BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22319_g1_i2 len=1525 path=[1570:0-86 1657:87-876 @2447@!:877-1439
3768:1440-1524]

Length=1525
                                                                      Score     E

sp|O82531.1|PSB1_PETHY  RecName: Full=Proteasome subunit beta typ...    191   3e-53   Petunia x hybrida [garden petunia]
ref|XP_009632018.1|  PREDICTED: proteasome subunit beta type-1          190   6e-53   
ref|XP_008354759.1|  PREDICTED: proteasome subunit beta type-1          189   6e-53   
ref|XP_009798486.1|  PREDICTED: proteasome subunit beta type-1-like     189   1e-52   
ref|XP_009761912.1|  PREDICTED: proteasome subunit beta type-1          189   1e-52   
ref|XP_006340658.1|  PREDICTED: proteasome subunit beta type-1-li...    188   2e-52   
ref|XP_008362617.1|  PREDICTED: proteasome subunit beta type-1          187   6e-52   
ref|XP_009339597.1|  PREDICTED: proteasome subunit beta type-1-like     187   6e-52   
ref|XP_009591182.1|  PREDICTED: proteasome subunit beta type-1-like     187   6e-52   
ref|XP_004232431.1|  PREDICTED: proteasome subunit beta type-1          187   8e-52   
gb|KDO37413.1|  hypothetical protein CISIN_1g027418mg                   185   1e-51   
ref|XP_006343387.1|  PREDICTED: proteasome subunit beta type-1-like     186   1e-51   
emb|CDP01980.1|  unnamed protein product                                185   3e-51   
ref|XP_006436864.1|  hypothetical protein CICLE_v10032692mg             185   3e-51   
ref|XP_009622935.1|  PREDICTED: proteasome subunit beta type-1-like     184   5e-51   
ref|XP_009798068.1|  PREDICTED: proteasome subunit beta type-1-like     184   8e-51   
emb|CDP17775.1|  unnamed protein product                                184   1e-50   
gb|AFK41008.1|  unknown                                                 183   1e-50   
gb|KDO85834.1|  hypothetical protein CISIN_1g027426mg                   182   1e-50   
ref|XP_011093209.1|  PREDICTED: proteasome subunit beta type-1-like     183   2e-50   
ref|XP_008232672.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    182   2e-50   
ref|XP_011090775.1|  PREDICTED: proteasome subunit beta type-1          182   3e-50   
ref|XP_007218359.1|  hypothetical protein PRUPE_ppa011112mg             182   4e-50   
ref|XP_006445250.1|  hypothetical protein CICLE_v10022119mg             182   4e-50   
gb|KDP28749.1|  hypothetical protein JCGZ_14520                         182   4e-50   
gb|KDO37411.1|  hypothetical protein CISIN_1g027418mg                   182   6e-50   
ref|XP_002511724.1|  proteasome subunit beta type, putative             181   1e-49   Ricinus communis
gb|KHN27009.1|  Proteasome subunit beta type-1                          180   2e-49   
gb|KHF98111.1|  Proteasome subunit beta type-1                          179   4e-49   
gb|EYU31997.1|  hypothetical protein MIMGU_mgv1a013334mg                179   5e-49   
ref|XP_004306916.1|  PREDICTED: proteasome subunit beta type-1-like     179   5e-49   
ref|NP_001238324.1|  uncharacterized protein LOC100306148               179   6e-49   
ref|XP_010056299.1|  PREDICTED: proteasome subunit beta type-1          179   6e-49   
ref|XP_008438155.1|  PREDICTED: proteasome subunit beta type-1          179   6e-49   
ref|XP_004169631.1|  PREDICTED: proteasome subunit beta type-1-like     177   6e-49   
ref|XP_009104277.1|  PREDICTED: proteasome subunit beta type-1-like     179   6e-49   
ref|XP_009116763.1|  PREDICTED: proteasome subunit beta type-1          179   6e-49   
ref|XP_004506503.1|  PREDICTED: proteasome subunit beta type-1-like     179   8e-49   
gb|KEH28252.1|  proteasome subunit beta protein                         176   9e-49   
ref|XP_010524362.1|  PREDICTED: proteasome subunit beta type-1          178   1e-48   
ref|XP_006402541.1|  hypothetical protein EUTSA_v10006409mg             178   1e-48   
ref|XP_003532008.1|  PREDICTED: proteasome subunit beta type-1-like     178   1e-48   
emb|CDY56729.1|  BnaCnng31140D                                          177   2e-48   
ref|XP_010692262.1|  PREDICTED: proteasome subunit beta type-1          177   2e-48   
gb|AES67685.2|  proteasome subunit beta protein                         177   3e-48   
gb|KCW72965.1|  hypothetical protein EUGRSUZ_E01416                     179   3e-48   
ref|XP_003597434.1|  Proteasome subunit beta type                       177   3e-48   
ref|XP_004133910.1|  PREDICTED: proteasome subunit beta type-1-like     177   4e-48   
ref|XP_006386573.1|  hypothetical protein POPTR_0002s14930g             175   4e-48   
emb|CDX71344.1|  BnaC07g06230D                                          177   4e-48   
ref|XP_003616394.1|  Proteasome subunit beta type                       177   5e-48   
emb|CDX89080.1|  BnaA04g01060D                                          177   5e-48   
ref|XP_009138810.1|  PREDICTED: proteasome subunit beta type-1-like     176   7e-48   
ref|XP_002302536.1|  Proteasome subunit beta type 1 family protein      176   1e-47   Populus trichocarpa [western balsam poplar]
gb|AFK36140.1|  unknown                                                 176   1e-47   
gb|KHG09051.1|  Proteasome subunit beta type-1                          175   1e-47   
ref|XP_002279266.1|  PREDICTED: proteasome subunit beta type-1          175   2e-47   Vitis vinifera
ref|XP_011017495.1|  PREDICTED: proteasome subunit beta type-1-like     174   4e-47   
ref|XP_011034390.1|  PREDICTED: proteasome subunit beta type-1          174   4e-47   
ref|XP_010092835.1|  Proteasome subunit beta type-1                     174   4e-47   
ref|XP_007052046.1|  N-terminal nucleophile aminohydrolases (Ntn ...    173   1e-46   
gb|AEX09185.1|  proteasome subunit beta type 1                          172   1e-46   
ref|XP_010934682.1|  PREDICTED: proteasome subunit beta type-1-like     172   1e-46   
emb|CAA47753.1|  proteosome subunit                                     172   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291810.1|  hypothetical protein CARUB_v10017986mg             172   2e-46   
ref|NP_191641.1|  proteasome subunit beta type-1                        172   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544653.1|  PREDICTED: proteasome subunit beta type-1          172   2e-46   
ref|XP_010940975.1|  PREDICTED: proteasome subunit beta type-1          172   3e-46   
ref|XP_006856911.1|  hypothetical protein AMTR_s00055p00220020          171   5e-46   
ref|XP_002320726.2|  Proteasome subunit beta type 1 family protein      170   9e-46   Populus trichocarpa [western balsam poplar]
ref|XP_009401263.1|  PREDICTED: proteasome subunit beta type-1-like     168   1e-45   
ref|XP_008791288.1|  PREDICTED: proteasome subunit beta type-1-like     170   1e-45   
ref|XP_008652898.1|  PREDICTED: proteasome subunit beta type-1 is...    169   1e-45   
ref|XP_010277370.1|  PREDICTED: proteasome subunit beta type-1          168   7e-45   
tpg|DAA62176.1|  TPA: hypothetical protein ZEAMMB73_205941              165   7e-45   
tpg|DAA62170.1|  TPA: hypothetical protein ZEAMMB73_205941              167   1e-44   
gb|EMT14457.1|  Proteasome subunit beta type-1                          167   1e-44   
ref|XP_009380355.1|  PREDICTED: proteasome subunit beta type-1-like     167   1e-44   
ref|NP_001030905.1|  proteasome subunit beta type-1                     167   1e-44   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ09670.1|  hypothetical protein OsI_31953                          166   2e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_008803997.1|  PREDICTED: proteasome subunit beta type-1          167   2e-44   
ref|XP_002462632.1|  hypothetical protein SORBIDRAFT_02g029260          167   2e-44   Sorghum bicolor [broomcorn]
ref|XP_009383984.1|  PREDICTED: proteasome subunit beta type-1          167   2e-44   
ref|XP_004957283.1|  PREDICTED: proteasome subunit beta type-1-like     167   2e-44   
ref|XP_008652897.1|  PREDICTED: proteasome subunit beta type-1 is...    166   4e-44   
tpg|DAA40478.1|  TPA: hypothetical protein ZEAMMB73_835212              164   9e-44   
ref|XP_003574814.1|  PREDICTED: proteasome subunit beta type-1-like     165   9e-44   
ref|XP_003578386.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    165   9e-44   
ref|XP_006660811.1|  PREDICTED: proteasome subunit beta type-1-like     165   1e-43   
tpg|DAA48191.1|  TPA: proteasome subunit beta type                      164   1e-43   
ref|NP_001063603.1|  Os09g0505600                                       164   1e-43   Oryza sativa Japonica Group [Japonica rice]
gb|ABK21828.1|  unknown                                                 165   1e-43   Picea sitchensis
gb|ACG27794.1|  proteasome subunit beta type 1                          164   1e-43   Zea mays [maize]
ref|XP_002445824.1|  hypothetical protein SORBIDRAFT_07g026360          164   2e-43   Sorghum bicolor [broomcorn]
ref|XP_004973989.1|  PREDICTED: proteasome subunit beta type-1-like     164   2e-43   
ref|XP_006659590.1|  PREDICTED: proteasome subunit beta type-1-like     163   4e-43   
ref|NP_001152701.1|  proteasome subunit beta type 1                     163   4e-43   Zea mays [maize]
ref|NP_001147213.1|  proteasome subunit beta type 1                     163   6e-43   Zea mays [maize]
gb|ACN35998.1|  unknown                                                 162   7e-43   Zea mays [maize]
gb|EEC83927.1|  hypothetical protein OsI_30000                          162   9e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001062318.1|  Os08g0529100                                       162   1e-42   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001276159.1|  proteasome subunit beta type-1-like                154   7e-40   
ref|XP_001775789.1|  predicted protein                                  154   1e-39   
ref|XP_001762412.1|  predicted protein                                  153   4e-39   
ref|XP_002970785.1|  hypothetical protein SELMODRAFT_94273              150   1e-38   
ref|XP_003080961.1|  PSB1_PETHY Proteasome subunit beta type 1 (ISS)    151   2e-38   
ref|XP_002986920.1|  hypothetical protein SELMODRAFT_124882             150   2e-38   
ref|XP_002988898.1|  hypothetical protein SELMODRAFT_235631             150   2e-38   
gb|EPS65527.1|  proteasome subunit beta type                            145   5e-38   
ref|XP_001419449.1|  predicted protein                                  149   7e-38   Ostreococcus lucimarinus CCE9901
emb|CBI17458.3|  unnamed protein product                                146   1e-37   
ref|XP_002501776.1|  predicted protein                                  148   1e-37   Micromonas commoda
ref|XP_003058525.1|  predicted protein                                  145   8e-37   
ref|XP_007515487.1|  predicted protein                                  145   2e-36   
gb|KFK35282.1|  hypothetical protein AALP_AA5G264500                    144   3e-36   
ref|XP_006380772.1|  hypothetical protein POPTR_0007s13360g             147   1e-35   
emb|CAC43327.1|  putative beta6 proteasome subunit                      141   1e-35   Nicotiana tabacum [American tobacco]
ref|XP_011025855.1|  PREDICTED: transcription factor bHLH110-like       147   1e-35   
ref|XP_002457528.1|  hypothetical protein SORBIDRAFT_03g008830          141   1e-35   Sorghum bicolor [broomcorn]
ref|XP_009798858.1|  PREDICTED: transcription factor bHLH110-like       145   3e-35   
ref|XP_010940117.1|  PREDICTED: transcription factor bHLH110-like       139   5e-35   
ref|XP_010649107.1|  PREDICTED: transcription factor bHLH110-like       145   7e-35   
ref|XP_008652896.1|  PREDICTED: proteasome subunit beta type-1 is...    140   7e-35   
ref|XP_011028459.1|  PREDICTED: transcription factor bHLH110-like       144   2e-34   
ref|XP_006340662.1|  PREDICTED: transcription factor bHLH110-like       142   2e-34   
ref|XP_007046833.1|  Basic helix-loop-helix DNA-binding superfami...    142   6e-34   
ref|XP_009392306.1|  PREDICTED: transcription factor bHLH110-like       135   7e-34   
gb|KHG10404.1|  Transcription factor protein                            141   7e-34   
ref|XP_007029396.1|  N-terminal nucleophile aminohydrolases (Ntn ...    137   1e-33   
ref|XP_008652895.1|  PREDICTED: proteasome subunit beta type-1 is...    136   2e-33   
gb|KHN27030.1|  Transcription factor bHLH110                            140   2e-33   
ref|XP_004232434.2|  PREDICTED: transcription factor bHLH110-like       139   3e-33   
ref|XP_010097031.1|  hypothetical protein L484_003630                   140   3e-33   
emb|CDX95297.1|  BnaC04g28610D                                          133   3e-33   
ref|XP_006383161.1|  hypothetical protein POPTR_0005s12150g             139   4e-33   
ref|XP_006383713.1|  hypothetical protein POPTR_0005s25240g             138   7e-33   
ref|XP_009390169.1|  PREDICTED: transcription factor bHLH110-like       135   1e-32   
ref|XP_006383714.1|  hypothetical protein POPTR_0005s25240g             139   1e-32   
ref|XP_009388096.1|  PREDICTED: transcription factor bHLH110-like       138   1e-32   
gb|EYU32900.1|  hypothetical protein MIMGU_mgv1a019357mg                137   1e-32   
emb|CDY07280.1|  BnaC04g18910D                                          133   2e-32   
ref|XP_009109789.1|  PREDICTED: transcription factor bHLH110 isof...    138   2e-32   
ref|XP_011028888.1|  PREDICTED: transcription factor bHLH110-like...    138   2e-32   
ref|XP_011028887.1|  PREDICTED: transcription factor bHLH110-like...    138   3e-32   
ref|XP_011048803.1|  PREDICTED: transcription factor bHLH110-like...    136   3e-32   
ref|XP_009109790.1|  PREDICTED: transcription factor bHLH110 isof...    137   3e-32   
ref|XP_010936678.1|  PREDICTED: transcription factor bHLH110-like       137   3e-32   
ref|NP_174087.1|  transcription factor bHLH110                          137   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109787.1|  PREDICTED: transcription factor bHLH110 isof...    137   5e-32   
ref|XP_009624505.1|  PREDICTED: transcription factor bHLH110-like...    137   5e-32   
ref|XP_006599357.1|  PREDICTED: transcription factor bHLH110-like...    134   5e-32   
ref|XP_011048801.1|  PREDICTED: transcription factor bHLH110-like...    137   6e-32   
ref|XP_006415743.1|  hypothetical protein EUTSA_v10007594mg             137   6e-32   
ref|XP_010478110.1|  PREDICTED: transcription factor bHLH110 isof...    136   6e-32   
gb|KDP38547.1|  hypothetical protein JCGZ_04472                         137   6e-32   
ref|XP_010254734.1|  PREDICTED: transcription factor bHLH110-like...    136   7e-32   
ref|XP_008440761.1|  PREDICTED: transcription factor bHLH110-like...    135   7e-32   
emb|CDX90101.1|  BnaA08g18830D                                          137   8e-32   
ref|XP_002890742.1|  hypothetical protein ARALYDRAFT_472970             137   8e-32   
ref|XP_003520288.2|  PREDICTED: transcription factor bHLH111-like...    135   9e-32   
ref|XP_010478109.1|  PREDICTED: transcription factor bHLH110 isof...    136   1e-31   
ref|XP_008795968.1|  PREDICTED: transcription factor bHLH110            135   1e-31   
ref|XP_006307468.1|  hypothetical protein CARUB_v10009095mg             136   1e-31   
ref|XP_006307469.1|  hypothetical protein CARUB_v10009095mg             136   1e-31   
ref|XP_011083625.1|  PREDICTED: transcription factor bHLH110            135   1e-31   
ref|XP_004150000.1|  PREDICTED: uncharacterized protein LOC101208178    134   1e-31   
ref|XP_007223238.1|  hypothetical protein PRUPE_ppa005486mg             135   2e-31   
emb|CDY11774.1|  BnaC03g58040D                                          135   2e-31   
ref|XP_007017613.1|  Basic helix-loop-helix DNA-binding superfami...    134   3e-31   
ref|XP_006435050.1|  hypothetical protein CICLE_v10001291mg             134   3e-31   
ref|XP_006473548.1|  PREDICTED: transcription factor bHLH110-like       134   4e-31   
gb|KFK36171.1|  hypothetical protein AALP_AA4G087200                    134   4e-31   
ref|XP_008784940.1|  PREDICTED: transcription factor bHLH110-like       133   6e-31   
ref|XP_009335970.1|  PREDICTED: transcription factor bHLH110            134   7e-31   
ref|XP_007156084.1|  hypothetical protein PHAVU_003G257100g             132   7e-31   
ref|XP_004967935.1|  PREDICTED: transcription factor bHLH123-like...    133   9e-31   
ref|XP_004967934.1|  PREDICTED: transcription factor bHLH123-like...    133   9e-31   
ref|XP_010664722.1|  PREDICTED: transcription factor bHLH110 isof...    133   1e-30   
ref|XP_002307676.2|  hypothetical protein POPTR_0005s25240g             133   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008388027.1|  PREDICTED: transcription factor bHLH110-like       133   1e-30   
ref|XP_008377204.1|  PREDICTED: transcription factor bHLH110            132   2e-30   
ref|XP_006847529.1|  hypothetical protein AMTR_s00014p00103240          131   3e-30   
ref|XP_006574695.1|  PREDICTED: transcription factor bHLH111-like...    130   4e-30   
ref|XP_009790800.1|  PREDICTED: transcription factor bHLH110            131   4e-30   
emb|CDP07480.1|  unnamed protein product                                131   4e-30   
ref|XP_004291848.1|  PREDICTED: transcription factor bHLH110-like       132   4e-30   
ref|XP_010263576.1|  PREDICTED: transcription factor bHLH110-like...    131   4e-30   
gb|EEC69777.1|  hypothetical protein OsI_00047                          130   8e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_008466527.1|  PREDICTED: transcription factor bHLH110-like...    130   9e-30   
ref|XP_008466525.1|  PREDICTED: transcription factor bHLH110-like...    130   9e-30   
dbj|BAD44875.1|  putative ethylene-responsive protein                   129   9e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008220847.1|  PREDICTED: transcription factor bHLH110 isof...    130   9e-30   
ref|NP_001041771.1|  Os01g0105700                                       129   9e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010673050.1|  PREDICTED: transcription factor bHLH110-like       130   2e-29   
ref|XP_004164011.1|  PREDICTED: transcription factor bHLH110-like       129   2e-29   
ref|XP_004147875.1|  PREDICTED: transcription factor bHLH110-like       130   2e-29   
gb|KGN59991.1|  hypothetical protein Csa_3G860270                       130   2e-29   
ref|XP_008673819.1|  PREDICTED: transcription factor bHLH110            129   3e-29   
ref|XP_002281118.2|  PREDICTED: transcription factor bHLH110 isof...    128   3e-29   Vitis vinifera
ref|XP_009586806.1|  PREDICTED: transcription factor bHLH110            128   4e-29   
ref|XP_006643643.1|  PREDICTED: uncharacterized protein LOC102705754    127   4e-29   
ref|XP_009413691.1|  PREDICTED: transcription factor bHLH110-like       127   5e-29   
ref|XP_009393607.1|  PREDICTED: transcription factor bHLH110-like       127   5e-29   
gb|KCW68202.1|  hypothetical protein EUGRSUZ_F01868                     127   9e-29   
ref|XP_010061277.1|  PREDICTED: transcription factor bHLH110            127   1e-28   
ref|XP_002534446.1|  transcription factor, putative                     125   1e-28   Ricinus communis
gb|EPS70844.1|  hypothetical protein M569_03916                         120   1e-28   
emb|CAN61992.1|  hypothetical protein VITISV_030445                     127   1e-28   Vitis vinifera
ref|XP_010540345.1|  PREDICTED: transcription factor bHLH110-like...    127   2e-28   
ref|XP_002510430.1|  transcription factor, putative                     126   2e-28   Ricinus communis
emb|CDM81294.1|  unnamed protein product                                124   7e-28   
gb|KEH36186.1|  BHLH transcription factor-like protein                  125   8e-28   
ref|XP_003566069.1|  PREDICTED: transcription factor bHLH123-like       122   1e-27   
ref|XP_008220849.1|  PREDICTED: transcription factor bHLH110 isof...    124   2e-27   
ref|XP_008466526.1|  PREDICTED: transcription factor bHLH110-like...    124   2e-27   
ref|XP_007153740.1|  hypothetical protein PHAVU_003G061000g             118   2e-27   
ref|XP_005848182.1|  hypothetical protein CHLNCDRAFT_22624              119   3e-27   
ref|XP_010540348.1|  PREDICTED: transcription factor bHLH110-like...    120   4e-27   
gb|EMT20268.1|  Transcription factor bHLH110                            122   5e-27   
ref|XP_011072388.1|  PREDICTED: transcription factor bHLH68-like ...    121   5e-27   
emb|CAN70945.1|  hypothetical protein VITISV_002869                     121   5e-27   Vitis vinifera
ref|XP_005652005.1|  N-terminal nucleophile aminohydrolase              119   5e-27   
ref|XP_006341970.1|  PREDICTED: transcription factor bHLH110-like       121   8e-27   
ref|XP_009624514.1|  PREDICTED: uncharacterized protein LOC104115...    120   8e-27   
ref|XP_004238285.1|  PREDICTED: transcription factor bHLH110            121   9e-27   
ref|XP_009594898.1|  PREDICTED: transcription factor bHLH123-like       121   1e-26   
ref|XP_011095780.1|  PREDICTED: transcription factor bHLH123            121   1e-26   
ref|XP_009790944.1|  PREDICTED: transcription factor bHLH123-like       121   1e-26   
gb|KGN62622.1|  hypothetical protein Csa_2G361860                       120   1e-26   
ref|XP_011080686.1|  PREDICTED: transcription factor bHLH68-like        119   1e-26   
gb|EYU27864.1|  hypothetical protein MIMGU_mgv1a011041mg                118   2e-26   
ref|XP_004248340.1|  PREDICTED: transcription factor bHLH123-like       120   2e-26   
ref|XP_010232975.1|  PREDICTED: transcription factor bHLH110-like       119   2e-26   
ref|XP_006452112.1|  hypothetical protein CICLE_v10008228mg             120   3e-26   
ref|XP_008647169.1|  PREDICTED: uncharacterized protein LOC103628822    119   3e-26   
ref|XP_011074574.1|  PREDICTED: transcription factor bHLH110-like...    118   3e-26   
gb|ACF85322.1|  unknown                                                 117   3e-26   Zea mays [maize]
ref|XP_010110036.1|  hypothetical protein L484_021925                   119   4e-26   
ref|XP_009384213.1|  PREDICTED: transcription factor bHLH103-like       118   4e-26   
ref|XP_009624511.1|  PREDICTED: transcription factor bHLH110-like...    119   4e-26   
ref|XP_003541762.1|  PREDICTED: transcription factor bHLH112-like...    119   4e-26   
ref|XP_008444742.1|  PREDICTED: transcription factor bHLH110 isof...    117   6e-26   
ref|XP_004500989.1|  PREDICTED: transcription factor bHLH110-like       118   6e-26   
ref|XP_004244171.1|  PREDICTED: transcription factor bHLH123            119   6e-26   
ref|XP_008386041.1|  PREDICTED: transcription factor bHLH123-like       119   6e-26   
ref|XP_009355551.1|  PREDICTED: transcription factor bHLH123-like...    119   6e-26   
ref|XP_010062929.1|  PREDICTED: transcription factor bHLH123            119   7e-26   
ref|XP_006360115.1|  PREDICTED: transcription factor bHLH123-like       119   7e-26   
gb|EPS73915.1|  hypothetical protein M569_00841                         112   8e-26   
gb|ACM50881.1|  20S proteasome beta subunit F1                          115   8e-26   Ulva fasciata
ref|XP_009355552.1|  PREDICTED: transcription factor bHLH123-like...    119   8e-26   
ref|XP_009420212.1|  PREDICTED: transcription factor bHLH112-like...    119   9e-26   
ref|XP_010540346.1|  PREDICTED: transcription factor bHLH110-like...    118   1e-25   
ref|NP_001130491.1|  putative HLH DNA-binding domain superfamily ...    117   1e-25   Zea mays [maize]
ref|XP_011074570.1|  PREDICTED: transcription factor bHLH110-like...    116   2e-25   
ref|XP_010909853.1|  PREDICTED: transcription factor bHLH112 isof...    118   2e-25   
ref|XP_006356148.1|  PREDICTED: transcription factor bHLH68-like ...    116   2e-25   
emb|CBI20463.3|  unnamed protein product                                116   3e-25   
ref|XP_002440027.1|  hypothetical protein SORBIDRAFT_09g024720          116   3e-25   Sorghum bicolor [broomcorn]
ref|XP_004141839.1|  PREDICTED: transcription factor bHLH68-like        115   3e-25   
gb|KDP38997.1|  hypothetical protein JCGZ_00754                         117   3e-25   
ref|XP_007148280.1|  hypothetical protein PHAVU_006G195000g             117   3e-25   
ref|XP_010923557.1|  PREDICTED: transcription factor bHLH113-like...    114   3e-25   
ref|XP_003571405.1|  PREDICTED: transcription factor bHLH112-like       116   3e-25   
ref|XP_002280367.3|  PREDICTED: transcription factor bHLH123 isof...    117   4e-25   Vitis vinifera
ref|XP_008439935.1|  PREDICTED: transcription factor bHLH112-like...    116   4e-25   
ref|XP_006849290.1|  hypothetical protein AMTR_s00167p00019840          111   4e-25   
gb|EEC79477.1|  hypothetical protein OsI_20507                          111   4e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_004241742.1|  PREDICTED: transcription factor bHLH68-like ...    115   4e-25   
emb|CAN78236.1|  hypothetical protein VITISV_016390                     117   5e-25   Vitis vinifera
gb|KHN08360.1|  Transcription factor bHLH123                            115   5e-25   
gb|KGN64594.1|  hypothetical protein Csa_1G070590                       115   5e-25   
ref|XP_004976935.1|  PREDICTED: transcription factor bHLH112-like       116   5e-25   
ref|XP_010271336.1|  PREDICTED: transcription factor bHLH113            114   5e-25   
ref|XP_008441703.1|  PREDICTED: transcription factor bHLH112-like...    115   5e-25   
ref|XP_008793684.1|  PREDICTED: transcription factor bHLH123-like       114   6e-25   
ref|XP_003635184.1|  PREDICTED: transcription factor bHLH112 isof...    116   6e-25   
ref|XP_006597380.1|  PREDICTED: transcription factor bHLH112-like...    116   7e-25   
ref|XP_008462744.1|  PREDICTED: transcription factor bHLH68 isofo...    115   8e-25   
ref|XP_008810246.1|  PREDICTED: transcription factor bHLH112-like       115   9e-25   
ref|XP_009803615.1|  PREDICTED: transcription factor bHLH112-like       116   1e-24   
ref|XP_004241741.1|  PREDICTED: transcription factor bHLH68-like ...    114   1e-24   
ref|XP_010112076.1|  hypothetical protein L484_002935                   116   1e-24   
emb|CDP05832.1|  unnamed protein product                                116   1e-24   
emb|CDY14219.1|  BnaA08g13500D                                          115   1e-24   
ref|XP_010460522.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    115   1e-24   
gb|EMT02903.1|  Transcription factor bHLH112                            115   1e-24   
ref|XP_009109051.1|  PREDICTED: transcription factor bHLH68-like        115   1e-24   
ref|XP_003593403.1|  Transcription factor bHLH112                       115   1e-24   
ref|XP_006851218.1|  hypothetical protein AMTR_s00043p00225670          115   1e-24   
ref|XP_006644815.1|  PREDICTED: transcription factor bHLH123-like       115   1e-24   
emb|CDO98010.1|  unnamed protein product                                114   1e-24   
emb|CDM84514.1|  unnamed protein product                                114   1e-24   
gb|KGN49165.1|  hypothetical protein Csa_6G516730                       115   1e-24   
ref|XP_008226756.1|  PREDICTED: transcription factor bHLH123            115   1e-24   
ref|XP_002300753.2|  hypothetical protein POPTR_0002s03380g             115   1e-24   
ref|XP_009377291.1|  PREDICTED: transcription factor bHLH123-like...    115   1e-24   
ref|XP_009377292.1|  PREDICTED: transcription factor bHLH123-like...    115   1e-24   
ref|XP_010938699.1|  PREDICTED: transcription factor bHLH113            112   2e-24   
ref|XP_006594645.1|  PREDICTED: transcription factor bHLH112-like...    115   2e-24   
ref|XP_003541039.2|  PREDICTED: transcription factor bHLH123-like       115   2e-24   
ref|XP_003567189.1|  PREDICTED: transcription factor bHLH123            114   2e-24   
gb|KHN28608.1|  Transcription factor bHLH123                            115   2e-24   
ref|XP_009109788.1|  PREDICTED: transcription factor bHLH110 isof...    114   2e-24   
ref|XP_006422897.1|  hypothetical protein CICLE_v10028922mg             112   2e-24   
ref|XP_011097951.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    115   2e-24   
ref|XP_002518591.1|  transcription factor, putative                     115   2e-24   
ref|XP_010263577.1|  PREDICTED: transcription factor bHLH110-like...    114   2e-24   
ref|XP_003526151.1|  PREDICTED: transcription factor bHLH123-like       115   2e-24   
ref|XP_006386206.1|  hypothetical protein POPTR_0002s03380g             114   2e-24   
gb|KHG01483.1|  Transcription factor bHLH68 -like protein               113   2e-24   
ref|XP_006406363.1|  hypothetical protein EUTSA_v10020666mg             115   3e-24   
ref|XP_003580620.1|  PREDICTED: transcription factor bHLH112-like       115   3e-24   
ref|XP_007213019.1|  hypothetical protein PRUPE_ppa023041mg             114   3e-24   
ref|XP_003596544.1|  Transcription factor bHLH123                       114   3e-24   
gb|KEH38833.1|  BHLH transcription factor-like protein                  114   3e-24   
ref|XP_011030917.1|  PREDICTED: transcription factor bHLH123            114   3e-24   
gb|EYU19181.1|  hypothetical protein MIMGU_mgv1a026531mg                114   3e-24   
dbj|BAK01805.1|  predicted protein                                      112   3e-24   
ref|XP_008366237.1|  PREDICTED: transcription factor bHLH123-like...    114   3e-24   
ref|XP_008366231.1|  PREDICTED: transcription factor bHLH123-like...    114   4e-24   
ref|XP_004485677.1|  PREDICTED: transcription factor bHLH112-like...    114   4e-24   
gb|AAF24944.1|AC012375_7  T22C5.11                                      115   4e-24   
ref|XP_007021136.1|  Basic helix-loop-helix DNA-binding superfami...    114   4e-24   
ref|XP_010267864.1|  PREDICTED: transcription factor bHLH112-like       114   4e-24   
ref|XP_006343090.1|  PREDICTED: transcription factor bHLH68-like        112   4e-24   
ref|XP_010240994.1|  PREDICTED: transcription factor bHLH123-like       114   4e-24   
ref|XP_009402586.1|  PREDICTED: transcription factor bHLH123-like...    112   4e-24   
emb|CDO99682.1|  unnamed protein product                                114   5e-24   
gb|KDP20840.1|  hypothetical protein JCGZ_21311                         114   5e-24   
ref|XP_011096171.1|  PREDICTED: transcription factor bHLH112 isof...    114   5e-24   
ref|NP_001055968.1|  Os05g0501200                                       112   5e-24   
ref|XP_002447167.1|  hypothetical protein SORBIDRAFT_06g029680          114   5e-24   
ref|XP_009774581.1|  PREDICTED: transcription factor bHLH68-like ...    111   5e-24   
ref|XP_003636605.1|  Transcription factor bHLH123                       113   5e-24   
ref|XP_004232764.1|  PREDICTED: transcription factor bHLH112            113   5e-24   
tpg|DAA57329.1|  TPA: putative HLH DNA-binding domain superfamily...    112   5e-24   
ref|XP_004487635.1|  PREDICTED: transcription factor bHLH123-like...    114   5e-24   
gb|KFK39385.1|  hypothetical protein AALP_AA3G238100                    113   5e-24   
ref|XP_004487634.1|  PREDICTED: transcription factor bHLH123-like...    114   6e-24   
gb|ACJ85397.1|  unknown                                                 111   6e-24   
ref|XP_011012087.1|  PREDICTED: transcription factor bHLH123-like...    114   6e-24   
ref|XP_011012088.1|  PREDICTED: transcription factor bHLH123-like...    113   6e-24   
gb|KEH19696.1|  BHLH transcription factor-like protein                  113   6e-24   
gb|EAY95687.1|  hypothetical protein OsI_17552                          113   6e-24   
gb|AFK49339.1|  unknown                                                 112   6e-24   
ref|XP_007133119.1|  hypothetical protein PHAVU_011G153000g             114   6e-24   
ref|XP_004294314.1|  PREDICTED: transcription factor bHLH123-like       113   6e-24   
ref|XP_011086152.1|  PREDICTED: transcription factor bHLH112-like       114   6e-24   
ref|XP_011003381.1|  PREDICTED: transcription factor bHLH112 isof...    114   7e-24   
ref|XP_009764035.1|  PREDICTED: transcription factor bHLH112-like       113   7e-24   
ref|XP_002445156.1|  hypothetical protein SORBIDRAFT_07g004980          113   7e-24   
emb|CAJ86024.1|  B0808H03.1                                             113   7e-24   
ref|XP_011003379.1|  PREDICTED: transcription factor bHLH112 isof...    114   7e-24   
ref|NP_001053983.1|  Os04g0631600                                       113   7e-24   
ref|XP_009380570.1|  PREDICTED: transcription factor bHLH68-like ...    111   7e-24   
ref|XP_003597717.1|  Transcription factor bHLH68                        111   7e-24   
ref|XP_008444743.1|  PREDICTED: transcription factor bHLH110 isof...    112   7e-24   
ref|XP_009628051.1|  PREDICTED: transcription factor bHLH68-like ...    111   7e-24   
gb|AES67968.2|  BHLH transcription factor-like protein                  111   8e-24   
ref|XP_003597718.1|  Transcription factor bHLH68                        111   8e-24   
ref|XP_009629262.1|  PREDICTED: transcription factor bHLH112-like       113   8e-24   
ref|XP_006652870.1|  PREDICTED: transcription factor bHLH112-like       113   8e-24   
ref|XP_010111014.1|  hypothetical protein L484_004995                   114   8e-24   
ref|XP_004509986.1|  PREDICTED: transcription factor bHLH123-like...    113   8e-24   
ref|XP_011048802.1|  PREDICTED: transcription factor bHLH110-like...    112   9e-24   
ref|XP_009608011.1|  PREDICTED: transcription factor bHLH68-like        111   9e-24   
gb|KDD75132.1|  proteasome subunit protein                              112   9e-24   
ref|XP_004509985.1|  PREDICTED: transcription factor bHLH123-like...    112   9e-24   
ref|XP_009417260.1|  PREDICTED: transcription factor bHLH112-like...    111   9e-24   
ref|XP_009402587.1|  PREDICTED: transcription factor bHLH123-like...    111   1e-23   
ref|XP_004235685.1|  PREDICTED: transcription factor bHLH68             110   1e-23   
ref|XP_010694303.1|  PREDICTED: transcription factor bHLH123 isof...    113   1e-23   
ref|XP_007148281.1|  hypothetical protein PHAVU_006G195000g             112   1e-23   
ref|XP_010694302.1|  PREDICTED: transcription factor bHLH123 isof...    113   1e-23   
gb|KDO47961.1|  hypothetical protein CISIN_1g036196mg                   110   1e-23   
ref|XP_006594799.1|  PREDICTED: transcription factor bHLH123-like...    112   1e-23   
emb|CDY19619.1|  BnaA05g20270D                                          112   1e-23   
ref|XP_003541866.1|  PREDICTED: transcription factor bHLH123-like...    112   1e-23   
ref|XP_010466266.1|  PREDICTED: transcription factor bHLH123            112   1e-23   
ref|XP_010545557.1|  PREDICTED: transcription factor bHLH123 isof...    112   1e-23   
ref|XP_010545555.1|  PREDICTED: transcription factor bHLH123 isof...    112   1e-23   
gb|EMT01196.1|  Transcription factor bHLH112                            112   1e-23   
ref|XP_004486757.1|  PREDICTED: transcription factor bHLH68-like        110   2e-23   
ref|XP_007211684.1|  hypothetical protein PRUPE_ppa005924mg             112   2e-23   
ref|XP_010062499.1|  PREDICTED: transcription factor bHLH68-like ...    110   2e-23   
ref|XP_009617831.1|  PREDICTED: transcription factor bHLH112-like       112   2e-23   
ref|XP_008224896.1|  PREDICTED: transcription factor bHLH112 isof...    112   2e-23   
gb|EEC71608.1|  hypothetical protein OsI_04012                          111   2e-23   
ref|XP_008439936.1|  PREDICTED: transcription factor bHLH112-like...    111   2e-23   
gb|EAZ05804.1|  hypothetical protein OsI_28041                          112   2e-23   
ref|XP_004151277.1|  PREDICTED: transcription factor bHLH123-like       112   2e-23   
ref|XP_003539573.2|  PREDICTED: transcription factor bHLH123-like...    112   2e-23   
gb|KGN56169.1|  hypothetical protein Csa_3G088430                       112   2e-23   
emb|CDX97479.1|  BnaC08g13440D                                          111   2e-23   
ref|XP_004970206.1|  PREDICTED: transcription factor bHLH123-like...    112   2e-23   
ref|XP_006592891.1|  PREDICTED: transcription factor bHLH123-like...    112   2e-23   
ref|XP_002521525.1|  conserved hypothetical protein                     111   2e-23   
ref|XP_008224893.1|  PREDICTED: transcription factor bHLH112 isof...    112   2e-23   
gb|EEE55506.1|  hypothetical protein OsJ_03706                          110   2e-23   
ref|XP_011008316.1|  PREDICTED: transcription factor bHLH68-like ...    110   2e-23   
ref|XP_009419079.1|  PREDICTED: transcription factor bHLH113-like       108   2e-23   
ref|XP_009617305.1|  PREDICTED: transcription factor bHLH112-like       110   3e-23   
ref|XP_004970205.1|  PREDICTED: transcription factor bHLH123-like...    111   3e-23   
ref|NP_001144636.1|  uncharacterized protein LOC100277655               110   3e-23   
ref|XP_002516005.1|  transcription factor, putative                     110   3e-23   
ref|XP_009417259.1|  PREDICTED: transcription factor bHLH123-like...    111   3e-23   
ref|XP_010047918.1|  PREDICTED: transcription factor bHLH68             110   3e-23   
ref|XP_006297611.1|  hypothetical protein CARUB_v10013632mg             112   3e-23   
ref|XP_010646711.1|  PREDICTED: transcription factor bHLH112 isof...    112   3e-23   
gb|AFK44804.1|  unknown                                                 107   3e-23   
ref|XP_006597381.1|  PREDICTED: transcription factor bHLH112-like...    112   3e-23   
ref|XP_010679784.1|  PREDICTED: transcription factor bHLH110-like       110   3e-23   
ref|NP_001044465.2|  Os01g0784900                                       110   3e-23   
ref|XP_009377815.1|  PREDICTED: transcription factor bHLH68-like        109   3e-23   
ref|NP_001191254.1|  uncharacterized protein LOC100533153               106   3e-23   
ref|XP_009405008.1|  PREDICTED: transcription factor bHLH112-like       110   3e-23   
emb|CDY29448.1|  BnaC05g32220D                                          111   3e-23   
ref|XP_002982885.1|  hypothetical protein SELMODRAFT_117274             104   3e-23   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    114   3e-23   
ref|XP_006655458.1|  PREDICTED: transcription factor bHLH123-like       110   4e-23   
ref|XP_009418757.1|  PREDICTED: transcription factor bHLH112-like...    110   4e-23   
ref|XP_009418756.1|  PREDICTED: transcription factor bHLH112-like...    110   4e-23   
ref|XP_008668450.1|  PREDICTED: uncharacterized protein LOC100383...    111   4e-23   
ref|XP_009397264.1|  PREDICTED: transcription factor bHLH113-like       108   4e-23   
ref|XP_008462743.1|  PREDICTED: transcription factor bHLH68 isofo...    110   4e-23   
emb|CDY48596.1|  BnaA01g07690D                                          110   4e-23   
ref|XP_008668451.1|  PREDICTED: uncharacterized protein LOC100383...    111   4e-23   
ref|XP_008342665.1|  PREDICTED: transcription factor bHLH68-like        109   5e-23   
gb|KHG21853.1|  Transcription factor bHLH68 -like protein               109   5e-23   
ref|XP_010931879.1|  PREDICTED: transcription factor bHLH112-like       110   5e-23   
ref|XP_011010531.1|  PREDICTED: transcription factor bHLH68-like ...    108   5e-23   
ref|XP_010665766.1|  PREDICTED: transcription factor bHLH112            111   5e-23   
gb|KDP37262.1|  hypothetical protein JCGZ_06318                         109   6e-23   
ref|XP_008672024.1|  PREDICTED: putative HLH DNA-binding domain s...    110   6e-23   
ref|XP_009397158.1|  PREDICTED: transcription factor bHLH112-like       110   6e-23   
ref|XP_010644310.1|  PREDICTED: transcription factor bHLH123 isof...    110   6e-23   
gb|AFK38358.1|  unknown                                                 110   6e-23   
ref|XP_010433138.1|  PREDICTED: transcription factor bHLH68-like ...    110   6e-23   
ref|XP_010928675.1|  PREDICTED: transcription factor bHLH123-like       110   7e-23   
ref|XP_007204357.1|  hypothetical protein PRUPE_ppa007164mg             109   7e-23   
emb|CBI22512.3|  unnamed protein product                                106   7e-23   
gb|ACN21652.1|  putative basic helix-loop-helix protein BHLH16          105   7e-23   
ref|NP_001170271.1|  putative HLH DNA-binding domain superfamily ...    109   8e-23   
ref|XP_010924017.1|  PREDICTED: transcription factor bHLH123-like       110   9e-23   
ref|XP_002675936.1|  predicted protein                                  106   9e-23   
gb|KDO56951.1|  hypothetical protein CISIN_1g019574mg                   108   9e-23   
ref|XP_008777138.1|  PREDICTED: transcription factor bHLH123-like       110   9e-23   
gb|KFK29460.1|  hypothetical protein AALP_AA7G137200                    109   9e-23   
gb|KDO56950.1|  hypothetical protein CISIN_1g019574mg                   108   9e-23   
ref|XP_006426930.1|  hypothetical protein CICLE_v10026009mg             108   9e-23   
gb|KHG24213.1|  Transcription factor protein                            107   1e-22   
ref|XP_007025886.1|  Transcription factor, putative                     110   1e-22   
ref|XP_010688253.1|  PREDICTED: transcription factor bHLH68             109   1e-22   
ref|XP_006383985.1|  hypothetical protein POPTR_0004s02870g             110   1e-22   
ref|XP_010057695.1|  PREDICTED: transcription factor bHLH112-like       110   1e-22   
ref|XP_008779448.1|  PREDICTED: transcription factor bHLH113-like       106   1e-22   
ref|XP_004513012.1|  PREDICTED: transcription factor bHLH68-like        108   1e-22   
ref|XP_008355967.1|  PREDICTED: transcription factor bHLH112-like...    109   1e-22   
ref|XP_009336861.1|  PREDICTED: transcription factor bHLH68-like ...    108   1e-22   
ref|XP_008383961.1|  PREDICTED: transcription factor bHLH112 isof...    109   1e-22   
ref|XP_006465639.1|  PREDICTED: transcription factor bHLH68-like ...    108   1e-22   
ref|XP_010447891.1|  PREDICTED: transcription factor bHLH68 isofo...    109   1e-22   
ref|XP_004967407.1|  PREDICTED: transcription factor bHLH68-like ...    108   1e-22   
ref|XP_006465638.1|  PREDICTED: transcription factor bHLH68-like ...    108   1e-22   
ref|XP_002269988.1|  PREDICTED: transcription factor bHLH113 isof...    106   1e-22   
ref|XP_011008318.1|  PREDICTED: transcription factor bHLH68-like ...    107   2e-22   
ref|XP_003531664.1|  PREDICTED: transcription factor bHLH68-like ...    107   2e-22   
ref|XP_004972712.1|  PREDICTED: transcription factor bHLH123-like       109   2e-22   
ref|XP_003637888.1|  Transcription factor bHLH68                        106   2e-22   
ref|XP_008383958.1|  PREDICTED: transcription factor bHLH112 isof...    110   2e-22   
ref|XP_006486976.1|  PREDICTED: transcription factor bHLH113-like       107   2e-22   
ref|XP_007045319.1|  Basic helix-loop-helix DNA-binding superfami...    110   2e-22   
ref|XP_007045320.1|  Basic helix-loop-helix DNA-binding superfami...    110   2e-22   
ref|XP_008383959.1|  PREDICTED: transcription factor bHLH112 isof...    110   2e-22   
ref|XP_007045318.1|  Basic helix-loop-helix DNA-binding superfami...    110   2e-22   
ref|XP_011096172.1|  PREDICTED: transcription factor bHLH112 isof...    109   2e-22   
ref|XP_010552489.1|  PREDICTED: transcription factor bHLH110            108   2e-22   
ref|XP_008242571.1|  PREDICTED: transcription factor bHLH68             108   2e-22   
ref|XP_006583063.1|  PREDICTED: transcription factor bHLH68-like ...    107   2e-22   
ref|XP_010540965.1|  PREDICTED: transcription factor bHLH68-like        108   2e-22   
ref|XP_004485676.1|  PREDICTED: transcription factor bHLH112-like...    109   2e-22   
ref|XP_010438345.1|  PREDICTED: transcription factor bHLH68-like        108   2e-22   
ref|XP_010447890.1|  PREDICTED: transcription factor bHLH68 isofo...    108   2e-22   
ref|XP_006377272.1|  hypothetical protein POPTR_0011s03560g             109   2e-22   
ref|XP_004487636.1|  PREDICTED: transcription factor bHLH123-like...    109   2e-22   
ref|XP_009774580.1|  PREDICTED: transcription factor bHLH68-like ...    107   2e-22   
ref|XP_010433137.1|  PREDICTED: transcription factor bHLH68-like ...    108   2e-22   
gb|ABK26980.1|  unknown                                                 107   2e-22   
ref|XP_009380568.1|  PREDICTED: transcription factor bHLH68-like ...    107   2e-22   
ref|XP_002317553.1|  ethylene-responsive family protein                 109   2e-22   
ref|XP_004981690.1|  PREDICTED: transcription factor bHLH68-like        107   2e-22   
ref|XP_002299721.1|  hypothetical protein POPTR_0001s18660g             107   2e-22   
ref|XP_009380567.1|  PREDICTED: transcription factor bHLH68-like ...    107   3e-22   
ref|XP_009628050.1|  PREDICTED: transcription factor bHLH68-like ...    107   3e-22   
gb|KEH27144.1|  BHLH transcription factor-like protein                  107   3e-22   
ref|XP_006412879.1|  hypothetical protein EUTSA_v10025359mg             108   3e-22   
ref|XP_011092529.1|  PREDICTED: transcription factor bHLH113-like       106   3e-22   
ref|XP_006585586.1|  PREDICTED: transcription factor bHLH68-like ...    107   3e-22   
gb|AFK35850.1|  unknown                                                 107   3e-22   



