  PREDICTED: blue copper protein-like              82.8    1e-15   
gb|EMT21853.1|  Blue copper protein                                   81.6    1e-15   
ref|XP_004152622.1|  PREDICTED: blue copper protein-like              82.4    1e-15   
ref|XP_004970211.1|  PREDICTED: blue copper protein-like              82.8    1e-15   
ref|XP_008241227.1|  PREDICTED: uncharacterized protein LOC103339673  83.6    1e-15   
gb|ACN54192.1|  blue copper protein                                   81.6    1e-15   
ref|XP_009798275.1|  PREDICTED: blue copper protein-like              82.4    1e-15   
ref|XP_010317461.1|  PREDICTED: mavicyanin-like                       81.6    1e-15   
gb|EMS59213.1|  Blue copper protein                                   81.6    1e-15   
ref|XP_010266815.1|  PREDICTED: blue copper protein-like              81.6    1e-15   
ref|XP_009761758.1|  PREDICTED: basic blue protein-like               80.1    2e-15   
gb|KDP41427.1|  hypothetical protein JCGZ_15834                       81.6    2e-15   
ref|NP_001067784.1|  Os11g0428800                                     79.7    2e-15   
ref|XP_010050212.1|  PREDICTED: basic blue protein-like               79.7    2e-15   
emb|CDO98154.1|  unnamed protein product                              81.3    2e-15   
ref|XP_003532980.1|  PREDICTED: basic blue protein-like               79.7    2e-15   
ref|XP_007214402.1|  hypothetical protein PRUPE_ppa026626mg           81.3    2e-15   
ref|XP_004956272.1|  PREDICTED: blue copper protein-like              80.5    3e-15   
ref|XP_008789579.1|  PREDICTED: mavicyanin-like                       80.5    3e-15   
ref|XP_004956273.1|  PREDICTED: blue copper protein-like              80.5    3e-15   
ref|XP_003578265.1|  PREDICTED: blue copper protein-like              80.1    3e-15   
dbj|BAK00909.1|  predicted protein                                    80.5    3e-15   
ref|XP_007135755.1|  hypothetical protein PHAVU_010G155900g           80.5    3e-15   
ref|XP_004147603.1|  PREDICTED: blue copper protein-like              80.1    3e-15   
ref|XP_006433913.1|  hypothetical protein CICLE_v10002591mg           80.5    3e-15   
ref|XP_009622013.1|  PREDICTED: mavicyanin-like                       80.5    4e-15   
ref|XP_004237949.1|  PREDICTED: blue copper protein                   80.1    4e-15   
ref|XP_010935193.1|  PREDICTED: mavicyanin-like                       80.1    4e-15   
gb|EYU36477.1|  hypothetical protein MIMGU_mgv1a014161mg              80.5    4e-15   
gb|KDP27597.1|  hypothetical protein JCGZ_19602                       79.0    5e-15   
gb|ABU56004.1|  blue copper-binding protein                           79.7    5e-15   
ref|XP_009770624.1|  PREDICTED: blue copper protein-like              80.1    5e-15   
ref|XP_004231787.1|  PREDICTED: mavicyanin                            79.7    5e-15   
gb|KDP43561.1|  hypothetical protein JCGZ_16848                       79.0    5e-15   
emb|CDY65141.1|  BnaC02g48390D                                        79.7    6e-15   
ref|XP_011026167.1|  PREDICTED: mavicyanin-like                       79.3    6e-15   
gb|KHG05659.1|  Blue copper                                           79.7    6e-15   
gb|KHG05969.1|  Chemocyanin                                           78.6    6e-15   
ref|XP_006826882.1|  hypothetical protein AMTR_s00010p00136010        78.2    7e-15   
ref|XP_011079859.1|  PREDICTED: mavicyanin-like                       79.7    7e-15   
ref|XP_009803778.1|  PREDICTED: basic blue protein-like               79.3    7e-15   
ref|XP_008437169.1|  PREDICTED: basic blue protein-like               79.3    7e-15   
ref|XP_003576631.1|  PREDICTED: blue copper protein-like              79.0    8e-15   
ref|XP_009391330.1|  PREDICTED: blue copper protein-like              79.3    8e-15   
ref|XP_006473004.1|  PREDICTED: blue copper protein-like              79.3    9e-15   
gb|KCW44224.1|  hypothetical protein EUGRSUZ_L02351                   79.0    9e-15   
gb|KDO55610.1|  hypothetical protein CISIN_1g030729mg                 79.0    9e-15   
ref|XP_006447099.1|  hypothetical protein CICLE_v10016947mg           79.0    9e-15   
ref|XP_011081177.1|  PREDICTED: blue copper protein-like              79.3    1e-14   
ref|XP_003575446.1|  PREDICTED: stellacyanin-like                     79.0    1e-14   
ref|XP_011022927.1|  PREDICTED: basic blue protein                    77.8    1e-14   
gb|AFK48048.1|  unknown                                               77.0    1e-14   
ref|XP_008449561.1|  PREDICTED: mavicyanin                            79.3    1e-14   
ref|XP_010266855.1|  PREDICTED: mavicyanin-like                       78.6    1e-14   
ref|XP_010041622.1|  PREDICTED: umecyanin-like                        79.0    1e-14   
gb|KDP29127.1|  hypothetical protein JCGZ_16516                       77.4    1e-14   
gb|EMT08781.1|  Chemocyanin                                           78.6    1e-14   
gb|EMT01941.1|  Basic blue protein                                    77.4    1e-14   
ref|XP_007141217.1|  hypothetical protein PHAVU_008G177100g           79.0    1e-14   
ref|XP_003549750.2|  PREDICTED: blue copper protein-like              79.3    2e-14   
ref|XP_009770280.1|  PREDICTED: mavicyanin-like                       78.2    2e-14   
ref|XP_010317457.1|  PREDICTED: mavicyanin-like                       77.8    2e-14   
ref|XP_006445439.1|  hypothetical protein CICLE_v10022525mg           78.2    2e-14   
gb|ADV57642.1|  copper binding protein 7                              78.2    2e-14   
ref|XP_008800585.1|  PREDICTED: mavicyanin-like                       78.2    2e-14   
gb|EMT14986.1|  Blue copper protein                                   78.2    2e-14   
ref|XP_008777839.1|  PREDICTED: cucumber peeling cupredoxin-like      78.6    2e-14   
gb|AAD10251.1|  blue copper-binding protein homolog                   77.8    2e-14   
ref|XP_006653637.1|  PREDICTED: blue copper protein-like              77.0    2e-14   
ref|XP_010940769.1|  PREDICTED: mavicyanin-like                       77.8    2e-14   
ref|XP_002961476.1|  hypothetical protein SELMODRAFT_69095            76.3    2e-14   
ref|XP_010690701.1|  PREDICTED: stellacyanin-like                     77.8    2e-14   
ref|XP_006421527.1|  hypothetical protein CICLE_v10005962mg           78.2    3e-14   
emb|CDY48260.1|  BnaC04g05190D                                        78.2    3e-14   
gb|EMT33685.1|  Mavicyanin                                            77.0    3e-14   
ref|XP_003609366.1|  Blue copper protein                              79.7    3e-14   
ref|XP_008373105.1|  PREDICTED: blue copper protein                   77.8    3e-14   
ref|XP_007023289.1|  Cupredoxin superfamily protein, putative         77.4    3e-14   
dbj|BAD15934.1|  putative Chemocyanin precursor                       77.4    3e-14   
tpg|DAA51831.1|  TPA: hypothetical protein ZEAMMB73_194052            76.3    3e-14   
ref|XP_008666919.1|  PREDICTED: mavicyanin-like                       76.3    4e-14   
ref|XP_006659514.1|  PREDICTED: blue copper protein-like              77.4    4e-14   
ref|XP_002460378.1|  hypothetical protein SORBIDRAFT_02g027260        77.0    4e-14   
ref|XP_004953983.1|  PREDICTED: blue copper protein-like              77.8    4e-14   
tpg|DAA36598.1|  TPA: hypothetical protein ZEAMMB73_027469            77.4    4e-14   
ref|NP_198005.1|  plastocyanin-like domain-containing protein / p...  77.4    4e-14   
gb|EYU46581.1|  hypothetical protein MIMGU_mgv1a014576mg              77.4    4e-14   
ref|XP_009143067.1|  PREDICTED: uclacyanin-2-like                     77.8    4e-14   
ref|XP_006647616.1|  PREDICTED: blue copper protein-like              77.4    4e-14   
ref|XP_006490062.1|  PREDICTED: blue copper protein-like              77.4    4e-14   
gb|AFW67270.1|  hypothetical protein ZEAMMB73_189474                  77.4    4e-14   
ref|XP_007163468.1|  hypothetical protein PHAVU_001G236700g           76.6    4e-14   
ref|XP_002513980.1|  Blue copper protein precursor, putative          77.4    4e-14   
ref|NP_001149787.1|  blue copper protein precursor                    77.4    4e-14   
ref|XP_001760382.1|  predicted protein                                76.6    5e-14   
ref|XP_008798824.1|  PREDICTED: blue copper protein-like              77.0    5e-14   
ref|XP_004974460.1|  PREDICTED: chemocyanin-like                      77.0    5e-14   
ref|XP_009595241.1|  PREDICTED: mavicyanin-like                       77.0    5e-14   
ref|XP_006291852.1|  hypothetical protein CARUB_v10018027mg           77.0    6e-14   
gb|ACZ74693.1|  basic blue protein                                    75.9    6e-14   
ref|XP_009129922.1|  PREDICTED: mavicyanin-like                       77.0    6e-14   
ref|XP_002443827.1|  hypothetical protein SORBIDRAFT_07g002860        76.6    6e-14   
ref|XP_002525715.1|  Mavicyanin, putative                             76.3    6e-14   
dbj|BAF01024.1|  uclacyanin I - like predicted GPI-anchored protein   77.4    6e-14   
ref|XP_010497014.1|  PREDICTED: uclacyanin-3-like                     77.0    6e-14   
emb|CDX87053.1|  BnaC09g03680D                                        76.6    6e-14   
ref|NP_180789.1|  uclacyanin 1                                        77.4    6e-14   
ref|XP_006487069.1|  PREDICTED: mavicyanin-like                       76.6    7e-14   
ref|XP_010919749.1|  PREDICTED: blue copper protein-like              76.6    7e-14   
gb|KCW79988.1|  hypothetical protein EUGRSUZ_C01322                   76.6    7e-14   
gb|KGN50175.1|  hypothetical protein Csa_5G157340                     76.3    8e-14   
ref|NP_001236879.1|  uncharacterized protein LOC100305545 precursor   76.3    8e-14   
ref|XP_002874308.1|  hypothetical protein ARALYDRAFT_489473           76.6    8e-14   
gb|KHN37985.1|  Blue copper protein                                   76.3    8e-14   
ref|XP_010048017.1|  PREDICTED: umecyanin-like                        76.3    8e-14   
emb|CDY19774.1|  BnaA09g04270D                                        76.3    9e-14   
ref|XP_002309922.1|  plastocyanin-like domain-containing family p...  75.5    9e-14   
gb|KCW80120.1|  hypothetical protein EUGRSUZ_C01450                   76.3    9e-14   
ref|XP_010933589.1|  PREDICTED: stellacyanin                          76.3    9e-14   
ref|XP_004957076.1|  PREDICTED: blue copper protein-like              75.9    9e-14   
ref|XP_007202499.1|  hypothetical protein PRUPE_ppa010678mg           77.0    9e-14   
ref|XP_006421531.1|  hypothetical protein CICLE_v10006656mg           76.6    9e-14   
gb|KCW80136.1|  hypothetical protein EUGRSUZ_C01480                   75.9    1e-13   
emb|CDX74686.1|  BnaA05g04320D                                        76.6    1e-13   
gb|KHN22113.1|  Stellacyanin                                          77.8    1e-13   
ref|XP_010515443.1|  PREDICTED: uclacyanin-3-like                     76.6    1e-13   
ref|XP_007152577.1|  hypothetical protein PHAVU_004G141800g           75.1    1e-13   
emb|CAD41463.3|  OSJNBa0079A21.7                                      76.3    1e-13   
ref|XP_003542629.1|  PREDICTED: blue copper protein-like              77.8    1e-13   
ref|XP_006419891.1|  hypothetical protein CICLE_v10005979mg           76.3    1e-13   
ref|XP_009761916.1|  PREDICTED: mavicyanin-like                       76.3    1e-13   
gb|ABN13629.1|  blue copper-like protein                              75.9    1e-13   
gb|EAY95049.1|  hypothetical protein OsI_16864                        75.9    1e-13   
ref|NP_001053468.1|  Os04g0545600                                     76.3    1e-13   
emb|CAH67255.1|  OSIGBa0101C23.7                                      75.9    1e-13   
ref|NP_001168456.1|  uncharacterized protein LOC100382230 precursor   76.3    1e-13   
gb|KDP40154.1|  hypothetical protein JCGZ_02152                       75.9    1e-13   
ref|XP_010048045.1|  PREDICTED: umecyanin-like                        75.9    1e-13   
ref|XP_011091677.1|  PREDICTED: early nodulin-like protein 1          76.6    1e-13   
ref|XP_010493895.1|  PREDICTED: mavicyanin-like                       75.9    1e-13   
dbj|BAJ87599.1|  predicted protein                                    75.9    1e-13   
ref|XP_010026035.1|  PREDICTED: blue copper protein                   75.9    1e-13   
emb|CDY65457.1|  BnaC03g71950D                                        76.6    1e-13   
ref|XP_004140151.1|  PREDICTED: mavicyanin-like                       75.9    1e-13   
ref|XP_009417164.1|  PREDICTED: mavicyanin                            75.9    1e-13   
ref|XP_010050033.1|  PREDICTED: umecyanin-like                        75.9    1e-13   
ref|XP_010454981.1|  PREDICTED: mavicyanin-like isoform X1            75.9    1e-13   
ref|XP_002452517.1|  hypothetical protein SORBIDRAFT_04g027290        76.3    2e-13   
gb|KFK26413.1|  hypothetical protein AALP_AA8G245300                  75.5    2e-13   
emb|CDY12217.1|  BnaC04g12470D                                        76.3    2e-13   
ref|XP_002466248.1|  hypothetical protein SORBIDRAFT_01g004320        75.9    2e-13   
ref|XP_002266874.1|  PREDICTED: cucumber peeling cupredoxin-like ...  75.5    2e-13   
ref|XP_010503741.1|  PREDICTED: uclacyanin-3-like                     75.9    2e-13   
emb|CDX71822.1|  BnaC08g30520D                                        74.7    2e-13   
ref|XP_006394874.1|  hypothetical protein EUTSA_v10004981mg           75.5    2e-13   
gb|AFK46705.1|  unknown                                               75.1    2e-13   
ref|NP_001234979.1|  uncharacterized protein LOC100305666 precursor   75.9    2e-13   
gb|EMT29096.1|  Blue copper protein                                   74.3    2e-13   
ref|XP_011032393.1|  PREDICTED: mavicyanin-like                       75.5    2e-13   
ref|XP_007211224.1|  hypothetical protein PRUPE_ppa013279mg           74.3    2e-13   
ref|XP_002528610.1|  Basic blue protein, putative                     73.2    2e-13   
ref|XP_009765641.1|  PREDICTED: mavicyanin-like                       75.5    2e-13   
ref|XP_004956416.1|  PREDICTED: blue copper protein-like              75.5    2e-13   
emb|CDP16681.1|  unnamed protein product                              75.1    2e-13   
ref|XP_010414015.1|  PREDICTED: blue copper protein-like              76.3    2e-13   
ref|XP_010234087.1|  PREDICTED: mavicyanin-like                       75.1    2e-13   
ref|XP_001752399.1|  predicted protein                                74.7    2e-13   
ref|XP_011016865.1|  PREDICTED: blue copper protein-like              75.1    2e-13   
ref|XP_004169987.1|  PREDICTED: mavicyanin-like                       75.1    2e-13   
emb|CAN66123.1|  hypothetical protein VITISV_023424                   76.6    2e-13   
ref|XP_011020150.1|  PREDICTED: umecyanin-like                        75.1    2e-13   
ref|XP_002265604.2|  PREDICTED: blue copper protein                   76.6    2e-13   
ref|XP_006651937.1|  PREDICTED: blue copper protein-like              74.3    2e-13   
ref|XP_010922520.1|  PREDICTED: cucumber peeling cupredoxin-like      75.9    2e-13   
ref|XP_006410363.1|  hypothetical protein EUTSA_v10017076mg           75.9    2e-13   
ref|XP_008455830.1|  PREDICTED: blue copper protein-like              75.9    3e-13   
ref|XP_010534192.1|  PREDICTED: basic blue protein-like               73.9    3e-13   



>ref|XP_009380082.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=127

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 73/112 (65%), Gaps = 6/112 (5%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVI  290
            ++ +A++++LL   AEA TYTV D   WS     WP GK F++GD+L+F Y+P VHNVV 
Sbjct  15   VLWVAVLSLLLAQVAEAATYTVGDTRGWSFNMDSWPRGKRFRAGDVLVFKYNPLVHNVVA  74

Query  291  VSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V+   YN C+      +L SG D VTL  G NYFIC + GHC+ GMKMAI A
Sbjct  75   VNAAGYNGCSTPRGSRVLTSGKDRVTLARGRNYFICNSVGHCQSGMKMAIVA  126



>ref|XP_003558311.1| PREDICTED: chemocyanin-like [Brachypodium distachyon]
Length=120

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = +3

Query  90   LFMGKMSTHDSIIVIAIVTMLLCG--FAEAETYTVEDKAKWSDWPNGKSFKSGDILIFNY  263
            +  G+ S    +++  +V  LL G   A A TY V+       W  GK+F++GDIL+FNY
Sbjct  1    MAQGRGSAMQGLVIGLLVPCLLLGADIAGAATYKVDWSMGADSWSGGKNFRAGDILVFNY  60

Query  264  DPSVHNVVIVSKENYNSCTISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +PSVHNVV V    Y+SC  SGT  +SG+D+VTL +GTNYFICG  GHC  GMKMA+TA
Sbjct  61   NPSVHNVVAVDAGGYDSCRGSGTTYSSGNDHVTLGAGTNYFICGLSGHCGAGMKMAVTA  119



>ref|XP_008218855.1| PREDICTED: basic blue protein-like [Prunus mume]
Length=126

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 78/124 (63%), Gaps = 8/124 (6%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLL--CGFAEAETYTVEDKAKWSD----WPNGKSFKSGDILIF  257
             G+ S    ++++  +++LL  C +AEA +YTV D   WS     WP GKSF++GD+L+F
Sbjct  3    QGRGSAGVGVVMVMCLSLLLLHCEWAEARSYTVGDAGGWSPNVAGWPKGKSFRAGDVLVF  62

Query  258  NYDPSVHNVVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMA  431
            NY PS HNVV V+K  Y +C+   +  +  +G D + L  G N+FIC   GHC+ GMK+A
Sbjct  63   NYAPSAHNVVAVNKAGYQTCSTPRAAKVFQTGKDQIKLAKGQNFFICSFPGHCQSGMKIA  122

Query  432  ITAT  443
            ITA 
Sbjct  123  ITAA  126



>ref|XP_009803052.1| PREDICTED: basic blue protein-like [Nicotiana sylvestris]
Length=119

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 72/112 (64%), Gaps = 4/112 (4%)
 Frame = +3

Query  117  DSIIVIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNV  284
             +I+ +  + +       A  Y V D   W    S+WPNGK+FK+GD+L+F Y   VHNV
Sbjct  7    SAILWVMFLALFTIQITNAAIYNVGDGNGWTFGVSNWPNGKNFKAGDVLVFKYPKGVHNV  66

Query  285  VIVSKENYNSCTISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            VIV+K NY SC  SG IL+SG+D VTL  GT YFICG  GHC GG K+++TA
Sbjct  67   VIVNKANYGSCNASGKILSSGNDRVTLGKGTYYFICGIPGHCNGGQKISVTA  118



>ref|XP_009605938.1| PREDICTED: basic blue protein-like [Nicotiana tomentosiformis]
Length=120

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +3

Query  129  VIAIVTMLLCGF--AEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVI  290
            +  ++ M+L  F    A TY V D   W    S+WPNGK+FK+GD+L+FNY  +VH+VVI
Sbjct  10   IFLVIFMVLFAFETTNATTYNVGDDGGWDMGVSNWPNGKNFKAGDVLVFNYPKNVHSVVI  69

Query  291  VSKENYNSCTISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V+KENY+SCT SG  L SG+D VTL  GT+YFICG   HC+   K+A+TA
Sbjct  70   VNKENYDSCTPSGKTLTSGNDKVTLGKGTSYFICGKPTHCQFDQKIAVTA  119



>ref|XP_009773795.1| PREDICTED: basic blue protein-like [Nicotiana sylvestris]
Length=120

 Score =   115 bits (288),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNY  263
            M   S   +I ++  + +       A TY V D   W    S+W NGK+FK+GD+L+FNY
Sbjct  1    MSGKSERSAIFLVIFMVLFTIQITNATTYNVGDDGGWDMGVSNWTNGKNFKTGDVLVFNY  60

Query  264  DPSVHNVVIVSKENYNSCTISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +VH+VVIV+KENY+SCT SG  L SG+D VTL  GT+YFICG   HC+   K+A+TA
Sbjct  61   PKNVHSVVIVNKENYDSCTPSGKTLTSGNDRVTLGKGTSYFICGKPTHCQFDQKIAVTA  119



>ref|XP_004290576.1| PREDICTED: basic blue protein-like [Fragaria vesca subsp. vesca]
Length=127

 Score =   115 bits (288),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 73/114 (64%), Gaps = 10/114 (9%)
 Frame = +3

Query  129  VIAIVTMLLC----GFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNV  284
            V+ +V +LLC     + +A TYTV D   WS     WPNGK F++GD+LIFNYD ++HNV
Sbjct  13   VVQVVAVLLCLMAVQYVDAATYTVGDSGGWSFNTGKWPNGKQFRAGDVLIFNYDSTLHNV  72

Query  285  VIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V V +  Y+SCT      +L SG+D V L  G NYFIC   GHC+ GMK+AI A
Sbjct  73   VAVGRGGYSSCTTPRGAKVLTSGNDRVKLAKGQNYFICNFPGHCESGMKVAINA  126



>gb|EYU18545.1| hypothetical protein MIMGU_mgv1a022688mg [Erythranthe guttata]
Length=119

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 6/119 (5%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPS  272
            MS   +I+++  V MLL   A A +Y V D + W+     W NGKSF++GD L+FNY   
Sbjct  1    MSQQKTIVMLVAVMMLLSNKAYATSYNVGDSSGWAFGIAGWENGKSFRAGDSLVFNYGAG  60

Query  273  VHNVVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             HNVV+V K +Y+SC++  S     SG DN+ L  G NYFICG  GHC+ GMK+A  A+
Sbjct  61   AHNVVVVDKASYDSCSVPASAPTYTSGQDNIVLNKGANYFICGFNGHCQAGMKIAANAS  119



>ref|XP_002464008.1| hypothetical protein SORBIDRAFT_01g010510 [Sorghum bicolor]
 gb|EER91006.1| hypothetical protein SORBIDRAFT_01g010510 [Sorghum bicolor]
Length=129

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 67/99 (68%), Gaps = 6/99 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG  329
            FAE+  YTV D+  WS    +WP GK F++GD+L+F Y+P  HNVV VS   YNSC+   
Sbjct  30   FAESAVYTVGDRGGWSFNTANWPKGKRFRAGDVLVFKYNPKAHNVVPVSAAGYNSCSAPR  89

Query  330  TI--LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             +  L +G+D VTL  GTNYFIC   GHC+ GMK+A+TA
Sbjct  90   GVRALTTGNDRVTLKRGTNYFICSFPGHCQAGMKVAVTA  128



>gb|ADP02231.1| Cu_bind_like domain-containing protein [Aegilops tauschii]
 gb|EMT13062.1| Chemocyanin [Aegilops tauschii]
Length=124

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS-  326
            FAE++ YTV D+  W+     WP GK F++GD+L+F Y    HNVV VS   Y SC+ + 
Sbjct  25   FAESKVYTVGDRNGWALSSGGWPRGKRFRAGDVLLFRYGRGAHNVVAVSAAGYRSCSAAR  84

Query  327  -GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             G   NSG D VTL  GTNYFIC   GHC+ GMKMA+TA 
Sbjct  85   GGRTYNSGSDRVTLARGTNYFICSVPGHCQAGMKMAVTAA  124



>ref|XP_009403746.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=123

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 66/98 (67%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS--  326
            AEA TY V   + W    + WP GKSF++GD+L+FNY+PSVHNVV VS   YNSC+    
Sbjct  25   AEAATYVVGGNSGWTFNVASWPRGKSFRAGDVLVFNYNPSVHNVVAVSAAGYNSCSAPKG  84

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +  SG D +TL  GTNYFIC   GHC+ GMK+A+TA
Sbjct  85   SRVYTSGKDRITLARGTNYFICSFAGHCQSGMKIAVTA  122



>ref|XP_007148487.1| hypothetical protein PHAVU_006G212900g [Phaseolus vulgaris]
 gb|ESW20481.1| hypothetical protein PHAVU_006G212900g [Phaseolus vulgaris]
Length=122

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 74/122 (61%), Gaps = 6/122 (5%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNY  263
            M +     ++I+   V +LL   A+A ++ V D   WS    +WPNGK FK+GD+L+FNY
Sbjct  1    MAQGRGFSAMILFCCVLVLLSEMADATSFVVGDNNGWSFNTNNWPNGKKFKAGDVLVFNY  60

Query  264  DPSVHNVVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
            DPS H+V +V    YNSC  S      +SGHD VTL  GT YFIC   GHC+ GMK+AI 
Sbjct  61   DPSHHDVRVVDVNGYNSCNPSKASKSFHSGHDQVTLAQGTTYFICSFPGHCQQGMKIAIN  120

Query  438  AT  443
            A 
Sbjct  121  AA  122



>gb|AAK55122.1|AF172853_1 putative S-RNase binding protein p11 precursor [Nicotiana alata]
Length=123

 Score =   113 bits (282),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 6/118 (5%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLL--CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYD  266
            MS      ++ ++ M+L       A  Y V D   W    S+WPNGK+FK+GD+L+F Y 
Sbjct  1    MSGKQGSAILWVIFMVLFTIQITNAAIYNVGDGNGWTFGVSNWPNGKNFKAGDVLVFKYP  60