>sp|O82531.1|PSB1_PETHY RecName: Full=Proteasome subunit beta type-1; AltName: Full=20S 
proteasome alpha subunit F; AltName: Full=20S proteasome 
subunit beta-6 [Petunia x hybrida]
 gb|AAC35983.1| proteasome beta subunit [Petunia x hybrida]
Length=223

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGDRLEIV+LN  G+R EEMELRKD
Sbjct  183   DLVKTCFASATERDIYTGDRLEIVILNASGIRREEMELRKD  223



>ref|XP_009632018.1| PREDICTED: proteasome subunit beta type-1 [Nicotiana tomentosiformis]
Length=223

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAKDAVTPLSESEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGDRLEIV+LN++G+R EEMELRKD
Sbjct  183   DLVKTCFASATERDIYTGDRLEIVILNVNGIRREEMELRKD  223



>ref|XP_008354759.1| PREDICTED: proteasome subunit beta type-1 [Malus domestica]
 ref|XP_009347285.1| PREDICTED: proteasome subunit beta type-1 [Pyrus x bretschneideri]
Length=223

 Score =   189 bits (481),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLI+P LDNQLKSPSPLL+PAQD++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIIPFLDNQLKSPSPLLLPAQDAVTPLSEAEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGDRLEIVVLN DG R E MELRKD
Sbjct  183   DLVKTCFASATERDIYTGDRLEIVVLNADGTRYEYMELRKD  223



>ref|XP_009798486.1| PREDICTED: proteasome subunit beta type-1-like [Nicotiana sylvestris]
Length=223

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAKDAVTPLSESEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGDRLEIVVLN DG+R EEM+LRKD
Sbjct  183   DLVKTCFASATERDIYTGDRLEIVVLNADGIRREEMDLRKD  223



>ref|XP_009761912.1| PREDICTED: proteasome subunit beta type-1 [Nicotiana sylvestris]
Length=223

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAKDAVTPLSESEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGDRLEIV+LN +G+R EEMELRKD
Sbjct  183   DLVKTCFASATERDIYTGDRLEIVILNANGIRREEMELRKD  223



>ref|XP_006340658.1| PREDICTED: proteasome subunit beta type-1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006340659.1| PREDICTED: proteasome subunit beta type-1-like isoform X2 [Solanum 
tuberosum]
Length=223

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PA D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAVDAVTPLSESEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD+LEIVVLN DG+R EEMELRKD
Sbjct  183   DLVKTCFASATERDIYTGDKLEIVVLNADGIRREEMELRKD  223



>ref|XP_008362617.1| PREDICTED: proteasome subunit beta type-1 [Malus domestica]
Length=223

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLI+P LDNQLKSPSPLL+PAQD++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIIPFLDNQLKSPSPLLLPAQDAVTPLSEAEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD LEIVVLN DG R E MELRKD
Sbjct  183   DLVKTCFASATERDIYTGDSLEIVVLNADGTRYEYMELRKD  223



>ref|XP_009339597.1| PREDICTED: proteasome subunit beta type-1-like [Pyrus x bretschneideri]
Length=223

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLI+P LDNQLKSPSPLL+PAQD++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIIPFLDNQLKSPSPLLLPAQDAVTPLSEAEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD LEIVVLN DG R E MELRKD
Sbjct  183   DLVKTCFASATERDIYTGDSLEIVVLNADGTRYEYMELRKD  223



>ref|XP_009591182.1| PREDICTED: proteasome subunit beta type-1-like [Nicotiana tomentosiformis]
Length=223

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAKDAVTPLSESEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD+LEIV+LN DGVR EEM+LR+D
Sbjct  183   DLVKTCFASATERDIYTGDKLEIVILNADGVRREEMDLRRD  223



>ref|XP_004232431.1| PREDICTED: proteasome subunit beta type-1 [Solanum lycopersicum]
Length=223

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PA D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAVDAVTPLSESEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD+LEIVVLN DG+R EEM+LRKD
Sbjct  183   DLVKTCFASATERDIYTGDKLEIVVLNADGIRREEMDLRKD  223



>gb|KDO37413.1| hypothetical protein CISIN_1g027418mg [Citrus sinensis]
Length=189

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  89    GKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAV  148

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD+LEIVVLN DG+  E MELRKD
Sbjct  149   DLVKTCFASATERDIYTGDKLEIVVLNKDGIHREYMELRKD  189



>ref|XP_006343387.1| PREDICTED: proteasome subunit beta type-1-like [Solanum tuberosum]
Length=223

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSGATLIMP LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGATLIMPFLDNQLKSPSPLLLPAKDAVTPLSESEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD+LE+++LN DGVR EEM+LR+D
Sbjct  183   DLVKTCFASATERDIYTGDKLEMLILNADGVRREEMDLRRD  223



>emb|CDP01980.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAKDAVTPLSESEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD+LEIVVLN +G R E MELRKD
Sbjct  183   DLVKTCFASATERDIYTGDKLEIVVLNAEGTRREYMELRKD  223



>ref|XP_006436864.1| hypothetical protein CICLE_v10032692mg [Citrus clementina]
 ref|XP_006493223.1| PREDICTED: proteasome subunit beta type-1-like [Citrus sinensis]
 gb|ESR50104.1| hypothetical protein CICLE_v10032692mg [Citrus clementina]
 gb|KDO37412.1| hypothetical protein CISIN_1g027418mg [Citrus sinensis]
Length=223

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  123   GKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD+LEIVVLN DG+  E MELRKD
Sbjct  183   DLVKTCFASATERDIYTGDKLEIVVLNKDGIHREYMELRKD  223



>ref|XP_009622935.1| PREDICTED: proteasome subunit beta type-1-like [Nicotiana tomentosiformis]
Length=223

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAKDAVTPLSESEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCF SATERDIYTGDRLEIVVLN D +R EEM+LRKD
Sbjct  183   DLVKTCFVSATERDIYTGDRLEIVVLNADRIRREEMDLRKD  223



>ref|XP_009798068.1| PREDICTED: proteasome subunit beta type-1-like [Nicotiana sylvestris]
Length=223

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAKDAVTPLSEAEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD+LEIV+LN DGV  EEM+LR+D
Sbjct  183   DLVKTCFASATERDIYTGDKLEIVILNADGVCREEMDLRRD  223



>emb|CDP17775.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PA+D++TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAKDAVTPLSESEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD+LEI+VLN +G+R E MELRKD
Sbjct  183   DLVKTCFASATERDIYTGDKLEILVLNAEGIRREYMELRKD  223



>gb|AFK41008.1| unknown [Lotus japonicus]
Length=223

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSETEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEIV+LN  G+R E MELRKD
Sbjct  183   DLVKTVFASATERDIYTGDKLEIVILNASGIRREYMELRKD  223



>gb|KDO85834.1| hypothetical protein CISIN_1g027426mg [Citrus sinensis]
Length=183

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  83    GKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAV  142

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD+LEIVVLN  G+  E MELRKD
Sbjct  143   DLVKTCFASATERDIYTGDKLEIVVLNKGGIHREYMELRKD  183



>ref|XP_011093209.1| PREDICTED: proteasome subunit beta type-1-like [Sesamum indicum]
Length=223

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSGATLI P LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGATLITPFLDNQLKSPSPLLLPAKDAVTPLSESEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD+LEIV+LN  G+R E MELRKD
Sbjct  183   DLVKTCFASATERDIYTGDKLEIVILNASGLRREYMELRKD  223



>ref|XP_008232672.1| PREDICTED: LOW QUALITY PROTEIN: proteasome subunit beta type-1 
[Prunus mume]
Length=212

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLI+P LDNQLKSPSPLL+PA D++TPLSE EAI
Sbjct  112   GKGCVFTYDAVGSYERVGYSSQGSGSTLIIPFLDNQLKSPSPLLLPAVDAVTPLSEAEAI  171

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGDRLEIVVLN DG R E MELRKD
Sbjct  172   DLVKTVFASATERDIYTGDRLEIVVLNADGTRYEYMELRKD  212



>ref|XP_011090775.1| PREDICTED: proteasome subunit beta type-1 [Sesamum indicum]
Length=223

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSGATLI P LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGATLITPFLDNQLKSPSPLLLPAKDAVTPLSESEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD++EIV+LN  G+R E MELRKD
Sbjct  183   DLVKTCFASATERDIYTGDKVEIVILNASGIRREYMELRKD  223



>ref|XP_007218359.1| hypothetical protein PRUPE_ppa011112mg [Prunus persica]
 gb|EMJ19558.1| hypothetical protein PRUPE_ppa011112mg [Prunus persica]
Length=223

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLI+P LDNQLKSPSPLL+PA D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIIPFLDNQLKSPSPLLLPAVDAVTPLSEAEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGDRLEIVVLN DG R E MELRKD
Sbjct  183   DLVKTVFASATERDIYTGDRLEIVVLNADGTRYEYMELRKD  223



>ref|XP_006445250.1| hypothetical protein CICLE_v10022119mg [Citrus clementina]
 ref|XP_006490927.1| PREDICTED: proteasome subunit beta type-1-like [Citrus sinensis]
 gb|ESR58490.1| hypothetical protein CICLE_v10022119mg [Citrus clementina]
 gb|KDO85833.1| hypothetical protein CISIN_1g027426mg [Citrus sinensis]
Length=223

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  123   GKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYTGD+LEIVVLN  G+  E MELRKD
Sbjct  183   DLVKTCFASATERDIYTGDKLEIVVLNKGGIHREYMELRKD  223



>gb|KDP28749.1| hypothetical protein JCGZ_14520 [Jatropha curcas]
Length=223

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YERVGYS+QGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE+EA+
Sbjct  123   GKGCVYTYDAVGSYERVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEVEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEIV+LN DG+R E +ELRKD
Sbjct  183   DLVKTVFASATERDIYTGDKLEIVILNADGIRREYLELRKD  223



>gb|KDO37411.1| hypothetical protein CISIN_1g027418mg [Citrus sinensis]
Length=223

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  123   GKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKTCFASATERDIYT ++LEIVVLN DG+  E MELRKD
Sbjct  183   DLVKTCFASATERDIYTANKLEIVVLNKDGIHREYMELRKD  223



>ref|XP_002511724.1| proteasome subunit beta type, putative [Ricinus communis]
 gb|EEF50393.1| proteasome subunit beta type, putative [Ricinus communis]
Length=223

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YERVGYS+QGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  123   GKGCVYTYDAVGSYERVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEPEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD++EIVVLN DG+R E MELRKD
Sbjct  183   DLVKTVFASATERDIYTGDKVEIVVLNADGIRREYMELRKD  223



>gb|KHN27009.1| Proteasome subunit beta type-1 [Glycine soja]
Length=232

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  132   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAV  191

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD++EIVVLN  G+R E M+LRKD
Sbjct  192   DLVKTVFASATERDIYTGDKVEIVVLNASGIRREYMDLRKD  232



>gb|KHF98111.1| Proteasome subunit beta type-1 [Gossypium arboreum]
Length=223

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YE+VGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPL+E EAI
Sbjct  123   GKGCVFTYDAVGSYEKVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLAEAEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASA+ERDIYTGD+LEIVV+N DG+R E M+LRKD
Sbjct  183   DLVKTVFASASERDIYTGDKLEIVVINADGIRREYMDLRKD  223



>gb|EYU31997.1| hypothetical protein MIMGU_mgv1a013334mg [Erythranthe guttata]
Length=223

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YERVGYSSQGSG+TLI P LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  123   GKGCVYTYDAVGSYERVGYSSQGSGSTLITPFLDNQLKSPSPLLLPAKDAVTPLSETEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLV+TCF SATERDIYTGD+LEIVVLN  G+R E MELRKD
Sbjct  183   DLVRTCFVSATERDIYTGDKLEIVVLNASGIRREYMELRKD  223



>ref|XP_004306916.1| PREDICTED: proteasome subunit beta type-1-like [Fragaria vesca 
subsp. vesca]
Length=223

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSG+TLIMP LDNQLKSPSPLL+PA D++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAVDAVTPLSEGEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGDRLEI VLN +G R E MELRKD
Sbjct  183   DLVKTVFASATERDIYTGDRLEITVLNANGTRTEFMELRKD  223



>ref|NP_001238324.1| uncharacterized protein LOC100306148 [Glycine max]
 gb|ACU14187.1| unknown [Glycine max]
Length=223

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD++EIVVLN  G+R E M+L+KD
Sbjct  183   DLVKTVFASATERDIYTGDKVEIVVLNASGIRREYMDLKKD  223



>ref|XP_010056299.1| PREDICTED: proteasome subunit beta type-1 [Eucalyptus grandis]
Length=223

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSELEAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSELEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT F SATERDIYTGD++EIV+LN +G+R E M+LRKD
Sbjct  183   DLVKTVFVSATERDIYTGDKVEIVILNAEGLRREFMDLRKD  223



>ref|XP_008438155.1| PREDICTED: proteasome subunit beta type-1 [Cucumis melo]
Length=223

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSG+TLI P LDNQLKSPSPLL+PAQDS TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSAQGSGSTLITPFLDNQLKSPSPLLLPAQDSSTPLSEAEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEIVVLN DG+R E M+LRKD
Sbjct  183   DLVKTVFASATERDIYTGDKLEIVVLNADGLRREYMDLRKD  223



>ref|XP_004169631.1| PREDICTED: proteasome subunit beta type-1-like, partial [Cucumis 
sativus]
Length=171

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSG+TLI P LDNQLKSPSPLL+PAQDS TPLSE EAI
Sbjct  71    GKGCVFTYDAVGSYERVGYSAQGSGSTLITPFLDNQLKSPSPLLLPAQDSSTPLSEAEAI  130

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEIVVLN DG+R E M LR+D
Sbjct  131   DLVKTVFASATERDIYTGDKLEIVVLNADGLRREYMNLRED  171



>ref|XP_009104277.1| PREDICTED: proteasome subunit beta type-1-like [Brassica rapa]
 emb|CDX67842.1| BnaA07g18820D [Brassica napus]
Length=223

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YE+VGYS+QGSG+TLIMP LDNQLKSPSPLL+PAQD+ITPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYEKVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAQDAITPLSEPEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEI++L  DG+R E MELRKD
Sbjct  183   DLVKTVFASATERDIYTGDKLEIMILKADGIRTEVMELRKD  223



>ref|XP_009116763.1| PREDICTED: proteasome subunit beta type-1 [Brassica rapa]
 emb|CDY52345.1| BnaA09g38940D [Brassica napus]
 emb|CDX71775.1| BnaC08g30990D [Brassica napus]
Length=223

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YE+VGYS+QGSG+TLIMP LDNQLKSPSPLL+PAQD+ITPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYEKVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAQDAITPLSEPEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEI++L  DG+R E MELRKD
Sbjct  183   DLVKTVFASATERDIYTGDKLEIMILKADGIRTEVMELRKD  223



>ref|XP_004506503.1| PREDICTED: proteasome subunit beta type-1-like [Cicer arietinum]
Length=223

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PA+D++TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAKDAVTPLSETEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD LEIV+LN  G+R E M+LRKD
Sbjct  183   DLVKTVFASATERDIYTGDNLEIVILNASGIRREYMDLRKD  223



>gb|KEH28252.1| proteasome subunit beta protein [Medicago truncatula]
Length=166

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  66    GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSETEAV  125

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD++EIV+LN  G+  + M+LRKD
Sbjct  126   DLVKTVFASATERDIYTGDKVEIVILNASGIHRDFMDLRKD  166



>ref|XP_010524362.1| PREDICTED: proteasome subunit beta type-1 [Tarenaya hassleriana]
Length=223

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YE+VGYS+QGSG+TLIMP LDNQLKSPSPLL+PAQD ITPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYEKVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAQDPITPLSESEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEIVVL  DG+  E MELRKD
Sbjct  183   DLVKTVFASATERDIYTGDKLEIVVLKADGIHTELMELRKD  223



>ref|XP_006402541.1| hypothetical protein EUTSA_v10006409mg [Eutrema salsugineum]
 gb|ESQ43994.1| hypothetical protein EUTSA_v10006409mg [Eutrema salsugineum]
Length=224

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YE+VGYS+QGSG+TLIMP LDNQLKSPSPLL+PAQDSITPLSE EA+
Sbjct  124   GKGCVFTYDAVGSYEKVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAQDSITPLSEAEAV  183

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEI+VL  DG R E M+LRKD
Sbjct  184   DLVKTVFASATERDIYTGDKLEIMVLKADGARREVMDLRKD  224



>ref|XP_003532008.1| PREDICTED: proteasome subunit beta type-1-like [Glycine max]
 gb|KHN26879.1| Proteasome subunit beta type-1 [Glycine soja]
Length=223

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD++EIV+LN  G+  E M+LRKD
Sbjct  183   DLVKTVFASATERDIYTGDKVEIVILNASGIHREYMDLRKD  223



>emb|CDY56729.1| BnaCnng31140D [Brassica napus]
Length=223

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YE+VGYS+QGSG+TLIMP LDNQLKSPSPLL+PAQD+ITPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYEKVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAQDAITPLSEPEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEI++L  DG+R E M+LRKD
Sbjct  183   DLVKTVFASATERDIYTGDKLEIMILKADGIRTEVMDLRKD  223



>ref|XP_010692262.1| PREDICTED: proteasome subunit beta type-1 [Beta vulgaris subsp. 
vulgaris]
Length=223

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YE+VGYSSQGSGA LIMP LDNQLKSPSPLL+P QD++TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYEKVGYSSQGSGAKLIMPFLDNQLKSPSPLLLPVQDAVTPLSEPEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD LEI+VLN DG+R E MELRKD
Sbjct  183   DLVKTAFASATERDIYTGDNLEILVLNKDGLRREYMELRKD  223



>gb|AES67685.2| proteasome subunit beta protein [Medicago truncatula]
Length=223

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD++EIV+LN  G+  E M+LRKD
Sbjct  183   DLVKTVFASATERDIYTGDKVEIVILNAGGIHREFMDLRKD  223



>gb|KCW72965.1| hypothetical protein EUGRSUZ_E01416 [Eucalyptus grandis]
Length=296

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSELEAI
Sbjct  196   GKGCVFTYDAVGSYERVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSELEAI  255

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT F SATERDIYTGD++EIV+LN +G+R E M+LRKD
Sbjct  256   DLVKTVFVSATERDIYTGDKVEIVILNAEGLRREFMDLRKD  296



>ref|XP_003597434.1| Proteasome subunit beta type [Medicago truncatula]
Length=231

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  131   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAV  190

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD++EIV+LN  G+  E M+LRKD
Sbjct  191   DLVKTVFASATERDIYTGDKVEIVILNAGGIHREFMDLRKD  231



>ref|XP_004133910.1| PREDICTED: proteasome subunit beta type-1-like [Cucumis sativus]
 gb|KGN56597.1| hypothetical protein Csa_3G126120 [Cucumis sativus]
Length=223

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSG+TLI P LDNQLKSPSPLL+PAQDS TPLSE EAI
Sbjct  123   GKGCVFTYDAVGSYERVGYSAQGSGSTLITPFLDNQLKSPSPLLLPAQDSSTPLSEAEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEIVVLN DG+R E M LR+D
Sbjct  183   DLVKTVFASATERDIYTGDKLEIVVLNADGLRREYMNLRED  223



>ref|XP_006386573.1| hypothetical protein POPTR_0002s14930g [Populus trichocarpa]
 gb|ERP64370.1| hypothetical protein POPTR_0002s14930g [Populus trichocarpa]
Length=178

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = -3

Query  1475  TFNCV*LPYNISGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQ  1296
             TFN + + ++  GKGCV+TYDAVG+YE+VGYS+QGSGA LIMP+LDNQLKSPSPLL+PAQ
Sbjct  67    TFNVL-VGFDEEGKGCVYTYDAVGSYEKVGYSAQGSGAKLIMPVLDNQLKSPSPLLLPAQ  125

Query  1295  DSITPLSELEAIDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             D++TPLSE EAID+VK  FASATERDIYTGD+LEIV+LN DG+R E  ELRKD
Sbjct  126   DAVTPLSEAEAIDVVKDVFASATERDIYTGDKLEIVILNADGMRREYAELRKD  178



>emb|CDX71344.1| BnaC07g06230D [Brassica napus]
Length=223

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  1442  SGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEA  1263
             +GKGCVFTYDAVG+YE+VGYS+QGSG+TLIMP LDNQLKSPSPLL+PAQD+ITPLSE EA
Sbjct  122   NGKGCVFTYDAVGSYEKVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAQDAITPLSEPEA  181

Query  1262  IDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             +DLVKT FASATERDIYTGD+LEI++L  DG++ E M+LRKD
Sbjct  182   VDLVKTVFASATERDIYTGDKLEIMILKADGIKTEVMDLRKD  223



>ref|XP_003616394.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES99352.1| proteasome subunit beta protein [Medicago truncatula]
Length=223

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSETEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD++EIV+LN  G+  + M+LRKD
Sbjct  183   DLVKTVFASATERDIYTGDKVEIVILNASGIHRDFMDLRKD  223



>emb|CDX89080.1| BnaA04g01060D [Brassica napus]
Length=223

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  1442  SGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEA  1263
             +GKGCVFTYDAVG+YE+VGYS+QGSG+TLIMP LDNQLKSPSPLL+PAQD+ITPLSE EA
Sbjct  122   NGKGCVFTYDAVGSYEKVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAQDAITPLSEPEA  181

Query  1262  IDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             +DLVKT FASATERDIYTGD+LEI++L  DG++ E M+LRKD
Sbjct  182   VDLVKTVFASATERDIYTGDKLEIMILKADGIKTEVMDLRKD  223



>ref|XP_009138810.1| PREDICTED: proteasome subunit beta type-1-like [Brassica rapa]
Length=223

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  1442  SGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEA  1263
             +GKGCVFTYDAVG+YE+VGYS+QGSG+TLIMP LDNQLKSPSPLL+PAQD+ITPLSE EA
Sbjct  122   NGKGCVFTYDAVGSYEKVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAQDAITPLSEPEA  181

Query  1262  IDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             +DLVKT FASATERDIYTGD+LEI++L  DG++ E M+LRKD
Sbjct  182   LDLVKTVFASATERDIYTGDKLEIMILKADGIKTEVMDLRKD  223



>ref|XP_002302536.1| Proteasome subunit beta type 1 family protein [Populus trichocarpa]
 gb|ABK94310.1| unknown [Populus trichocarpa]
 gb|EEE81809.1| Proteasome subunit beta type 1 family protein [Populus trichocarpa]
Length=223

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = -3

Query  1475  TFNCV*LPYNISGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQ  1296
             TFN + + ++  GKGCV+TYDAVG+YE+VGYS+QGSGA LIMP+LDNQLKSPSPLL+PAQ
Sbjct  112   TFNVL-VGFDEEGKGCVYTYDAVGSYEKVGYSAQGSGAKLIMPVLDNQLKSPSPLLLPAQ  170

Query  1295  DSITPLSELEAIDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             D++TPLSE EAID+VK  FASATERDIYTGD+LEIV+LN DG+R E  ELRKD
Sbjct  171   DAVTPLSEAEAIDVVKDVFASATERDIYTGDKLEIVILNADGMRREYAELRKD  223



>gb|AFK36140.1| unknown [Medicago truncatula]
Length=237

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD*SSCRRC  1116
             DLVKT FASATERDIYTGD++EIV+LN  G+  E M+LRK  +    C
Sbjct  183   DLVKTVFASATERDIYTGDKVEIVILNAGGIHREFMDLRKTDAFTEEC  230



>gb|KHG09051.1| Proteasome subunit beta type-1 [Gossypium arboreum]
 gb|KHG10143.1| Proteasome subunit beta type-1 [Gossypium arboreum]
Length=223

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YE+VGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPL E EAI
Sbjct  123   GKGCVFTYDAVGSYEKVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLVEAEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASA+ERDIYTGD+LE+V++N  G+R E MELRKD
Sbjct  183   DLVKTVFASASERDIYTGDKLELVIINAAGIRREYMELRKD  223



>ref|XP_002279266.1| PREDICTED: proteasome subunit beta type-1 [Vitis vinifera]
 emb|CBI38855.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YE+VGYSSQGSG+TLIMP LDNQLKSPSPLL+PA D++TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYEKVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPALDAVTPLSEPEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEIV+LN  G+R E M+LRKD
Sbjct  183   DLVKTVFASATERDIYTGDKLEIVILNASGIRREYMDLRKD  223



>ref|XP_011017495.1| PREDICTED: proteasome subunit beta type-1-like [Populus euphratica]
Length=223

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = -3

Query  1475  TFNCV*LPYNISGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQ  1296
             TFN + + ++  GKGCV+TYDAVG+YE+VGYS+QGSGA LIMP+LDNQLKSPSPLL+P+Q
Sbjct  112   TFNVL-VGFDEEGKGCVYTYDAVGSYEKVGYSAQGSGAKLIMPVLDNQLKSPSPLLLPSQ  170

Query  1295  DSITPLSELEAIDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             D++TPLSE EAID+VK  FASATERDIYTGD+LEIV+LN DG+R E  ELRKD
Sbjct  171   DAVTPLSEAEAIDVVKDVFASATERDIYTGDKLEIVILNADGMRREYAELRKD  223



>ref|XP_011034390.1| PREDICTED: proteasome subunit beta type-1 [Populus euphratica]
Length=223

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = -3

Query  1475  TFNCV*LPYNISGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQ  1296
             TFN + + ++  GKGCV+TYDAVG+YE+VGYS+QGSGA LIMP+LDNQLKSPSPLL+PAQ
Sbjct  112   TFNVL-VGFDEEGKGCVYTYDAVGSYEKVGYSAQGSGAKLIMPVLDNQLKSPSPLLLPAQ  170

Query  1295  DSITPLSELEAIDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             D++TPL+E EAID+VK  FASATERDIYTGD+LEIV++N DG+R E  ELRKD
Sbjct  171   DAVTPLTEAEAIDVVKDVFASATERDIYTGDKLEIVIVNADGIRREYAELRKD  223



>ref|XP_010092835.1| Proteasome subunit beta type-1 [Morus notabilis]
 gb|EXB52653.1| Proteasome subunit beta type-1 [Morus notabilis]
Length=223

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YE+VGYS+QGSG+TLIMP+LD QLKSPSPLL+PAQD++TPLSE +AI
Sbjct  123   GKGCVFTYDAVGSYEKVGYSAQGSGSTLIMPVLDKQLKSPSPLLLPAQDAVTPLSEADAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT F +ATERDIYTGD++EIVVLN DG+R E M+LRKD
Sbjct  183   DLVKTVFVAATERDIYTGDKVEIVVLNADGIRHEYMDLRKD  223



>ref|XP_007052046.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Theobroma cacao]
 gb|EOX96203.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Theobroma cacao]
Length=223

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YE+VGYSS GSG+TLIMP LDNQLKSPSPLL+PAQD++TPL E EA+
Sbjct  123   GKGCVFTYDAVGSYEKVGYSSLGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLVEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASA+ERDIYTGD+LEIVV+N DG+  E M+LRKD
Sbjct  183   DLVKTVFASASERDIYTGDKLEIVVINADGIHREYMDLRKD  223



>gb|AEX09185.1| proteasome subunit beta type 1 [Gossypium hirsutum]
Length=223

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV TYDAVG+YE+VGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPL E EAI
Sbjct  123   GKGCVLTYDAVGSYEKVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLVEAEAI  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASA+ERDIYTGD+LE+V++N  G+R E MELRKD
Sbjct  183   DLVKTVFASASERDIYTGDKLELVIINAAGIRREYMELRKD  223



>ref|XP_010934682.1| PREDICTED: proteasome subunit beta type-1-like [Elaeis guineensis]
Length=221

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSG+TL+MP+LDNQLKSPSPLL+PA+D++TPLSE +A+
Sbjct  121   GKGCVFTYDAVGSYERVGYSAQGSGSTLVMPILDNQLKSPSPLLLPARDAVTPLSEADAV  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             D+VK  FASATERDIYTGD+LEIV+LN  GVR E M+LRKD
Sbjct  181   DMVKDVFASATERDIYTGDKLEIVILNASGVRREFMDLRKD  221



>emb|CAA47753.1| proteosome subunit [Arabidopsis thaliana]
Length=230

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGY +QGSG+TLIMP LDNQLKSPSPLL+P QDS TPLSE EA+
Sbjct  130   GKGCVFTYDAVGSYERVGYGAQGSGSTLIMPFLDNQLKSPSPLLLPKQDSNTPLSEAEAV  189

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEI++L  DG++ E M+LRKD
Sbjct  190   DLVKTVFASATERDIYTGDKLEIMILKADGIKTELMDLRKD  230



>ref|XP_006291810.1| hypothetical protein CARUB_v10017986mg [Capsella rubella]
 ref|XP_010512413.1| PREDICTED: proteasome subunit beta type-1 [Camelina sativa]
 ref|XP_010413513.1| PREDICTED: proteasome subunit beta type-1 [Camelina sativa]
 ref|XP_010469142.1| PREDICTED: proteasome subunit beta type-1 [Camelina sativa]
 gb|EOA24708.1| hypothetical protein CARUB_v10017986mg [Capsella rubella]
Length=223

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGY +QGSG+TLIMP LDNQLKSPSPLL+P QDS TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYGAQGSGSTLIMPFLDNQLKSPSPLLLPKQDSNTPLSEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEI++L  DG++ E M+LRKD
Sbjct  183   DLVKTVFASATERDIYTGDKLEIMILKADGIKTELMDLRKD  223



>ref|NP_191641.1| proteasome subunit beta type-1 [Arabidopsis thaliana]
 ref|NP_001190146.1| proteasome subunit beta type-1 [Arabidopsis thaliana]
 ref|XP_002878350.1| hypothetical protein ARALYDRAFT_907612 [Arabidopsis lyrata subsp. 
lyrata]
 sp|P42742.2|PSB1_ARATH RecName: Full=Proteasome subunit beta type-1; AltName: Full=20S 
proteasome beta subunit F-1; AltName: Full=Proteasome component 
5; AltName: Full=Proteasome subunit beta type-6; AltName: 
Full=TAS-F22/FAFP98; AltName: Full=TAS-G39.20 [Arabidopsis 
thaliana]
 emb|CAA56201.1| proteasome subunit [Arabidopsis thaliana]
 gb|AAC32073.1| 20S proteasome beta subunit PBF1 [Arabidopsis thaliana]
 emb|CAB82686.1| proteasome component C5 [Arabidopsis thaliana]
 gb|AAL32868.1| proteasome component C5 [Arabidopsis thaliana]
 gb|AAM10133.1| proteasome component C5 [Arabidopsis thaliana]
 gb|AAM63678.1| proteasome component C5 [Arabidopsis thaliana]
 gb|EFH54609.1| hypothetical protein ARALYDRAFT_907612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE80112.1| proteasome subunit beta type-1 [Arabidopsis thaliana]
 gb|AEE80114.1| proteasome subunit beta type-1 [Arabidopsis thaliana]
Length=223

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGY +QGSG+TLIMP LDNQLKSPSPLL+P QDS TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYGAQGSGSTLIMPFLDNQLKSPSPLLLPKQDSNTPLSEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEI++L  DG++ E M+LRKD
Sbjct  183   DLVKTVFASATERDIYTGDKLEIMILKADGIKTELMDLRKD  223