Query  267  PSVHNVVIVSKENYNSCTISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              VHNVVIV+K NY +C  SG  L+SG+D VTL  GT YFICG  GHC GG K+++TA
Sbjct  61   KGVHNVVIVNKANYGTCNASGRTLSSGNDRVTLGKGTYYFICGIPGHCNGGQKISVTA  118



>tpg|DAA50956.1| TPA: chemocyanin [Zea mays]
Length=131

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 66/100 (66%), Gaps = 6/100 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG  329
            FAE+  YTV D+  WS    +WP GK F++GD+L+F YDP  HNVV VS   Y+SC+   
Sbjct  32   FAESAVYTVGDRGGWSFNTANWPKGKRFRAGDVLVFKYDPKAHNVVPVSAAGYSSCSAPR  91

Query  330  TI--LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             +  L +G+D VTL  G NYFIC   GHC+ GMK+A+TA 
Sbjct  92   GVRALTTGNDRVTLKRGVNYFICSFPGHCQAGMKVAVTAA  131



>ref|XP_009605936.1| PREDICTED: chemocyanin-like [Nicotiana tomentosiformis]
Length=119

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 72/114 (63%), Gaps = 5/114 (4%)
 Frame = +3

Query  114  HDSIIVIAIVTMLLC-GFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVH  278
              S I+ AI  +L       A  Y V D   W    S+WPNGK+FK+GD+L+F Y   +H
Sbjct  5    QGSAILWAIFMVLFTIQITNAAIYNVGDGNGWTLGVSNWPNGKNFKTGDVLVFKYPKGIH  64

Query  279  NVVIVSKENYNSCTISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            NVVIV+K NY +C  SG  L+SG+D VTL  GT YFICG  GHC GG K+++TA
Sbjct  65   NVVIVNKANYGTCKASGKTLSSGNDRVTLGKGTYYFICGIPGHCNGGQKISVTA  118



>ref|XP_009101233.1| PREDICTED: basic blue protein-like [Brassica rapa]
Length=129

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 75/115 (65%), Gaps = 8/115 (7%)
 Frame = +3

Query  120  SIIVIAIVTMLLCG--FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHN  281
            +I+ + +V++L+    + EA TY V D  KW+    DWP GK F +GD+L+FNY+PS HN
Sbjct  14   AIVALMVVSVLVLQSYYVEASTYIVGDSLKWAFNAVDWPKGKHFNAGDVLVFNYNPSFHN  73

Query  282  VVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            VV+V    YNSC      T   SG D++TL+ G N+FIC   GHC+G MK+A+TA
Sbjct  74   VVVVDSGGYNSCKTPAGATTYTSGKDHLTLSKGQNFFICNFPGHCEGNMKIAVTA  128



>emb|CDY03030.1| BnaC07g21970D [Brassica napus]
Length=129

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 76/115 (66%), Gaps = 8/115 (7%)
 Frame = +3

Query  120  SIIVIAIVTMLLCG--FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHN  281
            +I+ + +V++L+    + +A TY V D  KW+    DWP GK FK+GD+L+FNY+PS HN
Sbjct  14   AIVALMVVSVLVLQSYYVQASTYIVGDSLKWAFNVVDWPKGKHFKAGDVLVFNYNPSFHN  73

Query  282  VVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            VV+V    YN+C      T   SG D++TL+ G N+FIC   GHC+G MK+A+TA
Sbjct  74   VVVVDSGGYNNCKTPAGATTYTSGKDHLTLSKGQNFFICNFPGHCEGNMKIAVTA  128



>ref|XP_006650480.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=127

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 64/103 (62%), Gaps = 9/103 (9%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS-------DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCT  320
             AE+  YTV D+  WS        WP GK F++GD+L+F Y PS HNVV V+   YNSC+
Sbjct  25   LAESAVYTVGDRGGWSFRSFTTGGWPRGKRFRAGDVLVFKYSPSAHNVVAVNAAGYNSCS  84

Query  321  I--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
                  +  SG+D VTL  GTNYFIC   GHC+ GMK+AITA 
Sbjct  85   APRGARVFKSGNDRVTLARGTNYFICSFPGHCQSGMKIAITAA  127



>ref|NP_001147285.1| chemocyanin precursor [Zea mays]
 gb|ACG26574.1| chemocyanin precursor [Zea mays]
 gb|AFW67855.1| chemocyanin [Zea mays]
Length=132

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS-  326
            FAE+  YTV D+  WS     WPNGK F++GD+L+F YD   HNVV VS   Y+SC+   
Sbjct  33   FAESAVYTVGDRGGWSFNTASWPNGKRFRAGDVLVFRYDARAHNVVPVSAAGYSSCSAPE  92

Query  327  -GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
                L +G+D VTL  G NYFIC   GHC+ GMK+A+TA 
Sbjct  93   GARALATGNDRVTLRRGANYFICSFPGHCQAGMKVAVTAA  132



>sp|P60496.1|BABL_LILLO RecName: Full=Chemocyanin; AltName: Full=Basic blue protein; 
AltName: Full=Plantacyanin; Flags: Precursor [Lilium longiflorum]
 gb|AAR84219.1| chemocyanin [Lilium longiflorum]
Length=126

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 67/101 (66%), Gaps = 6/101 (6%)
 Frame = +3

Query  156  CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI  323
            C  AE+  YTV D   W    S WP GK+F++GD+L+F Y+P+VHNVV V    Y SCT 
Sbjct  25   CEVAESVVYTVGDGGGWTFGTSGWPAGKTFRAGDVLVFKYNPAVHNVVSVPAGGYKSCTA  84

Query  324  S--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            S    +  SG D +TL+ GTNYFIC   GHC+GG+K+A+TA
Sbjct  85   SPGSRVFKSGDDRITLSRGTNYFICSVPGHCQGGLKIAVTA  125



>ref|XP_008237710.1| PREDICTED: basic blue protein-like [Prunus mume]
Length=125

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 72/121 (60%), Gaps = 6/121 (5%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNY  263
             G+ S     +V+ +  M+  G + A TY V +   WS     WPNGK F++GD+L+FNY
Sbjct  4    QGRGSAGTIGVVVVLCLMVQLGCSNAATYKVGESGGWSFNTDSWPNGKQFRAGDVLLFNY  63

Query  264  DPSVHNVVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
            DP++HNVV V K  Y+SCT      +  SG D + L  G NYFIC   GHC+ GMK+AI 
Sbjct  64   DPTLHNVVAVDKGGYSSCTTPNGAKVFKSGKDRIRLGRGQNYFICNFPGHCESGMKIAIN  123

Query  438  A  440
            A
Sbjct  124  A  124



>ref|XP_002275987.1| PREDICTED: basic blue protein [Vitis vinifera]
 emb|CBI23866.3| unnamed protein product [Vitis vinifera]
Length=123

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIV  293
            IV+ +  +L C   +A T+TV   + W+     WP GK FK+GD+L+FNY PS HNVV V
Sbjct  12   IVLVLCLVLPCDMVDAATFTVGGASGWAFNAVGWPKGKRFKAGDVLVFNYSPSAHNVVAV  71

Query  294  SKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            +K  YN CT      +  +G D + L  G NYF+C   GHC+ GMK+A+TAT
Sbjct  72   NKAGYNGCTTPRGSKVYQTGKDQIKLVKGANYFLCNFPGHCQSGMKIAVTAT  123



>ref|NP_001237531.1| uncharacterized protein LOC100305588 precursor [Glycine max]
 gb|ACU13343.1| unknown [Glycine max]
Length=124

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 70/121 (58%), Gaps = 6/121 (5%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNY  263
             G+ S    I+V  +  + L   A A TY+V     W+     WPNGK F++GDILIFNY
Sbjct  3    QGRGSASLPIVVTVVSLLCLLERANAATYSVGGPGGWTFNTNAWPNGKRFRAGDILIFNY  62

Query  264  DPSVHNVVIVSKENYNSCTISG--TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
            D + HNVV V +  YNSC   G   + +SG D + L  G NYFIC   GHC+ GMK+AI 
Sbjct  63   DSTTHNVVAVDRSGYNSCKTPGGAKVFSSGKDQIKLARGQNYFICNYPGHCESGMKVAIN  122

Query  438  A  440
            A
Sbjct  123  A  123



>ref|XP_004982012.1| PREDICTED: chemocyanin-like [Setaria italica]
Length=130

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGT  332
            AE+  YTV D+  WS    +WP GK F++GD+L+F Y P  HNVV VS   Y SC+    
Sbjct  32   AESAVYTVGDRGGWSFNTANWPRGKRFRAGDVLVFRYSPKAHNVVPVSAAGYRSCSAPRG  91

Query  333  I--LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            +  L SG+D VTL  G NYFIC  +GHC+ GMK+A+TA 
Sbjct  92   VRALTSGNDRVTLKRGVNYFICSFQGHCQAGMKVAVTAA  130



>gb|AFK43827.1| unknown [Lotus japonicus]
Length=124

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 76/122 (62%), Gaps = 6/122 (5%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLL-CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFN  260
             G+ ++  S++V+   T +L    A A TY V D   W     +WP GKSFK+GDIL+FN
Sbjct  3    QGRGNSALSVLVLLFFTFVLNWDMANAITYKVGDAGGWRYNVDNWPQGKSFKTGDILVFN  62

Query  261  YDPSVHNVVIVSKENYNSCTIS-GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
            Y+P  H+VV V +  YN+C++  G +  SGHD++TL  G +YFIC   GHCK  MK+A+ 
Sbjct  63   YNPLFHDVVAVDEAGYNNCSVQNGKVYRSGHDSITLPQGQSYFICSLPGHCKASMKIAVN  122

Query  438  AT  443
            A 
Sbjct  123  AA  124



>gb|KHN23440.1| Basic blue protein [Glycine soja]
Length=124

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 70/121 (58%), Gaps = 6/121 (5%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNY  263
             G+ S    I+V  +  + L   A A TY+V     W+     WPNGK F++GD+LIFNY
Sbjct  3    QGRGSASLPIVVTVVSLLCLLERANAATYSVGGPGGWTFNTNAWPNGKRFRAGDVLIFNY  62

Query  264  DPSVHNVVIVSKENYNSCTISG--TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
            D + HNVV V +  YNSC   G   + +SG D + L  G NYFIC   GHC+ GMK+AI 
Sbjct  63   DSTTHNVVAVDRSGYNSCKTPGGAKVFSSGKDQIKLARGQNYFICNYPGHCESGMKVAIN  122

Query  438  A  440
            A
Sbjct  123  A  123



>gb|AFK38070.1| unknown [Lotus japonicus]
Length=130

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 72/126 (57%), Gaps = 12/126 (10%)
 Frame = +3

Query  99   GKMSTHDSIIVIAIVTMLLCGFA------EAETYTVEDKAKWS----DWPNGKSFKSGDI  248
            G+ S     +V+ +   LLC  A       A TYTV   A WS     WPNGK F++GD+
Sbjct  4    GRGSASLPTVVVTVGISLLCLLALQVEHANAATYTVGGPAGWSFNTDTWPNGKKFRAGDV  63

Query  249  LIFNYDPSVHNVVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGM  422
            LIFNYD + HNVV V +  Y SCT      +L+SG D + L  G NYFIC   GHC+ GM
Sbjct  64   LIFNYDSTTHNVVAVDQSGYKSCTTPAGAKVLSSGKDQIRLGRGQNYFICNCPGHCQSGM  123

Query  423  KMAITA  440
            K+AI A
Sbjct  124  KVAINA  129



>ref|XP_007200120.1| hypothetical protein PRUPE_ppa018507mg [Prunus persica]
 gb|EMJ01319.1| hypothetical protein PRUPE_ppa018507mg [Prunus persica]
Length=125

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 71/121 (59%), Gaps = 6/121 (5%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNY  263
             G+ S     +V+ +  M+  G + A TY V +   WS     WPNGK F++GD+L FNY
Sbjct  4    QGRGSAGTIGVVVVLCLMVQLGCSNAATYKVGESGGWSFNTDSWPNGKQFRAGDVLSFNY  63

Query  264  DPSVHNVVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
            DP++HNVV V K  Y+SCT      +  SG D + L  G NYFIC   GHC+ GMK+AI 
Sbjct  64   DPTLHNVVAVDKGGYSSCTTPNGAKVYKSGKDQIRLGRGQNYFICNFPGHCQSGMKIAIN  123

Query  438  A  440
            A
Sbjct  124  A  124



>ref|XP_010270378.1| PREDICTED: basic blue protein-like [Nelumbo nucifera]
Length=126

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 6/101 (6%)
 Frame = +3

Query  156  CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI  323
            C    A T+ V D   W    + WPNGKSF++GD+L+F Y P++HNVV V +  YNSCT 
Sbjct  25   CEMVHAATFMVGDAGGWTFNTAAWPNGKSFRAGDVLVFRYSPAIHNVVAVDRNGYNSCTT  84

Query  324  S--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                 +L +G+D + L  G NYFIC   GHC+ GMK+A+TA
Sbjct  85   PRGARVLTTGNDQIKLARGQNYFICTIAGHCQAGMKIAVTA  125



>ref|XP_002464007.1| hypothetical protein SORBIDRAFT_01g010500 [Sorghum bicolor]
 gb|EER91005.1| hypothetical protein SORBIDRAFT_01g010500 [Sorghum bicolor]
Length=128

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 66/100 (66%), Gaps = 6/100 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG  329
            FAE+  YTV D++ WS    +WP GK F++GD+L+F Y+   HNVV VS   Y SC+   
Sbjct  29   FAESAVYTVGDRSGWSFNTANWPKGKRFRAGDVLVFKYNAKAHNVVPVSAAGYRSCSAPR  88

Query  330  TI--LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             +  L +G+D VTL  G NYFIC   GHC+GGMK+A+TA 
Sbjct  89   GVRALTTGNDRVTLKRGANYFICSFPGHCQGGMKIAVTAA  128



>ref|XP_010926149.1| PREDICTED: chemocyanin-like [Elaeis guineensis]
Length=123

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSC-TISG  329
            AE+ TY V D   W+    +WP GK F++GD+L+F Y PS HNVV VS   YN C T  G
Sbjct  25   AESATYNVGDSRGWTFNVVNWPRGKRFRAGDVLVFKYSPSAHNVVAVSAAAYNRCLTPRG  84

Query  330  T-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            + +  SG+D +TL  GTNYFIC   GHC+ GMK+A+TA
Sbjct  85   SRVFRSGNDRITLARGTNYFICSFAGHCQAGMKIAVTA  122



>ref|XP_010260470.1| PREDICTED: basic blue protein-like [Nelumbo nucifera]
Length=126

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 6/101 (6%)
 Frame = +3

Query  156  CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI  323
            C  A A T+TV D   W    + WP GK F +GD+L+F Y+P++HNVV V +  YNSCT 
Sbjct  25   CEMARAATFTVGDAGGWTFNTAAWPRGKRFLAGDLLVFKYNPAIHNVVAVDRNGYNSCTA  84

Query  324  S--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                  L SG+D + L  G NYFIC   GHC+ GMK+A+TA
Sbjct  85   PRGARTLRSGNDQIKLARGQNYFICTVAGHCQAGMKIAVTA  125



>ref|XP_009341322.1| PREDICTED: basic blue protein-like [Pyrus x bretschneideri]
Length=124

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 69/111 (62%), Gaps = 4/111 (4%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVV  287
            ++IVI +   L  G A A+T+TV D A W+    DWP GK+F + D L+F Y+   HNVV
Sbjct  13   AVIVIGLCMALHGGIAHAKTFTVGDDAGWTFNVEDWPKGKTFAADDTLVFKYNKDQHNVV  72

Query  288  IVSKENYNSCTISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +V +  Y +CT SG   +SG+D + L  G  YFICG  GHC  G K+A+TA
Sbjct  73   VVDENGYKTCTASGKEFSSGNDEIKLARGQYYFICGVPGHCDRGQKIAVTA  123



>ref|XP_006434344.1| hypothetical protein CICLE_v10002840mg [Citrus clementina]
 gb|ESR47584.1| hypothetical protein CICLE_v10002840mg [Citrus clementina]
 gb|KDO83564.1| hypothetical protein CISIN_1g033108mg [Citrus sinensis]
Length=127

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 74/123 (60%), Gaps = 9/123 (7%)
 Frame = +3

Query  99   GKMSTHDSIIVIAIVTMLLCGFAE---AETYTVEDKAKWS----DWPNGKSFKSGDILIF  257
            G+ S   + I+ A++  LL  + E   A TYTV D   WS     W  GK FK+GD L+F
Sbjct  4    GRGSARCATIMAALLICLLLVYIEIVDATTYTVGDSGGWSFNMASWAKGKRFKAGDTLVF  63

Query  258  NYDPSVHNVVIVSKENYNSCTISG--TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMA  431
            NYDP++HNVV V++  Y SCT  G   + +SG D + L  G N+FIC + GHC  GMK+A
Sbjct  64   NYDPTLHNVVAVNRAGYRSCTAPGGAKVYSSGKDRIKLVRGQNFFICNSAGHCGSGMKIA  123

Query  432  ITA  440
            I A
Sbjct  124  INA  126



>ref|XP_006472899.1| PREDICTED: basic blue protein-like [Citrus sinensis]
Length=127

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 74/123 (60%), Gaps = 9/123 (7%)
 Frame = +3

Query  99   GKMSTHDSIIVIAIVTMLLCGFAE---AETYTVEDKAKWS----DWPNGKSFKSGDILIF  257
            G+ S   + I+ A++  LL  + E   A T+TV D   WS     W  GK FK+GD L+F
Sbjct  4    GRRSARCATIMAALLICLLLVYIEIVDATTFTVGDSGGWSFNMASWAKGKRFKAGDTLVF  63

Query  258  NYDPSVHNVVIVSKENYNSCTISG--TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMA  431
            NYDP++HNVV V++  Y SCT  G   + +SG D + L  G N+FIC + GHC  GMK+A
Sbjct  64   NYDPTLHNVVAVNRAGYRSCTAPGGAKVYSSGKDRIKLVRGQNFFICNSAGHCGSGMKIA  123

Query  432  ITA  440
            I A
Sbjct  124  INA  126



>ref|NP_001152423.1| chemocyanin precursor [Zea mays]
 gb|ACG47536.1| chemocyanin precursor [Zea mays]
Length=131

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG  329
            FAE+  YTV D+  WS    + P GK F++GD+L+F YDP  HNVV VS   Y+SC+   
Sbjct  32   FAESAVYTVGDRGGWSFNTANLPKGKRFRAGDVLVFKYDPKAHNVVPVSAAGYSSCSAPR  91

Query  330  TI--LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             +  L +G+D VTL  G NYFIC   GHC+ GMK+A+TA 
Sbjct  92   GVRALTTGNDRVTLKRGVNYFICSFPGHCQAGMKVAVTAA  131



>ref|XP_006349438.1| PREDICTED: chemocyanin-like [Solanum tuberosum]
Length=203

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 70/112 (63%), Gaps = 7/112 (6%)
 Frame = +3

Query  129  VIAIVTMLLCGFA---EAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVV  287
            +  ++ M+L        + TY V D   W    S+WPNGK+FK GD+L+FNY   +HNVV
Sbjct  10   IFLVIFMMLFAIQISNASTTYNVGDSNGWTFGVSNWPNGKNFKVGDVLVFNYPREIHNVV  69

Query  288  IVSKENYNSCTISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            IV+K +YN+C   G + NSG D +TL  GT YFICG  GHC G  K+AIT T
Sbjct  70   IVNKVDYNNCNPLGKMFNSGKDVITLKKGTTYFICGVPGHCDGAQKIAITDT  121



>ref|XP_010932617.1| PREDICTED: basic blue protein-like [Elaeis guineensis]
Length=126

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 72/117 (62%), Gaps = 7/117 (6%)
 Frame = +3

Query  114  HDSIIVIAIVTMLL-CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVH  278
            H   + +A++ +L+ C  AE+  YTV     W+     WPNGK F++GD+L+F Y+P+ H
Sbjct  10   HSVALGVALLCLLIHCELAESALYTVGGGGGWTFNTVSWPNGKRFRAGDVLVFKYNPAAH  69

Query  279  NVVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            NVV V+   YN CT      +  SG+D + L  G NYFIC   GHC+ GMK+++TAT
Sbjct  70   NVVAVNAVGYNRCTTPRGSKVFKSGNDRIRLRRGRNYFICNFVGHCQAGMKISVTAT  126



>ref|XP_003562309.1| PREDICTED: chemocyanin-like [Brachypodium distachyon]
Length=129

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 72/129 (56%), Gaps = 10/129 (8%)
 Frame = +3

Query  87   LLFMGKMSTHDSIIVIA---IVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGD  245
            +   G+ S  +  IV     +V ++  G AE+  Y V D   W+     WP GK FK+GD
Sbjct  1    MAAQGRGSAKNMAIVAVLGMVVVLVSAGMAESAVYNVGDNGGWTFNANSWPAGKRFKAGD  60

Query  246  ILIFNYDPSVHNVVIVSKENYNSCT---ISGTILNSGHDNVTLTSGTNYFICGAEGHCKG  416
            +L+F YD + H+V  VS   Y +C     +  +  SG D VTL  GTNYFICG  GHC+ 
Sbjct  61   VLVFKYDSTAHDVTAVSAAAYKACAKPARAAKVYKSGSDRVTLARGTNYFICGVPGHCQA  120

Query  417  GMKMAITAT  443
            GMK+A+TA 
Sbjct  121  GMKIAVTAA  129



>ref|XP_002520251.1| Basic blue protein, putative [Ricinus communis]
 gb|EEF42037.1| Basic blue protein, putative [Ricinus communis]
Length=126

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 68/116 (59%), Gaps = 11/116 (9%)
 Frame = +3

Query  126  IVIAIVTMLLCGFA-----EAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVH  278
            + IA V  LLC         A TYTV     W+     WP GK FK+GD L+FNYD +VH
Sbjct  10   LAIATVVALLCLLTLTKQVRAATYTVGGSGGWTFNVDSWPKGKRFKAGDTLVFNYDSTVH  69

Query  279  NVVIVSKENYNSCT--ISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            NVV V+K +Y SC+      +  SG D + L  G N+FICG  GHC+ GMK+AITA
Sbjct  70   NVVAVNKGSYTSCSAPAGAKVYTSGRDQIKLAKGQNFFICGISGHCQSGMKIAITA  125



>ref|XP_010916152.1| PREDICTED: basic blue protein-like [Elaeis guineensis]
Length=123

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 66/98 (67%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--S  326
            AE+ TYTV D   W+     WP GK F++GD+L+FNY+PS HNVV V++  Y+ CT    
Sbjct  25   AESATYTVGDGNGWTFNTDTWPRGKRFRAGDVLVFNYNPSAHNVVAVNRGGYSGCTTPRG  84

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +  SG+D +TL+ GTNYFIC   GHC+ GMK+A TA
Sbjct  85   SRVFRSGNDRITLSKGTNYFICNFAGHCQSGMKIAATA  122



>ref|NP_001051044.1| Os03g0709300 [Oryza sativa Japonica Group]
 gb|AAX95667.1| Plastocyanin-like domain, putative [Oryza sativa Japonica Group]
 gb|ABF98494.1| Chemocyanin precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12958.1| Os03g0709300 [Oryza sativa Japonica Group]
 gb|EAY91593.1| hypothetical protein OsI_13228 [Oryza sativa Indica Group]
 gb|EAZ28326.1| hypothetical protein OsJ_12301 [Oryza sativa Japonica Group]
 dbj|BAG94468.1| unnamed protein product [Oryza sativa Japonica Group]
Length=129

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 7/115 (6%)
 Frame = +3

Query  120  SIIVIAIVTMLLCG-FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNV  284
            +++ + ++ +LL G  AE+  YTV D+  W      W  GK F++GD+L+F Y PS HNV
Sbjct  15   AVLAMVLLCVLLHGELAESAVYTVGDRGGWGFNSGGWLRGKRFRAGDVLVFKYSPSAHNV  74

Query  285  VIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            V V+   Y SC+      +  SG D VTL  GTNYFIC   GHC+ GMK+A+TA 
Sbjct  75   VAVNAAGYKSCSAPRGAKVYKSGSDRVTLARGTNYFICSFPGHCQAGMKIAVTAA  129



>ref|XP_009421112.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=123

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 64/98 (65%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS--  326
            A+A TY V D   W+     WP+GK F+ GD+L+F Y+PSVHNVV VS   Y+ C+    
Sbjct  25   ADAATYVVGDSGGWTFNVVGWPSGKRFRPGDVLVFRYNPSVHNVVAVSAAGYSGCSAPTG  84

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +  SG+D +TL  GTNYFIC   GHC+ GMK+A+TA
Sbjct  85   SRVFTSGNDRITLARGTNYFICSFPGHCQAGMKIAVTA  122



>gb|EPS59878.1| hypothetical protein M569_14927, partial [Genlisea aurea]
Length=127

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 64/103 (62%), Gaps = 6/103 (6%)
 Frame = +3

Query  150  LLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSC  317
               G AEA TY V D   W+     WP+GK+F++GD L+FNYDPS+HNVV V+   YN C
Sbjct  25   FFSGAAEAATYKVGDDGGWTFNVNAWPSGKAFRAGDTLVFNYDPSMHNVVAVNNVGYNRC  84

Query  318  T--ISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +      +  SG D VTL  G NYFIC   GHC+ GMK+AI A
Sbjct  85   STPYRSPVYQSGGDRVTLRKGANYFICNFPGHCQSGMKIAINA  127



>ref|XP_010425055.1| PREDICTED: basic blue protein-like [Camelina sativa]
Length=130

 Score =   107 bits (268),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 77/115 (67%), Gaps = 8/115 (7%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHN  281
            +I+V+  V++LL    +A+A TYTV D   W+     WP GK+F++GD+L+FNY+PSVHN
Sbjct  15   AIVVLMAVSVLLLHADYAQAATYTVGDSGVWTFNAVGWPKGKNFRAGDVLVFNYNPSVHN  74

Query  282  VVIVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            VV V   +YNSC T +G     SG D +TL+ G N+FIC    HC+  MK+A+TA
Sbjct  75   VVKVDSGSYNSCKTPAGARTYTSGKDRITLSRGQNFFICNFPNHCESNMKIAVTA  129



>ref|XP_004488137.1| PREDICTED: chemocyanin-like [Cicer arietinum]
Length=126

 Score =   107 bits (268),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 75/116 (65%), Gaps = 9/116 (8%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHN  281
            SIIV+ + +M +  C   +A+TYTV D++ W+    +WP+GK+FK GDIL+FNY P VHN
Sbjct  10   SIIVMVLFSMFVFHCKKIDADTYTVGDESGWTFDVQNWPSGKTFKEGDILVFNYTPEVHN  69