>ref|XP_010544653.1| PREDICTED: proteasome subunit beta type-1 [Tarenaya hassleriana]
Length=223

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YE+VGYS+QGSG+TLIMP LDNQLKSPSPLL+PA D ITPLS  EA+
Sbjct  123   GKGCVFTYDAVGSYEKVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPAHDPITPLSVSEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYTGD+LEI++L  DG++ E MELRKD
Sbjct  183   DLVKTVFASATERDIYTGDKLEIIILKADGIQTELMELRKD  223



>ref|XP_010940975.1| PREDICTED: proteasome subunit beta type-1 [Elaeis guineensis]
Length=221

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSG+TLIMP+LDNQLKSPSPLL+PA+D++TPLSE +A+
Sbjct  121   GKGCVFTYDAVGSYERVGYSTQGSGSTLIMPVLDNQLKSPSPLLLPARDAVTPLSESDAV  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G+R E +ELRKD
Sbjct  181   DLVKDVFASATERDIYTGDKLEIVVINASGIRREFIELRKD  221



>ref|XP_006856911.1| hypothetical protein AMTR_s00055p00220020 [Amborella trichopoda]
 gb|ERN18378.1| hypothetical protein AMTR_s00055p00220020 [Amborella trichopoda]
Length=229

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSGATLI P+LDNQLK+PSPLL+PA+D+ITPLSE EA+
Sbjct  129   GKGCVFTYDAVGSYERVGYSAQGSGATLITPVLDNQLKTPSPLLLPAKDAITPLSETEAV  188

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             D+VK  FASA ERDIYTGDR+EIVV+N +G+R E +ELRKD
Sbjct  189   DMVKDVFASAAERDIYTGDRVEIVVVNSEGIRREYVELRKD  229



>ref|XP_002320726.2| Proteasome subunit beta type 1 family protein [Populus trichocarpa]
 gb|ABK95948.1| unknown [Populus trichocarpa]
 gb|EEE99041.2| Proteasome subunit beta type 1 family protein [Populus trichocarpa]
Length=223

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = -3

Query  1475  TFNCV*LPYNISGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQ  1296
             TFN V + ++  GKGCV+TYDAVG+YE+VGYS+QGSGA LIMP+LDNQLKSPSPLL+PA 
Sbjct  112   TFN-VLVGFDEEGKGCVYTYDAVGSYEKVGYSAQGSGAKLIMPVLDNQLKSPSPLLLPAL  170

Query  1295  DSITPLSELEAIDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             D++TPL+E EAID+VK  FASATERDIYTGD+LEIV++N DG+R E  ELRKD
Sbjct  171   DAVTPLTEAEAIDVVKDVFASATERDIYTGDKLEIVIVNADGIRREYAELRKD  223



>ref|XP_009401263.1| PREDICTED: proteasome subunit beta type-1-like [Musa acuminata 
subsp. malaccensis]
Length=166

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QG+GA LI+P+LDNQLKSPSPLL+PA+D++TPL E+EA+
Sbjct  66    GKGCVFTYDAVGSYERVGYSAQGTGAGLIIPVLDNQLKSPSPLLLPAKDAVTPLLEMEAV  125

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD++EI+V+N  G+R E MELRKD
Sbjct  126   DLVKDVFASATERDIYTGDKVEILVINASGIRQELMELRKD  166



>ref|XP_008791288.1| PREDICTED: proteasome subunit beta type-1-like [Phoenix dactylifera]
Length=221

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSG+TL+MP+LDNQLK+PSPLL+PA+D++TPLSE +A+
Sbjct  121   GKGCVFTYDAVGSYERVGYSAQGSGSTLVMPILDNQLKTPSPLLLPARDAVTPLSEADAV  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             D+VK  FASATERDIYTGD+LEIV+LN  GVR E ++LRKD
Sbjct  181   DMVKDVFASATERDIYTGDKLEIVILNASGVRREFIDLRKD  221



>ref|XP_008652898.1| PREDICTED: proteasome subunit beta type-1 isoform X4 [Zea mays]
Length=215

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  1451  YNISGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSE  1272
             +N+ GKGCVFTYDAVG+YER GYS+QG+G+TLIMP+LDNQLKSPSPLL+PA+D++TPLSE
Sbjct  111   FNVLGKGCVFTYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPARDAVTPLSE  170

Query  1271  LEAIDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
              EAIDLVK  FASATERDIYTGD+LEIVV+N  G + E ++LRKD
Sbjct  171   SEAIDLVKDVFASATERDIYTGDKLEIVVINKVGTKREYIDLRKD  215



>ref|XP_010277370.1| PREDICTED: proteasome subunit beta type-1 [Nelumbo nucifera]
Length=224

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSG+TLIMP+LDN+LKSPSPLL+PA+D++TPLSE EA+
Sbjct  124   GKGCVFTYDAVGSYERVGYSTQGSGSTLIMPVLDNKLKSPSPLLLPAKDAVTPLSESEAV  183

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASA ERDIY+GD+LEIVV+  DG+R E +E+RKD
Sbjct  184   DLVKDVFASAVERDIYSGDKLEIVVVKADGIRREYLEMRKD  224



>tpg|DAA62176.1| TPA: hypothetical protein ZEAMMB73_205941 [Zea mays]
Length=135

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G+TLIMP+LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  35    GKGCVFTYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPARDAVTPLSESEAI  94

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G + E ++LRKD
Sbjct  95    DLVKDVFASATERDIYTGDKLEIVVINKVGTKREYIDLRKD  135



>tpg|DAA62170.1| TPA: hypothetical protein ZEAMMB73_205941 [Zea mays]
Length=213

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G+TLIMP+LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  113   GKGCVFTYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPARDAVTPLSESEAI  172

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G + E ++LRKD
Sbjct  173   DLVKDVFASATERDIYTGDKLEIVVINKVGTKREYIDLRKD  213



>gb|EMT14457.1| Proteasome subunit beta type-1 [Aegilops tauschii]
Length=221

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV++YDAVG+YER GYS+QGSG+TLIMP+LDNQLKSPSPLLVPA+D++TPLSE EA+
Sbjct  121   GKGCVYSYDAVGSYERTGYSAQGSGSTLIMPVLDNQLKSPSPLLVPARDAVTPLSESEAV  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD++EIVV+N  G R E +ELRKD
Sbjct  181   DLVKDVFASATERDIYTGDKVEIVVINKAGTRREYIELRKD  221



>ref|XP_009380355.1| PREDICTED: proteasome subunit beta type-1-like [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YERVGYS+QG+GA LI+P+LDNQLKSPSPLL+PA+D++TPLSE EA+
Sbjct  121   GKGCVYTYDAVGSYERVGYSAQGTGAGLIIPVLDNQLKSPSPLLLPAKDAVTPLSETEAV  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD++EI+V+N  G+R E MELRKD
Sbjct  181   DLVKDVFASATERDIYTGDKVEIMVINASGIRQELMELRKD  221



>ref|NP_001030905.1| proteasome subunit beta type-1 [Arabidopsis thaliana]
 gb|AEE80113.1| proteasome subunit beta type-1 [Arabidopsis thaliana]
Length=223

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGY +QGSG+TLIMP LDNQLKSPSPLL+P QDS TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYGAQGSGSTLIMPFLDNQLKSPSPLLLPKQDSNTPLSEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVKT FASATERDIYT ++LEI++L  DG++ E M+LRKD
Sbjct  183   DLVKTVFASATERDIYTVNKLEIMILKADGIKTELMDLRKD  223



>gb|EAZ09670.1| hypothetical protein OsI_31953 [Oryza sativa Indica Group]
Length=178

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G+ LIMP+LDNQLKSPSPLL+PA+D++TPLSE EA+
Sbjct  78    GKGCVFTYDAVGSYERTGYSAQGTGSALIMPVLDNQLKSPSPLLLPARDAVTPLSETEAV  137

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G + E ++LRKD
Sbjct  138   DLVKDVFASATERDIYTGDKLEIVVINKAGTKREYIDLRKD  178



>ref|XP_008803997.1| PREDICTED: proteasome subunit beta type-1 [Phoenix dactylifera]
Length=221

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSG+TLI+P+LDNQLKSPSPLL+PA+D +TPLSE +A+
Sbjct  121   GKGCVFTYDAVGSYERVGYSAQGSGSTLIIPVLDNQLKSPSPLLLPARDPVTPLSESDAV  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G+R E ++LRKD
Sbjct  181   DLVKDVFASATERDIYTGDKLEIVVVNASGIRREFIDLRKD  221



>ref|XP_002462632.1| hypothetical protein SORBIDRAFT_02g029260 [Sorghum bicolor]
 gb|EER99153.1| hypothetical protein SORBIDRAFT_02g029260 [Sorghum bicolor]
Length=221

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G+TL+MP+LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  121   GKGCVFTYDAVGSYERTGYSAQGTGSTLMMPVLDNQLKSPSPLLLPARDAVTPLSESEAI  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G + E +ELRKD
Sbjct  181   DLVKDVFASATERDIYTGDKLEIVVINKAGTKREYIELRKD  221



>ref|XP_009383984.1| PREDICTED: proteasome subunit beta type-1 [Musa acuminata subsp. 
malaccensis]
Length=221

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QG+GA LI+P+LDNQLKSPSPLL+PA+D++TPL E EA+
Sbjct  121   GKGCVFTYDAVGSYERVGYSAQGTGAGLIIPVLDNQLKSPSPLLLPAKDAVTPLLESEAV  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD++EIVV+N  G+R E MELRKD
Sbjct  181   DLVKDVFASATERDIYTGDKVEIVVINASGIRQELMELRKD  221



>ref|XP_004957283.1| PREDICTED: proteasome subunit beta type-1-like [Setaria italica]
Length=221

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G++LIMP+LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  121   GKGCVFTYDAVGSYERTGYSAQGTGSSLIMPVLDNQLKSPSPLLLPARDAVTPLSESEAI  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G + E +ELRKD
Sbjct  181   DLVKDVFASATERDIYTGDKLEIVVINKAGTKREYIELRKD  221



>ref|XP_008652897.1| PREDICTED: proteasome subunit beta type-1 isoform X3 [Zea mays]
 tpg|DAA62172.1| TPA: proteasome subunit beta type [Zea mays]
Length=221

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G+TLIMP+LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  121   GKGCVFTYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPARDAVTPLSESEAI  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G + E ++LRKD
Sbjct  181   DLVKDVFASATERDIYTGDKLEIVVINKVGTKREYIDLRKD  221



>tpg|DAA40478.1| TPA: hypothetical protein ZEAMMB73_835212 [Zea mays]
Length=188

 Score =   164 bits (415),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G+TLIMP+LDNQLKSPSPLL+P +D++TPLSE EAI
Sbjct  88    GKGCVFTYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPVRDAVTPLSESEAI  147

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G   E ++LRKD
Sbjct  148   DLVKDVFASATERDIYTGDKLEIVVINKAGTMREYIDLRKD  188



>ref|XP_003574814.1| PREDICTED: proteasome subunit beta type-1-like [Brachypodium 
distachyon]
Length=219

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+GATL+MP+LDNQLKSPSPLL+PA+D++TPLSE EA+
Sbjct  119   GKGCVFTYDAVGSYERTGYSAQGTGATLMMPVLDNQLKSPSPLLLPARDAVTPLSESEAV  178

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD +EIVV+N  G   E +ELRKD
Sbjct  179   DLVKDVFASATERDIYTGDSVEIVVINSSGTHRECIELRKD  219



>ref|XP_003578386.1| PREDICTED: LOW QUALITY PROTEIN: proteasome subunit beta type-1-like 
[Brachypodium distachyon]
Length=221

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV++YDAVG+YER GYS+QG+G+TLIMP+LDNQLKSPSPLL+PA+D++TPLSE EA+
Sbjct  121   GKGCVYSYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPARDAVTPLSESEAV  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD++EIVV+N  G R E +ELRKD
Sbjct  181   DLVKDVFASATERDIYTGDKVEIVVINKAGTRREYIELRKD  221



>ref|XP_006660811.1| PREDICTED: proteasome subunit beta type-1-like [Oryza brachyantha]
Length=221

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G++LIMP+LDNQLKSPSPLL+PA+D++TPLSE EA+
Sbjct  121   GKGCVFTYDAVGSYERTGYSTQGTGSSLIMPVLDNQLKSPSPLLLPARDAVTPLSESEAV  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G++ E ++LRKD
Sbjct  181   DLVKDVFASATERDIYTGDKLEIVVINKAGMKREYIDLRKD  221



>tpg|DAA48191.1| TPA: proteasome subunit beta type [Zea mays]
Length=219

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G+ L+MP+LDNQLKSPSPLL+PA+D++TPLSE +A+
Sbjct  119   GKGCVFTYDAVGSYERTGYSAQGTGSALMMPVLDNQLKSPSPLLLPARDAVTPLSESDAV  178

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGDRLEIVV+N  G   E +ELRKD
Sbjct  179   DLVKDVFASATERDIYTGDRLEIVVINKSGTHREYIELRKD  219



>ref|NP_001063603.1| Os09g0505600 [Oryza sativa Japonica Group]
 sp|O64464.1|PSB1_ORYSJ RecName: Full=Proteasome subunit beta type-1; AltName: Full=20S 
proteasome alpha subunit F; AltName: Full=20S proteasome 
subunit beta-6 [Oryza sativa Japonica Group]
 dbj|BAA28276.1| beta 6 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAF25517.1| Os09g0505600 [Oryza sativa Japonica Group]
 gb|EAZ45289.1| hypothetical protein OsJ_29931 [Oryza sativa Japonica Group]
 dbj|BAG87594.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95912.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G+ LIMP+LDNQLKSPSPLL+PA+D++TPLSE EA+
Sbjct  121   GKGCVFTYDAVGSYERTGYSAQGTGSALIMPVLDNQLKSPSPLLLPARDAVTPLSETEAV  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G + E ++LRKD
Sbjct  181   DLVKDVFASATERDIYTGDKLEIVVINKAGTKREYIDLRKD  221



>gb|ABK21828.1| unknown [Picea sitchensis]
 gb|ABK22793.1| unknown [Picea sitchensis]
 gb|ACN39895.1| unknown [Picea sitchensis]
 gb|ACN40438.1| unknown [Picea sitchensis]
Length=229

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGY +QG+G TL+MP+LDNQLKSPSPLL+PAQD+ TPLSE EA+
Sbjct  129   GKGCVFTYDAVGSYERVGYGAQGTGGTLMMPVLDNQLKSPSPLLLPAQDATTPLSESEAV  188

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASA ERDIYTGD LEIVV+N +GV+ E +ELR+D
Sbjct  189   DLVKDVFASAAERDIYTGDGLEIVVVNAEGVKREFLELRRD  229



>gb|ACG27794.1| proteasome subunit beta type 1 [Zea mays]
Length=221

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G+TLIMP+LDNQLKSPSPLL+P +D++TPLSE EAI
Sbjct  121   GKGCVFTYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPVRDAVTPLSESEAI  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G + E ++LRKD
Sbjct  181   DLVKGVFASATERDIYTGDKLEIVVINKAGTKREYIDLRKD  221



>ref|XP_002445824.1| hypothetical protein SORBIDRAFT_07g026360 [Sorghum bicolor]
 gb|EES15319.1| hypothetical protein SORBIDRAFT_07g026360 [Sorghum bicolor]
Length=219

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -3

Query  1448  NISGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSEL  1269
             +  GKGCVFTYDAVG+YER GYS+QG+G+ L+MP+LDNQLKSPSPLL+PA+D++TPLSE 
Sbjct  116   DTQGKGCVFTYDAVGSYERTGYSAQGTGSALMMPVLDNQLKSPSPLLLPARDAVTPLSES  175

Query  1268  EAIDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             +A+DLVK  FASATERDIYTGDRLEIVV+N  G   E +ELRKD
Sbjct  176   DAVDLVKDVFASATERDIYTGDRLEIVVINSSGTHRECIELRKD  219



>ref|XP_004973989.1| PREDICTED: proteasome subunit beta type-1-like [Setaria italica]
Length=219

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+GA L+MP+LDNQLKSPSPLL+PA+D++TPLSE +A+
Sbjct  119   GKGCVFTYDAVGSYERTGYSAQGTGAALMMPVLDNQLKSPSPLLLPARDAVTPLSESDAV  178

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G   E +ELRKD
Sbjct  179   DLVKDVFASATERDIYTGDKLEIVVINSSGTHRECIELRKD  219



>ref|XP_006659590.1| PREDICTED: proteasome subunit beta type-1-like [Oryza brachyantha]
Length=219

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+GA L+MP+LDNQLKSPSPLL+PA+D++TPLSE +A+
Sbjct  119   GKGCVFTYDAVGSYERTGYSAQGTGAALMMPVLDNQLKSPSPLLLPARDAVTPLSESDAV  178

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G   E +ELRKD
Sbjct  179   DLVKDVFASATERDIYTGDKLEIVVINSSGSHRECIELRKD  219



>ref|NP_001152701.1| proteasome subunit beta type 1 [Zea mays]
 gb|ACF84800.1| unknown [Zea mays]
 gb|ACG24603.1| proteasome subunit beta type 1 [Zea mays]
 gb|ACG49053.1| proteasome subunit beta type 1 [Zea mays]
 gb|ACN31422.1| unknown [Zea mays]
 tpg|DAA40479.1| TPA: proteasome subunit beta type [Zea mays]
Length=221

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G+TLIMP+LDNQLKSPSPLL+P +D++TPLSE EAI
Sbjct  121   GKGCVFTYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPVRDAVTPLSESEAI  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G   E ++LRKD
Sbjct  181   DLVKDVFASATERDIYTGDKLEIVVINKAGTMREYIDLRKD  221



>ref|NP_001147213.1| proteasome subunit beta type 1 [Zea mays]
 gb|ACG26121.1| proteasome subunit beta type 1 [Zea mays]
Length=219

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G+ L+MP+LDNQLKSPSPLL+PA+D++TPLSE +A+
Sbjct  119   GKGCVFTYDAVGSYERTGYSAQGTGSALMMPVLDNQLKSPSPLLLPARDAVTPLSESDAV  178

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGDRLEIVV+N  G   E +ELRKD
Sbjct  179   DLVKDVFASATERDIYTGDRLEIVVINSFGTHRECIELRKD  219



>gb|ACN35998.1| unknown [Zea mays]
Length=221

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GK CVFTYDAVG+YER GYS+QG+G+TLIMP+LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  121   GKECVFTYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPARDAVTPLSESEAI  180

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G + E ++LRKD
Sbjct  181   DLVKDVFASATERDIYTGDKLEIVVINKVGTKREYIDLRKD  221



>gb|EEC83927.1| hypothetical protein OsI_30000 [Oryza sativa Indica Group]
Length=219

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+GA L+MP+LDNQLKSPSPLL+PA+D++TPLS+ +A+
Sbjct  119   GKGCVFTYDAVGSYERTGYSAQGTGAALMMPVLDNQLKSPSPLLLPARDAVTPLSQSDAV  178

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G   E +ELRKD
Sbjct  179   DLVKDVFASATERDIYTGDKLEIVVINSAGSHREFIELRKD  219



>ref|NP_001062318.1| Os08g0529100 [Oryza sativa Japonica Group]
 dbj|BAD09106.1| putative proteasome subunit beta type 1 [Oryza sativa Japonica 
Group]
 dbj|BAF24232.1| Os08g0529100 [Oryza sativa Japonica Group]
 dbj|BAG92264.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69042.1| hypothetical protein OsJ_28037 [Oryza sativa Japonica Group]
Length=219

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+GA L+MP+LDNQLKSPSPLL+PA+D++TPLS+ +A+
Sbjct  119   GKGCVFTYDAVGSYERTGYSAQGTGAALMMPVLDNQLKSPSPLLLPARDAVTPLSQSDAV  178

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  FASATERDIYTGD+LEIVV+N  G   E +ELRKD
Sbjct  179   DLVKDVFASATERDIYTGDKLEIVVINSAGSHREFIELRKD  219



>ref|NP_001276159.1| proteasome subunit beta type-1-like [Glycine max]
 gb|ACU20595.1| unknown [Glycine max]
Length=207

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYSSQGSG+TLIMP LDNQLKSPSPLL+PAQD++TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLE  1194
             DLVKT FASATERDIYTGD+L+
Sbjct  183   DLVKTVFASATERDIYTGDKLK  204



>ref|XP_001775789.1| predicted protein [Physcomitrella patens]
 gb|EDQ59328.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YER GYSSQGSG TLIMP+LDNQLKS SPL++P ++S TPL+E EA+
Sbjct  129   GKGCVYTYDAVGSYERSGYSSQGSGQTLIMPVLDNQLKSASPLVLPPRESSTPLTENEAV  188

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DL+K  FASA ERDIYTGD +EIV++N DG+R E M L++D
Sbjct  189   DLIKDTFASAAERDIYTGDGVEIVIINKDGIRRETMPLKRD  229



>ref|XP_001762412.1| predicted protein [Physcomitrella patens]
 gb|EDQ72879.1| predicted protein [Physcomitrella patens]
Length=237

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YER GYSSQGSG TLIMP+LDNQLKS SPL++P ++S TPL+E EA+
Sbjct  137   GKGCVYTYDAVGSYERSGYSSQGSGQTLIMPVLDNQLKSASPLVLPPRESSTPLTESEAV  196

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DL+K  FASA ERDIYTGD +EIV++N +G+R E M L++D
Sbjct  197   DLIKDTFASAAERDIYTGDGVEIVIINKEGIRRETMALKRD  237



>ref|XP_002970785.1| hypothetical protein SELMODRAFT_94273 [Selaginella moellendorffii]
 ref|XP_002991141.1| hypothetical protein SELMODRAFT_132999 [Selaginella moellendorffii]
 gb|EFJ07787.1| hypothetical protein SELMODRAFT_132999 [Selaginella moellendorffii]
 gb|EFJ28111.1| hypothetical protein SELMODRAFT_94273 [Selaginella moellendorffii]
Length=226

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YER GYS+QGSGA LIMP+LDNQLKS SPLL P +++ TPL+E EA+
Sbjct  126   GKGCVYTYDAVGSYERTGYSTQGSGAELIMPILDNQLKSASPLLYPPRETATPLTEQEAL  185

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             ++VK  FASATER IYTGD LEIVV+N DG+  E ++L+KD
Sbjct  186   EIVKDTFASATERQIYTGDGLEIVVINKDGIHKEYLDLKKD  226



>ref|XP_003080961.1| PSB1_PETHY Proteasome subunit beta type 1 (ISS) [Ostreococcus 
tauri]
 emb|CAL55129.1| Proteasome B-type subunit [Ostreococcus tauri]
Length=233

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKG VFTYDAVG+YER  YS QGSG  LIMP+LDNQLK+ SPL++PA  S TPLSE EAI
Sbjct  133   GKGAVFTYDAVGSYERTNYSCQGSGQALIMPVLDNQLKTVSPLVLPAASSATPLSEQEAI  192

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DL+K CFA+A ERDIYTGD +E+ ++N +GVR EEM LR D
Sbjct  193   DLIKDCFATAAERDIYTGDSVELWIMNAEGVRKEEMALRAD  233



>ref|XP_002986920.1| hypothetical protein SELMODRAFT_124882 [Selaginella moellendorffii]
 gb|EFJ12002.1| hypothetical protein SELMODRAFT_124882 [Selaginella moellendorffii]
Length=226

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YER GYS+QGSGA LIMP+LDNQLKS SPLL P +++ TPL+E EA+
Sbjct  126   GKGCVYTYDAVGSYERTGYSTQGSGAELIMPILDNQLKSASPLLYPPRETATPLTEQEAL  185

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             ++VK  FASATER IYTGD LEIVV+N DG+  E ++L+KD
Sbjct  186   EIVKDTFASATERQIYTGDGLEIVVINKDGIHKEYLDLKKD  226



>ref|XP_002988898.1| hypothetical protein SELMODRAFT_235631 [Selaginella moellendorffii]
 gb|EFJ09927.1| hypothetical protein SELMODRAFT_235631 [Selaginella moellendorffii]
Length=226

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCV+TYDAVG+YER GYS+QGSGA LIMP+LDNQLKS SPLL P +++ TPL+E EA+
Sbjct  126   GKGCVYTYDAVGSYERTGYSTQGSGAELIMPILDNQLKSASPLLYPPRETATPLTEQEAL  185

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             ++VK  FASATER IYTGD LEIVV+N DG+  E ++L+KD
Sbjct  186   EIVKDTFASATERQIYTGDGLEIVVINKDGIHKEYLDLKKD  226



>gb|EPS65527.1| proteasome subunit beta type, partial [Genlisea aurea]
Length=120

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  1448  NISGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSEL  1269
             +  GKGCVFTYDAVG+YERVGYSSQGSGATLI P LDNQLKSPSPLL+PA+D++TPLSE 
Sbjct  41    DTEGKGCVFTYDAVGSYERVGYSSQGSGATLITPFLDNQLKSPSPLLLPAKDAVTPLSES  100

Query  1268  EAIDLVKTCFASATERDIYT  1209
             EAIDLVKTCFASATERDIYT
Sbjct  101   EAIDLVKTCFASATERDIYT  120



>ref|XP_001419449.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97742.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=227

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKG VFTYDAVG+YER  YS QGSG  LIMP+LDNQLK+ SPL++PA  S TPLSE  AI
Sbjct  127   GKGAVFTYDAVGSYERTNYSCQGSGQALIMPVLDNQLKTVSPLVLPAVSSATPLSEAAAI  186

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             +L+K CFA+A ERDIYTGDR+E+ ++N DGVR EEM LR D
Sbjct  187   ELIKDCFATAAERDIYTGDRVELWIMNADGVRKEEMPLRLD  227



>emb|CBI17458.3| unnamed protein product [Vitis vinifera]
Length=162

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 87/115 (76%), Gaps = 9/115 (8%)
 Frame = +2

Query  656  RSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPYMK  835
            RSS P LKVRKEKLGDRIA LQRLVAPFGKTDTASVLTEAIGYI FLHDQIQ L++PYMK
Sbjct  49   RSSYPPLKVRKEKLGDRIAALQRLVAPFGKTDTASVLTEAIGYIQFLHDQIQTLSVPYMK  108