Query  282  VVIVSKENYNSCTISG--TILNSGHDNVTLTSGTNYFICGAEGHCKGG-MKMAITA  440
            VV V++  YNSC   G      SG D +TL  G NYFIC   GHC  G MK+A+ A
Sbjct  70   VVRVNEYGYNSCVALGGSKFYESGADRITLAKGPNYFICSIPGHCNSGMMKIALNA  125



>ref|XP_006395754.1| hypothetical protein EUTSA_v10005123mg [Eutrema salsugineum]
 gb|ESQ33040.1| hypothetical protein EUTSA_v10005123mg [Eutrema salsugineum]
Length=129

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 77/118 (65%), Gaps = 7/118 (6%)
 Frame = +3

Query  108  STHDSIIVIAIVTMLL-CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPS  272
            +T   + ++A+  MLL   + +A TYTV +   W+     WP GK FK+GD+L+FNY+PS
Sbjct  11   TTRAIVALMAVSVMLLQADYVQAATYTVGESNGWTFNAVGWPRGKHFKAGDVLVFNYNPS  70

Query  273  VHNVVIVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +HNVV+V    YN+C T +G  +  +G D +TL+ G N+FIC   GHC+  MK+A+TA
Sbjct  71   IHNVVVVDSGGYNNCKTPAGAKVYTTGKDRITLSKGQNFFICNFPGHCESAMKIAVTA  128



>ref|XP_008339291.1| PREDICTED: basic blue protein-like [Malus domestica]
Length=124

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 6/101 (6%)
 Frame = +3

Query  156  CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI  323
            C +A+A+TYTV D+  W    + WP+GK+F++GDIL+FNY  + HNVV V+K  Y +C  
Sbjct  23   CEWADAKTYTVGDRGGWTFNVAGWPSGKTFRAGDILVFNYGAAAHNVVAVNKAGYQTCNT  82

Query  324  SGT--ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             G   +  +G D + L  G N+FIC   GHC+ GMK+AITA
Sbjct  83   PGAAKVYQTGRDQIRLAKGQNFFICNFPGHCQSGMKIAITA  123



>ref|XP_007041535.1| Copper binding protein 6 [Theobroma cacao]
 gb|EOX97366.1| Copper binding protein 6 [Theobroma cacao]
Length=124

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 63/99 (64%), Gaps = 6/99 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS-  326
             A+A TYTV     W+     WP GK FK+GD L+FNY+PS+HNVV V++  Y SCT   
Sbjct  25   LAQAATYTVGGSNGWAFNSAGWPKGKRFKAGDTLVFNYNPSIHNVVAVNRAGYKSCTTPK  84

Query  327  -GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              T+  SG D + L  G N+FIC   GHC+ GMK+AITA
Sbjct  85   GATVFQSGKDQIKLAKGQNFFICNYIGHCQAGMKVAITA  123



>ref|XP_006292005.1| hypothetical protein CARUB_v10018193mg, partial [Capsella rubella]
 gb|EOA24903.1| hypothetical protein CARUB_v10018193mg, partial [Capsella rubella]
Length=149

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = +3

Query  75   RNSCLLFMGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSG  242
            R S   F+G      +I+ +  + +L   +A+A TYTV D   WS     WP GK FK+G
Sbjct  27   RGSASWFVG------AIVALMSLLLLHADYAQAATYTVGDSGVWSFNAVGWPKGKHFKAG  80

Query  243  DILIFNYDPSVHNVVIVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKG  416
            D+L+FNY+PS+HNVV V   +YNSC T +G     SG D +TL+ G N+FIC    HC+ 
Sbjct  81   DVLVFNYNPSMHNVVKVDGGSYNSCKTPAGARPYTSGKDRITLSRGQNFFICNFPNHCES  140

Query  417  GMKMAITAT  443
             MK+A+TA 
Sbjct  141  NMKIAVTAA  149



>ref|XP_007227174.1| hypothetical protein PRUPE_ppa021383mg [Prunus persica]
 gb|EMJ28373.1| hypothetical protein PRUPE_ppa021383mg [Prunus persica]
Length=126

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = +3

Query  156  CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCT-  320
            C +AEA +YTV D   W    + WP GKSF++GD+L+FNY  S HNVV V+K  Y +C+ 
Sbjct  25   CEWAEARSYTVGDAGGWTFNVAGWPKGKSFRAGDVLVFNYASSAHNVVAVNKAGYQTCSS  84

Query  321  -ISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
              +  +  +G D + L  G N+FIC   GHC+ GMK+AITA 
Sbjct  85   PRAAKVFQTGKDQIKLAKGQNFFICNFPGHCQSGMKIAITAA  126



>gb|EMT21220.1| Basic blue protein [Aegilops tauschii]
Length=122

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +3

Query  165  AEAETYTVEDKAKWSDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGT--IL  338
            A A TY V+       WP+GKSF++GD+L+F+Y+P+VHNVV V    YNSC  SG     
Sbjct  28   AGAATYNVDWSFAAGSWPSGKSFRAGDVLVFSYNPAVHNVVAVDAGGYNSCRGSGATHTY  87

Query  339  NSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             SG D VTL  GTNYFIC   GHC  GMKMA+TA
Sbjct  88   TSGSDRVTLVPGTNYFICSLSGHCGLGMKMAVTA  121



>ref|XP_010548684.1| PREDICTED: basic blue protein-like [Tarenaya hassleriana]
Length=121

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVI  290
            I  +++  +L    A +  Y V D + W    S WPNGK+FK+GD+L F YD ++H+VV 
Sbjct  9    IAAMSVCVLLQSQVALSTNYVVGDSSGWFFGVSAWPNGKTFKAGDVLEFKYDVTMHSVVE  68

Query  291  VSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V K +Y SC I    T  NSG D +TL++GT+YF+CG  GHC  GMK+AITA
Sbjct  69   VGKSDYESCNIPSDATTYNSGDDKITLSNGTSYFVCGFPGHCAAGMKIAITA  120



>ref|NP_001049610.1| Os03g0259100 [Oryza sativa Japonica Group]
 gb|ABF95068.1| Chemocyanin precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11524.1| Os03g0259100 [Oryza sativa Japonica Group]
 gb|EAY89315.1| hypothetical protein OsI_10818 [Oryza sativa Indica Group]
 gb|EAZ12895.1| hypothetical protein OsJ_02816 [Oryza sativa Japonica Group]
Length=120

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +3

Query  165  AEAETYTVEDKAKWSDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGTILNS  344
            A A TY V+       W  GK+F++GD+L+F+YDPSVHNVV V    Y+ C  SGT  +S
Sbjct  28   AAAATYNVDWSFGADSWSKGKNFRAGDVLVFSYDPSVHNVVAVDAGGYSGCRESGTKYSS  87

Query  345  GHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            G+D +TL  GT+YFIC   GHC  GMKMA+TA+
Sbjct  88   GNDRITLGRGTSYFICSFSGHCGAGMKMAVTAS  120



>ref|XP_002468153.1| hypothetical protein SORBIDRAFT_01g040540 [Sorghum bicolor]
 gb|EER95151.1| hypothetical protein SORBIDRAFT_01g040540 [Sorghum bicolor]
Length=119

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +3

Query  138  IVTMLLCGFAEAETYTVEDKAKWSDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSC  317
            +   LL G A+A T+ V+       W  GKSF++GD+L FNYDPSVHNVV V    Y  C
Sbjct  18   LAVCLLLGVADAATHRVDWSFNADGWSKGKSFRAGDVLEFNYDPSVHNVVAVDAGGYYGC  77

Query  318  TISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
              SGT   SG D +TL SGT+YFIC   GHC  GMKM + A+
Sbjct  78   RPSGTSYGSGSDRITLGSGTSYFICSLNGHCGMGMKMIVNAS  119



>ref|XP_008781025.1| PREDICTED: basic blue protein-like [Phoenix dactylifera]
Length=123

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSC-TISG  329
            AE+ TYTV D   W+    +WP GK F++GD+L+F Y  S HNVV V+   YN C T  G
Sbjct  25   AESATYTVGDSRGWTFNTVNWPRGKRFRAGDVLVFKYSRSAHNVVAVNAAAYNRCLTPRG  84

Query  330  T-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            + +  SG+D +TL  GTNYFIC   GHC+ GMK+A+TA
Sbjct  85   SRVFRSGNDRITLARGTNYFICNFPGHCQAGMKIAVTA  122



>ref|XP_006649774.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=121

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +3

Query  165  AEAETYTVEDKAKWSDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGTILNS  344
            A A TY V+       W  GK+F++GD+L+F+YDPSVHNVV V    Y+ C  SGT  +S
Sbjct  29   AAAATYNVDWSFGADSWSKGKNFRAGDVLVFSYDPSVHNVVEVDAGGYSGCRESGTKYSS  88

Query  345  GHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            G+D VTL  GT+YFIC   GHC  GMKMA+TA+
Sbjct  89   GNDRVTLGRGTSYFICSISGHCGAGMKMAVTAS  121



>ref|XP_009368430.1| PREDICTED: basic blue protein [Pyrus x bretschneideri]
Length=113

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 66/110 (60%), Gaps = 6/110 (5%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVI  290
            ++V+ +  ML   +  A    V D   W+     WPNGK F++GD+L+FNYDP++HNVV 
Sbjct  1    MVVVVLCLMLHLEYTHAAPQAVGDSGGWTFNSDSWPNGKHFRAGDVLLFNYDPNLHNVVA  60

Query  291  VSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAI  434
            V +  Y+SCT      +  SG D V L  G NYFIC   GHC+ GMK+AI
Sbjct  61   VDRGGYSSCTTPSGAKVFRSGKDRVRLGRGQNYFICSFPGHCESGMKVAI  110



>gb|ABZ04879.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04880.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04881.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04883.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04884.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04885.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04886.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04887.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04888.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04889.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04890.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04891.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04892.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04893.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04894.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04895.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04896.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04897.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04898.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04899.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04900.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04901.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04902.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04903.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04904.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04905.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04906.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04907.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04908.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|ABZ04909.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04910.1| putative chemocyanin precursor [Oryza rufipogon]
 gb|ABZ04911.1| putative chemocyanin precursor [Oryza sativa Indica Group]
 gb|ABZ04912.1| putative chemocyanin precursor [Oryza sativa Indica Group]
Length=127

 Score =   105 bits (262),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +3

Query  165  AEAETYTVEDKAKWSDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGTILNS  344
            A A TY V+       W  GK+F++GD+L+F+YDPSVHNVV V    Y+ C  SGT  +S
Sbjct  35   AAAATYNVDWSFGADSWSKGKNFRAGDVLVFSYDPSVHNVVAVDAGGYSGCRESGTKYSS  94

Query  345  GHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            G+D +TL  GT+YFIC   GHC  GMKMA+TA+
Sbjct  95   GNDRITLGRGTSYFICSFSGHCGAGMKMAVTAS  127



>ref|NP_001150703.1| chemocyanin precursor [Zea mays]
 gb|ACG40061.1| chemocyanin precursor [Zea mays]
Length=132

 Score =   105 bits (262),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 63/99 (64%), Gaps = 6/99 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG  329
             AE+  YTV D+  WS    +WP GK F++GD+L F Y+   HNVV VS   Y SC+   
Sbjct  33   LAESAVYTVGDRGGWSFNTANWPKGKRFRAGDVLAFRYNAKAHNVVPVSAAGYKSCSAPK  92

Query  330  TI--LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             +  L +G+D VTL  GTNYFIC   GHC+ GMK+A+TA
Sbjct  93   GVRALTTGNDRVTLKRGTNYFICSFPGHCQAGMKIAVTA  131



>ref|XP_006826880.1| hypothetical protein AMTR_s00010p00134400 [Amborella trichopoda]
 gb|ERM94117.1| hypothetical protein AMTR_s00010p00134400 [Amborella trichopoda]
Length=123

 Score =   105 bits (261),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVI  290
            ++ + +V   L   + A TYTV D   W    SDWPNGK+F +GD+L+F Y    HNVV 
Sbjct  11   LVALVLVVFGLLELSTATTYTVGDSGGWIFGVSDWPNGKNFLAGDVLVFQYSAVHHNVVA  70

Query  291  VSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V+ + YNSC++    T   SG+D++TL  G N+F+CG  GHC GGMK+   A
Sbjct  71   VNADGYNSCSVPPGSTTYTSGNDSITLQKGANFFLCGFPGHCSGGMKIQANA  122



>ref|XP_010502294.1| PREDICTED: basic blue protein [Camelina sativa]
Length=130

 Score =   105 bits (262),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 76/115 (66%), Gaps = 8/115 (7%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHN  281
            +I+ +  V++LL    +A+A TYTV D   W+     WP GK+F++GD+L+FNY+PS+HN
Sbjct  15   AIVALMAVSVLLLHADYAQAATYTVGDSGVWTFNAVGWPKGKNFRAGDVLVFNYNPSMHN  74

Query  282  VVIVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            VV V   +YNSC T +G     SG D +TL+ G N+FIC    HC+  MK+A+TA
Sbjct  75   VVKVDSGSYNSCKTPAGARTYTSGKDRITLSRGQNFFICNFPNHCESNMKIAVTA  129



>ref|XP_004301543.1| PREDICTED: chemocyanin-like [Fragaria vesca subsp. vesca]
Length=123

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 72/118 (61%), Gaps = 5/118 (4%)
 Frame = +3

Query  102  KMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDP  269
            ++S   +++++    ++    A A TYTV D A W+     WP GK F +GDIL+F Y+ 
Sbjct  5    RVSARINVMLLVFCVLIHYKIASATTYTVGDAAGWTFGIQSWPTGKQFHAGDILVFKYNK  64

Query  270  SVHNVVIVSKENYNSC-TISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +VHNV++  +  + +C T +G    SG+D + L  G NYFIC   GHC GGMKMAI+A
Sbjct  65   NVHNVIVTDENGFKACNTATGQKFISGNDQIKLKKGQNYFICSTPGHCAGGMKMAISA  122



>gb|EMS57005.1| Basic blue protein [Triticum urartu]
Length=122

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +3

Query  165  AEAETYTVEDKAKWSDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGT--IL  338
            A A TY V+       WP+GK+F++GD+L+F+Y+P+VHNVV V    YNSC  SG     
Sbjct  28   AGAATYNVDWSFAAGSWPSGKTFRAGDVLVFSYNPAVHNVVAVDAGGYNSCRGSGATHTY  87

Query  339  NSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             SG D VTL  GTNYFIC   GHC  GMKMA+TA
Sbjct  88   TSGSDRVTLVPGTNYFICSLSGHCGLGMKMAVTA  121



>gb|KDO65913.1| hypothetical protein CISIN_1g039717mg [Citrus sinensis]
Length=131

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 73/126 (58%), Gaps = 10/126 (8%)
 Frame = +3

Query  96   MGKMSTHDSIIVIA-IVTMLLCGFAEAE---TYTVEDKAKWS----DWPNGKSFKSGDIL  251
             G+ S   +  V A ++ +L   F   E   T+TV D + W+     W NGK FK+GD L
Sbjct  6    QGRCSASQATTVAATLIVLLFLRFHSTEATSTFTVGDTSGWTYNIQSWANGKQFKAGDTL  65

Query  252  IFNYDPSVHNVVIVSKENYNSCTISGT--ILNSGHDNVTLTSGTNYFICGAEGHCKGGMK  425
            IFNYD S+HNV +V   NY SC  S T    +SG D + L+ G NYFIC   GHC+ G+K
Sbjct  66   IFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCEAGLK  125

Query  426  MAITAT  443
            +A+ A+
Sbjct  126  LAVDAS  131



>ref|NP_001051910.1| Os03g0850900 [Oryza sativa Japonica Group]
 gb|AAO20055.1| putative basic blue copper protein [Oryza sativa Japonica Group]
 gb|ABF99923.1| Chemocyanin precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13824.1| Os03g0850900 [Oryza sativa Japonica Group]
 gb|EAY92604.1| hypothetical protein OsI_14346 [Oryza sativa Indica Group]
 gb|EAZ29321.1| hypothetical protein OsJ_13385 [Oryza sativa Japonica Group]
 dbj|BAG88354.1| unnamed protein product [Oryza sativa Japonica Group]
Length=125

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 62/101 (61%), Gaps = 7/101 (7%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS-  326
             AE+  +TV D+  W      W NGK FK+GD+L+F YD S HNVV V+   Y  CT + 
Sbjct  25   MAESAVFTVGDRGGWGMGAGSWANGKRFKAGDVLVFKYDSSAHNVVAVNAAGYKGCTAAP  84

Query  327  --GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
                +  SG+D VTL  GTNYFIC   GHC+ GMK+A+TA 
Sbjct  85   RGAKVYKSGNDRVTLARGTNYFICNFPGHCQAGMKIAVTAA  125



>ref|XP_008775007.1| PREDICTED: basic blue protein-like [Phoenix dactylifera]
Length=125

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--S  326
            AE+ TYTV D   W+     W  GK F++GD+L+F Y+PS HNVV+V+   Y  CT    
Sbjct  27   AESATYTVGDTNGWTFNTDTWTRGKRFRAGDVLVFKYNPSAHNVVVVNAAGYRGCTTPRG  86

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +L+SG+D VTL  GTNYFIC   GHC+ GMK+A TA
Sbjct  87   SRVLSSGNDQVTLAKGTNYFICNFAGHCQSGMKIAATA  124



>gb|AFP73459.1| early nodulin-like protein [Citrus trifoliata]
 gb|AFP73460.1| early nodulin-like protein [Citrus trifoliata]
Length=131

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 73/126 (58%), Gaps = 10/126 (8%)
 Frame = +3

Query  96   MGKMSTHDSIIVIA-IVTMLLCGFAEAE---TYTVEDKAKWS----DWPNGKSFKSGDIL  251
             G+ S   +  V A ++ +L  GF   E   T TV D + W+     W NGK FK+GD L
Sbjct  6    QGRCSASQATTVAATLLVLLFLGFHSTEATSTITVGDTSGWTYNIQSWTNGKQFKAGDTL  65

Query  252  IFNYDPSVHNVVIVSKENYNSCTISGT--ILNSGHDNVTLTSGTNYFICGAEGHCKGGMK  425
            IFNYD S+HNV +V   NY SC  S T    +SG D + L+ G NYFIC   GHC+ G+K
Sbjct  66   IFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCEAGLK  125

Query  426  MAITAT  443
            +A+ A+
Sbjct  126  LAVDAS  131



>gb|EYU18547.1| hypothetical protein MIMGU_mgv1a016285mg [Erythranthe guttata]
Length=127

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 6/110 (5%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVS  296
            V   + MLLC  A A +YTV D + W    S W NGKSFKSGD L+FNY   +H+VV V 
Sbjct  17   VTTSIVMLLCNKACATSYTVGDSSGWDYDVSGWENGKSFKSGDTLVFNYPAGLHSVVAVD  76

Query  297  KENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            K +Y+ C++  +     SG DN+ L  G NYFICG +GHC+ GMK+A  A
Sbjct  77   KSSYDLCSVPANAPTYTSGQDNIVLNKGANYFICGIDGHCEFGMKIAANA  126



>dbj|BAJ95771.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=121

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWSDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS--GTI  335
            FAE++ YTV        WP GK F++GD+L+F Y    HNVV V+   Y SC+ +     
Sbjct  26   FAESKVYTVGWAVSSGGWPRGKRFRAGDVLLFKYGRGAHNVVAVNAAGYKSCSAARGSRT  85

Query  336  LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             NSG D VTL+ GTNYFIC   GHC+ GMKMA+TA 
Sbjct  86   YNSGSDRVTLSRGTNYFICSVPGHCQAGMKMAVTAA  121



>ref|XP_007137515.1| hypothetical protein PHAVU_009G133600g [Phaseolus vulgaris]
 gb|ESW09509.1| hypothetical protein PHAVU_009G133600g [Phaseolus vulgaris]
Length=127

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 78/127 (61%), Gaps = 11/127 (9%)
 Frame = +3

Query  90   LFMGKMSTHDSIIVIAIVTML----LCGFAEAETYTVEDKAKWS----DWPNGKSFKSGD  245
            +F G+ S   S++++ ++++L    L   A A TYTV     W+     WP+GK F++GD
Sbjct  1    MFQGRGSAL-SLVLVTVISLLCLLVLVERANAATYTVGGPGGWTFNTDTWPSGKRFRAGD  59

Query  246  ILIFNYDPSVHNVVIVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGG  419
            +LIFNYD + HNVV V K  YNSC T +G  +  SG D + L  G NYFIC   GHC+ G
Sbjct  60   VLIFNYDSTNHNVVAVDKSGYNSCKTPAGAKVFRSGKDQIKLARGQNYFICNYPGHCESG  119

Query  420  MKMAITA  440
            MK+++ A
Sbjct  120  MKVSMNA  126



>ref|XP_009404130.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=131

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--S  326
            AEA TYTV D   WS     W  GK F++GD+L+F Y+PSVHNVV V+   YN C+    
Sbjct  33   AEAATYTVGDSGGWSFNMASWSRGKRFRAGDVLVFKYNPSVHNVVAVNAAGYNGCSTPRG  92

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +  SG+D +TL  G NY+IC   GHC+ GMK+AI A
Sbjct  93   SRVFTSGNDRITLARGRNYYICNFTGHCQSGMKIAIVA  130



>gb|KHN44270.1| Basic blue protein [Glycine soja]
Length=127

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG-  329
            A+A TYTV     W+     WP GK F++GDILIFNYD + HNVV V +  YNSC   G 
Sbjct  29   ADAATYTVGGPGGWTFNTNAWPKGKRFRAGDILIFNYDSTTHNVVAVDRSGYNSCKTPGG  88

Query  330  -TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              + +SG D + L  G NYFIC   GHC+ GMK+AI A
Sbjct  89   AKVFSSGKDQIKLARGQNYFICNYPGHCESGMKVAINA  126



>ref|XP_010514055.1| PREDICTED: basic blue protein-like [Camelina sativa]
Length=130

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 76/115 (66%), Gaps = 8/115 (7%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHN  281
            +I+ +  V++LL    +A+A TYTV D   W+     WP GK+F++GD+L+FNY+PS+HN
Sbjct  15   AIVALMAVSVLLLHADYAQAVTYTVGDSGVWTFNAVGWPKGKNFRAGDVLVFNYNPSMHN  74

Query  282  VVIVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            VV V   +YNSC T +G     SG D +TL+ G N+FIC    HC+  MK+A+TA
Sbjct  75   VVKVDSGSYNSCKTPAGARTYTSGKDRITLSRGQNFFICNFPNHCESNMKIAVTA  129



>ref|XP_011014751.1| PREDICTED: basic blue protein [Populus euphratica]
Length=125

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 67/112 (60%), Gaps = 8/112 (7%)
 Frame = +3

Query  129  VIAIVTMLLCGF--AEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVI  290
            V  ++ MLL  F  A A TYTV     W    S WP GKSFK+GDILIFNY  + HNVV 
Sbjct  13   VAVMLCMLLLHFDMAHAATYTVGGPGGWTFNASGWPKGKSFKAGDILIFNYSTAAHNVVA  72

Query  291  VSKENYNSCT--ISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V+K  Y+SCT      +  SG D + L  G N+FIC   GHC+ GMK+A+ A
Sbjct  73   VNKAGYSSCTSPRGAKVYTSGKDRIKLVKGQNFFICSFAGHCQSGMKIAVNA  124



>ref|XP_008339290.1| PREDICTED: basic blue protein-like [Malus domestica]
Length=122

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 70/108 (65%), Gaps = 4/108 (4%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVS  296
            VIAI  +L    A A+ +TV +   W+    DWPNGK+F + D L+F Y+ + HNV +V 
Sbjct  14   VIAIGLVLHGEIAHAKXFTVGEGDGWNFKVHDWPNGKNFTANDTLVFKYNNAFHNVAVVD  73

Query  297  KENYNSCTISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +  Y +CT+ G +L++G+D + +  G NYFICG  GHC  GMK+A+TA
Sbjct  74   ENGYRTCTVGGKLLSTGNDVIKIXQGQNYFICGFPGHCAAGMKIAVTA  121



>ref|XP_002298184.1| basic blue copper family protein [Populus trichocarpa]
 gb|EEE82989.1| basic blue copper family protein [Populus trichocarpa]
Length=125

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 67/112 (60%), Gaps = 8/112 (7%)
 Frame = +3

Query  129  VIAIVTMLLCGF--AEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVI  290
            V  ++ MLL  F  A A TYTV     W    S WP GKSFK+GDIL+FNY  + HNVV 
Sbjct  13   VAVMLCMLLLHFDMAHAATYTVGGPGGWTFNVSGWPKGKSFKAGDILVFNYSTAAHNVVA  72

Query  291  VSKENYNSCT--ISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V+K  Y+SCT      +  SG D + L  G N+FIC   GHC+ GMK+A+ A
Sbjct  73   VNKAGYSSCTSPRGAKVYTSGKDQIKLVKGQNFFICSFAGHCQSGMKIAVNA  124



>ref|NP_001149596.1| chemocyanin precursor [Zea mays]
 gb|ACG35999.1| chemocyanin precursor [Zea mays]
 gb|AFW58439.1| chemocyanin [Zea mays]
Length=129

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 63/98 (64%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--S  326
            AE+  +TV D+  WS     W NGK FK+GD+L+F YD + HNVV+V+   Y  C+    
Sbjct  31   AESAVFTVGDRGGWSFSTGTWTNGKRFKAGDVLVFKYDSTAHNVVVVNAAGYKGCSAPRG  90

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +  SG+D VTL  GTNYFIC   GHC+ GMK+A+TA
Sbjct  91   AKVYTSGNDRVTLARGTNYFICSIPGHCQSGMKIAVTA  128



>ref|NP_001266663.1| chemocyanin precursor [Zea mays]
 gb|ACG40792.1| chemocyanin precursor [Zea mays]
 gb|ACR37830.1| unknown [Zea mays]
 tpg|DAA50958.1| TPA: chemocyanin [Zea mays]
Length=130

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 62/100 (62%), Gaps = 6/100 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG  329
             AE+  YTV D+  WS    +WP GK F++GD+L F Y+   HNVV VS   Y SC+   
Sbjct  31   LAESAVYTVGDRGGWSFNTANWPKGKRFRAGDVLAFRYNAKAHNVVPVSAAGYKSCSAPK  90

Query  330  TI--LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             +  L +G+D VTL  G NYFIC   GHC+ GMK+A+TA 
Sbjct  91   GVRALTTGNDRVTLKRGANYFICSFPGHCQAGMKIAVTAA  130