Query  836  SSGDDSHHPHRTSRVVQALNMKNEEGK--TTLDLKSRGLCLVPLSLTSYISSCQM  994
            SS   S  P +       +   +E+GK     DL+SRGLCLVP+S TSYI++C +
Sbjct  109  SSQSKSLVPMQ-------MGSSDEDGKEGAKRDLRSRGLCLVPVSCTSYITACSV  156



>ref|XP_002501776.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63034.1| predicted protein [Micromonas sp. RCC299]
Length=229

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -3

Query  1475  TFNCV*LPYNISGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQ  1296
             TFN V    +  GKG VFTYDAVG+YER  YS QGSG  LIMP+LDNQLK+ SPL++PAQ
Sbjct  118   TFNIV-AGLDAEGKGAVFTYDAVGSYERTNYSCQGSGQGLIMPVLDNQLKTVSPLVLPAQ  176

Query  1295  DSITPLSELEAIDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
              S TPLSE EA+DLVK CFA+A ERDIYTGD +EI ++N DGVR E  EL+ D
Sbjct  177   SSATPLSESEAVDLVKDCFATAGERDIYTGDTVEIWIINKDGVRKEYQELKLD  229



>ref|XP_003058525.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56980.1| predicted protein [Micromonas pusilla CCMP1545]
Length=220

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -3

Query  1475  TFNCV*LPYNISGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQ  1296
             TFN V    +  GKG VFTYDAVG+YER  YS QGSG  LIMP+LDNQLK+ SPL++PAQ
Sbjct  109   TFNIV-AGLDKEGKGAVFTYDAVGSYERTNYSCQGSGQGLIMPVLDNQLKTVSPLVLPAQ  167

Query  1295  DSITPLSELEAIDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
              S TPLSE EA+DLVK CFA+A ERDIYTGD +EI ++N DG+R E  +L+ D
Sbjct  168   SSATPLSESEAVDLVKDCFATAGERDIYTGDSVEIWIINKDGLRKEYQDLKLD  220



>ref|XP_007515487.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14366.1| predicted protein [Bathycoccus prasinos]
Length=243

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKG VFTYDAVG+YER  YS QGSG  LIMP+LDNQLK+ SPL++PA  S TPLSE EAI
Sbjct  143   GKGAVFTYDAVGSYERTNYSCQGSGQQLIMPVLDNQLKTVSPLVLPAVSSATPLSEEEAI  202

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DL+K CFA+A ERDIYTGD +E+ V+N DG+R E M L+ D
Sbjct  203   DLIKDCFATAGERDIYTGDAVELFVMNKDGIRKETMPLKTD  243



>gb|KFK35282.1| hypothetical protein AALP_AA5G264500 [Arabis alpina]
Length=208

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGYS+QGSG+TLIMP LDNQLKSPSPLL+P QDS TPLSE EA+
Sbjct  123   GKGCVFTYDAVGSYERVGYSAQGSGSTLIMPFLDNQLKSPSPLLLPVQDSNTPLSEAEAV  182

Query  1259  DLVKTCFASATERDIYTGDRLEIV  1188
             DLVKT FASATERDIYT     +V
Sbjct  183   DLVKTVFASATERDIYTCKTFHLV  206



>ref|XP_006380772.1| hypothetical protein POPTR_0007s13360g [Populus trichocarpa]
 gb|ERP58569.1| hypothetical protein POPTR_0007s13360g [Populus trichocarpa]
Length=414

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 95/121 (79%), Gaps = 6/121 (5%)
 Frame = +2

Query  626  QSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQ  805
            ++KK R+ + RS CP LKVRKEKLGDRIA LQRLVAP+GKTDTASVLTEAIGYI FLHDQ
Sbjct  296  EAKKNRS-TPRSLCPPLKVRKEKLGDRIAALQRLVAPYGKTDTASVLTEAIGYIQFLHDQ  354

Query  806  IQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
            +Q L++PYMKSS      P RT++V  + N ++ +G+   DL+SRGLCLVPLS  S+ ++
Sbjct  355  VQTLSVPYMKSSNI---QPARTTQV--SSNEEDGKGQQKTDLRSRGLCLVPLSCVSFFNT  409

Query  986  C  988
            C
Sbjct  410  C  410



>emb|CAC43327.1| putative beta6 proteasome subunit [Nicotiana tabacum]
Length=192

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+Y RVGYSSQGSG+TLIMP LD QLKSPSPLL+PA+D++TPLSE EAI
Sbjct  115   GKGCVFTYDAVGSYGRVGYSSQGSGSTLIMPFLDYQLKSPSPLLLPAKDAVTPLSESEAI  174

Query  1259  DLVKTCFASATERDIYTG  1206
             DLVKTCF SATERDIYTG
Sbjct  175   DLVKTCFVSATERDIYTG  192



>ref|XP_011025855.1| PREDICTED: transcription factor bHLH110-like [Populus euphratica]
Length=400

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 95/121 (79%), Gaps = 6/121 (5%)
 Frame = +2

Query  626  QSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQ  805
            ++KK R+ + RS CP LKVRKEKLGDRIA LQRLVAP+GKTDTASVLTEAIGYI FLHDQ
Sbjct  282  EAKKNRS-TPRSLCPPLKVRKEKLGDRIAALQRLVAPYGKTDTASVLTEAIGYIQFLHDQ  340

Query  806  IQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
            +Q L++PYMKSS      P RT++V  + N ++ +G+   DL+SRGLCLVPLS  S+ ++
Sbjct  341  VQTLSVPYMKSSNIK---PARTTQV--SSNEEDGKGQQKRDLRSRGLCLVPLSCVSFFNT  395

Query  986  C  988
            C
Sbjct  396  C  396



>ref|XP_002457528.1| hypothetical protein SORBIDRAFT_03g008830 [Sorghum bicolor]
 gb|EES02648.1| hypothetical protein SORBIDRAFT_03g008830 [Sorghum bicolor]
Length=181

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 93/137 (68%), Gaps = 11/137 (8%)
 Frame = +2

Query  629   SKKPRTGSQRSS-----CPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
             SKKPR   QRSS      P  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGYI F
Sbjct  48    SKKPRV-EQRSSSSTTIVPSFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGYIKF  106

Query  794   LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTS  973
             L DQ++ L+ PY+KSS   S  P  T R     N   E+ +T LDL+SRGLCLVPLS TS
Sbjct  107   LQDQVETLSRPYLKSS--RSKKPKPTQRGCSNANAAGEQEETRLDLRSRGLCLVPLSCTS  164

Query  974   YISS---CQMPMNIYGH  1015
             Y+++     +P N  G+
Sbjct  165   YVTNENGVWVPPNFRGN  181



>ref|XP_009798858.1| PREDICTED: transcription factor bHLH110-like [Nicotiana sylvestris]
Length=369

 Score =   145 bits (366),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 94/129 (73%), Gaps = 8/129 (6%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A   + + SKKPR  SQ SS P+LKVRKEKLGDRI+ L RLVAPFGKTDTASVLTEAIGY
Sbjct  247  AETPAQEVSKKPRITSQ-SSTPMLKVRKEKLGDRISALHRLVAPFGKTDTASVLTEAIGY  305

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FL DQI  L++PY KSS    H  +       +++MK   G+T LDLKSRGLCLVP+S
Sbjct  306  IQFLQDQILTLSMPYTKSSQGKLHQINLKD---SSIDMK---GQTVLDLKSRGLCLVPMS  359

Query  965  LTSYIS-SC  988
             +SYI+ SC
Sbjct  360  FSSYITYSC  368



>ref|XP_010940117.1| PREDICTED: transcription factor bHLH110-like [Elaeis guineensis]
Length=152

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 92/124 (74%), Gaps = 8/124 (6%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            ASH   KKPR  S+ S  P  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  22   ASHTAPKKPRFESRSSFSP-FKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  80

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTS  973
            L  Q++ L++PYMKSS +      + SR  QA+  ++ + ++ LDL+SRGLCLVPLS TS
Sbjct  81   LQHQVETLSVPYMKSSNN------KKSRTTQAVPDEDRD-ESKLDLRSRGLCLVPLSCTS  133

Query  974  YISS  985
            Y++S
Sbjct  134  YVTS  137



>ref|XP_010649107.1| PREDICTED: transcription factor bHLH110-like [Vitis vinifera]
Length=411

 Score =   145 bits (366),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 92/132 (70%), Gaps = 10/132 (8%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  A H  +K    G  RSS P LKVRKEKLGDRIA LQRLVAPFGKTDTASVLTEAIGY
Sbjct  282  APKALHAATKMSGFG-PRSSYPPLKVRKEKLGDRIAALQRLVAPFGKTDTASVLTEAIGY  340

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGK--TTLDLKSRGLCLVP  958
            I FLHDQIQ L++PYMKSS          S V   +   +E+GK     DL+SRGLCLVP
Sbjct  341  IQFLHDQIQTLSVPYMKSS-------QSKSLVPMQMGSSDEDGKEGAKRDLRSRGLCLVP  393

Query  959  LSLTSYISSCQM  994
            +S TSYI++C +
Sbjct  394  VSCTSYITACSV  405



>ref|XP_008652896.1| PREDICTED: proteasome subunit beta type-1 isoform X2 [Zea mays]
 tpg|DAA62171.1| TPA: hypothetical protein ZEAMMB73_205941 [Zea mays]
Length=228

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  1451  YNISGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSE  1272
             +N+ GKGCVFTYDAVG+YER GYS+QG+G+TLIMP+LDNQLKSPSPLL+PA+D++TPLSE
Sbjct  111   FNVLGKGCVFTYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPARDAVTPLSE  170

Query  1271  LEAIDLVKTCFASATERDIYT  1209
              EAIDLVK  FASATERDIYT
Sbjct  171   SEAIDLVKDVFASATERDIYT  191



>ref|XP_011028459.1| PREDICTED: transcription factor bHLH110-like [Populus euphratica]
Length=390

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 91/121 (75%), Gaps = 7/121 (6%)
 Frame = +2

Query  626  QSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQ  805
            ++KK R     SSCP LKVRKEKLGDRIA LQRLVAP+GKTDTASVLTEAIGYI FLHDQ
Sbjct  273  EAKKNRPAP--SSCPTLKVRKEKLGDRIAALQRLVAPYGKTDTASVLTEAIGYIQFLHDQ  330

Query  806  IQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
            +Q +++PYMKSS      P RT++   +   ++ +G+   DL+SRGLCLVPLS  S+ ++
Sbjct  331  VQTMSVPYMKSSNIK---PARTAQACSS--EEDGKGQQKRDLRSRGLCLVPLSCVSFFNT  385

Query  986  C  988
            C
Sbjct  386  C  386



>ref|XP_006340662.1| PREDICTED: transcription factor bHLH110-like [Solanum tuberosum]
Length=349

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 88/128 (69%), Gaps = 11/128 (9%)
 Frame = +2

Query  608  AMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYI  787
            A    + SKKPR  SQ  S  +LKVRKEKLGDRI+ L RLVAPFGKTDTASVLTEAIGYI
Sbjct  231  ATPCQEASKKPRATSQSPSTLMLKVRKEKLGDRISALHRLVAPFGKTDTASVLTEAIGYI  290

Query  788  HFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSL  967
             FL DQI  L++PY KS+    HH          +N+K+   +  +DL+SRGLCLVP S 
Sbjct  291  QFLQDQILTLSMPYTKSTERKLHH----------INLKDSSIQAVVDLESRGLCLVPTSF  340

Query  968  TSYIS-SC  988
            +SYIS SC
Sbjct  341  SSYISPSC  348



>ref|XP_007046833.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOX90990.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=401

 Score =   142 bits (358),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 91/125 (73%), Gaps = 8/125 (6%)
 Frame = +2

Query  620  HQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLH  799
             Q +KK R+ + RS CP LKVRKEKLGDR+A LQ+LVAPFGKTDTA+VLTEAIGYI FLH
Sbjct  279  QQDAKKHRSSTSRSPCPTLKVRKEKLGDRVAALQKLVAPFGKTDTATVLTEAIGYIQFLH  338

Query  800  DQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNE-EGKTTLDLKSRGLCLVPLSLTSY  976
            DQ+Q L++P+MKSS        R  R VQ  + + E + +   DL+SRGLCLVP S  SY
Sbjct  339  DQVQTLSVPFMKSSQS------RLYRTVQVGSNEAEGQEEQKRDLRSRGLCLVPQSYASY  392

Query  977  -ISSC  988
             I+SC
Sbjct  393  FINSC  397



>ref|XP_009392306.1| PREDICTED: transcription factor bHLH110-like [Musa acuminata 
subsp. malaccensis]
Length=154

 Score =   135 bits (340),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 91/126 (72%), Gaps = 7/126 (6%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            +S    +KPR   QRSS    KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  22   SSQTPPRKPRFEQQRSSFSPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  81

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTS  973
            L DQ++ L++PYM+S G       R+  + +A N +++E +   DL+SRGLCLVPLS TS
Sbjct  82   LLDQVEKLSVPYMRSCGSK-----RSRTMEEASNGESDEPRR--DLRSRGLCLVPLSCTS  134

Query  974  YISSCQ  991
            Y+++ Q
Sbjct  135  YVTTEQ  140



>gb|KHG10404.1| Transcription factor protein [Gossypium arboreum]
Length=360

 Score =   141 bits (355),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 89/124 (72%), Gaps = 10/124 (8%)
 Frame = +2

Query  620  HQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLH  799
            H  +KK R+ + RS CP LKVRKEKLGDR+A LQ+LVAPFGKTDTASVLTEAIGYI FLH
Sbjct  242  HIDAKKHRSSTARSPCPTLKVRKEKLGDRVAALQKLVAPFGKTDTASVLTEAIGYIQFLH  301

Query  800  DQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSY-  976
            DQ++ L++P+MKSS          S++ + + M  +E +   DL+SRGLCLVP S   Y 
Sbjct  302  DQVETLSVPFMKSS---------QSKLYRTMQMGLKEEEQKPDLRSRGLCLVPESFAEYF  352

Query  977  ISSC  988
            I+ C
Sbjct  353  INRC  356



>ref|XP_007029396.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein, putative [Theobroma cacao]
 gb|EOY09898.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein, putative [Theobroma cacao]
Length=216

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YERVGY +QG+G+TLIMP LDNQLKSPSPLL+PAQD++T LSE EA+
Sbjct  100   GKGCVFTYDAVGSYERVGYGTQGTGSTLIMPFLDNQLKSPSPLLLPAQDAVTQLSESEAV  159

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNL  1176
             DLV+T +ASATERDIYT     +++ N 
Sbjct  160   DLVRTVYASATERDIYTVSFFFLLISNF  187



>ref|XP_008652895.1| PREDICTED: proteasome subunit beta type-1 isoform X1 [Zea mays]
 tpg|DAA62173.1| TPA: hypothetical protein ZEAMMB73_205941 [Zea mays]
Length=234

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKGCVFTYDAVG+YER GYS+QG+G+TLIMP+LDNQLKSPSPLL+PA+D++TPLSE EAI
Sbjct  121   GKGCVFTYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPARDAVTPLSESEAI  180

Query  1259  DLVKTCFASATERDIYT  1209
             DLVK  FASATERDIYT
Sbjct  181   DLVKDVFASATERDIYT  197



>gb|KHN27030.1| Transcription factor bHLH110 [Glycine soja]
Length=386

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 82/111 (74%), Gaps = 6/111 (5%)
 Frame = +2

Query  656  RSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPYMK  835
            R SCP LKVRKEKLGDRI  LQRLVAPFGKT TASVL+EAIGYIHFLH QIQ L++PYMK
Sbjct  281  RPSCPPLKVRKEKLGDRIQTLQRLVAPFGKTSTASVLSEAIGYIHFLHQQIQTLSIPYMK  340

Query  836  SSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISSC  988
            S+        + SRVVQ  + K +  +   DL+SRGLCLVPLS  S+I  C
Sbjct  341  SAQS------KPSRVVQLDSNKVDRREFKPDLRSRGLCLVPLSYASFIHRC  385



>ref|XP_004232434.2| PREDICTED: transcription factor bHLH110-like [Solanum lycopersicum]
Length=351

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 86/123 (70%), Gaps = 11/123 (9%)
 Frame = +2

Query  623  QQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHD  802
            + SKK R  SQ  S  +LKVRKEKLGDRI+ L RLVAPFGKTDTASVLTEAIGYI FL D
Sbjct  238  EASKKSRVTSQSPSTLMLKVRKEKLGDRISALHRLVAPFGKTDTASVLTEAIGYIQFLQD  297

Query  803  QIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
            QI  L++PY KS          T R +  +N+K+   +  LDL+SRGLCLVP S +SYIS
Sbjct  298  QILTLSMPYSKS----------TERKLHHINLKDSSIEAVLDLESRGLCLVPTSFSSYIS  347

Query  983  -SC  988
             SC
Sbjct  348  QSC  350



>ref|XP_010097031.1| hypothetical protein L484_003630 [Morus notabilis]
 gb|EXB66715.1| hypothetical protein L484_003630 [Morus notabilis]
Length=426

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 88/123 (72%), Gaps = 8/123 (7%)
 Frame = +2

Query  617  SHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFL  796
            SH ++ K      RSS P LKVRKEKLGDRIA L RLVAPFGKTDTASVLTEAIGYI FL
Sbjct  306  SHAEANKKSKSILRSSNPPLKVRKEKLGDRIAALHRLVAPFGKTDTASVLTEAIGYIQFL  365

Query  797  HDQIQALNLPYMKSSGDDSHHPHRTSRVVQAL-NMKN-EEGKTTLDLKSRGLCLVPLSLT  970
            HDQ+Q L++PYMKS         +TSR +Q +  + N EE +  +DL+SRGLCLVP S  
Sbjct  366  HDQVQTLSMPYMKSLQS------KTSRKIQQVYGLSNEEETELKMDLRSRGLCLVPQSCA  419

Query  971  SYI  979
            SY+
Sbjct  420  SYL  422



>emb|CDX95297.1| BnaC04g28610D [Brassica napus]
Length=137

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQ-DSITPLSELEA  1263
             GKGCVFTYDAVG+YE+VGYS+QGSG+TLIMP L    + P+     ++ D+ITPLSE EA
Sbjct  36    GKGCVFTYDAVGSYEKVGYSAQGSGSTLIMPSLTISSRVPARFCFLSRFDTITPLSEPEA  95

Query  1262  IDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             +DLV T FASATERDIYTG +LEI++L  D +R E MELRKD
Sbjct  96    VDLVNTVFASATERDIYTGYKLEIMILKPDDIRTEVMELRKD  137



>ref|XP_006383161.1| hypothetical protein POPTR_0005s12150g [Populus trichocarpa]
 gb|ERP60958.1| hypothetical protein POPTR_0005s12150g [Populus trichocarpa]
Length=394

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 84/112 (75%), Gaps = 7/112 (6%)
 Frame = +2

Query  662  SCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPYMKSS  841
            SCP LKVRKEKLGDRIA LQRLVAP+GKTDTASVLTEAIGYI FLHDQ+Q +++PYMK S
Sbjct  283  SCPTLKVRKEKLGDRIAALQRLVAPYGKTDTASVLTEAIGYIQFLHDQVQTMSVPYMKPS  342

Query  842  GDDSHHPHRTSRVVQALNMKNE-EGKTTLDLKSRGLCLVPLSLTSYISSCQM  994
                    + +R  QA + + + +G+   DL SRGLCLVPLS  S+ ++C +
Sbjct  343  NI------KPARTAQACSSEEDGKGQKKRDLTSRGLCLVPLSCVSFFNTCDV  388



>ref|XP_006383713.1| hypothetical protein POPTR_0005s25240g [Populus trichocarpa]
 gb|ERP61510.1| hypothetical protein POPTR_0005s25240g [Populus trichocarpa]
Length=355

 Score =   138 bits (347),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 88/118 (75%), Gaps = 7/118 (6%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S RS CP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  228  KKSRLES-RSPCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  286

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
             L++PYMKSS +      +TSR +QA +    + ++  DL+SRGLCLVPLS  SY+++
Sbjct  287  TLSVPYMKSSRN------KTSRSIQAASNSGGDQESKRDLRSRGLCLVPLSCMSYVTT  338



>ref|XP_009390169.1| PREDICTED: transcription factor bHLH110-like [Musa acuminata 
subsp. malaccensis]
Length=260

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 83/111 (75%), Gaps = 9/111 (8%)
 Frame = +2

Query  653  QRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPYM  832
            QRSSC   KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL DQ++ L++PYM
Sbjct  143  QRSSCSPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLLDQVEKLSVPYM  202

Query  833  KSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
            +SSG       + SR  Q     NEE K   DL+SRGLCLVPL+ TSY+++
Sbjct  203  RSSGS-----KKRSRTTQ--EASNEEAKR--DLRSRGLCLVPLACTSYMTT  244



>ref|XP_006383714.1| hypothetical protein POPTR_0005s25240g [Populus trichocarpa]
 gb|ERP61511.1| hypothetical protein POPTR_0005s25240g [Populus trichocarpa]
Length=430

 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 88/118 (75%), Gaps = 7/118 (6%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S RS CP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  303  KKSRLES-RSPCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  361

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
             L++PYMKSS +      +TSR +QA +    + ++  DL+SRGLCLVPLS  SY+++
Sbjct  362  TLSVPYMKSSRN------KTSRSIQAASNSGGDQESKRDLRSRGLCLVPLSCMSYVTT  413



>ref|XP_009388096.1| PREDICTED: transcription factor bHLH110-like [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 86/118 (73%), Gaps = 9/118 (8%)
 Frame = +2

Query  638  PRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQAL  817
            PR   QRSSC   KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL DQ++ L
Sbjct  265  PRFQQQRSSCSPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLLDQVEKL  324

Query  818  NLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISSCQ  991
            ++PYM+SSG       + SR  Q     NEE K   DL+SRGLCLVPL+ TSY+++ +
Sbjct  325  SVPYMRSSGSK-----KRSRTTQ--EASNEEAKR--DLRSRGLCLVPLACTSYMTTTE  373



>gb|EYU32900.1| hypothetical protein MIMGU_mgv1a019357mg [Erythranthe guttata]
Length=332

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 7/110 (6%)
 Frame = +2

Query  656  RSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPYMK  835
            R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL  Q++ L++PYMK
Sbjct  210  RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQSQVETLSVPYMK  269

Query  836  SSGDDSHHPHRTSRVVQ-ALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
            SS +      ++SRV++  + M+NE  +   DLKSRGLCLVPLS  SY++
Sbjct  270  SSRN------KSSRVLKVGVPMENENEEQRRDLKSRGLCLVPLSCLSYMT  313



>emb|CDY07280.1| BnaC04g18910D [Brassica napus]
Length=204

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPL-LVPAQDSITPLSELEA  1263
             GK CVFTYDAVG+YE+VGYS+QGSG+TLIMP L    + P     +P  D+ITP SE EA
Sbjct  103   GKSCVFTYDAVGSYEKVGYSAQGSGSTLIMPSLTISSRVPGRFCFLPRFDTITPFSEPEA  162

Query  1262  IDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             +DLV T FASATERDIY GD+LEI++   D +R E MELRKD
Sbjct  163   VDLVNTVFASATERDIYIGDKLEIMIFKADDIRTEVMELRKD  204



>ref|XP_009109789.1| PREDICTED: transcription factor bHLH110 isoform X3 [Brassica 
rapa]
Length=407

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  A    SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  263  APKAGETASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  321

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FL  QI+ L++PYM++S    + P +TS++        EE   T DL+SRGLCLVPLS
Sbjct  322  IKFLQSQIETLSVPYMRAS---RNRPGKTSQLGSIPQEGGEE--ETRDLRSRGLCLVPLS  376

Query  965  LTSYIS  982
              +Y++
Sbjct  377  CMTYVT  382



>ref|XP_011028888.1| PREDICTED: transcription factor bHLH110-like isoform X2 [Populus 
euphratica]
Length=423

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 91/121 (75%), Gaps = 12/121 (10%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S R SCP LK RKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  295  KKSRLES-RVSCPPLKARKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  353

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQAL--NMKN-EEGKTTLDLKSRGLCLVPLSLTSYIS  982
             L++PYMKSSG+      +TSR +QA   N+ + EE K   DL+SRGLCLVPLS  SY++
Sbjct  354  TLSIPYMKSSGN------KTSRSIQAAASNLGDIEEPKR--DLRSRGLCLVPLSCMSYVT  405

Query  983  S  985
            S
Sbjct  406  S  406



>ref|XP_011028887.1| PREDICTED: transcription factor bHLH110-like isoform X1 [Populus 
euphratica]
Length=431

 Score =   138 bits (347),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 91/121 (75%), Gaps = 12/121 (10%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S R SCP LK RKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  303  KKSRLES-RVSCPPLKARKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  361

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQAL--NMKN-EEGKTTLDLKSRGLCLVPLSLTSYIS  982
             L++PYMKSSG+      +TSR +QA   N+ + EE K   DL+SRGLCLVPLS  SY++
Sbjct  362  TLSIPYMKSSGN------KTSRSIQAAASNLGDIEEPKR--DLRSRGLCLVPLSCMSYVT  413

Query  983  S  985
            S
Sbjct  414  S  414



>ref|XP_011048803.1| PREDICTED: transcription factor bHLH110-like isoform X3 [Populus 
euphratica]
 ref|XP_011048804.1| PREDICTED: transcription factor bHLH110-like isoform X3 [Populus 
euphratica]
Length=349

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 90/129 (70%), Gaps = 11/129 (9%)
 Frame = +2

Query  608  AMASHQQSKKPRTG--SQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIG  781
            +M    Q+  P+      RS CP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIG
Sbjct  212  SMMEATQAAAPKKSRLESRSPCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLLEAIG  271

Query  782  YIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQ-ALNMKNEEGKTTLDLKSRGLCLVP  958
            YI FL +Q++ L++PYMKSS +      +TSR +Q A N   EE K   DL+SRGLCLVP
Sbjct  272  YIKFLQNQVETLSVPYMKSSRN------KTSRSIQSASNSGGEESKR--DLRSRGLCLVP  323

Query  959  LSLTSYISS  985
            LS  SY+++
Sbjct  324  LSCMSYVTT  332



>ref|XP_009109790.1| PREDICTED: transcription factor bHLH110 isoform X4 [Brassica 
rapa]
Length=396

 Score =   137 bits (345),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  A    SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  252  APKAGETASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  310

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FL  QI+ L++PYM++S +    P +TS++        EE   T DL+SRGLCLVPLS
Sbjct  311  IKFLQSQIETLSVPYMRASRN---RPGKTSQLGSIPQEGGEE--ETRDLRSRGLCLVPLS  365

Query  965  LTSYIS  982
              +Y++
Sbjct  366  CMTYVT  371



>ref|XP_010936678.1| PREDICTED: transcription factor bHLH110-like [Elaeis guineensis]
Length=388

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 91/124 (73%), Gaps = 8/124 (6%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            AS  + KK R  S RSS    KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  263  ASQTEQKKSRFES-RSSISSFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  321

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTS  973
            L DQ++ L++PY+KSS +      + +R++Q ++   E  K  LDL+SRGLCLVPLS TS
Sbjct  322  LQDQVETLSVPYLKSSNN------KKARIIQEVS-NEERDKPKLDLRSRGLCLVPLSCTS  374

Query  974  YISS  985
            Y+++
Sbjct  375  YVTN  378



>ref|NP_174087.1| transcription factor bHLH110 [Arabidopsis thaliana]
 sp|Q9SFZ3.2|BH110_ARATH RecName: Full=Transcription factor bHLH110; AltName: Full=Basic 
helix-loop-helix protein 110; Short=AtbHLH110; Short=bHLH 
110; AltName: Full=Transcription factor EN 59; AltName: Full=bHLH 
transcription factor bHLH110 [Arabidopsis thaliana]
 gb|AEE30860.1| transcription factor bHLH110 [Arabidopsis thaliana]
Length=453

 Score =   137 bits (346),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 88/124 (71%), Gaps = 6/124 (5%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  A    SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  309  ATKAGENASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  367

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FL  QI+ L++PYM++S +    P + S++V      +EE   T DL+SRGLCLVPLS
Sbjct  368  IKFLQSQIETLSVPYMRASRN---RPGKASQLVSQSQEGDEE--ETRDLRSRGLCLVPLS  422

Query  965  LTSY  976
              +Y
Sbjct  423  CMTY  426



>ref|XP_009109787.1| PREDICTED: transcription factor bHLH110 isoform X1 [Brassica 
rapa]
Length=440

 Score =   137 bits (345),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  A    SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  296  APKAGETASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  354

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FL  QI+ L++PYM++S +    P +TS++        EE   T DL+SRGLCLVPLS
Sbjct  355  IKFLQSQIETLSVPYMRASRN---RPGKTSQLGSIPQEGGEE--ETRDLRSRGLCLVPLS  409

Query  965  LTSYIS  982
              +Y++
Sbjct  410  CMTYVT  415



>ref|XP_009624505.1| PREDICTED: transcription factor bHLH110-like isoform X1 [Nicotiana 
tomentosiformis]
Length=412

 Score =   137 bits (344),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 91/129 (71%), Gaps = 8/129 (6%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A   + + SKKPR  SQ SS P+LKVRKEKLG RI+ L RLVAPFGKTDTASVLTEAIGY
Sbjct  290  AENPAQEVSKKPRITSQ-SSTPMLKVRKEKLGHRISALHRLVAPFGKTDTASVLTEAIGY  348

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FL DQI  L++PY KSS    H  +       +++MK   G+   DLKSRGLCLVP+S
Sbjct  349  IQFLQDQILTLSMPYAKSSKGKLHQINLKD---SSIDMK---GQAVQDLKSRGLCLVPMS  402

Query  965  LTSYIS-SC  988
             +SYI+ SC
Sbjct  403  FSSYITYSC  411



>ref|XP_006599357.1| PREDICTED: transcription factor bHLH110-like isoform X1 [Glycine 
max]
 ref|XP_006599358.1| PREDICTED: transcription factor bHLH110-like isoform X2 [Glycine 
max]
Length=315

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 82/112 (73%), Gaps = 7/112 (6%)
 Frame = +2

Query  656  RSSCPVLK-VRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPYM  832
            R SCP LK VRKEKLGDRI  LQRLVAPFGKT TASVL+EAIGYIHFLH QIQ L++PYM
Sbjct  209  RPSCPPLKQVRKEKLGDRIQTLQRLVAPFGKTSTASVLSEAIGYIHFLHQQIQTLSIPYM  268

Query  833  KSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISSC  988
            KS+        + SRVVQ  + K +  +   DL+SRGLCLVPLS  S+I  C
Sbjct  269  KSAQS------KPSRVVQLDSNKVDRREFKPDLRSRGLCLVPLSYASFIHRC  314



>ref|XP_011048801.1| PREDICTED: transcription factor bHLH110-like isoform X1 [Populus 
euphratica]
Length=424

 Score =   137 bits (344),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 88/119 (74%), Gaps = 10/119 (8%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S RS CP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  298  KKSRLES-RSPCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLLEAIGYIKFLQNQVE  356

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQ-ALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
             L++PYMKSS +      +TSR +Q A N   EE K   DL+SRGLCLVPLS  SY+++
Sbjct  357  TLSVPYMKSSRN------KTSRSIQSASNSGGEESKR--DLRSRGLCLVPLSCMSYVTT  407



>ref|XP_006415743.1| hypothetical protein EUTSA_v10007594mg [Eutrema salsugineum]
 gb|ESQ34096.1| hypothetical protein EUTSA_v10007594mg [Eutrema salsugineum]
Length=456

 Score =   137 bits (345),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 91/126 (72%), Gaps = 6/126 (5%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  A    SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  312  ATKAGENASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  370

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I+FL +QI+ L++PYM++S    + P + S++       +EE   T DL+SRGLCLVPLS
Sbjct  371  INFLQNQIETLSVPYMRAS---RNRPGKASQLGSLPQEGDEE--ETRDLRSRGLCLVPLS  425

Query  965  LTSYIS  982
              +Y++
Sbjct  426  CMTYVT  431



>ref|XP_010478110.1| PREDICTED: transcription factor bHLH110 isoform X2 [Camelina 
sativa]
Length=387

 Score =   136 bits (342),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 91/128 (71%), Gaps = 10/128 (8%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  A    SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  243  ATKAGENASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  301

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEG--KTTLDLKSRGLCLVP  958
            I FL  QI+ L++PYM++S +      R ++  Q L  + +EG  + T DL+SRGLCLVP
Sbjct  302  IKFLQSQIETLSVPYMRASKN------RPAKASQ-LGSQPQEGDDEETRDLRSRGLCLVP  354

Query  959  LSLTSYIS  982
            LS  +Y++
Sbjct  355  LSCMTYVT  362



>gb|KDP38547.1| hypothetical protein JCGZ_04472 [Jatropha curcas]
Length=453

 Score =   137 bits (344),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 88/123 (72%), Gaps = 3/123 (2%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            A+    KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  313  ATQAAQKKSRLES-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  371

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTS  973
            L +Q++ L++PYM+SS   +    RT++  Q    + E+ +   DL+SRGLCLVPLS  S
Sbjct  372  LQNQVETLSVPYMRSSRKKTS--TRTAQTFQGSGPEEEDDEPRKDLRSRGLCLVPLSCMS  429

Query  974  YIS  982
            YI+
Sbjct  430  YIT  432



>ref|XP_010254734.1| PREDICTED: transcription factor bHLH110-like isoform X1 [Nelumbo 
nucifera]
Length=423

 Score =   136 bits (343),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 91/128 (71%), Gaps = 12/128 (9%)
 Frame = +2

Query  608  AMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYI  787
            A  S   +KKPR  S RSS P  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGYI
Sbjct  288  AKLSQAATKKPRFES-RSSFPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGYI  346

Query  788  HFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALN---MKNEEGKTTLDLKSRGLCLVP  958
             FL DQ++ L++PYMKSS        +T R +Q  +    +NEE K   DL+SRGLCLVP
Sbjct  347  KFLQDQVETLSVPYMKSSRS------KTCRTMQGGSGDGERNEEPKR--DLRSRGLCLVP  398

Query  959  LSLTSYIS  982
            LS TSY++
Sbjct  399  LSCTSYVT  406



>ref|XP_008440761.1| PREDICTED: transcription factor bHLH110-like isoform X1 [Cucumis 
melo]
Length=357

 Score =   135 bits (340),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 89/129 (69%), Gaps = 12/129 (9%)
 Frame = +2

Query  608  AMASHQQSKKPRT----GSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEA  775
            +M+  ++S  P +     + RSSCP LKVRKEKLGDRI+ LQRLVAPFGKTDT+SVLTEA
Sbjct  232  SMSEPKKSNNPESKKSCSTSRSSCPPLKVRKEKLGDRISALQRLVAPFGKTDTSSVLTEA  291

Query  776  IGYIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEG-KTTLDLKSRGLCL  952
            IGYI FLHDQ++ L++PY+ SS    +   +   +        EEG K   DL+SRGLCL
Sbjct  292  IGYIQFLHDQVETLSMPYLGSSQSKPYQKQQPGSI-------QEEGTKPRQDLRSRGLCL  344

Query  953  VPLSLTSYI  979
            +PLS  S+I
Sbjct  345  MPLSCASFI  353



>emb|CDX90101.1| BnaA08g18830D [Brassica napus]
Length=460

 Score =   137 bits (344),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  A    SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  316  APKAGETASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  374

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FL  QI+ L++PYM++S +    P +TS++        EE   T DL+SRGLCLVPLS
Sbjct  375  IKFLQSQIETLSVPYMRASRN---RPGKTSQLGSIPQEGGEE--ETRDLRSRGLCLVPLS  429

Query  965  LTSYIS  982
              +Y++
Sbjct  430  CMTYVT  435



>ref|XP_002890742.1| hypothetical protein ARALYDRAFT_472970 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67001.1| hypothetical protein ARALYDRAFT_472970 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   137 bits (344),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 91/128 (71%), Gaps = 10/128 (8%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A       SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  305  ATKVGENASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  363

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEG--KTTLDLKSRGLCLVP  958
            I FL  QI+ L++PYM++S +      RT +  Q L  +++EG  + T DL+SRGLCLVP
Sbjct  364  IKFLQSQIETLSVPYMRASRN------RTGKASQ-LGSQSQEGDEEETRDLRSRGLCLVP  416

Query  959  LSLTSYIS  982
            LS  +Y++
Sbjct  417  LSCMTYVT  424



>ref|XP_003520288.2| PREDICTED: transcription factor bHLH111-like isoform X1 [Glycine 
max]
Length=374

 Score =   135 bits (340),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 82/116 (71%), Gaps = 6/116 (5%)
 Frame = +2

Query  641  RTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALN  820
            +    R SCP LKVRKEKLGDRI  LQRLVAPFGKT TA VL+EAIGYIHFLH QIQ L+
Sbjct  264  KVKKSRPSCPPLKVRKEKLGDRIQTLQRLVAPFGKTSTAYVLSEAIGYIHFLHQQIQTLS  323

Query  821  LPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISSC  988
            +PYMKS+        + SR+VQ  + K +  +   DL+SRGLCLVPLS  S+I  C
Sbjct  324  IPYMKSAQS------KPSRMVQLDSNKVDRREFMPDLRSRGLCLVPLSYASFIHRC  373



>ref|XP_010478109.1| PREDICTED: transcription factor bHLH110 isoform X1 [Camelina 
sativa]
Length=449

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 91/128 (71%), Gaps = 10/128 (8%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  A    SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  305  ATKAGENASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  363

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEG--KTTLDLKSRGLCLVP  958
            I FL  QI+ L++PYM++S +      R ++  Q L  + +EG  + T DL+SRGLCLVP
Sbjct  364  IKFLQSQIETLSVPYMRASKN------RPAKASQ-LGSQPQEGDDEETRDLRSRGLCLVP  416

Query  959  LSLTSYIS  982
            LS  +Y++
Sbjct  417  LSCMTYVT  424



>ref|XP_008795968.1| PREDICTED: transcription factor bHLH110 [Phoenix dactylifera]
Length=394

 Score =   135 bits (340),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 93/124 (75%), Gaps = 8/124 (6%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            AS    KKPR  S RSS    KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  264  ASQTAPKKPRFES-RSSFSPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  322

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTS  973
            L  QI+ L++PYM+SS +      + SR +Q ++ ++++ ++ LDL+SRGLCLVPLS TS
Sbjct  323  LQHQIETLSVPYMRSSNN------KKSRTMQGVSDEDKD-ESKLDLRSRGLCLVPLSCTS  375

Query  974  YISS  985
            Y++S
Sbjct  376  YVTS  379



>ref|XP_006307468.1| hypothetical protein CARUB_v10009095mg [Capsella rubella]
 gb|EOA40366.1| hypothetical protein CARUB_v10009095mg [Capsella rubella]
Length=453

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  +    SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  309  ATKSGENASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  367

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FL  QI+ L++PYM++S    + P + S++       +EE   T DL+SRGLCLVPLS
Sbjct  368  IKFLQSQIETLSVPYMRAS---RNRPGKASQLGSQPQEGDEE--ETRDLRSRGLCLVPLS  422

Query  965  LTSYIS  982
              SY++
Sbjct  423  CMSYVT  428



>ref|XP_006307469.1| hypothetical protein CARUB_v10009095mg [Capsella rubella]
 gb|EOA40367.1| hypothetical protein CARUB_v10009095mg [Capsella rubella]
Length=455

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  +    SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  311  ATKSGENASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  369

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FL  QI+ L++PYM++S    + P + S++       +EE   T DL+SRGLCLVPLS
Sbjct  370  IKFLQSQIETLSVPYMRAS---RNRPGKASQLGSQPQEGDEE--ETRDLRSRGLCLVPLS  424

Query  965  LTSYIS  982
              SY++
Sbjct  425  CMSYVT  430



>ref|XP_011083625.1| PREDICTED: transcription factor bHLH110 [Sesamum indicum]
Length=433

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 92/138 (67%), Gaps = 17/138 (12%)
 Frame = +2

Query  602  GAAMASHQQSK-KPRTGSQ----------RSSCPVLKVRKEKLGDRIAGLQRLVAPFGKT  748
            GAA A    SK +P+   Q          R+SCP  KVRKEKLGDRIA LQ+LVAPFGKT
Sbjct  285  GAAEAKRSSSKTEPKAPLQSAPKKSRLEARASCPPFKVRKEKLGDRIAALQQLVAPFGKT  344

Query  749  DTASVLTEAIGYIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLD  928
            DTASVL EAIGYI FL +Q++ L++PYMK+S +      ++SR ++     NE  +   D
Sbjct  345  DTASVLMEAIGYIKFLQNQVETLSVPYMKASRN------KSSRAMKGGPTDNEHEEPKRD  398

Query  929  LKSRGLCLVPLSLTSYIS  982
            LKSRGLCLVPLS  SYI+
Sbjct  399  LKSRGLCLVPLSCLSYIT  416



>ref|XP_004150000.1| PREDICTED: uncharacterized protein LOC101208178 [Cucumis sativus]
 ref|XP_004170476.1| PREDICTED: uncharacterized LOC101208178 [Cucumis sativus]
 gb|KGN48870.1| hypothetical protein Csa_6G504510 [Cucumis sativus]
Length=356

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 89/128 (70%), Gaps = 10/128 (8%)
 Frame = +2

Query  608  AMASHQQSKKPRT----GSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEA  775
            +M+  ++S  P +     + R+SCP LKVRKEKLGDRI+ LQRLVAPFGKTDT+SVLTEA
Sbjct  231  SMSEPKKSNNPESKKSCSTSRTSCPPLKVRKEKLGDRISALQRLVAPFGKTDTSSVLTEA  290

Query  776  IGYIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLV  955
            IGYI FLHDQ++ L++PY+ SS    +         Q  +++ E  K   DL+SRGLCL+
Sbjct  291  IGYIQFLHDQVETLSMPYLGSSQSKPYQKQ------QPGSIQEEGTKPRQDLRSRGLCLM  344

Query  956  PLSLTSYI  979
            PLS  S+I
Sbjct  345  PLSCASFI  352



>ref|XP_007223238.1| hypothetical protein PRUPE_ppa005486mg [Prunus persica]
 gb|EMJ24437.1| hypothetical protein PRUPE_ppa005486mg [Prunus persica]
Length=458

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 89/119 (75%), Gaps = 8/119 (7%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S R++CP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  329  KKSRLES-RTACPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  387

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQ-ALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
             L++PYMKSS +      ++S+ +Q  +   NE  +T  DL+SRGLCLVPLS  SY++S
Sbjct  388  TLSVPYMKSSRN------KSSKTMQGGVTEINENDETKRDLRSRGLCLVPLSCMSYVTS  440



>emb|CDY11774.1| BnaC03g58040D [Brassica napus]
Length=462

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  A    SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  318  APKAGETASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  376

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FL  QI+ L++PYM++S +    P + S++       +EE   T DL+SRGLCLVPLS
Sbjct  377  IKFLQSQIETLSVPYMRASRN---RPGKASQLGSIPQEGDEE--ETRDLRSRGLCLVPLS  431

Query  965  LTSYIS  982
              +Y++
Sbjct  432  CMTYVT  437



>ref|XP_007017613.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY14838.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=425

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 91/123 (74%), Gaps = 6/123 (5%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            A+   +KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  290  ATAAATKKSRLES-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  348

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTS  973
            L +Q++ L++PYMKSS +++    R+++    +   NEE K   DL+SRGLCLVPLS  S
Sbjct  349  LQNQVETLSVPYMKSSRNNA---SRSNQGGSTMEDGNEEPKR--DLRSRGLCLVPLSCMS  403

Query  974  YIS  982
            Y++
Sbjct  404  YVT  406



>ref|XP_006435050.1| hypothetical protein CICLE_v10001291mg [Citrus clementina]
 gb|ESR48290.1| hypothetical protein CICLE_v10001291mg [Citrus clementina]
Length=419

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 90/124 (73%), Gaps = 8/124 (6%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            A+   SKK R  S R+SCP +KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  285  ATQFASKKSRLES-RASCPPMKVRKEKLGDRIAALQQLVAPFGKTDTASVLLEAIGYIKF  343

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNM-KNEEGKTTLDLKSRGLCLVPLSLT  970
            L +Q++ L++PYMKSS        R SR +Q  ++  N + +   DL+SRGLCLVPLS  
Sbjct  344  LQNQVETLSVPYMKSSRS------RPSRTMQGGSIAANGDEEPKRDLRSRGLCLVPLSCM  397

Query  971  SYIS  982
            SY++
Sbjct  398  SYVT  401



>ref|XP_006473548.1| PREDICTED: transcription factor bHLH110-like [Citrus sinensis]
Length=431

 Score =   134 bits (337),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 88/123 (72%), Gaps = 6/123 (5%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            A+   SKK R  S R+SCP +KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  297  ATQFASKKSRLES-RASCPPMKVRKEKLGDRIAALQQLVAPFGKTDTASVLLEAIGYIKF  355

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTS  973
            L +Q++ L++PYMKSS      P RT +        +EE K   DL+SRGLCLVPLS  S
Sbjct  356  LQNQVETLSVPYMKSS---RSKPSRTMQGGSIAANGDEEPKR--DLRSRGLCLVPLSCMS  410

Query  974  YIS  982
            Y++
Sbjct  411  YVT  413



>gb|KFK36171.1| hypothetical protein AALP_AA4G087200 [Arabis alpina]
Length=452

 Score =   134 bits (338),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  AS   SKKPR  S RSSCP  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGY
Sbjct  308  ATKASENASKKPRVES-RSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGY  366

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FL  QI+ L++PYM+++ +    P + S++       +EE     DL+SRGLCLVPLS
Sbjct  367  IKFLQSQIETLSVPYMRAARN---RPGKASQLGSLPQEGDEE--EMRDLRSRGLCLVPLS  421

Query  965  LTSYIS  982
              +Y++
Sbjct  422  CMTYVT  427



>ref|XP_008784940.1| PREDICTED: transcription factor bHLH110-like [Phoenix dactylifera]
Length=393

 Score =   133 bits (334),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 91/125 (73%), Gaps = 10/125 (8%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            AS  + KK R  S RSS    KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  263  ASQTEPKKTRFES-RSSFSPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  321

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQAL-NMKNEEGKTTLDLKSRGLCLVPLSLT  970
            L DQ++ L++PY++SS +      + +R  Q + N K +E K  LDL+SRGLCLVPLS T
Sbjct  322  LQDQVETLSVPYLRSSNN------KKARTTQGVSNEKRDEPK--LDLRSRGLCLVPLSCT  373

Query  971  SYISS  985
            SY++S
Sbjct  374  SYVTS  378



>ref|XP_009335970.1| PREDICTED: transcription factor bHLH110 [Pyrus x bretschneideri]
 ref|XP_009335979.1| PREDICTED: transcription factor bHLH110 [Pyrus x bretschneideri]
 ref|XP_009335986.1| PREDICTED: transcription factor bHLH110 [Pyrus x bretschneideri]
Length=455

 Score =   134 bits (336),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 86/119 (72%), Gaps = 9/119 (8%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  320  KKSRLES-RTSCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  378

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMK--NEEGKTTLDLKSRGLCLVPLSLTSYIS  982
             L++PYMKSS +      +TS+ +    M   N  G+T  DL SRGLCLVPLS  SY++
Sbjct  379  TLSVPYMKSSRN------KTSKTILQGGMAEINGNGETKRDLISRGLCLVPLSCMSYVT  431



>ref|XP_007156084.1| hypothetical protein PHAVU_003G257100g [Phaseolus vulgaris]
 gb|ESW28078.1| hypothetical protein PHAVU_003G257100g [Phaseolus vulgaris]
Length=372

 Score =   132 bits (333),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 89/122 (73%), Gaps = 13/122 (11%)
 Frame = +2

Query  623  QQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHD  802
            ++S+     S+ SSCP LK+RKEKLGDRI  LQRLVAPFGKT TASVL+EAIGYIHFLH 
Sbjct  263  KESEAKAKKSRPSSCPPLKIRKEKLGDRIQTLQRLVAPFGKTSTASVLSEAIGYIHFLHQ  322

Query  803  QIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
            QIQ L+ PYMKS+        +++R++Q   + ++E KT  DL+SRGLCLVP S  S+I 
Sbjct  323  QIQTLSTPYMKST--------QSNRMMQ---LGSKELKT--DLRSRGLCLVPFSYASFIH  369

Query  983  SC  988
             C
Sbjct  370  RC  371



>ref|XP_004967935.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Setaria 
italica]
Length=420

 Score =   133 bits (334),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 85/118 (72%), Gaps = 5/118 (4%)
 Frame = +2

Query  632  KKPRTGSQRSS-CPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQI  808
            KKPR  S+ S+  P  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGYI FL DQ+
Sbjct  293  KKPRVESRASTIVPSFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGYIKFLQDQV  352

Query  809  QALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
            + L+ PY+KSS +    P  T R     N   EE  T LDL+SRGLCLVPLS TSY++
Sbjct  353  ETLSGPYLKSSRNKK--PRTTQRGPSDANGGEEE--TRLDLRSRGLCLVPLSCTSYVT  406



>ref|XP_004967934.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Setaria 
italica]
Length=421

 Score =   133 bits (334),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 85/118 (72%), Gaps = 5/118 (4%)
 Frame = +2

Query  632  KKPRTGSQRSS-CPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQI  808
            KKPR  S+ S+  P  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGYI FL DQ+
Sbjct  294  KKPRVESRASTIVPSFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGYIKFLQDQV  353

Query  809  QALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
            + L+ PY+KSS +    P  T R     N   EE  T LDL+SRGLCLVPLS TSY++
Sbjct  354  ETLSGPYLKSSRNKK--PRTTQRGPSDANGGEEE--TRLDLRSRGLCLVPLSCTSYVT  407



>ref|XP_010664722.1| PREDICTED: transcription factor bHLH110 isoform X1 [Vitis vinifera]
Length=430

 Score =   133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 89/124 (72%), Gaps = 3/124 (2%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            A+    KK R  S R+SCP +KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  293  ATQATPKKSRLES-RASCPPIKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  351

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTS  973
            L +Q++ L++PYMKSS + S    +  R   A    +EE +   DL+SRGLCLVPLS  S
Sbjct  352  LQNQVETLSVPYMKSSRNKSSISMQGVRKGSADGEGSEEPRR--DLRSRGLCLVPLSCMS  409

Query  974  YISS  985
            Y+++
Sbjct  410  YVTT  413



>ref|XP_002307676.2| hypothetical protein POPTR_0005s25240g [Populus trichocarpa]
 gb|EEE94672.2| hypothetical protein POPTR_0005s25240g [Populus trichocarpa]
Length=419

 Score =   133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 84/118 (71%), Gaps = 18/118 (15%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S RS CP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  303  KKSRLES-RSPCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  361

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
             L++PYMKSS +      +TSR +QA            DL+SRGLCLVPLS  SY+++
Sbjct  362  TLSVPYMKSSRN------KTSRSIQA-----------RDLRSRGLCLVPLSCMSYVTT  402



>ref|XP_008388027.1| PREDICTED: transcription factor bHLH110-like [Malus domestica]
 ref|XP_008388028.1| PREDICTED: transcription factor bHLH110-like [Malus domestica]
Length=455

 Score =   133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 86/119 (72%), Gaps = 9/119 (8%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  320  KKSRLES-RNSCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  378

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMK--NEEGKTTLDLKSRGLCLVPLSLTSYIS  982
             L++PYMKSS +      +TS+ +    M   N  G+T  DL SRGLCLVPLS  SY++
Sbjct  379  TLSVPYMKSSRN------KTSKTILQGGMAEINGNGETKRDLISRGLCLVPLSCMSYVT  431



>ref|XP_008377204.1| PREDICTED: transcription factor bHLH110 [Malus domestica]
Length=452

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 85/118 (72%), Gaps = 8/118 (7%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  319  KKSRLES-RTSCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  377

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGK-TTLDLKSRGLCLVPLSLTSYIS  982
             L++PYMKSS +      +TS+ +    M    G   T DL+SRGLCLVPLS  SY++
Sbjct  378  TLSVPYMKSSRN------KTSKTILQGGMAEINGNGETRDLRSRGLCLVPLSCMSYVT  429



>ref|XP_006847529.1| hypothetical protein AMTR_s00014p00103240 [Amborella trichopoda]
 gb|ERN09110.1| hypothetical protein AMTR_s00014p00103240 [Amborella trichopoda]
Length=385

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 90/130 (69%), Gaps = 3/130 (2%)
 Frame = +2

Query  602  GAAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIG  781
            G+  AS   SK+ R     SS P  KVR+EKLGDRI  LQ+LVAPFGKTDTASVL EAIG
Sbjct  242  GSTTASEAPSKR-RRFEASSSFPPFKVRREKLGDRITALQQLVAPFGKTDTASVLMEAIG  300