>ref|XP_003560817.1| PREDICTED: basic blue protein-like [Brachypodium distachyon]
Length=130

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 62/100 (62%), Gaps = 6/100 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--  323
            FAE+  YTV D+  W+     WP GK F++GD+L F Y    HNVV V+   Y SC+   
Sbjct  31   FAESAVYTVGDRGGWTLNSGGWPRGKRFRAGDVLQFKYGRGAHNVVAVNAAGYKSCSAPR  90

Query  324  SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
               + +SG+D+V L+ GTNYFIC   GHC  GMKMA+TA 
Sbjct  91   GAKVYSSGNDSVKLSRGTNYFICSIPGHCGAGMKMAVTAA  130



>ref|XP_002278646.1| PREDICTED: basic blue protein [Vitis vinifera]
Length=126

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 71/113 (63%), Gaps = 7/113 (6%)
 Frame = +3

Query  123  IIVIAIVTMLL-CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVV  287
            +I++A++ +L+      A TYTV D   W     +WPNGK+FK+GD+L+FNY P VHNVV
Sbjct  13   LIMVALLCLLVHSAPVHAATYTVGDADGWIYDVVNWPNGKTFKAGDVLVFNYLPEVHNVV  72

Query  288  IVSKENYNSCTISG--TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             V    YN C       + NSG+D +TL  GTN FIC  EGHC  GMK+ +TA
Sbjct  73   EVDINGYNRCKAPAGSKVHNSGNDKITLVKGTNSFICTFEGHCLQGMKITVTA  125



>gb|ACJ84083.1| unknown [Medicago truncatula]
Length=121

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 67/119 (56%), Gaps = 6/119 (5%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPS  272
            +    +++++    +L    A A TYTV     W+     WPNGK F++GD L+FNY PS
Sbjct  3    LGRASALVLLVCFFVLNSELAHAATYTVGGPGGWTFNTVGWPNGKRFRAGDTLVFNYSPS  62

Query  273  VHNVVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             HNVV V+K  Y+SC       +  SG D + L  G NYFIC   GHC+ GMK+AI A 
Sbjct  63   AHNVVAVNKGGYDSCKTPRGAKVYRSGKDQIRLARGQNYFICNFVGHCESGMKIAINAA  121



>ref|XP_006387908.1| hypothetical protein POPTR_0487s00220g [Populus trichocarpa]
 gb|ERP46822.1| hypothetical protein POPTR_0487s00220g [Populus trichocarpa]
Length=126

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 6/104 (6%)
 Frame = +3

Query  147  MLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNS  314
            M+L G   A TYTV     W+     WP GK FK+GD L+F YDP++HNVV V++  Y+S
Sbjct  22   MVLTGHVHAATYTVGGSGGWTLNMDSWPKGKRFKAGDTLVFTYDPTIHNVVAVNRGGYSS  81

Query  315  C-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            C T +G  +  SG D + L+ G N+FIC   GHC+ GMK+AI A
Sbjct  82   CITPAGAKVYKSGKDQIKLSKGQNFFICNVAGHCESGMKIAINA  125



>gb|EMS48727.1| Chemocyanin [Triticum urartu]
Length=136

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 63/111 (57%), Gaps = 6/111 (5%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVS  296
            V+ +   L  G AE+  +TV D   WS     WPNGK FK  D+L+FNYDP+ H+VV VS
Sbjct  17   VLLVCAFLHAGVAESAEFTVGDGGGWSVSAGSWPNGKRFKGRDVLVFNYDPTAHDVVAVS  76

Query  297  KENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             E Y +C       +  SG D VTL  G NYFI    G C+ GMK+ +TA 
Sbjct  77   AEGYRACAAPSGAKVYKSGADRVTLALGPNYFISSVPGDCQAGMKITVTAA  127



>gb|AGX45477.1| chemocyanin-like protein [Triticum aestivum]
Length=126

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 60/100 (60%), Gaps = 7/100 (7%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGT  332
            A+A  + V D+  WS     WP GK FK+GD+L+F YD + H+VV VS   Y +C     
Sbjct  27   AQAAVFNVGDRGGWSFDTNSWPTGKRFKAGDVLVFKYDATAHDVVAVSAAGYRACAKPAK  86

Query  333  ---ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
               +  SG D VTL  GTNYFIC   GHC+ GMK+A+TA 
Sbjct  87   GAKVYKSGADRVTLARGTNYFICSIPGHCQSGMKIAVTAA  126



>ref|XP_003629993.1| Basic blue protein [Medicago truncatula]
 gb|AET04469.1| basic blue-like protein [Medicago truncatula]
Length=121

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 67/119 (56%), Gaps = 6/119 (5%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPS  272
            +    +++++    +L    A A TYTV     W+     WPNGK F++GD L+FNY PS
Sbjct  3    LGRGSALVLLVCFFVLNSELAHAATYTVGGPGGWTFNTVGWPNGKRFRAGDTLVFNYSPS  62

Query  273  VHNVVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             HNVV V+K  Y+SC       +  SG D + L  G NYFIC   GHC+ GMK+AI A 
Sbjct  63   AHNVVAVNKGGYDSCKTPRGAKVYRSGKDQIRLARGQNYFICNFVGHCESGMKIAINAA  121



>ref|XP_006443619.1| hypothetical protein CICLE_v10022827mg [Citrus clementina]
 ref|XP_006479305.1| PREDICTED: chemocyanin-like [Citrus sinensis]
 gb|ESR56859.1| hypothetical protein CICLE_v10022827mg [Citrus clementina]
Length=131

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 9/124 (7%)
 Frame = +3

Query  99   GKMSTHDSIIVIAIVTMLLCGFAEAE---TYTVEDKAKWS----DWPNGKSFKSGDILIF  257
            G  ++  + +   ++ +L   F   E   T+TV D + W+     W NGK FK+GD LIF
Sbjct  8    GCSASQATTVAATLLVLLFLRFHSTEATSTFTVGDTSGWTYNIQSWTNGKQFKAGDTLIF  67

Query  258  NYDPSVHNVVIVSKENYNSCTISGT--ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMA  431
            NYD S+HNV +V   NY SC  S T    +SG D + L+ G NYFIC   GHC+ G+K+A
Sbjct  68   NYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCEAGLKLA  127

Query  432  ITAT  443
            + A+
Sbjct  128  VDAS  131



>ref|XP_009129116.1| PREDICTED: basic blue protein [Brassica rapa]
 emb|CDY09351.1| BnaA02g26590D [Brassica napus]
Length=129

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 72/116 (62%), Gaps = 8/116 (7%)
 Frame = +3

Query  117  DSIIVIAIVTMLL--CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVH  278
             +I+ + +V++L+    + +A TYTV +   W+     WP+GK FK+GD+L+FNY+P +H
Sbjct  13   QAIVALMLVSVLVLQADYVQAATYTVGESNGWAFNAVGWPSGKHFKAGDVLVFNYNPRIH  72

Query  279  NVVIVSKENYNSC--TISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            NVV V    YN+C          SG D +TL+ G N+FIC   GHC+  MK+A+TA
Sbjct  73   NVVAVDSGGYNNCKTPARARTYTSGKDRITLSKGQNFFICNFPGHCEAAMKIAVTA  128



>emb|CDY41671.1| BnaC02g34830D [Brassica napus]
Length=129

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 71/115 (62%), Gaps = 8/115 (7%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHN  281
            +I+ + +V++L+    + +A TYTV +   W+     WP GK FK+GD+L+FNY+P +HN
Sbjct  14   AIVALMLVSVLVLQADYVQAATYTVGESNSWAFNAVGWPTGKHFKAGDVLVFNYNPRIHN  73

Query  282  VVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            VV V    YN+C          SG D +TL+ G N+FIC   GHC+  MK+A+TA
Sbjct  74   VVAVDSGGYNNCKTPARARTYTSGKDRITLSKGQNFFICNFPGHCEAAMKIAVTA  128



>ref|XP_006650902.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=123

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 59/99 (60%), Gaps = 6/99 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--S  326
            AE+  +TV D+  W      W +GK FK+GD+L+F YD S HNVV V    Y  CT    
Sbjct  25   AESAVFTVGDRGGWGMGAGSWASGKRFKAGDVLVFKYDSSAHNVVAVDAAGYKGCTAPRG  84

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
              +  SG D VTL  GTNYFIC   GHC+ GMK+A+TA 
Sbjct  85   ARVFKSGSDRVTLARGTNYFICNFPGHCQAGMKIAVTAA  123



>ref|XP_004982014.1| PREDICTED: chemocyanin-like [Setaria italica]
Length=129

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 59/99 (60%), Gaps = 6/99 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSC--TIS  326
            AE+  YTV D + W     +WP GK F++GD+L+F Y P  HNVV V+   Y SC     
Sbjct  31   AESAVYTVGDSSGWGFNTVNWPRGKRFRAGDVLVFRYSPKAHNVVAVNAAGYGSCGAPRG  90

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
               L SG+D VTL  G NYFIC   GHC+ GMK+A+ A 
Sbjct  91   ARALTSGNDRVTLKRGANYFICSFPGHCQAGMKIAVNAA  129



>ref|XP_007023293.1| Copper binding protein 6, putative [Theobroma cacao]
 gb|EOY25915.1| Copper binding protein 6, putative [Theobroma cacao]
Length=123

 Score =   102 bits (254),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 6/96 (6%)
 Frame = +3

Query  171  AETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--SGT  332
            A T+ V D   W    SDWPNGKSFK+GDIL F Y+ + HNV +V K+ ++SCT+  + T
Sbjct  27   AATFKVGDDDGWRFGVSDWPNGKSFKAGDILEFVYNRANHNVAVVDKDGHDSCTVPDNAT  86

Query  333  ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +  +G D +TL  G NYFICG  GHC  GM +AITA
Sbjct  87   VFQTGDDKITLEKGENYFICGFTGHCANGMNLAITA  122



>ref|XP_002447932.1| hypothetical protein SORBIDRAFT_06g018350 [Sorghum bicolor]
 gb|EES12260.1| hypothetical protein SORBIDRAFT_06g018350 [Sorghum bicolor]
Length=130

 Score =   102 bits (254),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--S  326
            AE+  +TV D+  WS     W NGK FK+GD+L+F YD + HNVV V+   Y  C+    
Sbjct  32   AESAVFTVGDRGGWSFNTNTWTNGKRFKAGDVLVFKYDSTAHNVVAVNAAGYKGCSAPRG  91

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +  SG+D VTL  GTNYFIC   GHC+ GMK+A+TA
Sbjct  92   AKVYKSGNDRVTLARGTNYFICSIPGHCQSGMKIAVTA  129



>gb|ACG29532.1| chemocyanin precursor [Zea mays]
Length=129

 Score =   102 bits (254),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--S  326
            AE+  +TV D+  WS     W NGK FK+GD+L+F YD + HNVV V+   Y  C+    
Sbjct  31   AESAVFTVGDRGGWSFSTGTWTNGKRFKAGDVLVFKYDSTAHNVVAVNAAGYKGCSAPRG  90

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +  SG+D VTL  GTNYFIC   GHC+ GMK+A+TA
Sbjct  91   AKVYTSGNDRVTLARGTNYFICSIPGHCQSGMKIAVTA  128



>emb|CDO97529.1| unnamed protein product [Coffea canephora]
Length=123

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 73/119 (61%), Gaps = 6/119 (5%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNY  263
             G+ S   +  ++  + +L  G AEA  Y V     W+     WP+GK F++GD L+F+Y
Sbjct  3    QGRCSATFATAMMLCLLVLHSGVAEAAIYRVGGAGGWNFNTVSWPSGKRFRAGDTLVFSY  62

Query  264  DPSVHNVVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAI  434
            +P++HNVV V+K  Y+SCT      + ++G+D + L  G NYFIC  +GHC+ GMK+A+
Sbjct  63   NPAIHNVVAVNKAGYDSCTAPRGSKVYHTGNDQIKLVKGANYFICSYQGHCQSGMKIAV  121



>ref|XP_004301545.1| PREDICTED: chemocyanin-like [Fragaria vesca subsp. vesca]
Length=123

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVV  287
            +++++    ++    A A TY V DKA W+     WP GK F +GDIL+F Y+ +VH+V+
Sbjct  11   NVMLLVFCVLIHYKIASATTYIVGDKAGWTFGIQSWPTGKQFHAGDILVFKYNMNVHSVI  70

Query  288  IVSKENYNSC-TISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +  +  + +C T++G    SG+D + L  G NYFICG  GHC GGMKM I+A
Sbjct  71   VTDENGFKTCNTVTGQKFVSGNDQIKLRMGQNYFICGTPGHCVGGMKMTISA  122



>ref|XP_009404791.1| PREDICTED: chemocyanin-like [Musa acuminata subsp. malaccensis]
Length=175

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 68/114 (60%), Gaps = 11/114 (10%)
 Frame = +3

Query  132  IAIVTMLLCGFAEAE-----TYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNV  284
            +A+   LLC    +E     T+ V D   W    + WP+GK F++GD+L F Y+P  HNV
Sbjct  61   VAMGLALLCLLVHSEVAGAATFVVGDSGGWTFSTAGWPSGKRFRAGDVLEFRYNPWAHNV  120

Query  285  VIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V VS   Y SC+ S    +  SG+D VTL  GTN+FIC   GHC+ GMK+A+TA
Sbjct  121  VAVSAAGYRSCSASPAARVFTSGNDRVTLARGTNHFICSLAGHCESGMKIAVTA  174



>ref|XP_009404787.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=122

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAE-----TYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHN  281
            + A+  + LC F   E      +TV D A WS    +WPNGKSFK+GD+L+F Y    HN
Sbjct  7    IAALALICLCLFYHLEITAATEFTVGDSAGWSFNVQNWPNGKSFKAGDVLVFKYGLGTHN  66

Query  282  VVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            VV+V  E YNSC          SG+D +TL +GT+YFIC   GHC+ G+K+ +TA+
Sbjct  67   VVVVDAEGYNSCKPKSDSKTYTSGNDKITLAAGTSYFICSYPGHCEAGVKIKVTAS  122



>gb|AFK41897.1| unknown [Medicago truncatula]
Length=126

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG-  329
            A A TYTV     W+     WPNGK FK+GD+L FNYD + HNVV V K  YN+C   G 
Sbjct  28   ANAATYTVGGTGGWTYNTDTWPNGKKFKAGDVLSFNYDSTTHNVVAVDKSGYNNCKTPGG  87

Query  330  -TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              + +SG D + L+ G NYFIC   GHC+ GMK++I A
Sbjct  88   AKVFSSGSDQIRLSRGQNYFICSYPGHCQSGMKVSIYA  125



>ref|XP_002876842.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53101.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=129

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 72/115 (63%), Gaps = 8/115 (7%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHN  281
            +I+ + +V++LL    + +A TYTV D   W+     WP GK F++GD+L+FNY+P +HN
Sbjct  14   AIVTLMVVSVLLLQADYVQAATYTVGDSGVWTFNAVGWPKGKHFRAGDVLVFNYNPRMHN  73

Query  282  VVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            VV V   +YN+C          +G D +TL+ G ++FIC   GHC+  MK+A+TA
Sbjct  74   VVKVDSGSYNNCQTPAGAKTYTTGKDRITLSKGQHFFICNFPGHCENAMKIAVTA  128



>dbj|BAJ96641.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=126

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 60/100 (60%), Gaps = 7/100 (7%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGT  332
            A+A  + V D+  WS     WP GK FK+GD+L+F YD + H+VV VS   Y +C     
Sbjct  27   ADAAVFNVGDRGGWSFNTNSWPAGKRFKAGDVLVFKYDATAHDVVAVSAAGYKTCAKPAK  86

Query  333  ---ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
               +  SG D VTL  GTNYFIC   GHC+ GMK+A+TA 
Sbjct  87   GAKVYKSGADRVTLARGTNYFICSIPGHCQSGMKIAVTAA  126



>gb|KEH37636.1| basic blue-like protein [Medicago truncatula]
Length=125

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 77/123 (63%), Gaps = 9/123 (7%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLL--CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIF  257
             G++S+  SII+++++ ML+     + AE + V D   WS    +WP GK+FK+GD L+F
Sbjct  3    QGRVSS-TSIILMSLLCMLVFHSNMSFAEEHIVGDGKGWSFGVQNWPAGKTFKAGDTLVF  61

Query  258  NYDPSVHNVVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMA  431
            NY P+ HNVV+V+K  Y+SC       +  SG D +TL  G NYF+CG  GHC  G K+A
Sbjct  62   NYSPTSHNVVVVNKSGYDSCVAPKGSKVYTSGADRITLAKGGNYFLCGFPGHCNLGQKIA  121

Query  432  ITA  440
            + A
Sbjct  122  VNA  124



>ref|NP_001265957.1| basic blue protein-like precursor [Cicer arietinum]
 emb|CAA10134.1| basic blue copper protein [Cicer arietinum]
Length=122

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 58/99 (59%), Gaps = 6/99 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--  323
             A+A  YTV     W+     WPNGK+FK+GD L+FNY P  HNVV VSK  Y SC    
Sbjct  23   LAQAAIYTVGGAGGWTFNTIAWPNGKNFKAGDTLVFNYSPGAHNVVAVSKAGYGSCKTPR  82

Query  324  SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
               +  SG D + L  G NYFIC   GHC+ GMK+AI A
Sbjct  83   GAKVYRSGKDQIRLARGQNYFICNYVGHCESGMKIAINA  121



>gb|KFK33467.1| hypothetical protein AALP_AA5G016900 [Arabis alpina]
Length=130

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 73/116 (63%), Gaps = 9/116 (8%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGF---AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVH  278
            +I+ +  V++LL       +A TYTV D + W+     WP+GK FK+GD+L+FNY+PS H
Sbjct  14   AIVALMAVSVLLLQADHNVQAATYTVGDSSGWALNAVGWPSGKQFKAGDVLVFNYNPSFH  73

Query  279  NVVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            NVV+V    Y +C    S +   SG D +TL++G +YFIC    HC+  MK+A+TA
Sbjct  74   NVVVVDSGGYKNCVTPASASTYTSGKDRMTLSTGPHYFICNFPSHCESDMKIAVTA  129



>gb|KFK33466.1| hypothetical protein AALP_AA5G016800 [Arabis alpina]
Length=130

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 9/116 (8%)
 Frame = +3

Query  120  SIIVIAIVTMLLCG---FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVH  278
            +I+ +  V++LL        A+TYTV D   W+     WP GK FK+GD+L+FNY PS H
Sbjct  14   AIVALMAVSVLLLQADYVQAAKTYTVGDSRGWAFNTVGWPRGKQFKAGDVLVFNYSPSFH  73

Query  279  NVVIVSKENYNSCTISGTI--LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            N+V+V+ E Y  C          SG D +TL+ G ++FIC   GHC+  MK+A+TA
Sbjct  74   NLVVVNSEGYKKCVTPALAKKYTSGKDRITLSKGQHFFICDFPGHCESDMKIAVTA  129



>ref|XP_008218970.1| PREDICTED: basic blue protein-like [Prunus mume]
Length=111

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKS-FKSGDILIFNYDPSVHNVVI  290
            +++  + +  C  + A  YTV D   W+    DWP GK  F S D L+F Y+   HNV +
Sbjct  1    MLLLCIMLPCCEISYATNYTVGDDDGWNFKVHDWPTGKKLFHSHDTLVFKYNNGQHNVAV  60

Query  291  VSKENYNSCTISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            V +  Y +CTIS  + +SG+D + L  G NYFICG  GHC  GMKMA+TAT
Sbjct  61   VDENGYTTCTISDQVFSSGNDEIKLQHGQNYFICGFPGHCAAGMKMAVTAT  111



>gb|AFK36389.1| unknown [Lotus japonicus]
Length=124

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 70/123 (57%), Gaps = 6/123 (5%)
 Frame = +3

Query  90   LFMGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIF  257
            + +GK S    + V+++  +L    A A T+TV D   W+     WP GK F++GD L+F
Sbjct  1    MVLGKGSAMVDLAVLSLCLVLHFEMAHAATFTVGDANGWTFNTVGWPKGKRFRAGDTLVF  60

Query  258  NYDPSVHNVVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMA  431
            NY P  HNVV V+K +Y++C         NSG D + L  G NYFIC   GHC+ G K+A
Sbjct  61   NYSPGAHNVVAVNKASYSACKTPKGAKTYNSGSDQIKLAKGPNYFICNFAGHCESGTKVA  120

Query  432  ITA  440
            + A
Sbjct  121  VNA  123



>gb|ABK23767.1| unknown [Picea sitchensis]
Length=131

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 60/97 (62%), Gaps = 5/97 (5%)
 Frame = +3

Query  168  EAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGT-  332
            E  TYTV  +  W    + W  GK F++GD L+FNY+PS HN+V+V    Y SC+  G+ 
Sbjct  35   EGATYTVGGRQGWGFQTNSWTAGKRFRAGDTLVFNYNPSAHNLVVVGAGAYRSCSTGGSR  94

Query  333  ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             L SG D VTL  G NYFIC   GHC  GMK+A+ AT
Sbjct  95   PLTSGSDKVTLRKGVNYFICSIPGHCTSGMKIAVPAT  131



>ref|XP_010692867.1| PREDICTED: basic blue protein-like [Beta vulgaris subsp. vulgaris]
Length=126

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 70/124 (56%), Gaps = 8/124 (6%)
 Frame = +3

Query  96   MGKMSTHDSIIV-IAIVTML-LCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIF  257
             G+ S   +++V +AI+ +L L     A  YTV     W+     WP GKSFK+GDIL F
Sbjct  3    QGRGSARPTMVVGVAILCLLALTHSTFAAIYTVGAGGGWTYNVQSWPRGKSFKAGDILAF  62

Query  258  NYDPSVHNVVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMA  431
            NY    HNV  VS+  +NSC       +  SG D + L  G NYFIC   GHCKGGM++A
Sbjct  63   NYARGSHNVAGVSRRGFNSCIAPRGARVYQSGRDRIRLRRGVNYFICTFPGHCKGGMRIA  122

Query  432  ITAT  443
            I A+
Sbjct  123  INAS  126



>ref|NP_001149612.1| chemocyanin precursor [Zea mays]
 gb|ACG36081.1| chemocyanin precursor [Zea mays]
 tpg|DAA44473.1| TPA: chemocyanin [Zea mays]
Length=121

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = +3

Query  168  EAETYTVEDKAKWSDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGTILNSG  347
            +A T+ V+       W  GKSF++GD+L FNYDPSVHNVV V    YN C  SGT   SG
Sbjct  30   DAATHRVDWSFNADSWSKGKSFRAGDVLEFNYDPSVHNVVAVDAGGYNGCRPSGTSYGSG  89

Query  348  HDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             D +TL  GT+YFIC   GHC  GMKM + A+
Sbjct  90   SDRITLGPGTSYFICSLNGHCGMGMKMVVNAS  121



>ref|XP_007019333.1| Copper binding protein 6 [Theobroma cacao]
 gb|EOY16558.1| Copper binding protein 6 [Theobroma cacao]
Length=127

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 6/97 (6%)
 Frame = +3

Query  168  EAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS--G  329
            +A TYTV     W    + WP GKSF++GD+L+FNYD ++HNVV V++E Y  CT     
Sbjct  30   DAATYTVGGPGGWTFNMATWPKGKSFRAGDVLVFNYDATIHNVVAVNREAYTGCTTPAGA  89

Query  330  TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             + +SG D + L  G N+FIC   GHC+ GMK+AI A
Sbjct  90   KVYSSGKDQIKLVKGLNFFICNTAGHCESGMKIAINA  126



>gb|ABZ04882.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
Length=127

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = +3

Query  165  AEAETYTVEDKAKWSDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGTILNS  344
            A A TY V+          GK+F++GD+L+F+YDPSVHNVV V    Y+ C  SGT  +S
Sbjct  35   AAAATYNVDWSFGADSXSKGKNFRAGDVLVFSYDPSVHNVVAVDAGGYSGCRESGTKYSS  94

Query  345  GHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            G+D +TL  GT+YFIC   GHC  GMKMA+TA+
Sbjct  95   GNDRITLGRGTSYFICSFSGHCGAGMKMAVTAS  127



>ref|NP_001235375.1| uncharacterized protein LOC100305948 precursor [Glycine max]
 gb|ACU13882.1| unknown [Glycine max]
Length=121

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 56/99 (57%), Gaps = 6/99 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS-  326
             A A TY V D   W+     WP GK F++GD L FNY P  HNVV VSK  Y+SC    
Sbjct  22   MARAATYRVGDSRGWTFNTVTWPQGKRFRAGDTLAFNYSPGAHNVVAVSKAGYDSCKTPR  81

Query  327  -GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
               +  SG D + L  G NYFIC   GHC+ GMK+AI A
Sbjct  82   GAKVYRSGKDQIRLARGQNYFICNYVGHCESGMKIAINA  120



>ref|XP_010692871.1| PREDICTED: basic blue protein-like [Beta vulgaris subsp. vulgaris]
Length=123

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = +3

Query  114  HDSIIVIAIVTMLLCGFAE---AETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPS  272
              S +V+ +  + L    +   A  Y+V     W+    +WP GKSF++GD+L FNY  +
Sbjct  5    RGSAMVVGVAILCLLALTQPTFAAIYSVGGAGGWTYNVQNWPRGKSFRAGDLLAFNYGRT  64

Query  273  VHNVVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            +HNVV VSK  Y+SC+      +  +G D V L+ G NYFIC   GHC+ GMK+AI A 
Sbjct  65   LHNVVAVSKRGYDSCSAPRGARVYQTGKDRVRLSRGQNYFICTLPGHCQAGMKIAINAA  123



>gb|ADV57641.1| copper binding protein 6 [Gossypium hirsutum]
Length=127

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVV  287
            S I + +  M+     +A TYTV     W    + WP GK F++GD+L+FNYD ++HNVV
Sbjct  14   SAIALLLCLMVCLETIDAATYTVGGSNGWTFNTATWPKGKRFRAGDVLVFNYDATIHNVV  73

Query  288  IVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             V++  Y +CT      + NSG D + L  G N+F+C   GHC+ GMK+AI A
Sbjct  74   AVNRRGYTNCTTPAGAKVYNSGKDKIKLAKGLNFFMCSTAGHCESGMKIAINA  126



>gb|EYU18544.1| hypothetical protein MIMGU_mgv1a016345mg [Erythranthe guttata]
Length=125

 Score =   100 bits (248),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 6/101 (6%)
 Frame = +3

Query  156  CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSC-T  320
            C  AEA T+ V     W+     WP GK F++GD L+FNY    HNVV V++  YN C T
Sbjct  24   CEVAEAATFAVGGGGGWTYNTVGWPKGKRFRAGDTLVFNYGSGYHNVVAVNRAGYNGCAT  83

Query  321  ISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             +G  +  SG+D + L  GTNYFIC   GHC+GGMK+A+TA
Sbjct  84   PAGAKVYQSGNDQIKLAKGTNYFICNYPGHCEGGMKIAVTA  124



>gb|ACJ84194.1| unknown [Medicago truncatula]
 gb|KEH35401.1| basic blue-like protein [Medicago truncatula]
Length=126

 Score =   100 bits (248),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG-  329
            A A +YTV     W+     WPNGK FK+GD+L FNYD + HNVV V K  YN+C   G 
Sbjct  28   ANAASYTVGGTGGWTYNTDTWPNGKKFKAGDVLSFNYDSTTHNVVAVDKSGYNNCKTPGG  87

Query  330  -TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              + +SG D + L+ G NYFIC   GHC+ GMK++I A
Sbjct  88   AKVFSSGSDQIRLSRGQNYFICSYPGHCQSGMKVSIYA  125



>gb|AFW57670.1| hypothetical protein ZEAMMB73_536294 [Zea mays]
Length=111

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 63/105 (60%), Gaps = 6/105 (6%)
 Frame = +3

Query  168  EAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--SG  329
            E+  +TV D+  WS     W NGK FK+GD+L+F YD + HNVV V+   Y  C+   S 
Sbjct  6    ESAVFTVGDRGGWSFSTSTWTNGKRFKAGDVLVFKYDSTAHNVVAVNAAGYKGCSAPRSA  65

Query  330  TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT*SIVIHT  464
             +  SG+D VTL  GTNYFIC   GHC+ GMK+A+     I + T
Sbjct  66   KVYTSGNDRVTLARGTNYFICSIPGHCQSGMKIAVPRATYIYLST  110



>ref|XP_008775029.1| PREDICTED: chemocyanin-like [Phoenix dactylifera]
Length=127

 Score = 99.8 bits (247),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 75/125 (60%), Gaps = 9/125 (7%)
 Frame = +3

Query  96   MGKMSTHDSIIV-IAIVTMLLCGFA--EAETYTVEDKAKW----SDWPNGKSFKSGDILI  254
             G+ +T  ++ + + ++ + +C F   E++ Y V D   W    ++WPNGK+F++GD+L+
Sbjct  3    QGRGTTSSTVALGLVLICLFVCQFEIIESKEYIVGDALGWTFGVANWPNGKNFQAGDVLV  62

Query  255  FNYDPSVHNVVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKM  428
            F YDP  HNVV V    YNSC +  +  + +SG+D ++L  G NYF C    HC+  +K+
Sbjct  63   FRYDPQAHNVVAVDAAGYNSCKVGLNSKVYDSGNDRISLQKGANYFFCSFANHCQMNLKI  122

Query  429  AITAT  443
            A+ A 
Sbjct  123  AVKAA  127



>ref|XP_011087777.1| PREDICTED: basic blue protein-like [Sesamum indicum]
Length=126

 Score = 99.8 bits (247),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 59/101 (58%), Gaps = 6/101 (6%)
 Frame = +3

Query  156  CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCT-  320
            C  AEA TYTV     W    + WP GK FK+GD L+FNY P+ HNVV V+K  Y  C  
Sbjct  25   CEVAEAATYTVGGAGGWTFNVATWPTGKRFKAGDTLVFNYSPTAHNVVAVNKGGYQGCAS  84

Query  321  -ISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                 +  +G D + L  G N+FIC   GHC+ GMK+A+TA
Sbjct  85   PRGAKLYTTGKDQIKLAKGQNFFICNFPGHCQAGMKIAVTA  125



>ref|XP_010241114.1| PREDICTED: basic blue protein-like [Nelumbo nucifera]
Length=129

 Score = 99.8 bits (247),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 64/96 (67%), Gaps = 6/96 (6%)
 Frame = +3

Query  171  AETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSC--TISGT  332
            A +Y V D A W+    +WP+GK+FK+GD L+F+YDP +HNVV V    Y SC   +  T
Sbjct  33   ATSYVVGDDAGWTYNVQNWPDGKTFKAGDTLVFSYDPMLHNVVEVDNNGYYSCMPAVGST  92

Query  333  ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            I  SG+D +TL+ G +YFICG  GHC+  M++A+ A
Sbjct  93   IYTSGNDQITLSEGPHYFICGFPGHCEAAMRIAVNA  128



>gb|ACG32438.1| chemocyanin precursor [Zea mays]
Length=121

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = +3

Query  165  AEAETYTVEDKAKWSDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGTILNS  344
            A+A T+ V+       W  GKSF++GD+L FNYDPSVHNVV V    YN C  SGT   S
Sbjct  29   ADAATHRVDWSFNADSWSKGKSFRAGDVLEFNYDPSVHNVVAVDAGGYNGCRPSGTSYGS  88

Query  345  GHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            G D +TL  GT+YFIC    HC  GMKM + A+
Sbjct  89   GSDRITLGPGTSYFICSLNRHCGMGMKMVVNAS  121



>gb|AAM60981.1| putative basic blue protein plantacyanin [Arabidopsis thaliana]
Length=129

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 73/115 (63%), Gaps = 8/115 (7%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHN  281
            +I+ +  V++LL    + +A TYTV D   W+     WP GK F++GD+L+FNY+P +HN
Sbjct  14   AIVTLMAVSVLLLQADYVQAATYTVGDSGIWTFNAVGWPKGKHFRAGDVLVFNYNPRMHN  73

Query  282  VVIVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            VV V   +YN+C T +G     SG D +TL+ G N+FIC    HC+  MK+A+TA
Sbjct  74   VVXVDSGSYNNCKTPTGAKPYTSGKDRITLSKGQNFFICNFPNHCESDMKIAVTA  128



>ref|XP_006653392.1| PREDICTED: basic blue protein-like [Oryza brachyantha]
Length=136

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 66/111 (59%), Gaps = 6/111 (5%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIV  293
            +V+A+   +    A    + V D + W+     WPN K FKSGD+L+F YDPS HNVV V
Sbjct  25   VVLALRRGVQPAAASQREWPVGDSSGWTFGVVGWPNYKPFKSGDVLVFTYDPSSHNVVAV  84

Query  294  SKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            S  +Y  C +    T  +SG D VTL+ G  +FICG  GHC  GMK+A+TA
Sbjct  85   SDVDYALCKVPANATTYSSGDDRVTLSRGVAFFICGFPGHCDKGMKIAVTA  135



>gb|KHG19540.1| Basic blue [Gossypium arboreum]
Length=123

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 66/112 (59%), Gaps = 12/112 (11%)
 Frame = +3

Query  144  TMLLCGF------AEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIV  293
            T+LLC        A++ ++TV  +  W    + WP  K FK+GD L+FNY+PS+HNVV V
Sbjct  12   TVLLCCLLLHFEVAQSASFTVGGRGGWTFNAAAWPKRKRFKAGDTLVFNYNPSIHNVVAV  71

Query  294  SKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            ++  Y SC       +  SG D + L  G N+FIC   GHC+ GMK+A+TA 
Sbjct  72   NRAGYKSCKAPKGAKVFKSGKDQIKLKKGQNFFICNYIGHCQAGMKIAVTAA  123



>emb|CDP03862.1| unnamed protein product [Coffea canephora]
Length=129

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 75/128 (59%), Gaps = 11/128 (9%)
 Frame = +3

Query  90   LFMGKMSTHDSIIVIAIVTMLLCGFA-----EAETYTVEDKAKWS----DWPNGKSFKSG  242
            +++   S+       A++ +LL  F+     +A TY V D + W+    +W  GK F +G
Sbjct  1    MYVQGRSSARQATAFAVLMILLSLFSRLRATQATTYAVGDSSGWNFNMGNWTEGKRFNAG  60

Query  243  DILIFNYDPSVHNVVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKG  416
            DIL FNYD S+HNVV+V  + Y +CT S    I NSG+D + L+ G  YFIC   GHC G
Sbjct  61   DILTFNYDSSLHNVVMVDAKGYENCTASSKAKIYNSGNDKIKLSRGRYYFICTFPGHCDG  120

Query  417  GMKMAITA  440
            G+K+ ++A
Sbjct  121  GLKIQLSA  128



>ref|XP_009765796.1| PREDICTED: basic blue protein-like [Nicotiana sylvestris]
Length=125

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 68/122 (56%), Gaps = 6/122 (5%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNY  263
             G+ S    ++V+ IV ++    A+A  Y V D   W+     WP GK F++GD L FNY
Sbjct  4    QGRSSAMKVVLVLCIVALIQTEMAQAAVYNVGDAGGWTFNTVSWPGGKRFRAGDTLAFNY  63

Query  264  DPSVHNVVIVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
                HNVV V+K  YN C T  G+ +   G D + L  G NYFIC   GHC+ GMK+++ 
Sbjct  64   QSGAHNVVAVNKYGYNKCRTPRGSKVYTKGGDKIKLVKGQNYFICNFPGHCESGMKISVF  123

Query  438  AT  443
            A+
Sbjct  124  AS  125



>ref|XP_011024698.1| PREDICTED: basic blue protein-like [Populus euphratica]
Length=130

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 75/129 (58%), Gaps = 13/129 (10%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLC-------GFAEAETYTVEDKAKWS----DWPNGKSFKSG  242
            MG+     +I V+ + T+L+          A+A T+TV D + W+     W +GK FK+G
Sbjct  1    MGRQGRCSAIYVVLVSTLLVILSLQFKIAIAKAATFTVGDTSGWTFNIQSWTDGKKFKAG  60

Query  243  DILIFNYDPSVHNVVIVSKENYNSCTISGT--ILNSGHDNVTLTSGTNYFICGAEGHCKG  416
            D LIFNYDPS+H+V  V  + Y+ CT+S +     SG+D + L  G NYFIC    HC  
Sbjct  61   DSLIFNYDPSLHDVATVDVDGYDGCTVSQSSNTYTSGNDTIKLQEGQNYFICSIPSHCDW  120

Query  417  GMKMAITAT  443
            G+K+A+ A+
Sbjct  121  GLKIAVNAS  129



>gb|EMS53389.1| Chemocyanin [Triticum urartu]
Length=129

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 58/98 (59%), Gaps = 7/98 (7%)
 Frame = +3

Query  171  AETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI---SG  329
            A  + V D+  WS     WP GK FK+GD+L+F YD + H+VV VS   Y +C       
Sbjct  32   AAVFNVGDRGGWSFNTNSWPTGKRFKAGDVLVFKYDATAHDVVAVSAAGYKACAKPAKGA  91

Query  330  TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             +  SG D VTL  GTNYFIC   GHC+ GMK+A+TA 
Sbjct  92   KVYKSGADRVTLARGTNYFICSIPGHCQSGMKIAVTAA  129



>gb|KHN47172.1| Basic blue protein [Glycine soja]
Length=124

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 72/123 (59%), Gaps = 7/123 (6%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNY  263
            M +  +  + +++  + +L      A TY V D   W+    +WPNGKSFK+GDIL F Y
Sbjct  1    MAQGRSSAATMLLLCMLVLYSEMVHAATYVVGDATGWAYNVNNWPNGKSFKAGDILEFKY  60

Query  264  DPSVHNVVIVSKENYNSC--TISGTILNSGHDNVTLTSGTNYFICGAEGHCK-GGMKMAI  434
             P  HNV+ V +  YN+C  T +  +  SG D++ L  G NYFICG  GHC+  GM++A+
Sbjct  61   SPFAHNVIQVDEFGYNTCIPTFNSRLFFSGDDHIQLAKGLNYFICGFPGHCQLHGMRIAV  120

Query  435  TAT  443
             AT
Sbjct  121  NAT  123



>ref|XP_004149964.1| PREDICTED: basic blue protein-like [Cucumis sativus]
 ref|XP_004170027.1| PREDICTED: LOW QUALITY PROTEIN: basic blue protein-like [Cucumis 
sativus]
 gb|KGN57571.1| hypothetical protein Csa_3G215590 [Cucumis sativus]
Length=125

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 71/121 (59%), Gaps = 7/121 (6%)
 Frame = +3

Query  99   GKMSTHDSIIVIAIVTML-LCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNY  263
            G+ S    ++++ ++ ML     A A  YTV     W    + WP GK F++GD L+FNY
Sbjct  4    GRGSAMVCVVMVCMLLMLQYSHMAHAAVYTVGGAQGWTFNVASWPKGKRFRAGDTLVFNY  63

Query  264  DPSVHNVVIVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
             PS HNVV V++  Y+ C T  G+ +  +G D + L  G N+FIC   GHC+GGMK+A+ 
Sbjct  64   SPSAHNVVGVNRLGYSRCITPRGSKVFQTGKDQIKLVKGQNFFICNIPGHCQGGMKIAVN  123

Query  438  A  440
            A
Sbjct  124  A  124



>ref|NP_178388.1| plantacyanin [Arabidopsis thaliana]
 sp|Q8LG89.2|BABL_ARATH RecName: Full=Basic blue protein; AltName: Full=Plantacyanin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK17131.1|AF325063_1 putative basic blue protein (plantacyanin) [Arabidopsis thaliana]
 gb|AAC32449.1| plantacyanin [Arabidopsis thaliana]
 gb|AAC32906.1| putative basic blue protein (plantacyanin) [Arabidopsis thaliana]
 gb|AAL36048.1| At2g02850/T17M13.2 [Arabidopsis thaliana]
 gb|AAM19923.1| At2g02850/T17M13.2 [Arabidopsis thaliana]
 gb|AEC05633.1| plantacyanin [Arabidopsis thaliana]
Length=129

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 73/115 (63%), Gaps = 8/115 (7%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHN  281
            +I+ +  V++LL    + +A TYTV D   W+     WP GK F++GD+L+FNY+P +HN
Sbjct  14   AIVTLMAVSVLLLQADYVQAATYTVGDSGIWTFNAVGWPKGKHFRAGDVLVFNYNPRMHN  73

Query  282  VVIVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            VV V   +YN+C T +G     SG D +TL+ G N+FIC    HC+  MK+A+TA
Sbjct  74   VVKVDSGSYNNCKTPTGAKPYTSGKDRITLSKGQNFFICNFPNHCESDMKIAVTA  128



>ref|XP_004981033.1| PREDICTED: chemocyanin-like [Setaria italica]
Length=128

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--S  326
            AE+  +TV D+  W+     W NGK FK+GD+L+F YD S HNV  V+   Y  C     
Sbjct  30   AESAVFTVGDRGGWTFNSNTWTNGKRFKAGDVLVFKYDSSAHNVASVNAAGYKGCAAPRG  89

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                 SG+D VTL  GTNYFIC   GHC+ GMK+A+TA
Sbjct  90   ARTYTSGNDRVTLARGTNYFICSIPGHCQAGMKIAVTA  127



>ref|XP_004299980.1| PREDICTED: basic blue protein-like [Fragaria vesca subsp. vesca]
Length=124

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 64/100 (64%), Gaps = 7/100 (7%)
 Frame = +3

Query  162  FAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS-  326
            +A+A TYTV DK  W    + WP GK+F++GD L+FNY  + HNVV V+K  Y  C+ + 
Sbjct  24   WADAATYTVGDKRGWTFNVAGWPKGKTFRAGDTLVFNYGSAAHNVVAVNKVGYQKCSTTP  83

Query  327  --GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                +  +G+D + L  G N+FIC   GHC+ GM++AITA
Sbjct  84   GNARVYQTGNDKIRLAKGQNFFICNFPGHCQSGMQVAITA  123



>ref|XP_003541507.2| PREDICTED: chemocyanin-like [Glycine max]
Length=128

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 72/123 (59%), Gaps = 7/123 (6%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNY  263
            M +  +  + +++  + +L      A TY V D   W+    +WPNGKSFK+GDIL F Y
Sbjct  5    MAQGRSSAATMLLLCMLVLYSEMVHAATYVVGDATGWAYNVNNWPNGKSFKAGDILEFKY  64

Query  264  DPSVHNVVIVSKENYNSC--TISGTILNSGHDNVTLTSGTNYFICGAEGHCK-GGMKMAI  434
             P  HNV+ V +  YN+C  T +  +  SG D++ L  G NYFICG  GHC+  GM++A+
Sbjct  65   SPFAHNVIQVDEFGYNTCIPTFNSRLFFSGDDHIQLAKGLNYFICGFPGHCQLHGMRIAV  124

Query  435  TAT  443
             AT
Sbjct  125  NAT  127



>gb|KHG11741.1| hypothetical protein F383_14857 [Gossypium arboreum]
Length=127

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVV  287
            S I + +  M+     +A TYTV     W    + WP GK F++GD+L+FNY+ ++HNVV
Sbjct  14   SAIALLLCLMVCLETIDAATYTVGGSNGWTFNTATWPKGKRFRAGDVLVFNYNATIHNVV  73

Query  288  IVSKENYNSCT--ISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             V++  Y SCT      + NSG D + L  G N+F+C   GHC+ GMK+AI A
Sbjct  74   AVNRGEYTSCTAPAGAKVYNSGKDKIKLAKGLNFFMCNTAGHCESGMKIAINA  126



>gb|AFK41143.1| unknown [Medicago truncatula]
 gb|KEH35398.1| basic blue-like protein [Medicago truncatula]
Length=126

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 70/113 (62%), Gaps = 7/113 (6%)
 Frame = +3

Query  123  IIVIAIV-TMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVV  287
            +IVI+++  M+L     AETYTV     W+     WPNGKSF +GD+L F Y+P +HNVV
Sbjct  13   VIVISLLCLMVLAKSTNAETYTVGGPKGWTFGIKKWPNGKSFVAGDVLDFGYNPKMHNVV  72

Query  288  IVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +V +  Y+ C T  G+ +  +G D + L  G NYFIC   GHC+ GMK+ I A
Sbjct  73   LVDQTGYDKCKTPEGSKVFRTGSDQIELVKGDNYFICNLPGHCQSGMKIYINA  125



>ref|XP_010549226.1| PREDICTED: LOW QUALITY PROTEIN: basic blue protein-like [Tarenaya 
hassleriana]
Length=129

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS--  326
            A A  YTV D   W+     WP GK F++GD+L+F Y P++HNVV V +  Y+SC     
Sbjct  31   ASAAVYTVGDSGGWTFNVVGWPRGKRFRAGDVLVFKYGPTLHNVVAVDRRGYSSCRAPAG  90

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                 SG+D +TL  G N+FIC   GHC+ GMK+A+ A
Sbjct  91   AKTYRSGNDRITLKKGLNFFICSFPGHCESGMKIAVNA  128



>ref|XP_008441659.1| PREDICTED: basic blue protein-like, partial [Cucumis melo]
Length=147

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 6/110 (5%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVS  296
            VI +V M      EA  Y V   + W+    +WP G  F++GDIL FNYD S+HNVV+V+
Sbjct  37   VIGLVMMSQLESVEAAVYDVGGSSGWTFNVQNWPKGIRFRAGDILKFNYDSSIHNVVVVN  96

Query  297  KENYNSCTISG--TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            K  Y SC   G   + N+G D + L  G +YFIC   GHC+ GMK+A+ A
Sbjct  97   KAGYASCKTPGGAKVYNTGSDQIKLPKGQSYFICNFPGHCEAGMKIAVNA  146



>ref|XP_002266573.1| PREDICTED: basic blue protein-like [Vitis vinifera]
Length=129

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 8/114 (7%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFA--EAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNV  284
            +I++A++ +L+   A     TYTV   A W    ++WP GK F++GD+L FNYD  VHNV
Sbjct  15   LIMVAVIYLLIQYSAPVHGATYTVGGSAGWTFNSANWPKGKRFRAGDVLAFNYDSKVHNV  74

Query  285  VIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V V++  Y+SCT      +  SG + + L  G N+FIC   GHC+ GMK+A+ A
Sbjct  75   VAVNEGGYSSCTTPAGAKVYQSGKEQIKLVKGQNFFICNYAGHCESGMKIAVNA  128



>ref|XP_004149974.1| PREDICTED: basic blue protein-like [Cucumis sativus]
 gb|KGN57570.1| hypothetical protein Csa_3G214590 [Cucumis sativus]
Length=127

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 66/113 (58%), Gaps = 7/113 (6%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIV  293
            +V  ++ +       A  Y V ++  W    S WP GK+F +GDIL F+Y+PS+HNVV+V
Sbjct  14   VVFCLLLLQQLKMGYATIYNVGEELGWTFNVSSWPIGKNFHAGDILAFSYNPSMHNVVVV  73

Query  294  SKENYNSC---TISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             K  YN C    I  T+  SG D + L  G NY+IC   GHC+ GMK+AI AT
Sbjct  74   DKVGYNWCLTHPIEATVHRSGKDQIKLVEGMNYYICSRPGHCQMGMKLAINAT  126



>ref|XP_009405255.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=122

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 71/121 (59%), Gaps = 9/121 (7%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAE---AETYTVEDKAKWS----DWPNGKSFKSGDILIFNY  263
            M+    I  +A+V + L    E   A    V D   WS    +WPNGK+FK+GD+L+F Y
Sbjct  1    MAGRSYIAALALVCLCLFYHLEITAAAEIPVGDSDGWSFDVGNWPNGKTFKAGDVLVFKY  60

Query  264  DPSVHNVVIVSKENYNSCTI-SGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
            D   HNVV+V  E Y+SCT  SG+    SG D +TL  GT+YFIC   GHC GGMK+ + 
Sbjct  61   DEGSHNVVVVDAEGYDSCTAKSGSKTYTSGTDKITLAKGTSYFICSYPGHCDGGMKIKVV  120

Query  438  A  440
            A
Sbjct  121  A  121



>ref|XP_004984952.1| PREDICTED: basic blue protein-like [Setaria italica]
Length=120

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = +3

Query  195  KAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGTILNSGHDNVT  362
            +  WS     W  GKSF++GD+L FNYDPS+HNVV V    Y  C+ SG    SG D +T
Sbjct  34   RVDWSFNADSWSRGKSFRAGDVLEFNYDPSLHNVVAVDAGGYYGCSSSGRAYGSGSDRIT  93

Query  363  LTSGTNYFICGAEGHCKGGMKMAITAT  443
            L  GTNYFIC   GHC  GMKMA+ A+
Sbjct  94   LGPGTNYFICSLNGHCGMGMKMAVNAS  120



>ref|XP_010109721.1| Basic blue protein [Morus notabilis]
 gb|EXC24191.1| Basic blue protein [Morus notabilis]
Length=130

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS--  326
            A+A T  V D + W+     W NGK FK+GDIL+FNYD S+H+VV+V  + Y SCT S  
Sbjct  32   AKATTQMVGDSSGWTFNVESWTNGKKFKAGDILVFNYDTSLHDVVVVDAKGYKSCTSSSG  91

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
                +SG D V L+ G NYFIC   GHC GG+K+++ A+
Sbjct  92   AQTYSSGKDQVKLSKGQNYFICSIPGHCDGGVKISVNAS  130



>ref|NP_001237170.1| uncharacterized protein LOC100499869 precursor [Glycine max]
 gb|ACU13981.1| unknown [Glycine max]
 gb|KHN06504.1| Basic blue protein [Glycine soja]
Length=121

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--  323
             A A TYTV D   W+     WP GK F++GD L FNY P  HNVV V+K  Y+SC    
Sbjct  22   MARAATYTVGDSGGWTFNTVAWPKGKLFRAGDTLAFNYSPGTHNVVAVNKAGYDSCKTPR  81

Query  324  SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
               +  SG D + L  G NYFIC   GHC+ GMK+AI A
Sbjct  82   GAKVYKSGTDQIRLAKGQNYFICNYVGHCESGMKIAINA  120



>gb|KHG29325.1| Basic blue [Gossypium arboreum]
Length=127

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 60/99 (61%), Gaps = 6/99 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--  323
             A+A TYTV     W+     W   K FK+GD L+F Y+PS+HNVV V++  Y+SCT   
Sbjct  28   LAQAATYTVGGTGGWAINVAGWTKDKRFKAGDTLVFKYNPSIHNVVAVNRAGYSSCTTPK  87

Query  324  SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
               +  SG D + L  G NYFIC   GHC+ GMK+A+TA
Sbjct  88   GAKVYQSGKDQIKLVKGQNYFICNYAGHCQAGMKIAVTA  126



>ref|XP_006826879.1| hypothetical protein AMTR_s00010p00134160 [Amborella trichopoda]
 gb|ERM94116.1| hypothetical protein AMTR_s00010p00134160 [Amborella trichopoda]
Length=124

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 65/113 (58%), Gaps = 9/113 (8%)
 Frame = +3

Query  129  VIAIVTMLLCGF---AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVV  287
            ++A+V +++C       A TYTV D   W+     WP GK F++GD+L+F YD S HNVV
Sbjct  11   LVALVFVMICLLEVSTAATTYTVGDSRGWTFNMVSWPAGKRFRAGDVLVFQYDNSAHNVV  70

Query  288  IVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             V+   Y SC +        SG D +TL  G N+F+C   GHC+ GMK+ + A
Sbjct  71   AVNAAGYKSCLVPRGSRTYRSGSDRITLRRGANFFLCSIPGHCQSGMKVQVNA  123



>ref|XP_008465594.1| PREDICTED: basic blue protein-like [Cucumis melo]
Length=125

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 58/98 (59%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS--  326
            A A  YTV     W    + WP GK F++GD L+FNY PS HNVV V++  Y+ CT    
Sbjct  27   AHAAVYTVGGAQGWTFNVASWPKGKRFRAGDTLVFNYSPSAHNVVGVNRLGYSRCTTPRG  86

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +  +G D + L  G N+FIC   GHC+GGMK+A+ A
Sbjct  87   SKVFQTGKDQIKLVKGQNFFICSLPGHCQGGMKIAVNA  124



>ref|XP_002275963.1| PREDICTED: basic blue protein [Vitis vinifera]
Length=124

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 7/111 (6%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVS  296
            V+    +L C  A A TY V     W+     WP GK F +GDIL+FNY+ + H+VV V+
Sbjct  13   VLLFCLLLHCDTAHATTYAVGGAKGWTLDVVGWPYGKRFMAGDILVFNYNAAAHDVVSVN  72

Query  297  KENYNSCTI---SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            K  YN+CT+   +  + ++G D + L  G N+FIC   GHC+ GMK+AITA
Sbjct  73   KVGYNTCTMPRGASKVYHTGKDQIKLVKGQNFFICSFPGHCQSGMKIAITA  123