Query  782  YIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNM--KNEEGKTTLDLKSRGLCLV  955
            YI FL +Q++ L++PYMK SG +++   R S   +  N   K+ +G+   DLKSRGLCLV
Sbjct  301  YIKFLQEQVETLSVPYMKLSGSNANAGRRRSHGDRTKNEGDKDGDGEPKRDLKSRGLCLV  360

Query  956  PLSLTSYISS  985
            PLS T+ ++S
Sbjct  361  PLSCTTLVTS  370



>ref|XP_006574695.1| PREDICTED: transcription factor bHLH111-like isoform X2 [Glycine 
max]
Length=375

 Score =   130 bits (328),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +2

Query  656  RSSCPVLK-VRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPYM  832
            R SCP LK VRKEKLGDRI  LQRLVAPFGKT TA VL+EAIGYIHFLH QIQ L++PYM
Sbjct  269  RPSCPPLKQVRKEKLGDRIQTLQRLVAPFGKTSTAYVLSEAIGYIHFLHQQIQTLSIPYM  328

Query  833  KSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISSC  988
            KS+        + SR+VQ  + K +  +   DL+SRGLCLVPLS  S+I  C
Sbjct  329  KSAQS------KPSRMVQLDSNKVDRREFMPDLRSRGLCLVPLSYASFIHRC  374



>ref|XP_009790800.1| PREDICTED: transcription factor bHLH110 [Nicotiana sylvestris]
Length=411

 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 89/127 (70%), Gaps = 13/127 (10%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            A     KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  278  APQNAPKKSRVDS-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  336

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQA----LNMKNEEGKTTLDLKSRGLCLVPL  961
            L +Q++ L++PYMKSS +      +TSR +      +N  +EE K   DL+SRGLCLVPL
Sbjct  337  LQNQVETLSVPYMKSSRN------KTSRSLHGGGGEMNGSSEELKR--DLRSRGLCLVPL  388

Query  962  SLTSYIS  982
            S  +Y++
Sbjct  389  SCLTYMT  395



>emb|CDP07480.1| unnamed protein product [Coffea canephora]
Length=441

 Score =   131 bits (330),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 85/120 (71%), Gaps = 6/120 (5%)
 Frame = +2

Query  623  QQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHD  802
            Q + K      R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +
Sbjct  312  QAAPKRSRSESRASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQN  371

Query  803  QIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
            Q++ L++PY+KSS +      ++SR V    ++N   +   DL+SRGLCLVP+S  SY++
Sbjct  372  QVETLSVPYLKSSRN------KSSRTVHGGAVENGGEERKRDLRSRGLCLVPMSCLSYVA  425



>ref|XP_004291848.1| PREDICTED: transcription factor bHLH110-like [Fragaria vesca 
subsp. vesca]
Length=468

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S R+ CP LKVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  328  KKSRLES-RTPCPPLKVRKEKLGDRIATLQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  386

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSY  976
             L++PYMKSS D+          V  +N  N + +   DL+SRGLCLVPLS  SY
Sbjct  387  TLSVPYMKSSRDNKSSQAMLQAGVVDINGSNGDHERKRDLRSRGLCLVPLSCMSY  441



>ref|XP_010263576.1| PREDICTED: transcription factor bHLH110-like isoform X1 [Nelumbo 
nucifera]
Length=430

 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 86/122 (70%), Gaps = 6/122 (5%)
 Frame = +2

Query  617  SHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFL  796
            S   +KKPR  S RSS P  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGYI FL
Sbjct  299  SQAATKKPRFES-RSSFPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGYIKFL  357

Query  797  HDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSY  976
             DQ++ L++PYMKSS    +   RT         +N+E K   DL+SRGLCLVPLS TSY
Sbjct  358  QDQVETLSVPYMKSS---RNKICRTMEGGSGDGDRNDEQKQ--DLRSRGLCLVPLSCTSY  412

Query  977  IS  982
             +
Sbjct  413  FT  414



>gb|EEC69777.1| hypothetical protein OsI_00047 [Oryza sativa Indica Group]
Length=387

 Score =   130 bits (326),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = +2

Query  629  SKKPRTGSQRSS-CPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQ  805
            SKKPR  S  SS  P  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGYI FL DQ
Sbjct  255  SKKPRLDSHSSSMLPSFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGYIKFLQDQ  314

Query  806  IQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
            ++ L+ PY++SS +      R ++  +       +    LDL+SRGLCLVPLS TSY++
Sbjct  315  VETLSGPYLRSSKNSKKLACRAAQQQRKGTSNGGDAAAKLDLRSRGLCLVPLSCTSYVT  373



>ref|XP_008466527.1| PREDICTED: transcription factor bHLH110-like isoform X3 [Cucumis 
melo]
Length=426

 Score =   130 bits (327),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 86/124 (69%), Gaps = 9/124 (7%)
 Frame = +2

Query  620  HQQS--KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            +QQS  KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  289  NQQSPLKKSRLDS-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  347

Query  794  LHDQIQALNLPYMKSSGDD-SHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLT  970
            L +Q++ L++PYMK +G + +  P   S V         EG    DL+SRGLCLVPL   
Sbjct  348  LQNQVETLSVPYMKPAGSNKAPQPTHRSSVEDG-----NEGGQNRDLRSRGLCLVPLGCL  402

Query  971  SYIS  982
            SY++
Sbjct  403  SYVT  406



>ref|XP_008466525.1| PREDICTED: transcription factor bHLH110-like isoform X1 [Cucumis 
melo]
Length=460

 Score =   130 bits (328),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 86/124 (69%), Gaps = 9/124 (7%)
 Frame = +2

Query  620  HQQS--KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            +QQS  KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  323  NQQSPLKKSRLDS-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  381

Query  794  LHDQIQALNLPYMKSSGDD-SHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLT  970
            L +Q++ L++PYMK +G + +  P   S V         EG    DL+SRGLCLVPL   
Sbjct  382  LQNQVETLSVPYMKPAGSNKAPQPTHRSSVEDG-----NEGGQNRDLRSRGLCLVPLGCL  436

Query  971  SYIS  982
            SY++
Sbjct  437  SYVT  440



>dbj|BAD44875.1| putative ethylene-responsive protein [Oryza sativa Japonica Group]
 gb|EEE53712.1| hypothetical protein OsJ_00043 [Oryza sativa Japonica Group]
Length=387

 Score =   129 bits (325),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = +2

Query  629  SKKPRTGSQRSS-CPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQ  805
            SKKPR  S  SS  P  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGYI FL DQ
Sbjct  255  SKKPRLESHSSSMLPSFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGYIKFLQDQ  314

Query  806  IQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
            ++ L+ PY++SS +      R ++  +       +    LDL+SRGLCLVPLS TSY++
Sbjct  315  VETLSGPYLRSSKNSKKLACRAAQQQRKGTSNGGDAAAKLDLRSRGLCLVPLSCTSYVT  373



>ref|XP_008220847.1| PREDICTED: transcription factor bHLH110 isoform X1 [Prunus mume]
 ref|XP_008220848.1| PREDICTED: transcription factor bHLH110 isoform X1 [Prunus mume]
Length=458

 Score =   130 bits (328),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 87/119 (73%), Gaps = 8/119 (7%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S R++CP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  329  KKSRLES-RTACPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  387

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQ-ALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
             L++PYMKSS +      ++ + +Q  +   N   +T  DL+SRGLCLVPLS  SY++S
Sbjct  388  TLSVPYMKSSRN------KSCKTMQGGVTEINGNDETKRDLRSRGLCLVPLSCMSYVTS  440



>ref|NP_001041771.1| Os01g0105700 [Oryza sativa Japonica Group]
 dbj|BAF03685.1| Os01g0105700 [Oryza sativa Japonica Group]
Length=388

 Score =   129 bits (325),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = +2

Query  629  SKKPRTGSQRSS-CPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQ  805
            SKKPR  S  SS  P  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGYI FL DQ
Sbjct  256  SKKPRLESHSSSMLPSFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGYIKFLQDQ  315

Query  806  IQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
            ++ L+ PY++SS +      R ++  +       +    LDL+SRGLCLVPLS TSY++
Sbjct  316  VETLSGPYLRSSKNSKKLACRAAQQQRKGTSNGGDAAAKLDLRSRGLCLVPLSCTSYVT  374



>ref|XP_010673050.1| PREDICTED: transcription factor bHLH110-like [Beta vulgaris subsp. 
vulgaris]
Length=463

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 88/118 (75%), Gaps = 3/118 (3%)
 Frame = +2

Query  629  SKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQI  808
            SKK R  S+ +S P LKVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI+FL +QI
Sbjct  325  SKKQRFESRGTSYPPLKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYINFLQNQI  384

Query  809  QALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
            + L++PYMK +  +     R  RV      ++EE K ++DL+SRGLCLVP+S  SYI+
Sbjct  385  ETLSVPYMKLASRNKASNAR--RVSDDEYCESEEQK-SIDLRSRGLCLVPVSCMSYIN  439



>ref|XP_004164011.1| PREDICTED: transcription factor bHLH110-like [Cucumis sativus]
Length=427

 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 90/126 (71%), Gaps = 12/126 (10%)
 Frame = +2

Query  620  HQQS---KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIH  790
            +QQS   KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI 
Sbjct  289  NQQSPPLKKSRLDS-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIK  347

Query  791  FLHDQIQALNLPYMKSSGDD--SHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            FL +Q++ L++PYMK +G +  +   HR+S  V+  N    EG    DL+SRGLCLVPL 
Sbjct  348  FLQNQVETLSVPYMKPAGGNKATQPTHRSS--VEDGN----EGGQNRDLRSRGLCLVPLG  401

Query  965  LTSYIS  982
              SY++
Sbjct  402  CLSYVT  407



>ref|XP_004147875.1| PREDICTED: transcription factor bHLH110-like [Cucumis sativus]
Length=458

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 90/126 (71%), Gaps = 12/126 (10%)
 Frame = +2

Query  620  HQQS---KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIH  790
            +QQS   KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI 
Sbjct  320  NQQSPPLKKSRLDS-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIK  378

Query  791  FLHDQIQALNLPYMKSSGDD--SHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            FL +Q++ L++PYMK +G +  +   HR+S  V+  N    EG    DL+SRGLCLVPL 
Sbjct  379  FLQNQVETLSVPYMKPAGGNKATQPTHRSS--VEDGN----EGGQNRDLRSRGLCLVPLG  432

Query  965  LTSYIS  982
              SY++
Sbjct  433  CLSYVT  438



>gb|KGN59991.1| hypothetical protein Csa_3G860270 [Cucumis sativus]
Length=462

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 90/126 (71%), Gaps = 12/126 (10%)
 Frame = +2

Query  620  HQQS---KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIH  790
            +QQS   KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI 
Sbjct  324  NQQSPPLKKSRLDS-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIK  382

Query  791  FLHDQIQALNLPYMKSSGDD--SHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            FL +Q++ L++PYMK +G +  +   HR+S  V+  N    EG    DL+SRGLCLVPL 
Sbjct  383  FLQNQVETLSVPYMKPAGGNKATQPTHRSS--VEDGN----EGGQNRDLRSRGLCLVPLG  436

Query  965  LTSYIS  982
              SY++
Sbjct  437  CLSYVT  442



>ref|XP_008673819.1| PREDICTED: transcription factor bHLH110 [Zea mays]
 tpg|DAA53853.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=443

 Score =   129 bits (323),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 85/120 (71%), Gaps = 6/120 (5%)
 Frame = +2

Query  629  SKKPRTGSQRSS--CPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHD  802
            SKKPR   QRSS   P  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGYI FL D
Sbjct  314  SKKPRV-EQRSSTIVPSFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGYIKFLQD  372

Query  803  QIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
            Q++ L+ PY+KSS   S  P  T R     +    E +T  DL+SRGLCLVPLS TSY++
Sbjct  373  QVETLSRPYLKSS--RSKKPRPTPRGSSNASAGELE-ETRPDLRSRGLCLVPLSCTSYVT  429



>ref|XP_002281118.2| PREDICTED: transcription factor bHLH110 isoform X2 [Vitis vinifera]
 emb|CBI19743.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 89/125 (71%), Gaps = 8/125 (6%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            A+    KK R  S R+SCP +KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  293  ATQATPKKSRLES-RASCPPIKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  351

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTT-LDLKSRGLCLVPLSLT  970
            L +Q++ L++PYMKSS +      ++S  +Q  +   E  +    DL+SRGLCLVPLS  
Sbjct  352  LQNQVETLSVPYMKSSRN------KSSISMQGGSADGEGSEEPRRDLRSRGLCLVPLSCM  405

Query  971  SYISS  985
            SY+++
Sbjct  406  SYVTT  410



>ref|XP_009586806.1| PREDICTED: transcription factor bHLH110 [Nicotiana tomentosiformis]
Length=409

 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 86/124 (69%), Gaps = 8/124 (6%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            A     KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  277  APQNAPKKSRVDS-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  335

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMK-NEEGKTTLDLKSRGLCLVPLSLT  970
            L +Q++ L++PYMKSS +      +TSR +     + N   +   DL+SRGLCLVPLS  
Sbjct  336  LQNQVETLSVPYMKSSRN------KTSRSLHGGGGEMNGSEEVKRDLRSRGLCLVPLSCL  389

Query  971  SYIS  982
            +Y++
Sbjct  390  TYMT  393



>ref|XP_006643643.1| PREDICTED: uncharacterized protein LOC102705754 [Oryza brachyantha]
Length=393

 Score =   127 bits (320),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 84/122 (69%), Gaps = 8/122 (7%)
 Frame = +2

Query  629  SKKPRTGSQRSSC--PVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHD  802
            SKKPR  S+ SS   P  KVRKEKLGDRI+ LQ+LV+PFGKTDTASVL EAIGYI FL D
Sbjct  262  SKKPRLESRSSSALIPSFKVRKEKLGDRISALQQLVSPFGKTDTASVLMEAIGYIKFLQD  321

Query  803  QIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNE--EGKTTLDLKSRGLCLVPLSLTSY  976
            Q++ L+ PY++SS +      +  R  Q     +   E    LDL+SRGLCLVPLS TSY
Sbjct  322  QVETLSGPYLRSSKNS----KKACRAAQQRKGASNGGEAAAKLDLRSRGLCLVPLSCTSY  377

Query  977  IS  982
            ++
Sbjct  378  VT  379



>ref|XP_009413691.1| PREDICTED: transcription factor bHLH110-like [Musa acuminata 
subsp. malaccensis]
Length=366

 Score =   127 bits (319),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 84/118 (71%), Gaps = 6/118 (5%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            +KPR   QRSS    KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL DQ++
Sbjct  247  RKPRV-EQRSSFSPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLLDQVE  305

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
             L++PY++ SG+      R+   +Q  + +  +      L+SRGLCLVPLS TSY++S
Sbjct  306  KLSVPYLRPSGNK-----RSRTSMQEASNEESDEPAKRGLRSRGLCLVPLSYTSYMTS  358



>ref|XP_009393607.1| PREDICTED: transcription factor bHLH110-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   127 bits (319),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 82/115 (71%), Gaps = 7/115 (6%)
 Frame = +2

Query  635  KPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQA  814
            KPR   Q SS    KVRKEK+GDRIA LQ+LVAPFGKTDTASVL EAIGYI FL DQ++ 
Sbjct  267  KPRF-EQHSSFSPFKVRKEKMGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLLDQVEK  325

Query  815  LNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYI  979
            L+LPY++SSG+      +  R +Q  + +  +     DL+SRGLCLVPLS TSYI
Sbjct  326  LSLPYLRSSGN------KRPRTMQEASNEERDEMGKRDLRSRGLCLVPLSRTSYI  374



>gb|KCW68202.1| hypothetical protein EUGRSUZ_F01868 [Eucalyptus grandis]
Length=392

 Score =   127 bits (318),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 85/112 (76%), Gaps = 5/112 (4%)
 Frame = +2

Query  650  SQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPY  829
            S R++    KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q+Q L++PY
Sbjct  268  STRAASAPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVQTLSVPY  327

Query  830  MKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
            MK+S  +++     SR    +  +++E +TT DLKSRGLCLVPLS  SY+++
Sbjct  328  MKASRKEANR----SRQRGPIEDEDDE-QTTRDLKSRGLCLVPLSCMSYVAA  374



>ref|XP_010061277.1| PREDICTED: transcription factor bHLH110 [Eucalyptus grandis]
Length=436

 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 88/119 (74%), Gaps = 6/119 (5%)
 Frame = +2

Query  632  KKPRTG-SQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQI  808
            KK R   S R++    KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q+
Sbjct  305  KKTRVDQSTRAASAPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQV  364

Query  809  QALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
            Q L++PYMK+S  +++     SR    +  +++E +TT DLKSRGLCLVPLS  SY+++
Sbjct  365  QTLSVPYMKASRKEANR----SRQRGPIEDEDDE-QTTRDLKSRGLCLVPLSCMSYVAA  418



>ref|XP_002534446.1| transcription factor, putative [Ricinus communis]
 gb|EEF27938.1| transcription factor, putative [Ricinus communis]
Length=305

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 8/118 (7%)
 Frame = +2

Query  617  SHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFL  796
            S   +K+PR  +  S+ P  KVRKEK+GDRI  LQ+LV+PFGKTDTASVL+EAI YI FL
Sbjct  175  SETATKRPRNETA-STVPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFL  233

Query  797  HDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLT  970
            H+Q+  L+ PYMK SG   HH   + +       K+ EG+   DL+SRGLCLVP+S+T
Sbjct  234  HEQVTVLSTPYMK-SGAPIHHQQSSDK------SKDPEGQKQADLRSRGLCLVPVSIT  284



>gb|EPS70844.1| hypothetical protein M569_03916, partial [Genlisea aurea]
Length=128

 Score =   120 bits (300),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 69/117 (59%), Positives = 80/117 (68%), Gaps = 11/117 (9%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  + R SCP LKVRKEKLGDRIA LQ LVAPFGKTDTASVL EAIGYI FLH+Q+ 
Sbjct  21   KKSRLET-RPSCPPLKVRKEKLGDRIAALQHLVAPFGKTDTASVLMEAIGYIKFLHNQVD  79

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
             L++PYMKSS          SR     +   EE +    L+SRGLCLVPLS  S+++
Sbjct  80   TLSVPYMKSS----------SRKKSTDSKIKEEDEEEDGLRSRGLCLVPLSCLSFMA  126



>emb|CAN61992.1| hypothetical protein VITISV_030445 [Vitis vinifera]
Length=512

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 88/124 (71%), Gaps = 6/124 (5%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            A+    KK R  S R+SCP +KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  318  ATQATPKKSRLES-RASCPPIKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  376

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTS  973
            L +Q++ L++PYMKSS + S    +      A    +EE +   DL+SRGLCLVPLS  S
Sbjct  377  LQNQVETLSVPYMKSSRNKSSISMQGG---SADGEGSEEPRR--DLRSRGLCLVPLSCMS  431

Query  974  YISS  985
            Y+++
Sbjct  432  YVTT  435



>ref|XP_010540345.1| PREDICTED: transcription factor bHLH110-like isoform X1 [Tarenaya 
hassleriana]
Length=452

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 87/125 (70%), Gaps = 17/125 (14%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KKPR    RS CP LKVRKEKLGDRI+ LQ+LV+PFGKTDTASVL EAIGYI FL +QI+
Sbjct  334  KKPRV-EPRSPCPPLKVRKEKLGDRISALQQLVSPFGKTDTASVLMEAIGYIKFLQNQIE  392

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMKN--------EEGKTTLDLKSRGLCLVPLSL  967
             L++PYM++S +      R  +  Q + MKN        EE K  ++L+S GLCLVPLS 
Sbjct  393  TLSVPYMRASRN------REGKSSQGVIMKNGSVSHERSEEPK--MNLRSLGLCLVPLSC  444

Query  968  TSYIS  982
             SY++
Sbjct  445  MSYVT  449



>ref|XP_002510430.1| transcription factor, putative [Ricinus communis]
 gb|EEF52617.1| transcription factor, putative [Ricinus communis]
Length=436

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 87/123 (71%), Gaps = 5/123 (4%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            A+ Q + K      R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  299  ATLQAAPKKSRLETRASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  358

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTS  973
            L +Q++ L++PYMKSS + S    ++   V+  N + ++     DL+SRGLCLVPLS  S
Sbjct  359  LQNQVETLSVPYMKSSRNKSSRNSQSGPTVEEGNFEPKK-----DLRSRGLCLVPLSCMS  413

Query  974  YIS  982
            Y++
Sbjct  414  YVT  416



>emb|CDM81294.1| unnamed protein product [Triticum aestivum]
Length=424

 Score =   124 bits (312),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 85/122 (70%), Gaps = 8/122 (7%)
 Frame = +2

Query  632  KKPRTGSQRSSC-----PVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFL  796
            KKPR    R +      P  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGYI FL
Sbjct  292  KKPRLLHSRPATNNNILPSFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGYIKFL  351

Query  797  HDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSY  976
             DQ++ L+ PYM+S+    H   RT++     +  +++ +  +DL+SRGLCLVPL+ TSY
Sbjct  352  QDQVETLSGPYMRSA---KHKKARTTQQRGPSDTGDQKEEAKVDLRSRGLCLVPLACTSY  408

Query  977  IS  982
            ++
Sbjct  409  VT  410



>gb|KEH36186.1| BHLH transcription factor-like protein [Medicago truncatula]
Length=454

 Score =   125 bits (313),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 79/104 (76%), Gaps = 7/104 (7%)
 Frame = +2

Query  674  LKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPYMKSSGDDS  853
             KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL  Q++ L++PYMKSS +  
Sbjct  339  FKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQGQVETLSVPYMKSSQN--  396

Query  854  HHPHRTSRVVQALNMKNE-EGKTTLDLKSRGLCLVPLSLTSYIS  982
                + +RV+Q  + K + +G+   DL+SRGLCLVPLS  SYI+
Sbjct  397  ----QNNRVIQGGSAKGDTKGEPKQDLRSRGLCLVPLSCMSYIA  436



>ref|XP_003566069.1| PREDICTED: transcription factor bHLH123-like [Brachypodium distachyon]
Length=318

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 84/132 (64%), Gaps = 7/132 (5%)
 Frame = +2

Query  602  GAAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIG  781
            GA   S   SKKPR  +  S  P  KVRKEKLGDRI  LQ+LV+PFGKTDTASVL EAIG
Sbjct  180  GAGAGSPVASKKPRIDTP-SPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIG  238

Query  782  YIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPL  961
            YI FLHDQ+ +L+ PY+ S G      H+    ++       +GK   DL+SRGLCLVP+
Sbjct  239  YIKFLHDQVASLSSPYLSSCGRALQDQHQLQGSIKV------DGKAKEDLRSRGLCLVPV  292

Query  962  SLTSYISSCQMP  997
            + T  +++   P
Sbjct  293  ASTYTVANEAAP  304



>ref|XP_008220849.1| PREDICTED: transcription factor bHLH110 isoform X2 [Prunus mume]
Length=456

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 85/119 (71%), Gaps = 10/119 (8%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S R++CP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL  Q Q
Sbjct  329  KKSRLES-RTACPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFL--QNQ  385

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQ-ALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISS  985
             L++PYMKSS +      ++ + +Q  +   N   +T  DL+SRGLCLVPLS  SY++S
Sbjct  386  TLSVPYMKSSRN------KSCKTMQGGVTEINGNDETKRDLRSRGLCLVPLSCMSYVTS  438



>ref|XP_008466526.1| PREDICTED: transcription factor bHLH110-like isoform X2 [Cucumis 
melo]
Length=458

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 84/124 (68%), Gaps = 11/124 (9%)
 Frame = +2

Query  620  HQQS--KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            +QQS  KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI F
Sbjct  323  NQQSPLKKSRLDS-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKF  381

Query  794  LHDQIQALNLPYMKSSGDD-SHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLT  970
            L  Q Q L++PYMK +G + +  P   S V         EG    DL+SRGLCLVPL   
Sbjct  382  L--QNQTLSVPYMKPAGSNKAPQPTHRSSVEDG-----NEGGQNRDLRSRGLCLVPLGCL  434

Query  971  SYIS  982
            SY++
Sbjct  435  SYVT  438



>ref|XP_007153740.1| hypothetical protein PHAVU_003G061000g [Phaseolus vulgaris]
 gb|ESW25734.1| hypothetical protein PHAVU_003G061000g [Phaseolus vulgaris]
Length=194

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 2/80 (3%)
 Frame = -3

Query  1424  FTYDAVGNYER--VGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAIDLV  1251
             + ++ +G  ++  VGYSSQGSG+TLIMP LDNQLKSPSPLL+PA D++TPLSE EA+DLV
Sbjct  111   YAFNVLGGLDKGMVGYSSQGSGSTLIMPSLDNQLKSPSPLLLPAVDAVTPLSEAEAVDLV  170

Query  1250  KTCFASATERDIYTGDRLEI  1191
             K+ FASATERDIYTGD++EI
Sbjct  171   KSVFASATERDIYTGDKVEI  190



>ref|XP_005848182.1| hypothetical protein CHLNCDRAFT_22624 [Chlorella variabilis]
 gb|EFN56080.1| hypothetical protein CHLNCDRAFT_22624 [Chlorella variabilis]
Length=239

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             G+G V+TYDA+G+YERVGY  QG+G  L+ P+LDNQLK+ SPL +P Q  ++ L   +A+
Sbjct  139   GRGAVYTYDAIGSYERVGYGCQGNGKELVQPVLDNQLKAASPLALPPQQWLSSLPLEQAV  198

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLVK  F SA ERDIYTGD +EI+++  D ++ + +EL++D
Sbjct  199   DLVKGAFVSAGERDIYTGDDVEILIITKDCIKTDRLELKRD  239



>ref|XP_010540348.1| PREDICTED: transcription factor bHLH110-like isoform X4 [Tarenaya 
hassleriana]
Length=323

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 88/138 (64%), Gaps = 21/138 (15%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLK----VRKEKLGDRIAGLQRLVAPFGKTDTASVLTE  772
            A        KKPR    RS CP LK    VRKEKLGDRI+ LQ+LV+PFGKTDTASVL E
Sbjct  192  ATKGRENAPKKPRV-EPRSPCPPLKLIKQVRKEKLGDRISALQQLVSPFGKTDTASVLME  250