>emb|CBI23865.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 7/111 (6%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVS  296
            V+    +L C  A A TY V     W+     WP GK F +GDIL+FNY+ + H+VV V+
Sbjct  24   VLLFCLLLHCDTAHATTYAVGGAKGWTLDVVGWPYGKRFMAGDILVFNYNAAAHDVVSVN  83

Query  297  KENYNSCTI---SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            K  YN+CT+   +  + ++G D + L  G N+FIC   GHC+ GMK+AITA
Sbjct  84   KVGYNTCTMPRGASKVYHTGKDQIKLVKGQNFFICSFPGHCQSGMKIAITA  134



>gb|EMS53390.1| Chemocyanin [Triticum urartu]
Length=127

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = +3

Query  180  YTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG---TIL  338
            + V D+  WS     WP GK FK+GD+L+F YD + H+VV VS   Y +C        + 
Sbjct  33   FNVGDRGGWSFNTNSWPTGKRFKAGDVLVFKYDATAHDVVAVSAAGYKACAKPANGAKVY  92

Query  339  NSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             SG D VTL  GTNYFIC   GHC+ GMK+A+TA 
Sbjct  93   KSGSDRVTLARGTNYFICSIPGHCQSGMKIAVTAA  127



>gb|EMT29953.1| Chemocyanin [Aegilops tauschii]
Length=127

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = +3

Query  180  YTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGT---IL  338
            + V D+  WS     WP GK FK+GD+L+F YD + H+VV VS   Y +C        + 
Sbjct  33   FNVGDRGGWSFNTNSWPTGKRFKAGDVLVFKYDATAHDVVAVSAAGYKACAKPAKGAKVY  92

Query  339  NSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             SG D VTL  GTNYFIC   GHC+ GMK+A+TA 
Sbjct  93   KSGADRVTLARGTNYFICSIPGHCQSGMKIAVTAA  127



>ref|XP_010063900.1| PREDICTED: basic blue protein [Eucalyptus grandis]
 gb|KCW71186.1| hypothetical protein EUGRSUZ_F04279 [Eucalyptus grandis]
Length=129

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 6/100 (6%)
 Frame = +3

Query  162  FAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG  329
            +A A TYTV     W    + WP GK F++GD LIF YD ++HNVV ++K  Y+SC   G
Sbjct  30   YARAATYTVGGSGGWTLNVASWPKGKRFRAGDTLIFKYDRTLHNVVALNKGGYDSCRTPG  89

Query  330  --TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
               + +SG+D + L  G NYFIC   GHC+  MK+A+ A 
Sbjct  90   GAKVYSSGNDQIKLVKGPNYFICNFPGHCESAMKIAVNAA  129



>ref|XP_007159595.1| hypothetical protein PHAVU_002G250600g [Phaseolus vulgaris]
 gb|ESW31589.1| hypothetical protein PHAVU_002G250600g [Phaseolus vulgaris]
Length=123

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 66/116 (57%), Gaps = 9/116 (8%)
 Frame = +3

Query  120  SIIVIAIVTMLL---CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVH  278
            S+IV+  +++ L   C  A + TYTV D   W+     W  GK F++GD L+FNY P  H
Sbjct  7    SVIVVLTLSLWLVLHCEMAHSATYTVGDANGWTFNTVAWTKGKRFRAGDTLVFNYGPGTH  66

Query  279  NVVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            NVV V+K  Y +CT        NSG D + L  G NYFIC   GHC+ G K+AI A
Sbjct  67   NVVAVNKAGYKACTTPNGAKTYNSGSDQIKLVKGQNYFICNFVGHCESGTKIAINA  122



>emb|CBI19945.3| unnamed protein product [Vitis vinifera]
Length=175

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 8/114 (7%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAE--TYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNV  284
            +I++A++ +L+   A     TYTV   A W    ++WP GK F++GD+L FNYD  VHNV
Sbjct  61   LIMVAVIYLLIQYSAPVHGATYTVGGSAGWTFNSANWPKGKRFRAGDVLAFNYDSKVHNV  120

Query  285  VIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V V++  Y+SCT      +  SG + + L  G N+FIC   GHC+ GMK+A+ A
Sbjct  121  VAVNEGGYSSCTTPAGAKVYQSGKEQIKLVKGQNFFICNYAGHCESGMKIAVNA  174



>ref|XP_009414068.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=126

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 6/97 (6%)
 Frame = +3

Query  168  EAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--SG  329
            EA  YTV D   W+     WP GK F++GD+L+F Y  + HNVV V+   Y+ CT     
Sbjct  29   EAAVYTVGDSQGWTFNTVGWPKGKRFRAGDVLVFKYSSTAHNVVAVNAAGYSRCTTPRGS  88

Query  330  TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             +  +G+D + L  GTNYFIC   GHC+ GMK+A+TA
Sbjct  89   RVSKTGNDRIRLRKGTNYFICNFAGHCQAGMKIAVTA  125



>ref|NP_001048019.2| Os02g0731400 [Oryza sativa Japonica Group]
 dbj|BAH01435.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57747.1| hypothetical protein OsJ_08265 [Oryza sativa Japonica Group]
 dbj|BAF09933.2| Os02g0731400 [Oryza sativa Japonica Group]
Length=134

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 61/107 (57%), Gaps = 6/107 (6%)
 Frame = +3

Query  138  IVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKEN  305
             + M     AEA  YTV D + W      W  GK+F++GD+L F Y+  VH+V  V    
Sbjct  27   FLVMSAAPLAEAARYTVGDSSGWRFYAEGWAKGKTFRAGDVLEFKYNAVVHDVAAVDLAA  86

Query  306  YNSCTISGTI--LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            Y SCT+   +  + SG D VTL  GT+YFIC   GHCK GMK+A+ A
Sbjct  87   YRSCTVPKGVRKMRSGRDKVTLRKGTHYFICTEPGHCKAGMKLAVRA  133



>ref|XP_004502569.1| PREDICTED: basic blue protein-like [Cicer arietinum]
Length=126

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 6/99 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG-  329
            A A TYTV     W+     WP+GK FK+GD+LIF YD + HNVV V K  Y+ C   G 
Sbjct  28   ANAATYTVGGPGGWTFNTNTWPDGKKFKAGDVLIFKYDSTTHNVVAVDKSGYSGCKTPGG  87

Query  330  -TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
              + ++G D + L  G NYFIC   GHC+ GMK+AI A+
Sbjct  88   AKVFSTGSDQIRLGRGLNYFICNFPGHCESGMKVAINAS  126



>ref|XP_008456091.1| PREDICTED: basic blue protein-like [Cucumis melo]
Length=129

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 66/114 (58%), Gaps = 9/114 (8%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVI  290
            +  + +V  L  G+A    Y V D+  W    S WP GK+F +GDIL FNY PS HNVV 
Sbjct  15   VFCLFLVQQLKMGYAT--IYNVGDELGWTFNVSSWPIGKNFHAGDILAFNYTPSTHNVVE  72

Query  291  VSKENYNSC---TISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            V K  YN C    I  T+ +SG D + L  G NY+IC   GHC+ GMK+AI AT
Sbjct  73   VDKVGYNWCLINPIEATVHHSGKDQMKLVEGMNYYICSLPGHCQMGMKLAINAT  126



>ref|XP_004160478.1| PREDICTED: basic blue protein-like [Cucumis sativus]
Length=127

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 61/98 (62%), Gaps = 7/98 (7%)
 Frame = +3

Query  171  AETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSC---TISG  329
            A  Y V ++  W    S WP GK+F +GDIL F+Y+PS+HNVV+V K  YN C    I  
Sbjct  29   ATIYNVGEELGWTFNVSSWPIGKNFHAGDILAFSYNPSMHNVVVVDKVGYNWCLTHPIEA  88

Query  330  TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            T+  SG D + L  G NY+IC   GHC+ GMK+AI AT
Sbjct  89   TVHRSGKDQIKLVEGMNYYICSRPGHCQMGMKLAINAT  126



>gb|AEC10985.1| basic blue protein [Camellia sinensis]
Length=122

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 58/99 (59%), Gaps = 6/99 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSC--TIS  326
            AEA TY V     W+     WP GK F++GDIL FNY+   HNVV V+K  Y+SC     
Sbjct  24   AEAATYIVGGAGGWTFNSVGWPKGKRFRAGDILAFNYNAQAHNVVSVNKAGYDSCKAPAG  83

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
              + +SG D + L  G N+FIC   GHC  GMK+A+TA 
Sbjct  84   ARVFSSGKDQIKLVKGQNFFICSLPGHCGSGMKIAVTAA  122



>gb|EEC73941.1| hypothetical protein OsI_08810 [Oryza sativa Indica Group]
Length=134

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 60/107 (56%), Gaps = 6/107 (6%)
 Frame = +3

Query  138  IVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKEN  305
             + M     AEA  YTV D   W      W  GK+F++GD+L F Y+  VH+V  V    
Sbjct  27   FLVMSAAPLAEAARYTVGDSGGWRFYAEGWAKGKTFRAGDVLEFKYNAVVHDVAAVDLAA  86

Query  306  YNSCTISGTI--LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            Y SCT+   +  + SG D VTL  GT+YFIC   GHCK GMK+A+ A
Sbjct  87   YRSCTVPKGVRKMRSGRDKVTLRKGTHYFICTEPGHCKAGMKLAVRA  133



>emb|CAB65280.1| basic blue protein [Medicago sativa subsp. x varia]
Length=117

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 69/113 (61%), Gaps = 7/113 (6%)
 Frame = +3

Query  123  IIVIAIVTML-LCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVV  287
            + VI+++ +L L     AETYTV     W+     WPNGKSF +GD+L F Y+P +HNVV
Sbjct  4    VTVISLLGLLFLAKSTNAETYTVGGPKGWTFGIKKWPNGKSFVAGDVLDFGYNPKMHNVV  63

Query  288  IVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +V +  Y+ C T  G+ +  +G D + L  G NYFIC   GHC+ GMK+ I A
Sbjct  64   LVDQTGYDKCKTPEGSKVFRTGSDQIELVKGDNYFICNLPGHCQSGMKIYINA  116



>ref|XP_006431923.1| hypothetical protein CICLE_v10003124mg [Citrus clementina]
 gb|ESR45163.1| hypothetical protein CICLE_v10003124mg [Citrus clementina]
Length=124

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 65/114 (57%), Gaps = 9/114 (8%)
 Frame = +3

Query  120  SIIVIAIVTMLL--CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHN  281
            +II +A V +LL  C    A T+ V D   W     +WP GK+FK GDIL FNYDP  HN
Sbjct  8    AIIAVATVLLLLMHCNIGSATTFKVGDDGGWVFGVQNWPEGKTFKCGDILEFNYDPQRHN  67

Query  282  VVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKG-GMKMAI  434
            V+IV +E ++SC  +       +G D + L  G N+FICG   HC   GMK+ I
Sbjct  68   VIIVDQEGHDSCKPASDAKKFQTGKDQIMLNHGKNFFICGVPTHCSDHGMKLEI  121



>ref|XP_011027397.1| PREDICTED: LOW QUALITY PROTEIN: carboxyvinyl-carboxyphosphonate 
phosphorylmutase, chloroplastic [Populus euphratica]
Length=290

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = +3

Query  90   LFMGKMSTHDSIIV---IAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDI  248
            L+M    + D ++V     +  M+L G   A TY V     W+     WP GK FK+GD 
Sbjct  164  LYMEGRGSADLVMVNVAALLCLMVLTGHVHAATYIVGGSGGWTLNMDSWPKGKRFKAGDT  223

Query  249  LIFNYDPSVHNVVIVSKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGM  422
            L+F YDP++HNVV V++  Y+SC T +G  +  SG D + L+ G N FIC   GHC+ GM
Sbjct  224  LVFTYDPTIHNVVAVNRGGYSSCITPAGAKVYKSGKDLIKLSKGQNLFICNVAGHCESGM  283

Query  423  KMAITAT  443
            K+A+ A 
Sbjct  284  KIAVNAA  290



>gb|KDO50927.1| hypothetical protein CISIN_1g048131mg [Citrus sinensis]
Length=124

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 11/113 (10%)
 Frame = +3

Query  129  VIAIVTMLL----CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNV  284
            +IA+VT+LL    C    A T+ V D   W     +WP GK+FK GDIL FNYDP  HNV
Sbjct  9    IIAVVTVLLLLMHCNIGSATTFKVGDDGGWVFGVQNWPEGKTFKCGDILEFNYDPQRHNV  68

Query  285  VIVSKENYNSCTISGTI--LNSGHDNVTLTSGTNYFICGAEGHCKG-GMKMAI  434
            +IV +E ++SC  +       +G D + L  G N+FICG   HC   GMK+ I
Sbjct  69   IIVDQEGHDSCKPASDAKKFQTGKDQIVLNHGKNFFICGVPTHCSDHGMKLEI  121



>ref|XP_006349402.1| PREDICTED: basic blue protein-like [Solanum tuberosum]
Length=120

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 63/112 (56%), Gaps = 6/112 (5%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVI  290
            + V+ IV ++    A A  Y V D   W+     WP GK F++GDIL FNY    HNVV 
Sbjct  8    VFVLCIVVLIQTEMAHAVEYKVGDSGGWTFNTVGWPKGKRFRAGDILTFNYPNGAHNVVA  67

Query  291  VSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V+K+ YN C+      + + G D V L  G NYFIC   GHC+ GMK+++ A
Sbjct  68   VNKDGYNKCSTPRGAKVYSKGGDKVKLVKGQNYFICNYAGHCESGMKISVFA  119



>gb|EMS53388.1| Chemocyanin [Triticum urartu]
Length=127

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 59/103 (57%), Gaps = 10/103 (10%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPS---VHNVVIVSKENYNSCTI  323
            AEA  + V D+  WS     WP GK FK+GD+L+F YD +    H+VV V    Y +C  
Sbjct  25   AEAAVFNVGDRGGWSFNTNSWPTGKRFKAGDVLVFKYDRADARAHDVVAVGAAGYKACAK  84

Query  324  ---SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
                  +  SG D VTL  GTNYFIC   GHC+ GMK+A+TA 
Sbjct  85   PANGAKVYKSGADRVTLARGTNYFICSIPGHCQSGMKIAVTAA  127



>ref|XP_002266922.1| PREDICTED: basic blue protein [Vitis vinifera]
 emb|CBI37323.3| unnamed protein product [Vitis vinifera]
Length=128

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 76/128 (59%), Gaps = 9/128 (7%)
 Frame = +3

Query  87   LLFMGKMSTHDSIIVIAIVTMLLCGF--AEAETYTVEDKAKWS----DWPNGKSFKSGDI  248
            +   G+ S + +I +  I+  +L     ++A T+ V D + W+    +W +GK FK+GD 
Sbjct  1    MALQGRCSANHAIALTTILVFVLLHVKASQATTFMVGDSSGWTFNINNWASGKKFKAGDK  60

Query  249  LIFNYDPSVHNVVIVSKENYNSCTI---SGTILNSGHDNVTLTSGTNYFICGAEGHCKGG  419
            L+F Y+PS HNVV + ++ YN C+    S  I ++G+D V L  G NYFICG  GHC  G
Sbjct  61   LVFKYNPSFHNVVAIDEDGYNGCSTASPSSKIYSTGNDAVKLLKGHNYFICGVPGHCDMG  120

Query  420  MKMAITAT  443
            +K+ + A+
Sbjct  121  LKIRVNAS  128



>ref|XP_002303034.1| hypothetical protein POPTR_0002s24290g [Populus trichocarpa]
 gb|EEE82307.1| hypothetical protein POPTR_0002s24290g [Populus trichocarpa]
Length=130

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 67/114 (59%), Gaps = 6/114 (5%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVV  287
            S +++ +        A+A T+TV D + W+     W +GK FK+GD LIFNYDPS+H+V 
Sbjct  16   STLLVILSLQFKIAIAKAATFTVGDTSGWTFNIQSWTDGKKFKAGDSLIFNYDPSLHDVA  75

Query  288  IVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             V  + Y+ CT+  S +   SG D + L  G NYFIC    HC  G+K+A+ A+
Sbjct  76   TVDVDGYDGCTLSPSSSTYTSGKDTIKLKEGQNYFICSLPSHCDWGLKIAVNAS  129



>gb|AFK38630.1| unknown [Lotus japonicus]
Length=122

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 64/114 (56%), Gaps = 12/114 (11%)
 Frame = +3

Query  135  AIVTMLLC------GFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNV  284
            AI+ +L+C        A A TYTV     W+     WP GK F++GD L+F Y    HNV
Sbjct  8    AIMVLLVCFLALHSEMAHAATYTVGGAGGWTFNTVGWPKGKRFRAGDTLVFKYGAGAHNV  67

Query  285  VIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V V+K  Y++C       +  SG+D + LT G NYFIC   GHC+ GMK+AI A
Sbjct  68   VAVNKAAYDTCKTPRGAKVYRSGNDQIRLTRGQNYFICNYVGHCESGMKIAINA  121



>ref|XP_004165906.1| PREDICTED: basic blue protein-like [Cucumis sativus]
Length=132

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 66/110 (60%), Gaps = 6/110 (5%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVS  296
            VI +V M      EA  Y V     W+     WP GK F++GDIL FNY+P VHNVV+V+
Sbjct  22   VIGLVMMSQLESVEAAVYDVGGSGGWTFNTESWPKGKRFRAGDILRFNYNPLVHNVVVVN  81

Query  297  KENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +  +++C T +G  +  SG D + L  G +YFIC   GHC+ GMK+A+ A
Sbjct  82   QGGFSTCNTPAGAKVYKSGSDQIKLPKGQSYFICNFPGHCQSGMKIAVNA  131



>gb|KGN47495.1| Basic blue protein [Cucumis sativus]
Length=132

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 66/110 (60%), Gaps = 6/110 (5%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVS  296
            VI +V M      EA  Y V     W+     WP GK F++GDIL FNY+P VHNVV+V+
Sbjct  22   VIGLVMMSQLESVEAAVYDVGGSGGWTFNTESWPKGKRFRAGDILRFNYNPLVHNVVVVN  81

Query  297  KENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +  +++C T +G  +  SG D + L  G +YFIC   GHC+ GMK+A+ A
Sbjct  82   QGGFSTCNTPAGAKVYKSGSDQIKLPKGQSYFICNFPGHCQSGMKIAVNA  131



>ref|XP_007159596.1| hypothetical protein PHAVU_002G250700g [Phaseolus vulgaris]
 gb|ESW31590.1| hypothetical protein PHAVU_002G250700g [Phaseolus vulgaris]
Length=123

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLL-CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFN  260
            MG       +++I++  ++L    A A TYTV     W+     WPNGK F++GD L+F 
Sbjct  1    MGLGRGSAVVLLISLCFLVLHSQMAHAATYTVGGSGGWTFNTVGWPNGKRFRAGDTLVFK  60

Query  261  YDPSVHNVVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAI  434
            Y    HNVV V+K  Y SC       +  SG+D + L  G NYFIC   GHC+ GMK+AI
Sbjct  61   YSSGAHNVVAVNKVGYGSCKTPRGARVYQSGNDQIKLVKGQNYFICNYVGHCESGMKIAI  120

Query  435  TAT  443
             A 
Sbjct  121  NAA  123



>dbj|BAK02839.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=122

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +3

Query  180  YTVEDKAKWSDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGT--ILNSGHD  353
            Y V+       W +GKSF++GD+L+F+Y+P+VHNVV V    YNSC  S       SG D
Sbjct  33   YNVDWSFAADSWSSGKSFRAGDVLVFSYNPAVHNVVAVDAGGYNSCRGSSAAYTYTSGSD  92

Query  354  NVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +VTL  GTNYFIC   GHC  GMKMA+TA
Sbjct  93   HVTLVPGTNYFICSLSGHCGLGMKMAVTA  121



>ref|XP_004230515.1| PREDICTED: basic blue protein-like [Solanum lycopersicum]
Length=120

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 61/112 (54%), Gaps = 6/112 (5%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVI  290
            + V+ IV ++      A  Y V     W+     WP GK F++GD+L FNY    HNVV 
Sbjct  8    VFVLCIVVLIQAEITHAAVYNVGGTGGWTFNTVGWPKGKRFRAGDVLTFNYSSGAHNVVA  67

Query  291  VSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V+K  YNSC+      + N G D V L  G NYFIC   GHC+ GMK+++ A
Sbjct  68   VNKGGYNSCSTPRGAKVYNKGGDKVKLVKGQNYFICNFPGHCQSGMKISVFA  119



>ref|XP_002452607.1| hypothetical protein SORBIDRAFT_04g028940 [Sorghum bicolor]
 gb|EES05583.1| hypothetical protein SORBIDRAFT_04g028940 [Sorghum bicolor]
Length=135

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 67/122 (55%), Gaps = 16/122 (13%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEA----------ETYTVEDKAKWS----DWPNGKSFKSGDILIFNY  263
            +V+A+  +L+ G   A           +Y V D   W      W  G++F++GD+L+FNY
Sbjct  14   VVLALAALLMVGLFVATSAPVAEAAAASYMVGDYGGWKFNVDRWAKGRTFRAGDVLVFNY  73

Query  264  DPSVHNVVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
            + +VH+V +V+   Y SC +     +L SG D V L  GT+YF C   GHC+ GMK+A+ 
Sbjct  74   NRAVHDVAVVNAAAYRSCAVPKGAKVLRSGRDKVRLGRGTHYFACTVRGHCQAGMKIAVR  133

Query  438  AT  443
            A 
Sbjct  134  AV  135



>ref|XP_010103882.1| Basic blue protein [Morus notabilis]
 gb|EXB97323.1| Basic blue protein [Morus notabilis]
Length=125

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 7/100 (7%)
 Frame = +3

Query  162  FAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--  323
             A A TYTV     W    + WP GK F++GD L+FNY    HNVV V+K  Y +C    
Sbjct  25   LARAATYTVGGAGGWTFNVAGWPKGKRFRAGDTLVFNYGRGAHNVVAVNKAGYQTCRTVP  84

Query  324  -SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                +  SG D + L  G N+FIC   GHC+ GMK+A+TA
Sbjct  85   KGAKVYTSGKDQIKLVKGQNFFICNFPGHCESGMKIAVTA  124



>gb|EMS62053.1| Chemocyanin [Triticum urartu]
Length=125

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 10/100 (10%)
 Frame = +3

Query  168  EAETYTVEDKAKWSD------WPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS-  326
             A TY V D A W+       W  GK+F++GD+L+F Y+ + H+V  VSK  Y  CT+S 
Sbjct  24   SATTYLVGDAAGWTRNVDYGGWLAGKTFRAGDVLVFKYNSTFHDVAWVSKGGYKKCTVSP  83

Query  327  ---GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
                 +  +G+D VTL  GT+YFICG  GHC  GMK+A+T
Sbjct  84   KGFAPVYRNGYDAVTLPRGTHYFICGVPGHCSAGMKLAVT  123



>ref|XP_006826881.1| hypothetical protein AMTR_s00010p00135470 [Amborella trichopoda]
 gb|ERM94118.1| hypothetical protein AMTR_s00010p00135470 [Amborella trichopoda]
Length=123

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 62/112 (55%), Gaps = 6/112 (5%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVI  290
            ++ +  V   L   + A TYTV D   W    SDWP GK F +GD+L+FNY    HNVV 
Sbjct  11   LVALVFVFFGLLELSTATTYTVGDSGGWTFGVSDWPKGKKFVAGDVLVFNYPAGNHNVVP  70

Query  291  VSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            V+ + YNSC++        SG D VTL  G N++ICG   HC  GM++   A
Sbjct  71   VNADGYNSCSVPPGSKTYTSGEDRVTLNKGDNFYICGFADHCDAGMQIQANA  122



>ref|NP_001234435.1| plantacyanin precursor [Solanum lycopersicum]
 gb|AAF66243.1|AF243181_1 plantacyanin [Solanum lycopersicum]
Length=122

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVI  290
            +IV+ +  +L    + A TY   D   W    + WPNGK+F +GD++ F Y    HNVV 
Sbjct  11   VIVMILCILLQSNISNAATYPAGDGKGWGFNMNGWPNGKTFNAGDVIEFKYKVDEHNVVK  70

Query  291  VSKENYNSCTIS-GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            VS+E Y+SC  S G + NSG D + L  GT+YFIC    HC  G+K AITA
Sbjct  71   VSQEEYDSCKTSGGQVFNSGDDQIPLEKGTSYFICTFGPHCSEGVKAAITA  121



>ref|XP_002438215.1| hypothetical protein SORBIDRAFT_10g009630 [Sorghum bicolor]
 gb|EER89582.1| hypothetical protein SORBIDRAFT_10g009630 [Sorghum bicolor]
Length=146

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 60/95 (63%), Gaps = 5/95 (5%)
 Frame = +3

Query  168  EAETYTVEDKAKWSDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS-----GT  332
            +A  +T+  K  +  W  GK+F +GDIL+F Y+ + H+V  VSK  Y +C +S       
Sbjct  50   DAAGWTLRPKVDYGQWVAGKTFHAGDILVFKYNTTYHDVAWVSKGGYRNCIVSPKGGRAP  109

Query  333  ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
            + ++GHD VTL  GT+YFICG  GHC  GMK+A+T
Sbjct  110  VYHTGHDAVTLPRGTHYFICGTPGHCSAGMKLAVT  144



>ref|XP_006648513.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=125

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG-  329
            A A  +TV D   WS     W NGK+F +GD+L+F+YDP++HNVV V +  Y+ CT +  
Sbjct  27   AGATEWTVGDGNGWSFGVAGWENGKAFSAGDVLVFHYDPAMHNVVQVDQAGYDGCTAAAG  86

Query  330  -TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             T   SG+D +TL +G  +FIC   GHC+ GMK+A+ A
Sbjct  87   DTTYASGNDKITLAAGKAFFICSFPGHCQNGMKIAVAA  124



>gb|KEH37639.1| basic blue-like protein [Medicago truncatula]
Length=100

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 58/97 (60%), Gaps = 6/97 (6%)
 Frame = +3

Query  171  AETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG--T  332
            A  Y V D   WS    +W  GK+FK GDIL+FNY P +HNVVIV++  YNSC   G   
Sbjct  4    AAEYIVGDGKGWSFHVQNWTLGKTFKEGDILVFNYTPVIHNVVIVNELQYNSCVAIGGSK  63