Query  773  AIGYIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKN--------EEGKTTLD  928
            AIGYI FL +QI+ L++PYM++S +      R  +  Q + MKN        EE K  ++
Sbjct  251  AIGYIKFLQNQIETLSVPYMRASRN------REGKSSQGVIMKNGSVSHERSEEPK--MN  302

Query  929  LKSRGLCLVPLSLTSYIS  982
            L+S GLCLVPLS  SY++
Sbjct  303  LRSLGLCLVPLSCMSYVT  320



>gb|EMT20268.1| Transcription factor bHLH110 [Aegilops tauschii]
Length=440

 Score =   122 bits (306),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 82/119 (69%), Gaps = 13/119 (11%)
 Frame = +2

Query  641  RTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALN  820
            R  +  +  P  KVRKEKLGDRIA LQ++V+PFGKTDTASVL EAIGYI FL DQ++ L+
Sbjct  316  RPATNNNILPSFKVRKEKLGDRIAALQQMVSPFGKTDTASVLMEAIGYIKFLQDQVETLS  375

Query  821  LPYMKSSGDDSHHPHRTSRVVQALNM-----KNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
             PYM+S+       H+ +R  Q   +     + EE K  +DL+SRGLCLVPL+ TSY++
Sbjct  376  GPYMRSAK------HKKARTTQQRGLSDTGHQKEEAK--VDLRSRGLCLVPLACTSYVT  426



>ref|XP_011072388.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Sesamum 
indicum]
Length=364

 Score =   121 bits (303),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 88/137 (64%), Gaps = 21/137 (15%)
 Frame = +2

Query  629  SKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQI  808
            SKK R   Q S+ P LKVRKEKLGDRI  L +LV+PFGKTDTASVL+EAIGYI FL  QI
Sbjct  211  SKKARV-QQSSAQPALKVRKEKLGDRITALHQLVSPFGKTDTASVLSEAIGYIRFLQGQI  269

Query  809  QALNLPYMK-SSGDDSHH-----------PHRTSRVVQALNM------KNEEGKT--TLD  928
            +AL+ PYM+ +SG   HH           P  T + +  + M      +  EG++   +D
Sbjct  270  EALSSPYMRNASGSTGHHQHSVQERNCLFPEETGQFLNDIGMERGAPKQESEGRSGALMD  329

Query  929  LKSRGLCLVPLSLTSYI  979
            L+SRGLCLVP+S T ++
Sbjct  330  LRSRGLCLVPISCTQHV  346



>emb|CAN70945.1| hypothetical protein VITISV_002869 [Vitis vinifera]
Length=396

 Score =   121 bits (304),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 81/128 (63%), Gaps = 26/128 (20%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A  A H  +K    G  RSS P LKVRKEKLGDRIA LQRLVAPFGKTDTASVLTEAIGY
Sbjct  287  APKALHAATKMSGFGP-RSSYPPLKVRKEKLGDRIAALQRLVAPFGKTDTASVLTEAIGY  345

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FLHDQIQ        SS +D                  +EG    DL+SRGLCLVP+S
Sbjct  346  IQFLHDQIQG-------SSDED-----------------GKEGAKR-DLRSRGLCLVPVS  380

Query  965  LTSYISSC  988
             TSYI++C
Sbjct  381  CTSYITAC  388



>ref|XP_005652005.1| N-terminal nucleophile aminohydrolase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27461.1| N-terminal nucleophile aminohydrolase [Coccomyxa subellipsoidea 
C-169]
Length=249

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQDSITPLSELEAI  1260
             GKG V++YDA+G++ER GY+ QGSG  LI P+LDNQLK+ SPL++P ++ ++ L   +A+
Sbjct  149   GKGAVYSYDAIGSHERSGYAVQGSGKDLIQPVLDNQLKAASPLVLPPENWMSSLPLDQAV  208

Query  1259  DLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
             DLV+  F SA ERDIYTGD +EI ++ ++G + E +EL+KD
Sbjct  209   DLVRDAFVSAGERDIYTGDAVEIYIMTMEGTKREVLELKKD  249



>ref|XP_006341970.1| PREDICTED: transcription factor bHLH110-like [Solanum tuberosum]
Length=406

 Score =   121 bits (303),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 82/117 (70%), Gaps = 7/117 (6%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  281  KKSRVDS-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  339

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
             L++PYMKSS   +              M NEE K   DL+SRGLCLVPL+  +Y++
Sbjct  340  TLSVPYMKSSRSKASRSLHGG----GGEMNNEEMKR--DLRSRGLCLVPLTCLTYVT  390



>ref|XP_009624514.1| PREDICTED: uncharacterized protein LOC104115541 isoform X3 [Nicotiana 
tomentosiformis]
Length=368

 Score =   120 bits (302),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = +2

Query  677  KVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPYMKSSGDDSH  856
            KVRKEKLG RI+ L RLVAPFGKTDTASVLTEAIGYI FL DQI  L++PY KSS     
Sbjct  269  KVRKEKLGHRISALHRLVAPFGKTDTASVLTEAIGYIQFLQDQILTLSMPYAKSSKGK--  326

Query  857  HPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS-SC  988
              H+ +    +++MK   G+   DLKSRGLCLVP+S +SYI+ SC
Sbjct  327  -LHQINLKDSSIDMK---GQAVQDLKSRGLCLVPMSFSSYITYSC  367



>ref|XP_004238285.1| PREDICTED: transcription factor bHLH110 [Solanum lycopersicum]
Length=405

 Score =   121 bits (303),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 82/117 (70%), Gaps = 7/117 (6%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  S R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL +Q++
Sbjct  280  KKSRVDS-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQNQVE  338

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
             L++PYMKSS   +              M NEE K   DL+SRGLCLVPL+  +Y++
Sbjct  339  TLSVPYMKSSRSKASRSLHGG----GGEMNNEEMKR--DLRSRGLCLVPLTCLTYVT  389



>ref|XP_009594898.1| PREDICTED: transcription factor bHLH123-like [Nicotiana tomentosiformis]
Length=416

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 81/121 (67%), Gaps = 12/121 (10%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            +S   +K+PR  +  S  P  KVRKEK+GDRI  LQ+LV+PFGKTDTASVL+EAI YI F
Sbjct  285  SSEISNKRPRDETP-SPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  343

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNE--EGKTTLDLKSRGLCLVPLSL  967
            LHDQI AL+ PYMKS      H        Q  N K+E  EG+   DL+SRGLCLVP+S 
Sbjct  344  LHDQIGALSAPYMKSGSSAMQH--------QQSNNKSEDAEGRNQ-DLRSRGLCLVPVSS  394

Query  968  T  970
            T
Sbjct  395  T  395



>ref|XP_011095780.1| PREDICTED: transcription factor bHLH123 [Sesamum indicum]
Length=416

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 80/119 (67%), Gaps = 8/119 (7%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            ++   +K+PR+    SS P  KVRKEK+GDRI  LQ+LV+PFGKTDTASVL+EAI YI F
Sbjct  285  STEASNKRPRSNETPSSLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  344

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLT  970
            LH+Q+  L+ PYMK+     HH +       +   K+ EG    DL+SRGLCLVP+S T
Sbjct  345  LHEQVSVLSTPYMKNGAPIQHHQN-------SDKSKDPEGGRQ-DLRSRGLCLVPVSST  395



>ref|XP_009790944.1| PREDICTED: transcription factor bHLH123-like [Nicotiana sylvestris]
Length=423

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 79/119 (66%), Gaps = 8/119 (7%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            +S   +K+PR  +  S  P  KVRKEK+GDRI  LQ+LV+PFGKTDTASVL+EAI YI F
Sbjct  292  SSETTNKRPRDETP-SPSPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  350

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLT  970
            LHDQI AL  PYMKS      H   +++   A      EG+   DL+SRGLCLVP+S T
Sbjct  351  LHDQIGALGAPYMKSGSSAMQHQQSSNKSEDA------EGQNQ-DLRSRGLCLVPVSST  402



>gb|KGN62622.1| hypothetical protein Csa_2G361860 [Cucumis sativus]
Length=347

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 84/127 (66%), Gaps = 10/127 (8%)
 Frame = +2

Query  608  AMASHQQSKKPRTGSQ---RSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAI  778
            A +  QQ + P   ++   R +CP LK+RKEKLGDRIA LQ+LVAPFGKTDTASVL EAI
Sbjct  201  AYSLKQQKQSPNKKTRVEPRPTCPPLKIRKEKLGDRIAALQQLVAPFGKTDTASVLMEAI  260

Query  779  GYIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVP  958
             YI+FL +Q++ L+  YMKS    ++   R   +       N++ K   DLK++GLCLVP
Sbjct  261  SYINFLQNQVEMLSHSYMKSCRSKNYKTTRRDEL-------NDDKKQESDLKAKGLCLVP  313

Query  959  LSLTSYI  979
            L+  SY+
Sbjct  314  LACISYL  320



>ref|XP_011080686.1| PREDICTED: transcription factor bHLH68-like [Sesamum indicum]
Length=340

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 83/125 (66%), Gaps = 9/125 (7%)
 Frame = +2

Query  629  SKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQI  808
            SKKPR   Q S+ P LKVRKEKLGDRI  L +LV+PFGKTDTASVL+EAIGYI FL  QI
Sbjct  197  SKKPRV-QQSSAQPALKVRKEKLGDRITALHQLVSPFGKTDTASVLSEAIGYIRFLQAQI  255

Query  809  QALNLPYMKSSGDDSHHPHRTSRVVQALNMK--------NEEGKTTLDLKSRGLCLVPLS  964
            +AL+ PYM++    S   H+ S +   + M+        ++  +   DL+SRGLCLVP+S
Sbjct  256  EALSSPYMRNGSGSSTIHHQHSFLNDQMGMEGRGPSKQDSQSSRGVKDLRSRGLCLVPIS  315

Query  965  LTSYI  979
             T  +
Sbjct  316  CTQNV  320



>gb|EYU27864.1| hypothetical protein MIMGU_mgv1a011041mg [Erythranthe guttata]
Length=294

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 86/133 (65%), Gaps = 15/133 (11%)
 Frame = +2

Query  614   ASHQQS-KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIH  790
             AS++ S K+PR  +  S  P  KVRKEKLGDRI  LQ+LV+PFGKTDTASVL EAI YI 
Sbjct  167   ASNEPSFKRPRIETP-SPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIK  225

Query  791   FLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLT  970
             FLHDQ+  L+ PY+K         HR S  VQ L  +++EG    DLK+RGLCLVP  +T
Sbjct  226   FLHDQVNELSSPYLK---------HRPS-PVQRLQAEDKEG-VMQDLKTRGLCLVP--VT  272

Query  971   SYISSCQMPMNIY  1009
             S     Q P + +
Sbjct  273   STFPVAQTPADFW  285



>ref|XP_004248340.1| PREDICTED: transcription factor bHLH123-like [Solanum lycopersicum]
Length=386

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 79/114 (69%), Gaps = 10/114 (9%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            K+PR  +   S P++KVRKEK+GDRI  LQ+LV+PFGKTDTASVL+EAI YI FLHDQI 
Sbjct  261  KRPRNETSTPS-PIIKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHDQIG  319

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGK-TTLDLKSRGLCLVPLSLT  970
            AL+ PYMKS     H        +Q+ N   + G+    DL+SRGLCLVP+S T
Sbjct  320  ALSAPYMKSGASMQH--------LQSDNKSEDIGEGRNKDLRSRGLCLVPISST  365



>ref|XP_010232975.1| PREDICTED: transcription factor bHLH110-like [Brachypodium distachyon]
Length=341

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 80/125 (64%), Gaps = 23/125 (18%)
 Frame = +2

Query  668  PVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQI-------------  808
            P  KVRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGYI+FL DQ+             
Sbjct  206  PSFKVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGYINFLQDQVEVVTHPDHRLLDS  265

Query  809  -------QALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSL  967
                   Q L+ PYMKSS    H   RT++     N  +++ +  LDL+SRGLCLVPLS 
Sbjct  266  LTIAYVMQTLSGPYMKSS---KHKKARTTQQRGPSNTGDQKEEAKLDLRSRGLCLVPLSC  322

Query  968  TSYIS  982
            TSY++
Sbjct  323  TSYVT  327



>ref|XP_006452112.1| hypothetical protein CICLE_v10008228mg [Citrus clementina]
 ref|XP_006475252.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Citrus 
sinensis]
 gb|ESR65352.1| hypothetical protein CICLE_v10008228mg [Citrus clementina]
Length=459

 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  629  SKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQI  808
            SK+ +     S  P  KVRKEK+GDRI  LQ+LV+PFGKTDTASVL+EAI YI FLHDQ+
Sbjct  332  SKRAKNDQPASPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHDQV  391

Query  809  QALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLT  970
              L+ PYMKS G    H   + +V      K+ EG    DL+SRGLCLVP+S T
Sbjct  392  AVLSTPYMKSGGAPIPHQPNSEKV------KDSEGPKQ-DLRSRGLCLVPVSST  438



>ref|XP_008647169.1| PREDICTED: uncharacterized protein LOC103628822 [Zea mays]
Length=333

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 7/84 (8%)
 Frame = -3

Query  1439  GKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVP-------AQDSITP  1281
             GKGCVF YDAVG+YER  YS+QG+ +TLIMP+L+NQLKSPS +L+P       AQD++TP
Sbjct  72    GKGCVFAYDAVGSYERTIYSAQGTRSTLIMPVLNNQLKSPSHILLPARKYFQCAQDAVTP  131

Query  1280  LSELEAIDLVKTCFASATERDIYT  1209
             LSE EAIDL+K  FASATERDIYT
Sbjct  132   LSESEAIDLIKVVFASATERDIYT  155



>ref|XP_011074574.1| PREDICTED: transcription factor bHLH110-like isoform X2 [Sesamum 
indicum]
Length=319

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 5/111 (5%)
 Frame = +2

Query  632  KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
            KK R  + R+SCP  KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FLH Q+Q
Sbjct  200  KKSRVEA-RASCPPFKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLHTQVQ  258

Query  812  ALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
             L+LPY+K++   +     T+ +++A     E  +   +L+S GLCLVPLS
Sbjct  259  TLSLPYLKNTSTGT----HTTTIIKAGGDGKESEEAKRELRSGGLCLVPLS  305



>gb|ACF85322.1| unknown [Zea mays]
Length=287

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 89/157 (57%), Gaps = 21/157 (13%)
 Frame = +2

Query  602   GAAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIG  781
             G +  S    KK R  +  S+   LKVRKE+LGDRI  L ++V+PFGKTDTASVL E IG
Sbjct  110   GNSAGSGSAPKKARVQTSSSAQSTLKVRKERLGDRITALHQIVSPFGKTDTASVLQETIG  169

Query  782   YIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRV------------VQALNMKNEEGK---  916
             YI FL  QI+AL+ PY+     DS   H T+ +            VQ   M N+EG+   
Sbjct  170   YIRFLLSQIEALSFPYLGHDNGDSMQQHNTNNLLLNHSTSDAMVQVQGPPMTNQEGEVYG  229

Query  917   ------TTLDLKSRGLCLVPLSLTSYISSCQMPMNIY  1009
                   +  DL+SRGLCLVP+S TS+++    P + +
Sbjct  230   NGIEEGSRKDLRSRGLCLVPVSCTSHLADDNGPSDFW  266



>ref|XP_010110036.1| hypothetical protein L484_021925 [Morus notabilis]
 gb|EXC25054.1| hypothetical protein L484_021925 [Morus notabilis]
Length=437

 Score =   119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 84/113 (74%), Gaps = 9/113 (8%)
 Frame = +2

Query  653  QRSSCPVLK-VRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPY  829
            QR+S  + K VRKEKLGDRIA LQ+LV+PFGKTDTASVL EAIGYI FL +Q++ L++PY
Sbjct  311  QRTSYGLSKAVRKEKLGDRIAALQQLVSPFGKTDTASVLMEAIGYIKFLQNQVETLSVPY  370

Query  830  MKSSGDDSHHPHRTSRVVQA--LNMKNEEGKTTLDLKSRGLCLVPLSLTSYIS  982
            MKSS +      ++ + VQ    + +++  +T  DLKSRGLCLVPLS  SY++
Sbjct  371  MKSSRN------KSCKTVQGGLKDHQDDNEETKRDLKSRGLCLVPLSCMSYVT  417



>ref|XP_009384213.1| PREDICTED: transcription factor bHLH103-like [Musa acuminata 
subsp. malaccensis]
Length=351

 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 88/126 (70%), Gaps = 10/126 (8%)
 Frame = +2

Query  632   KKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQ  811
             KK RT +  S  P  KVRKEKLGDRI  LQ+LV+PFGKTDTASVL EAI YI FLHDQ++
Sbjct  227   KKARTETP-SPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLQEAIEYIKFLHDQVR  285

Query  812   ALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYISSCQ  991
              L+ PY+K+        H+  + V++L+   + G+   DL+SRGLCLVP+S T  +++ +
Sbjct  286   VLSAPYLKNG-------HQMQQ-VKSLDSSKDSGEQNQDLRSRGLCLVPMSSTFAVAN-E  336

Query  992   MPMNIY  1009
             +P +++
Sbjct  337   IPADLW  342



>ref|XP_009624511.1| PREDICTED: transcription factor bHLH110-like isoform X2 [Nicotiana 
tomentosiformis]
Length=392

 Score =   119 bits (298),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 82/129 (64%), Gaps = 28/129 (22%)
 Frame = +2

Query  605  AAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGY  784
            A   + + SKKPR  SQ SS P+LKVRKEKLG RI+ L RLVAPFGKTDTASVLTEAIGY
Sbjct  290  AENPAQEVSKKPRITSQ-SSTPMLKVRKEKLGHRISALHRLVAPFGKTDTASVLTEAIGY  348

Query  785  IHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLS  964
            I FL DQI                       +  +++MK   G+   DLKSRGLCLVP+S
Sbjct  349  IQFLQDQI-----------------------LDSSIDMK---GQAVQDLKSRGLCLVPMS  382

Query  965  LTSYIS-SC  988
             +SYI+ SC
Sbjct  383  FSSYITYSC  391



>ref|XP_003541762.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Glycine 
max]
 gb|KHN19075.1| Transcription factor bHLH112 [Glycine soja]
Length=437

 Score =   119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 79/123 (64%), Gaps = 11/123 (9%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQR----SSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIG  781
            A+ + S +P    QR    S  P  KVRKEKLGDRI  LQ+LV+PFGKTDTASVL EAI 
Sbjct  299  AAKKNSPEPAFKRQRIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIE  358

Query  782  YIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPL  961
            YI FLHDQ+  L+ PYMK++G    H           N+K+ EG    DL+SRGLCLVP+
Sbjct  359  YIKFLHDQVSVLSTPYMKNNGAPIQHQQDCD------NLKDSEGAKQ-DLRSRGLCLVPI  411

Query  962  SLT  970
            S T
Sbjct  412  SST  414



>ref|XP_008444742.1| PREDICTED: transcription factor bHLH110 isoform X1 [Cucumis melo]
Length=342

 Score =   117 bits (294),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 76/108 (70%), Gaps = 7/108 (6%)
 Frame = +2

Query  656  RSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPYMK  835
            R+SCP LK+RKEKLGDRIA LQ+LVAPFGKTDTASVL EAI YI+FL +Q++ L+  YMK
Sbjct  215  RASCPPLKIRKEKLGDRIAALQQLVAPFGKTDTASVLMEAISYINFLQNQVEMLSHSYMK  274

Query  836  SSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYI  979
            S    ++            +  N++ K   DLK++GLCLVPL+  SY+
Sbjct  275  SCRSKNYK-------TTCRDELNDDKKQESDLKAKGLCLVPLACISYL  315



>ref|XP_004500989.1| PREDICTED: transcription factor bHLH110-like [Cicer arietinum]
Length=382

 Score =   118 bits (296),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 72/102 (71%), Gaps = 5/102 (5%)
 Frame = +2

Query  674  LKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPYMKSSGDDS  853
             KVRKEKLGDRIA LQ+LVAPFGKTDTASVL EAIGYI FL  Q++ L++PYMK S + +
Sbjct  267  FKVRKEKLGDRIAALQQLVAPFGKTDTASVLMEAIGYIKFLQGQVETLSVPYMKLSQNQN  326

Query  854  HHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLTSYI  979
            +   R       +N     G+   DL+SRGLCLVPLS  SYI
Sbjct  327  NRVMRGDSTTCDIN-----GEPKQDLRSRGLCLVPLSCMSYI  363



>ref|XP_004244171.1| PREDICTED: transcription factor bHLH123 [Solanum lycopersicum]
Length=479

 Score =   119 bits (299),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 79/119 (66%), Gaps = 7/119 (6%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            +S   +K+PR  +  S  P  KVRKEK+GDRI  LQ+LV+PFGKTDTASVL+EAI YI F
Sbjct  347  SSETSNKRPRNEAP-SPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  405

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLT  970
            LHDQ+  L+ PYMKS     H  +   +     N+  E GK   DL+SRGLCLVP+S T
Sbjct  406  LHDQVNVLSTPYMKSGASIQHQQNTGDKS----NVNPEGGKQ--DLRSRGLCLVPVSST  458



>ref|XP_008386041.1| PREDICTED: transcription factor bHLH123-like [Malus domestica]
Length=455

 Score =   119 bits (298),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 79/123 (64%), Gaps = 8/123 (7%)
 Frame = +2

Query  602  GAAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIG  781
            G    S   SK+PR  +  S  P  KVRKEK+GDRI  LQ+LV+PFGKTDTASVL+EAI 
Sbjct  320  GKKSGSEAASKRPRNEAS-SPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIE  378

Query  782  YIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPL  961
            YI FLH+Q+  L+ PYMKS     H    + +V      K+ +G    DL+SRGLCLVP+
Sbjct  379  YIKFLHEQVNVLSTPYMKSGAVIQHQQQNSDKV------KDPDGPKQ-DLRSRGLCLVPV  431

Query  962  SLT  970
            S T
Sbjct  432  SST  434



>ref|XP_009355551.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Pyrus 
x bretschneideri]
Length=455

 Score =   119 bits (298),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 79/123 (64%), Gaps = 8/123 (7%)
 Frame = +2

Query  602  GAAMASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIG  781
            G    S   SK+PR  +  S  P  KVRKEK+GDRI  LQ+LV+PFGKTDTASVL+EAI 
Sbjct  320  GKKSGSEAASKRPRNETS-SPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIE  378

Query  782  YIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPL  961
            YI FLH+Q+  L+ PYMKS     H    + +V      K+ +G    DL+SRGLCLVP+
Sbjct  379  YIKFLHEQVNVLSTPYMKSGAVIQHQQQNSDKV------KDPDGPKQ-DLRSRGLCLVPV  431

Query  962  SLT  970
            S T
Sbjct  432  SST  434



>ref|XP_010062929.1| PREDICTED: transcription factor bHLH123 [Eucalyptus grandis]
 gb|KCW70079.1| hypothetical protein EUGRSUZ_F03384 [Eucalyptus grandis]
Length=436

 Score =   119 bits (297),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 78/126 (62%), Gaps = 12/126 (10%)
 Frame = +2

Query  602  GAAM---ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTE  772
            GAAM         K+PR+ +  S  P  KVRKEK+GDRI  LQ+LV+PFGKTDTASVLTE
Sbjct  299  GAAMKKSGGEPAGKRPRSETP-SPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLTE  357

Query  773  AIGYIHFLHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCL  952
            AI YI FLHDQI  L+ PYMK+ G   H         Q  +   +      DL+SRGLCL
Sbjct  358  AIEYIKFLHDQISVLSTPYMKNGGAMQHQ--------QTPDKSEDPDGPRPDLRSRGLCL  409

Query  953  VPLSLT  970
            VP+S T
Sbjct  410  VPVSST  415



>ref|XP_006360115.1| PREDICTED: transcription factor bHLH123-like [Solanum tuberosum]
Length=445

 Score =   119 bits (298),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 78/119 (66%), Gaps = 7/119 (6%)
 Frame = +2

Query  614  ASHQQSKKPRTGSQRSSCPVLKVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHF  793
            +S   +K+PR  +  S  P  KVRKEK+GDRI  LQ+LV+PFGKTDTASVL+EAI YI F
Sbjct  313  SSETSNKRPRNEAP-SPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  371

Query  794  LHDQIQALNLPYMKSSGDDSHHPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLT  970
            LHDQ+  L+ PYMKS     H      +     N+  E GK   DL+SRGLCLVP+S T
Sbjct  372  LHDQVNVLSTPYMKSGASIQHQQSTGDKS----NVNPEGGKQ--DLRSRGLCLVPVSST  424



>gb|EPS73915.1| hypothetical protein M569_00841, partial [Genlisea aurea]
Length=114

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%), Gaps = 6/98 (6%)
 Frame = +2

Query  677  KVRKEKLGDRIAGLQRLVAPFGKTDTASVLTEAIGYIHFLHDQIQALNLPYMKSSGDDSH  856
            +VRKEK+GDRI  LQ+LV+PFGKTDTASVL+EAI YI +LH+Q+  L+ PYMK +     
Sbjct  1    QVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKYLHEQVNVLSSPYMKVASPTQQ  60

Query  857  HPHRTSRVVQALNMKNEEGKTTLDLKSRGLCLVPLSLT  970
            H H+  + V+A    NEE     DL+SRGLCLVP+S T
Sbjct  61   HMHQ--KQVRATTRSNEET----DLRSRGLCLVPVSST  92



>gb|ACM50881.1| 20S proteasome beta subunit F1 [Ulva fasciata]
Length=241

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = -3

Query  1475  TFNCV*LPYNISGKGCVFTYDAVGNYERVGYSSQGSGATLIMPLLDNQLKSPSPLLVPAQ  1296
             TFN +    +  G G V++YDAVG+YER GY++QG+G  L+ PLLDNQL++ SPL++P +
Sbjct  130   TFNIL-AGLDADGTGAVYSYDAVGSYERTGYAAQGTGNDLVQPLLDNQLRAASPLVLPKK  188

Query  1295  DSITPLSELEAIDLVKTCFASATERDIYTGDRLEIVVLNLDGVRLEEMELRKD  1137
              S+T L    A+D+V+    +A ERDIYTGD +E+ ++  DG+R E   L+ D
Sbjct  189   PSVTALPVERALDIVRDALTAAGERDIYTGDSIEVWIMTKDGIRKESTPLKTD  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4286445245352