Query  333  ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
                G D +TL  G NYFICG   HC  GMK+A+ A+
Sbjct  64   FYYKGADRITLAKGANYFICGTPFHCNLGMKIAVNAS  100



>gb|EMT29954.1| Chemocyanin [Aegilops tauschii]
Length=123

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 58/100 (58%), Gaps = 8/100 (8%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGT  332
            AEA  + V D+  WS     WP GK FK+GD+L+F YD + H+V  VS   Y +C     
Sbjct  25   AEAAVFNVGDRGGWSFNTNSWPTGKHFKAGDVLVFKYDATAHDVA-VSAAGYKACAKPAN  83

Query  333  ---ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
               +  SG D V L  GTNYFIC   GHC+ GMK+A+TA 
Sbjct  84   GAKVYKSGADRVILARGTNYFICSIPGHCQSGMKIAVTAA  123



>ref|XP_006493535.1| PREDICTED: uncharacterized protein LOC102628714 [Citrus sinensis]
Length=360

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 11/113 (10%)
 Frame = +3

Query  129  VIAIVTMLL----CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNV  284
            +IA+VT+LL    C    A T+ V D   W     +WP GK+FK GDIL FNYDP  HNV
Sbjct  245  IIAVVTVLLLLMHCNIGSATTFKVGDDGGWVFGVQNWPQGKTFKCGDILEFNYDPQRHNV  304

Query  285  VIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKG-GMKMAI  434
            +IV +E ++SC  +       +G D + L  G N+FICG   HC   GMK+ I
Sbjct  305  IIVDQEGHDSCKPASDAKKFQTGKDQIVLNHGKNFFICGVPTHCSDHGMKLEI  357



>gb|EMS52226.1| Basic blue protein [Triticum urartu]
Length=161

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 58/100 (58%), Gaps = 6/100 (6%)
 Frame = +3

Query  159  GFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS  326
            G A A TY V D   WS     WPNGK F++GD+L+F Y+P +HNVV V ++ YN CT  
Sbjct  61   GVASAATYYVGDVGGWSLSSGSWPNGKQFRAGDVLVFRYNPLMHNVVAVGEDGYNGCTTP  120

Query  327  --GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                   SG+D VTL  G N F+C    HC  GMKM + A
Sbjct  121  PGSRTYESGNDAVTLARGANRFMCTRFYHCNFGMKMVVNA  160



>ref|NP_001051043.1| Os03g0709100 [Oryza sativa Japonica Group]
 gb|AAX95669.1| Plastocyanin-like domain, putative [Oryza sativa Japonica Group]
 gb|ABF98492.1| Plastocyanin-like domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12957.1| Os03g0709100 [Oryza sativa Japonica Group]
 gb|EAY91591.1| hypothetical protein OsI_13226 [Oryza sativa Indica Group]
 gb|EAZ28324.1| hypothetical protein OsJ_12299 [Oryza sativa Japonica Group]
 dbj|BAG88030.1| unnamed protein product [Oryza sativa Japonica Group]
Length=131

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = +3

Query  156  CGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI  323
            CG A+A TY V D   WS     WP+GK F +GDIL+F Y P +HNVV V ++ Y  C  
Sbjct  30   CGVADAATYYVGDSLGWSLGSGSWPSGKKFHAGDILVFRYLPWMHNVVAVDEDGYADCNP  89

Query  324  S--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                    SG D+V L  G N+F+C   GHC  GMKM +TA
Sbjct  90   PPFSRYYTSGSDSVRLARGDNFFVCTRYGHCNLGMKMVVTA  130



>ref|XP_011087776.1| PREDICTED: basic blue protein-like [Sesamum indicum]
Length=131

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (59%), Gaps = 7/123 (6%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLL-CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFN  260
            M +   + ++ +I +++ML+    A+A+ YTV     W    S W  GK FK+GD L+F 
Sbjct  5    MSEEKGYANLAMIMVLSMLIYIHSADAKIYTVGGSTGWIFNVSGWETGKPFKAGDKLVFK  64

Query  261  YDPSVHNVVIVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAI  434
            Y    HNVV+V K +Y+SC++        SG+D +TL  GTNYFICG  GHC  GMK+A 
Sbjct  65   YAVGRHNVVVVDKGSYDSCSVPAGAPTYGSGNDKLTLKEGTNYFICGFTGHCHAGMKIAA  124

Query  435  TAT  443
             A 
Sbjct  125  NAA  127



>gb|KHG30077.1| Basic blue [Gossypium arboreum]
Length=126

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 64/111 (58%), Gaps = 11/111 (10%)
 Frame = +3

Query  141  VTMLLCGF-----AEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIV  293
            V +L C        +A TYTV     W    + WP GK F++GD L+F YD ++HNVV V
Sbjct  15   VALLFCFLFFWENVDAATYTVGGSNGWTFNMATWPRGKRFRAGDTLLFEYDATIHNVVAV  74

Query  294  SKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            ++  Y SC T +G  +  SG D V L  G NYFIC   GHC+ GMK+AI A
Sbjct  75   NRGGYRSCITPAGAKVYKSGKDEVKLGKGMNYFICNIAGHCESGMKIAINA  125



>ref|XP_006650478.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=132

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 12/117 (10%)
 Frame = +3

Query  126  IVIAIVTMLLC------GFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSV  275
            + +A ++ + C      G A+A TY V D   WS     WP+GK F +GD+L+F Y P +
Sbjct  15   VAVAFLSAVSCFLLSGVGVADAATYYVGDSLGWSLGSGSWPSGKKFHAGDVLVFRYLPWM  74

Query  276  HNVVIVSKENYNSC--TISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            HNVV V ++ Y  C    S     SG D+V L  G N+F+C   GHC  GMKM ITA
Sbjct  75   HNVVAVDEDGYADCNPPPSSRYYTSGSDSVKLARGDNFFVCTRYGHCNLGMKMVITA  131



>ref|XP_007201673.1| hypothetical protein PRUPE_ppa022496mg [Prunus persica]
 gb|EMJ02872.1| hypothetical protein PRUPE_ppa022496mg [Prunus persica]
Length=128

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 68/117 (58%), Gaps = 6/117 (5%)
 Frame = +3

Query  111  THDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVH  278
            T     +   + +++    +  T+TV   + W+    +W +GK FK+GDIL+FNYDPS H
Sbjct  12   TEKPATIFLFLFLIIVSAQKTTTFTVGGNSGWTFNVENWTDGKKFKAGDILVFNYDPSSH  71

Query  279  NVVIVSKENYNSCTISGT--ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
            +V +V    + SC+ S      ++G D V L+ G NYFIC   GHC GG+K+++ A+
Sbjct  72   DVAVVDANEFTSCSASSNSKTFSTGKDRVKLSKGLNYFICTVPGHCNGGVKISVNAS  128



>ref|XP_006656866.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=132

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 67/125 (54%), Gaps = 11/125 (9%)
 Frame = +3

Query  99   GKMSTHDSIIVIAIVTMLLC-GFAEAE----TYTVEDKAKWSD----WPNGKSFKSGDIL  251
            G+ S    +++  +V  LL   F  AE    TY V D   W      W  GK+F +GD+L
Sbjct  7    GRSSASGVVLLSCLVVALLTESFPAAEAAGTTYYVGDAGGWGRNLDWWLAGKTFYAGDVL  66

Query  252  IFNYDPSVHNVVIVSKENYNSCTI--SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMK  425
            +F Y+   H+V +V  + Y  C +  S  +L SG+D VTL  G NYFICG   HC  GMK
Sbjct  67   VFKYNREYHDVAVVGGKGYRRCKVPRSTVVLRSGYDQVTLRRGNNYFICGMPAHCDAGMK  126

Query  426  MAITA  440
            +A+ A
Sbjct  127  LAVKA  131



>gb|ADV57643.1| copper binding protein 8 [Gossypium hirsutum]
Length=126

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 63/111 (57%), Gaps = 11/111 (10%)
 Frame = +3

Query  141  VTMLLCGFA-----EAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIV  293
            V +L C        +A TYTV     W    + WP GK F++GD L F YD ++HNVV V
Sbjct  15   VALLFCFLVFWENVDAATYTVGGSNGWTFNMATWPRGKRFRAGDTLFFKYDATIHNVVAV  74

Query  294  SKENYNSC-TISGT-ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            ++  Y SC T +G  +  SG D V L  G NYFIC   GHC+ GMK+AI A
Sbjct  75   NRGGYRSCITPAGAKVYKSGKDEVKLGKGMNYFICNIAGHCESGMKIAINA  125



>ref|XP_008800754.1| PREDICTED: basic blue protein-like [Phoenix dactylifera]
Length=126

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--S  326
            AE+  YTV     WS     WPNGK F++GD+L+F Y+P  HNV  V+   YN CT+   
Sbjct  28   AESAIYTVGGSGGWSLNTVSWPNGKRFRAGDVLVFKYNPKAHNVAAVNAAGYNRCTMPRG  87

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
              I  SG+D++ L  G NYFIC   GHC+ GMK+A+TA 
Sbjct  88   SKIFKSGNDSIRLRRGRNYFICSFVGHCQAGMKIAVTAA  126



>ref|XP_002464009.1| hypothetical protein SORBIDRAFT_01g010520 [Sorghum bicolor]
 gb|EER91007.1| hypothetical protein SORBIDRAFT_01g010520 [Sorghum bicolor]
Length=130

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 57/96 (59%), Gaps = 6/96 (6%)
 Frame = +3

Query  171  AETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS--GT  332
            A TY V D   WS     WPNGK F++GD L+F Y P +HNVV VS++ YN CT      
Sbjct  34   ATTYYVGDSNGWSFSSPSWPNGKHFRAGDTLVFRYIPWIHNVVAVSEDGYNGCTTPPGSR  93

Query  333  ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
               SG D+VTL  G N+FIC   GHC  GMK+ + A
Sbjct  94   TYTSGADSVTLAKGDNFFICTRFGHCNLGMKLVVYA  129



>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein
Length=96

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 6/93 (6%)
 Frame = +3

Query  180  YTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSC-TISGT-ILN  341
            Y V     W+     WP GK F++GDIL+FNY+PS+HNVV+V++  +++C T +G  +  
Sbjct  3    YVVGGSGGWTFNTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAGAKVYT  62

Query  342  SGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            SG D + L  G +YFIC   GHC+ GMK+A+ A
Sbjct  63   SGRDQIKLPKGQSYFICNFPGHCQSGMKIAVNA  95



>ref|NP_001148389.1| LOC100282003 precursor [Zea mays]
 gb|ACG31278.1| chemocyanin precursor [Zea mays]
Length=133

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 58/98 (59%), Gaps = 7/98 (7%)
 Frame = +3

Query  171  AETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS---G  329
            A +Y V D   W      W  G++F++GD+L+F+Y+ +VH+V +V+   Y SC +     
Sbjct  36   AASYMVGDYGGWKFNVDRWAKGRTFRAGDVLVFSYNRAVHDVAVVNAAAYRSCAVPNKGA  95

Query  330  TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             +L SG D V L  GT+YF C   GHC+ GMK+A+ A 
Sbjct  96   RVLRSGRDKVRLGRGTHYFACTVRGHCQAGMKLAVRAV  133



>gb|ACN37046.1| unknown [Zea mays]
 gb|AFW73253.1| chemocyanin [Zea mays]
Length=135

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 58/98 (59%), Gaps = 7/98 (7%)
 Frame = +3

Query  171  AETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS---G  329
            A +Y V D   W      W  G++F++GD+L+F+Y+ +VH+V +V+   Y SC +     
Sbjct  38   AASYMVGDYGGWKFNVDRWAKGRTFRAGDVLVFSYNRAVHDVAVVNAAAYRSCAVPNKGA  97

Query  330  TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             +L SG D V L  GT+YF C   GHC+ GMK+A+ A 
Sbjct  98   RVLRSGRDKVRLGRGTHYFACTVRGHCQAGMKLAVRAV  135



>ref|XP_004144257.1| PREDICTED: basic blue protein-like [Cucumis sativus]
Length=106

 Score = 90.9 bits (224),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = +3

Query  168  EAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSC-TISGT  332
            EA  Y V     W+     WP GK F++GDIL FNY+P VHNVV+V++  +++C T +G 
Sbjct  9    EAAVYDVGGSGGWTFNTESWPKGKRFRAGDILRFNYNPLVHNVVVVNQGGFSTCNTPAGA  68

Query  333  -ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             +  SG D + L  G +YFIC   GHC+ GMK+A+ A
Sbjct  69   KVYKSGSDQIKLPKGQSYFICNFPGHCQSGMKIAVNA  105



>ref|XP_006349398.1| PREDICTED: chemocyanin-like [Solanum tuberosum]
Length=122

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVI  290
            ++V+ +  +L    + A T+   D   W    + WPNGK+F +GD++ F Y   +HNVV 
Sbjct  11   VLVMMLCILLQSNISNAATFPAGDDKGWGFNMNGWPNGKTFNTGDVIEFKYKVDMHNVVK  70

Query  291  VSKENYNSCTIS-GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            VSK  Y+SC  S G + NSG D + L  GT+YFIC    HC  G+K AITA
Sbjct  71   VSKGEYDSCKTSGGQVYNSGDDKIPLEKGTSYFICTIGPHCSEGVKTAITA  121



>ref|XP_011087775.1| PREDICTED: basic blue protein-like [Sesamum indicum]
Length=130

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG-  329
            A A +YTV D + W    + W  GK FK+GD LIF Y    HN V+V K +Y+SC++   
Sbjct  32   ANATSYTVGDSSGWTFNVAGWEKGKPFKAGDTLIFKYVVGQHNTVVVDKASYDSCSVPAG  91

Query  330  -TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                +SG+DN+TL  G NY ICG  GHC+ GMK+A  A
Sbjct  92   APTYSSGNDNLTLKKGPNYLICGIRGHCEAGMKIAPIA  129



>dbj|BAJ96430.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=138

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 15/120 (13%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAE-----AETYTVEDKAKWSD-----WPNGKSFKSGDILIFNYDPSV  275
            +V+  V + + G A        TY V D   W+      WPNGK+F +GD+L+F YD  +
Sbjct  18   VVLLCVLLPITGAAAMAGRAPRTYVVGDDKGWARDLNSWWPNGKTFYAGDVLVFKYDKEL  77

Query  276  HNVVIVSKENYNSCTI-----SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            H+V ++  + Y  C +        ++ +G+D VTL  G NYFICG  GHC   MK+A+ A
Sbjct  78   HDVTVLGGKGYRRCEVPRHSSKSWVMRTGNDQVTLRRGNNYFICGLPGHCDKNMKLAVKA  137



>ref|XP_010905831.1| PREDICTED: basic blue protein-like [Elaeis guineensis]
Length=126

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 63/123 (51%), Gaps = 8/123 (7%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKW------SDWPNGKSFKSGDILIF  257
            MG+ S   ++ +  ++ M       A T+ V D   W      +DW N  +F +GD L+F
Sbjct  3    MGRGSCTTAVFLALLLIMCAPFHTLAATHVVGDSQGWGFSLSYADWANENTFAAGDTLVF  62

Query  258  NYDPSVHNVVIVSKENYNSCTISGT--ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMA  431
            NY P  HNVV VS   Y +C  S T     +G+D  TL  G NYFIC   GHC  GMK+ 
Sbjct  63   NYQPGAHNVVPVSAAGYKTCKASDTSKAATTGNDKFTLKKGANYFICSLPGHCAAGMKLQ  122

Query  432  ITA  440
            + A
Sbjct  123  VVA  125



>ref|NP_001130720.1| uncharacterized protein LOC100191824 precursor [Zea mays]
 gb|ACF79053.1| unknown [Zea mays]
 tpg|DAA47751.1| TPA: blue copper protein [Zea mays]
Length=178

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (58%), Gaps = 8/119 (7%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS------DWPNGKSFKSGDILIFNYD  266
            M+   S ++  +V +     A A T+TV D + WS      +W +GK+F  GD L+FN+ 
Sbjct  1    MAASRSALITLLVLVSSVAAASATTFTVGDSSGWSRSVNYDNWASGKTFTDGDQLVFNFA  60

Query  267  PSVHNVVIVSKENYNSC--TISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
               H+VV V K  Y+ C  T +   + +G   V LTSGT+Y+ICG  GHC GGMK+A+T
Sbjct  61   TGNHDVVEVDKSGYDGCSTTNAANTIQNGPATVNLTSGTHYYICGISGHCSGGMKLAVT  119



>ref|NP_001141104.1| uncharacterized protein LOC100273187 precursor [Zea mays]
 gb|ACF85403.1| unknown [Zea mays]
 gb|ACG38124.1| basic blue protein precursor [Zea mays]
 tpg|DAA50955.1| TPA: basic blue protein [Zea mays]
Length=127

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 56/96 (58%), Gaps = 6/96 (6%)
 Frame = +3

Query  171  AETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS--GT  332
            A TY V D   WS     WPNGK F++GD L+F Y P +HNVV V ++ YN CT      
Sbjct  31   ATTYYVGDSNGWSFSSPSWPNGKHFRAGDTLVFRYIPWIHNVVAVDEDGYNGCTTPPGSR  90

Query  333  ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
               SG D+VTL  G N+FIC   GHC  GMK+ + A
Sbjct  91   TYTSGADSVTLARGDNFFICTRFGHCNLGMKLVVYA  126



>gb|EMS61550.1| Chemocyanin [Triticum urartu]
Length=160

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (58%), Gaps = 10/99 (10%)
 Frame = +3

Query  174  ETYTVEDKAKW-----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI-----  323
             TY V D   W     S WPNGK+F +GD+L+F YD  +H+V +V  + Y  C +     
Sbjct  61   RTYVVGDDKGWGRDLNSWWPNGKTFYAGDVLVFKYDKELHDVSVVGGKGYQRCEVPRHSA  120

Query  324  SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
               ++ +G+D VTL  G NYFICG  GHC   MK+A+ A
Sbjct  121  KSWVMRTGNDQVTLRRGNNYFICGLPGHCDKNMKLAVKA  159



>ref|XP_010692866.1| PREDICTED: basic blue protein-like [Beta vulgaris subsp. vulgaris]
Length=126

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = +3

Query  180  YTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCT--ISGTILN  341
            YTV     W+    +W  GK FK+GD+L FNYD + HNVV VSK+ Y+SC+      +  
Sbjct  33   YTVGGAGGWAFNVNNWSTGKPFKAGDMLAFNYDKTTHNVVPVSKKGYDSCSSPRGAKVYQ  92

Query  342  SGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            SG D + L+ G +YFIC   GHC+ GMK+AI A
Sbjct  93   SGKDRIKLSKGPSYFICTLPGHCQSGMKIAINA  125



>dbj|BAK06251.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=122

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 62/98 (63%), Gaps = 7/98 (7%)
 Frame = +3

Query  168  EAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG--  329
              +  TV D   WS     W NGK  +SGD+L+F Y+PS+HNVV V + +YNSCT+SG  
Sbjct  25   HGKELTVGDNKGWSFGVSGWENGKRIQSGDVLVFKYNPSMHNVVQVGEGDYNSCTVSGPS  84

Query  330  TILNSGHDNVTLTSGTN-YFICGAEGHCKGGMKMAITA  440
                SG+D++ L  G   +F+C   GHC+ GMK+A+TA
Sbjct  85   RTYTSGNDHIQLAHGGKAFFLCSVPGHCQKGMKIAVTA  122



>ref|XP_006647843.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=138

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 63/116 (54%), Gaps = 16/116 (14%)
 Frame = +3

Query  141  VTMLLCGF----------AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVH  278
            V +L+ GF          A A  YTV D   W      W  GK+F++GD+L F Y+ +VH
Sbjct  22   VQLLMVGFLVMSAAPLAAAAAARYTVGDSGGWRFYAEGWAKGKTFRAGDVLEFKYNAAVH  81

Query  279  NVVIVSKENYNSCTISGTI--LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +V  V   +Y SC     +  + SGHD VTL  G +YFIC   GHCK GMK+A+ A
Sbjct  82   DVAAVDLASYRSCVAPKGVRKMRSGHDKVTLHKGAHYFICTEPGHCKAGMKLAVRA  137



>sp|P00303.1|BABL_CUCSA RecName: Full=Basic blue protein; AltName: Full=CBP; AltName: 
Full=Cusacyanin; AltName: Full=Plantacyanin [Cucumis sativus]
 prf||0811264A protein,blue
Length=96

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 60/93 (65%), Gaps = 6/93 (6%)
 Frame = +3

Query  180  YTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSC-TISGT-ILN  341
            Y V     W+     WP GK F++GDIL+FNY+P +HNVV+V++  +++C T +G  +  
Sbjct  3    YVVGGSGGWTFNTESWPKGKRFRAGDILLFNYNPXMHNVVVVNQGGFSTCNTPAGAKVYT  62

Query  342  SGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            SG D + L  G +YFIC   GHC+ GMK+A+ A
Sbjct  63   SGRDQIKLPKGQSYFICNFPGHCQSGMKIAVNA  95



>ref|XP_006345294.1| PREDICTED: mavicyanin-like [Solanum tuberosum]
Length=122

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 73/127 (57%), Gaps = 14/127 (11%)
 Frame = +3

Query  87   LLFMGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS------DWPNGKSFKSGDI  248
            + F GK     +++V+ +V M   G A A  Y V D A W+      +W   K F++GD 
Sbjct  1    MTFFGK-----AMLVVLMVMMAASGSAMATVYQVGDLAGWTFNYNYNEWAFFKQFQAGDT  55

Query  249  LIFNYDPSVHNVVIVSKENYNSCTISG-TILNSGHDNVTLTS--GTNYFICGAEGHCKGG  419
            L+FNYDP +HNV+ V   +YNSCT +     NSG D++TL +  G  +F+CG  GHC  G
Sbjct  56   LVFNYDPQLHNVMQVDINDYNSCTSNPIATFNSGSDSITLDTPDGDYFFLCGIPGHCASG  115

Query  420  MKMAITA  440
            +K+ I +
Sbjct  116  LKIHIKS  122



>ref|XP_006349399.1| PREDICTED: chemocyanin-like [Solanum tuberosum]
Length=122

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 69/122 (57%), Gaps = 11/122 (9%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLC-----GFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIF  257
            MS  + + ++A   M+LC       ++A+T+   D   W    + WPNGK+FK+GD++ F
Sbjct  1    MSGVNKVTIVAFA-MMLCILLQTNISKADTFLAGDANGWGFQLNGWPNGKTFKTGDVIKF  59

Query  258  NYDPSVHNVVIVSKENYNSCT-ISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAI  434
             Y    HNVV V +  ++SC    G    SG D +TLT GT+YFIC    HC  G+K A+
Sbjct  60   KYPAGAHNVVKVDQAGFDSCNGAGGQAFTSGDDKITLTQGTSYFICTIGPHCANGIKAAV  119

Query  435  TA  440
            TA
Sbjct  120  TA  121



>gb|EMT07777.1| Blue copper protein [Aegilops tauschii]
Length=168

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 67/112 (60%), Gaps = 10/112 (9%)
 Frame = +3

Query  129  VIAIVTMLLCGFAEAETYTV-EDKAKWS------DWPNGKSFKSGDILIFNYDPSVHNVV  287
            ++A+  M +   A A  Y V E    W        W + ++FK+ D ++F Y P  H+V+
Sbjct  7    ILAVAVMAILSTASAAIYNVGEPGGAWDLSTNYGTWASSRNFKADDQIVFKYSPQAHDVL  66

Query  288  IVSKENYNSCTISGTI--LNSGHDNVTLT-SGTNYFICGAEGHCKGGMKMAI  434
             VSK +Y+SC+ +  I  LNSG+D VTLT SGT YFICG  GHC GGMK+ I
Sbjct  67   EVSKADYDSCSTASPITTLNSGNDIVTLTASGTRYFICGFPGHCAGGMKVKI  118



>dbj|BAD53512.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 dbj|BAD54387.1| putative chemocyanin precursor [Oryza sativa Japonica Group]
 gb|EAZ36570.1| hypothetical protein OsJ_20909 [Oryza sativa Japonica Group]
Length=150

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 57/100 (57%), Gaps = 8/100 (8%)
 Frame = +3

Query  165  AEAETYTVEDKAKWSD----WPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG-  329
            A  +TY V D A W      W  GK+F +GD+L+F Y+   H+V +V  + Y  C +   
Sbjct  39   AGGKTYYVGDAAGWGRNLDWWLAGKTFYAGDVLVFKYNKEYHDVAVVGGKGYRRCKVPRN  98

Query  330  ---TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                +L +G+D VTL  G NYFICG  GHC  GMK+A+ A
Sbjct  99   KDTAVLRTGYDQVTLRRGNNYFICGMPGHCDAGMKLAVKA  138



>gb|AFK40327.1| unknown [Lotus japonicus]
Length=125

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS-G  329
            A A TYTV D+  W    ++W  GKSF++GDIL+FNY P  HNVV+V    Y +C  + G
Sbjct  27   AYATTYTVGDQYGWKFFITNWTEGKSFEAGDILVFNYSPLNHNVVVVDANGYKNCNAAGG  86

Query  330  TILNSGHDNVTLTSGTNYFICGAEGHCK-GGMKMAITA  440
             + NSGHD++TL  G +Y+I      C+ G MKMA+ A
Sbjct  87   KVYNSGHDSITLPKGQSYYISSFTDQCQYGSMKMAVYA  124



>ref|XP_006349400.1| PREDICTED: chemocyanin-like [Solanum tuberosum]
Length=122

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 69/122 (57%), Gaps = 11/122 (9%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLC-----GFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIF  257
            MS  + + ++A   M+LC       ++A+T+   D   W    + WPNGK+FK+GD++ F
Sbjct  1    MSGVNKVTIVAFA-MMLCILLQTNISKADTFLAGDANGWGFQLNGWPNGKTFKTGDVIEF  59

Query  258  NYDPSVHNVVIVSKENYNSCT-ISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAI  434
             Y    HNVV V +  ++SC    G    SG D +TLT GT+YFIC    HC  G+K A+
Sbjct  60   KYPAGAHNVVKVDQAGFDSCNGAGGQAFTSGDDKITLTQGTSYFICTIGPHCANGIKAAV  119

Query  435  TA  440
            TA
Sbjct  120  TA  121



>ref|XP_011087774.1| PREDICTED: basic blue protein-like [Sesamum indicum]
Length=130

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS--  326
            A A +YTV D + W    + W  GK FK+GD LIF Y    HN V+V K +Y+SC++   
Sbjct  32   ANATSYTVGDSSGWTFNVAGWEKGKPFKAGDTLIFKYVVGQHNTVVVDKASYDSCSVPAG  91

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                +SG+D +TL  G NY ICG  GHC+ GMK+A  A
Sbjct  92   APTYSSGNDKLTLKKGPNYLICGIRGHCEAGMKIAPVA  129



>gb|EAZ00445.1| hypothetical protein OsI_22465 [Oryza sativa Indica Group]
Length=138

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 57/100 (57%), Gaps = 8/100 (8%)
 Frame = +3

Query  165  AEAETYTVEDKAKWSD----WPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG-  329
            A  +TY V D A W      W  GK+F +GD+L+F Y+   H+V +V  + Y  C +   
Sbjct  38   AGGKTYYVGDAAGWGRNLDWWLAGKTFYAGDVLVFKYNKEYHDVAVVGGKGYRRCKVPRN  97

Query  330  ---TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                +L +G+D VTL  G NYFICG  GHC  GMK+A+ A
Sbjct  98   KDTVVLRTGYDQVTLRRGNNYFICGMPGHCDAGMKLAVKA  137



>ref|XP_006349401.1| PREDICTED: chemocyanin-like [Solanum tuberosum]
Length=122

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 69/122 (57%), Gaps = 11/122 (9%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLC-----GFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIF  257
            MS  + + ++A   M+LC       ++A+T+   D   W    + WPNGK+FK+GD++ F
Sbjct  1    MSGVNKVTIVAFA-MMLCILLQTNISKADTFLAGDANGWGFQLNGWPNGKTFKTGDVIEF  59

Query  258  NYDPSVHNVVIVSKENYNSCT-ISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAI  434
             Y    HNVV V +  ++SC    G    SG D +TLT GT+YFIC    HC  G+K A+
Sbjct  60   KYPAGAHNVVKVDQAGFDSCNGAGGQAFTSGDDKITLTQGTSYFICTIGPHCANGVKAAV  119

Query  435  TA  440
            TA
Sbjct  120  TA  121



>gb|EMT33682.1| Blue copper protein [Aegilops tauschii]
Length=171

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 68/113 (60%), Gaps = 10/113 (9%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYTVEDKAK-------WSDWPNGKSFKSGDILIFNYDPSVHNV  284
            I++A+  M +   A A  Y V +  +       +S W + ++F+  D ++F Y P  H+V
Sbjct  7    ILLAVAAMAIMSTASAAIYNVGEPGRAWDLGTNYSTWASSRTFQPDDQIVFKYSPQAHDV  66

Query  285  VIVSKENYNSCTISGTI--LNSGHDNVTLT-SGTNYFICGAEGHCKGGMKMAI  434
            + VSK +Y+SC+ +  I  LNSG+D + LT +GT YFICG  GHC GGMK+ I
Sbjct  67   LEVSKADYDSCSTATPIATLNSGNDVIALTVTGTRYFICGFPGHCAGGMKVKI  119



>gb|EPS66274.1| hypothetical protein M569_08503 [Genlisea aurea]
Length=127

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 62/113 (55%), Gaps = 6/113 (5%)
 Frame = +3

Query  123  IIVIAIVTMLLCGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVI  290
            I ++ +   LL G  +A T  V   + W    S W NGK FK GDIL+F Y+P  HNVV+
Sbjct  15   IPLVVLTAFLLSGEVDAVTCIVGGSSGWTFGVSSWTNGKHFKVGDILVFKYNPKYHNVVV  74

Query  291  VSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
             + ++Y  CT      +  SG D + L  GT Y +C   GHCK GM +A TA+
Sbjct  75   TNSKDYPICTAPAGAKVYKSGDDQIKLVKGTTYILCTVPGHCKDGMHIAATAS  127



>ref|XP_004977875.1| PREDICTED: chemocyanin-like [Setaria italica]
Length=113

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 7/98 (7%)
 Frame = +3

Query  168  EAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIV-SKENYNSCTI--S  326
            ++  + V D A WS     WPN K FK+GD+L+F+Y    HNVV V S   Y+ C +  +
Sbjct  15   DSRLWPVGDSAGWSFGVLGWPNYKPFKAGDVLLFSYKHGAHNVVQVNSVAQYSMCEVPRN  74

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
             T+ +SG+D VTL  G ++F+CG  GHC+ GMK+A+TA
Sbjct  75   ATVWSSGNDRVTLARGMSFFVCGIPGHCQKGMKIAVTA  112



>gb|EMT07779.1| Mavicyanin [Aegilops tauschii]
Length=170

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 10/113 (9%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYTV-EDKAKWS------DWPNGKSFKSGDILIFNYDPSVHNV  284
            I++A+ +M +   A A  Y V E    W        W + ++F++GD ++F Y P  H+V
Sbjct  7    ILLAMASMAILSTASAAIYNVGEPGGAWDLSTNYGTWASSRNFQTGDQIVFKYSPQAHDV  66

Query  285  VIVSKENYNSCTISG--TILNSGHDNVTL-TSGTNYFICGAEGHCKGGMKMAI  434
            + VSK +Y+SC+ +   T  NSG+D VTL T+GT+Y+ICG  GHC GGMK+ I
Sbjct  67   LEVSKADYDSCSTASPVTTFNSGNDVVTLTTTGTSYYICGFPGHCAGGMKVKI  119



>ref|XP_004230514.1| PREDICTED: basic blue protein-like [Solanum lycopersicum]
Length=122

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 65/115 (57%), Gaps = 10/115 (9%)
 Frame = +3

Query  126  IVIAIVTMLLCGF-----AEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVH  278
            + I    M+LC F     ++A+T+       W    + WPNGK+FK+GD++ F Y    H
Sbjct  7    VTIVAFAMMLCIFLQTNISKADTFLAGGANGWGFQLNGWPNGKTFKTGDVIEFKYPAGAH  66

Query  279  NVVIVSKENYNSCT-ISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            NVV V +  +NSC    G + +SG D +TLT GT+YFIC    HC  G+K A+ A
Sbjct  67   NVVKVDQAGFNSCNGAGGQVFSSGDDKITLTKGTSYFICTIGQHCANGVKAAVIA  121



>ref|XP_003571173.1| PREDICTED: basic blue protein-like [Brachypodium distachyon]
Length=123

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 72/121 (60%), Gaps = 7/121 (6%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNY  263
            M ++S    ++ + I        A ++ +TV D   WS     W +G +  +GD L+F Y
Sbjct  1    MARISIGTMVLGLLIAICCTATIAHSKEWTVGDAKGWSFRVAGWESGLAIHTGDTLVFKY  60

Query  264  DPSVHNVVIVSKENYNSCTISGTI---LNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAI  434
            +P  HNVV V +++YN+C++SG +    NSG+D++ +  G ++FIC   GHC+ GMK+AI
Sbjct  61   NPKEHNVVQVDEKSYNACSVSGRLSGDYNSGNDHIRVGRGKSFFICSFAGHCEQGMKIAI  120

Query  435  T  437
            T
Sbjct  121  T  121



>ref|NP_001152010.1| blue copper protein precursor [Zea mays]
 gb|ACG45379.1| blue copper protein precursor [Zea mays]
Length=174

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 10/120 (8%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAEAETYTVED-------KAKWSDWPNGKSFKSGDILIFNY  263
            M+T    +V      +L G A A TY V +       +  +  W + K F  GD ++F Y
Sbjct  1    MATSRLALVSVFAAAVLLGMASAATYNVGEPGGSWDLRTNYGTWVSSKRFHPGDQIVFKY  60

Query  264  DPSVHNVVIVSKENYNSCTISGTIL--NSGHDNVTLTS-GTNYFICGAEGHCKGGMKMAI  434
             P  H+VV V+K +Y+SC+I+  +   NSG+D + L S GT YFICG  GHC  GMK+ I
Sbjct  61   SPQAHDVVEVNKADYDSCSIASPVATHNSGNDAIALASPGTRYFICGFPGHCDAGMKIQI  120



>ref|XP_004149963.1| PREDICTED: basic blue protein-like [Cucumis sativus]
 ref|XP_004160463.1| PREDICTED: basic blue protein-like [Cucumis sativus]
 gb|KGN57569.1| hypothetical protein Csa_3G214580 [Cucumis sativus]
Length=124

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 63/113 (56%), Gaps = 13/113 (12%)
 Frame = +3

Query  141  VTMLLCGF------AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVV-  287
            +T+LLC F      A+A+ YTV D   W+     W  GK F++GDI++F Y    HNVV 
Sbjct  11   ITLLLCIFLIQSEIAQAKVYTVGDALGWTFNVNTWTKGKIFRAGDIIVFKYPRMAHNVVS  70

Query  288  IVSKENYNSCTIS--GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            + +K  YN C       +  +G D + L  G NYFIC   GHCK GMK+AI A
Sbjct  71   LKNKVAYNWCLKPKGSKVYQTGKDRIKLVKGYNYFICSYPGHCKAGMKIAIKA  123



>gb|EMS50846.1| Blue copper protein [Triticum urartu]
Length=171

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 10/113 (9%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYTV-EDKAKWS------DWPNGKSFKSGDILIFNYDPSVHNV  284
            I++A+  M +   A A TY V E    W        W + ++F++ D ++F Y P  H+V
Sbjct  7    ILLAMAAMAVLSTASAATYNVGEPGGAWDLSTNYGTWASSRNFQTSDQIVFKYSPQAHDV  66

Query  285  VIVSKENYNSCTISGTI--LNSGHDNVTLTS-GTNYFICGAEGHCKGGMKMAI  434
            + VSK +Y+SC+ +  I   NSG+D VT T+ GT YFICG  GHC GGMK+ I
Sbjct  67   LEVSKADYDSCSTANPITTFNSGNDVVTFTATGTRYFICGFPGHCAGGMKVKI  119



>gb|ACG40270.1| blue copper protein precursor [Zea mays]
Length=176

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 8/119 (7%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAEAETYTVEDKAKWS------DWPNGKSFKSGDILIFNYD  266
            M+   S ++  +V +     A A T+TV D + WS      +W +GK+F  GD L+FN+ 
Sbjct  1    MAASRSALITLLVLVSSVAAASATTFTVGDSSGWSRSVNYDNWASGKTFTDGDQLVFNFA  60

Query  267  PSVHNVVIVSKENYNSC--TISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
               H+VV V K  Y+ C  T +   + +G   V LTSGT+Y+ICG  GHC  GMK+A+T
Sbjct  61   TGNHDVVEVDKSGYDGCSTTNAANTIQNGPATVNLTSGTHYYICGFTGHCSAGMKLAVT  119



>ref|XP_008789430.1| PREDICTED: basic blue protein-like [Phoenix dactylifera]
Length=126

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 65/125 (52%), Gaps = 12/125 (10%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCG--FAEAETYTVEDKAKW------SDWPNGKSFKSGDIL  251
            MG+ S   +I V   + ++LC      A T+ V D   W      +DW N K+F +GD L
Sbjct  3    MGRGSC--TIAVFLALFLILCAPFHTLAATHVVGDSQGWGFSMSYTDWANEKTFAAGDTL  60

Query  252  IFNYDPSVHNVVIVSKENYNSCTISGT--ILNSGHDNVTLTSGTNYFICGAEGHCKGGMK  425
            +FNY    HNVV VS   Y +C  SG+     +G D  TL  G NYFIC   GHC  GM+
Sbjct  61   VFNYQAGAHNVVPVSAAGYKTCKASGSSKAATTGDDQFTLKKGANYFICSFPGHCAAGMR  120

Query  426  MAITA  440
            + + A
Sbjct  121  LQVIA  125



>ref|XP_003560827.1| PREDICTED: basic blue protein-like [Brachypodium distachyon]
Length=132

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 66/121 (55%), Gaps = 10/121 (8%)
 Frame = +3

Query  108  STHDSIIVIAIVTMLLCGFAEAETYTVEDKAKW-----SDWPNGKSFKSGDILIFNYDPS  272
            +T  +++  A++  LL   A A+TY V D A W     S W  GK+F +GD+ +F YD  
Sbjct  11   TTASALVAGAVLLCLLLPTAMAKTYMVGDGAGWTKNLESTWLPGKTFYAGDVFVFKYDKE  70

Query  273  VHNVVIVSKENYNSCTISGT-----ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
             H+V +V  + Y  C          ++ +G+D VTL  G+N+FICG   HC   MK+A+ 
Sbjct  71   KHDVTVVGGKGYARCKAPRNSTHSWVMRTGNDQVTLRRGSNFFICGQPDHCAKNMKLAVK  130

Query  438  A  440
            A
Sbjct  131  A  131



>gb|ACN28394.1| unknown [Zea mays]
 tpg|DAA60662.1| TPA: blue copper protein [Zea mays]
Length=174

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 65/120 (54%), Gaps = 10/120 (8%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLLCGFAEAETYTVEDKA-------KWSDWPNGKSFKSGDILIFNY  263
            M+T    +V      +L G A A TY V + A        +  W + K F  GD  +F Y
Sbjct  1    MATSRLALVSVFAAAVLLGMASAATYNVGEPAGSWDLRTNYGTWVSSKRFHPGDQTVFKY  60

Query  264  DPSVHNVVIVSKENYNSCTISGTIL--NSGHDNVTLTS-GTNYFICGAEGHCKGGMKMAI  434
             P  H+VV V+K +Y+SC+I+  +   NSG+D + L S GT YFICG  GHC  GMK+ I
Sbjct  61   SPQAHDVVEVNKADYDSCSIASPVATHNSGNDAIALASPGTRYFICGFPGHCDAGMKIQI  120



>dbj|BAK00202.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 66/113 (58%), Gaps = 10/113 (9%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYTV-EDKAKWS------DWPNGKSFKSGDILIFNYDPSVHNV  284
            I++A+ TM +   A A  Y V E    W        W + ++F   D ++F Y P  H+V
Sbjct  7    ILLAVATMTILSTASAAIYNVGEPGGAWDLSTNYGTWASSRNFHPSDRIVFKYSPQAHDV  66

Query  285  VIVSKENYNSCTISGTI--LNSGHDNVTLTS-GTNYFICGAEGHCKGGMKMAI  434
            + VSK +Y+SC+ +  I  LNSG+D V LT+ GT YFICG  GHC GGMK+ I
Sbjct  67   LEVSKADYDSCSTASPIATLNSGNDVVPLTATGTRYFICGFPGHCAGGMKVKI  119



>ref|XP_004953818.1| PREDICTED: chemocyanin-like [Setaria italica]
Length=131

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 56/96 (58%), Gaps = 6/96 (6%)
 Frame = +3

Query  171  AETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS--GT  332
            A ++ V D   W      W  G++F++GD L+F Y+ +VH+V +V    Y SC +     
Sbjct  35   AASHMVGDYGGWKFNVDRWTKGRTFRAGDQLVFRYNRAVHDVAVVDAAAYRSCVVPRGAK  94

Query  333  ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            +L SG D V L  GT+YF+C   GHC+ GMK+A+ A
Sbjct  95   VLRSGRDKVRLGRGTHYFVCTVRGHCQAGMKIAVRA  130



>dbj|BAK01270.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01286.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=138

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 10/96 (10%)
 Frame = +3

Query  180  YTVEDKAKWSD------WPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS----G  329
            Y V D A W+       W  GK+F++GD+L+F Y+ + H+V  VSK  Y  C +S     
Sbjct  41   YLVGDAAGWTRNVDYGGWLAGKTFRAGDVLVFKYNSTFHDVAWVSKGGYKRCIVSPKGFA  100

Query  330  TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
             +  +G+D V L  GT+YFICG  GHC  GMK+A+T
Sbjct  101  PVYRNGYDAVGLPRGTHYFICGVPGHCSAGMKLAVT  136



>gb|KHN48106.1| Basic blue protein [Glycine soja]
Length=122

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 7/100 (7%)
 Frame = +3

Query  162  FAEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPS-VHNVVIVSKENYNSCTI-  323
             A A TY V D   W+     WP GK F++GD L++ +  S  HNVV V+K  Y+SC   
Sbjct  22   MARAATYRVGDSRGWTFNTVTWPQGKRFRAGDTLVWGWQRSGTHNVVAVNKAGYDSCKTP  81

Query  324  -SGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                +  SG D + L  G NYFIC   GHC+ GMK+AI A
Sbjct  82   RGAKVYRSGKDQIRLARGQNYFICNYVGHCESGMKIAINA  121



>ref|XP_008659439.1| PREDICTED: basic blue protein-like [Zea mays]
 gb|AFW86300.1| hypothetical protein ZEAMMB73_767386 [Zea mays]
Length=142

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 59/97 (61%), Gaps = 10/97 (10%)
 Frame = +3

Query  177  TYTVEDKAKWS------DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTIS----  326
            TY V D A W+       W  GK+F +GDIL+F Y+ + H+V  VSK  Y +C +S    
Sbjct  44   TYLVGDAAGWTLKVDYGRWVAGKTFHAGDILVFKYNTTWHDVAWVSKGGYRNCIVSPKGR  103

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
              + ++G+D VTL  GT+YFIC   GHC  GMK+A+T
Sbjct  104  APVYHTGYDAVTLPRGTHYFICAMPGHCSAGMKLAVT  140



>gb|EMT33683.1| Blue copper protein [Aegilops tauschii]
Length=171

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 10/113 (9%)
 Frame = +3

Query  126  IVIAIVTMLLCGFAEAETYTV-EDKAKWS------DWPNGKSFKSGDILIFNYDPSVHNV  284
            I++A+  M +   A A  Y V E    W        W + ++F++ D ++F Y P  H+V
Sbjct  7    ILLAVAAMAVLSTASAAIYNVGEPGGAWDLSTNYGTWASSRNFQTSDQIVFKYSPQAHDV  66

Query  285  VIVSKENYNSCTISGTI--LNSGHDNVTLTS-GTNYFICGAEGHCKGGMKMAI  434
            + VSK +Y+SC+ +  I   NSG+D VTLT+ GT YFICG  GHC GGMK+ I
Sbjct  67   LEVSKADYDSCSTANPITTFNSGNDVVTLTATGTRYFICGFPGHCAGGMKVKI  119



>ref|XP_002275938.1| PREDICTED: basic blue protein-like [Vitis vinifera]
Length=126

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--S  326
            A A TYTV   + W+     W +GKSF++GD+L+FNYDP  H+VV V + +Y++CT+   
Sbjct  28   AHAATYTVGGSSGWTFNVESWTDGKSFRAGDVLVFNYDPKDHDVVAVDQYSYDTCTVGEG  87

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +  SG+D++ L  G N FIC    HC  GMK+ + A
Sbjct  88   AKVYESGNDSIELVKGENCFICSFLSHCDSGMKIHMIA  125



>emb|CAN73750.1| hypothetical protein VITISV_021353 [Vitis vinifera]
Length=124

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--S  326
            A A TYTV   + W+     W +GKSF++GD+L+FNYDP  H+VV V + +Y++CT+   
Sbjct  26   AHAATYTVGGSSGWTFNVESWTDGKSFRAGDVLVFNYDPKDHDVVAVDQYSYDTCTVGEG  85

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +  SG+D++ L  G N FIC    HC  GMK+ + A
Sbjct  86   AKVYESGNDSIELVKGENCFICSFLSHCDSGMKIHMIA  123



>ref|XP_009599432.1| PREDICTED: basic blue protein-like [Nicotiana tomentosiformis]
Length=122

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +3

Query  105  MSTHDSIIVIAIVTMLL----CGFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFN  260
            MS    + +IA+  ML        + A T+       W    + WPNG++FK GD++ F 
Sbjct  1    MSGGKGVTIIAVAVMLCILLQTSISSAATFPAGGANGWGFNMNGWPNGQTFKVGDVIEFK  60

Query  261  YDPSVHNVVIVSKENYNSC-TISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
            Y   +HNVV VSK  ++SC    G + +SG D VTL  GT YFIC    HC  G+K A+T
Sbjct  61   YMAGMHNVVKVSKAGFDSCDGTGGQVFSSGDDKVTLVQGTQYFICTIGPHCSNGVKAAVT  120

Query  438  A  440
            A
Sbjct  121  A  121



>ref|XP_011023387.1| PREDICTED: mavicyanin-like [Populus euphratica]
Length=165

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 65/117 (56%), Gaps = 12/117 (10%)
 Frame = +3

Query  120  SIIVIAIVTMLLCGFAEAETYTVEDKAKWS--------DWPNGKSFKSGDILIFNYDPSV  275
            +I+V++ +T  LCG + A  Y V D A W+        DW   K+F  GD L+FNY+   
Sbjct  7    TILVVSFLTTALCGVSMATVYQVGDSAGWTSMGQVDYQDWAANKNFHGGDTLVFNYNNQF  66

Query  276  HNVVIVSKENYNSCTISGTI--LNSGHDNVTLTS--GTNYFICGAEGHCKGGMKMAI  434
            HNV  V+ + + SC  +  I   N+G D VTL    G  YFICG  GHC+GG K+ I
Sbjct  67   HNVKQVTHQGFESCNATSPIATYNNGSDTVTLGKQLGHFYFICGYPGHCQGGQKIDI  123



>gb|EMT05500.1| Chemocyanin [Aegilops tauschii]
Length=121

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 61/98 (62%), Gaps = 7/98 (7%)
 Frame = +3

Query  162  FAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISG  329
                + + V+DK  W    S W NGK FKSGD+L+F Y+ ++HN+V V + +YNSC + G
Sbjct  23   LVHGKEWIVDDKG-WTIGISGWENGKRFKSGDVLVFKYESAMHNLVQVEERDYNSCLVVG  81

Query  330  --TILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAIT  437
                 +SG+D++ L  G  +F+C    HC+ GMKMA+T
Sbjct  82   PSKFHDSGNDHIQLAGGKAFFLCSVMRHCEQGMKMAVT  119



>ref|XP_009420116.1| PREDICTED: basic blue protein-like [Musa acuminata subsp. malaccensis]
Length=127

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 55/99 (56%), Gaps = 9/99 (9%)
 Frame = +3

Query  171  AETYTVEDKAKW------SDWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTISGT  332
            A T+ V D   W      ++W NGKSF  GD L+FNY   +HNVV V+   Y SC  SG+
Sbjct  28   ATTHVVGDSQGWGFSMSYANWANGKSFAPGDTLVFNYQAGLHNVVPVNAAGYRSCKASGS  87

Query  333  ---ILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
                  +G D  TL  G NYFIC   GHC+ GMK+ + A
Sbjct  88   ASKAATTGDDKFTLKKGANYFICSIPGHCEAGMKIQVIA  126



>ref|XP_009605937.1| PREDICTED: basic blue protein-like [Nicotiana tomentosiformis]
Length=119

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 64/116 (55%), Gaps = 10/116 (9%)
 Frame = +3

Query  123  IIVIAIVTMLLC-----GFAEAETYTVEDKAKW----SDWPNGKSFKSGDILIFNYDPSV  275
            I+ I  V M+LC       + A T+       W    + WPNG++FK GD++ F Y   +
Sbjct  3    IVTIIAVAMMLCVLLQTNISNAATFPAGGANGWGFNMNGWPNGQTFKVGDVIEFKYMAGM  62

Query  276  HNVVIVSKENYNSCT-ISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
            HNVV VSK  ++SC    G + +SG D VTL  GT YFIC    HC  G+K+A+ A
Sbjct  63   HNVVRVSKAGFDSCDGTGGQVFSSGDDKVTLVQGTQYFICTIGPHCSNGVKVAVIA  118



>gb|EMS58905.1| Blue copper protein [Triticum urartu]
Length=171

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 70/123 (57%), Gaps = 14/123 (11%)
 Frame = +3

Query  96   MGKMSTHDSIIVIAIVTMLLCGFAEAETYTV-EDKAKWS------DWPNGKSFKSGDILI  254
            M  M T    I++A+  M +   A A  Y V E    W        W + ++F++ D ++
Sbjct  1    MAAMRT----ILLAVAAMTVLSTASAAIYNVGEPGGAWDFSTNYDTWASSRNFQTSDRIV  56

Query  255  FNYDPSVHNVVIVSKENYNSCTISG--TILNSGHDNVTLTS-GTNYFICGAEGHCKGGMK  425
            F Y P  H+V+ VSK +Y+SC+ +   T LN G+D VTLT+ GT YFICG  GHC GGMK
Sbjct  57   FKYSPQAHDVLEVSKADYDSCSTASPVTTLNFGNDVVTLTATGTRYFICGFPGHCAGGMK  116

Query  426  MAI  434
            + I
Sbjct  117  VKI  119



>emb|CBI23864.3| unnamed protein product [Vitis vinifera]
Length=155

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENYNSCTI--S  326
            A A TYTV   + W+     W +GKSF++GD+L+FNYDP  H+VV V + +Y++CT+   
Sbjct  57   AHAATYTVGGSSGWTFNVESWTDGKSFRAGDVLVFNYDPKDHDVVAVDQYSYDTCTVGEG  116

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +  SG+D++ L  G N FIC    HC  GMK+ + A
Sbjct  117  AKVYESGNDSIELVKGENCFICSFLSHCDSGMKIHMIA  154



>ref|XP_008456090.1| PREDICTED: basic blue protein-like [Cucumis melo]
Length=124

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 13/113 (12%)
 Frame = +3

Query  141  VTMLLCGF------AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVV-  287
            +T+LLC F      A+A+ YTV D   W+     W  GK F++GDIL+F Y    HNVV 
Sbjct  11   ITLLLCIFLIQSEIAQAKVYTVGDANGWTFNVTTWTKGKIFRAGDILVFKYPRLGHNVVA  70

Query  288  IVSKENYNSC--TISGTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITA  440
              +K  YN C    +  +  +G D + L  G NYFIC   GHCK GMK+AI A
Sbjct  71   FKNKVAYNWCLKPKNSKVYQTGKDRIKLVKGYNYFICSYPGHCKAGMKIAIKA  123



>ref|XP_009372474.1| PREDICTED: basic blue protein-like [Pyrus x bretschneideri]
Length=124

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = +3

Query  165  AEAETYTVEDKAKWS----DWPNGKSFKSGDILIFNYDPSVHNVVIVSKENY--NSCTIS  326
            A+  T+TV DK+ W+    +W +GK FK+GD L+FNYDP +HNV +V    Y   + + S
Sbjct  26   AQKTTFTVGDKSGWTFNVENWTDGKKFKAGDELVFNYDPPLHNVAVVDANEYSSCAASSS  85

Query  327  GTILNSGHDNVTLTSGTNYFICGAEGHCKGGMKMAITAT  443
                 +G D V L+ G NYFIC   GHC  G+K+++ A+
Sbjct  86   SRTFTTGKDPVKLSKGLNYFICTVPGHCDAGVKISVNAS  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 884735313480