BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22317_g2_i1 len=1160 path=[2265:0-208 2473:209-227 @2220@!:228-796
3058:797-798 3060:799-917 1906:918-990 4350:991-1001 1990:1002-1159]

Length=1160
                                                                      Score     E

ref|XP_009610471.1|  PREDICTED: cationic peroxidase 1-like              481   1e-166   
ref|XP_009788801.1|  PREDICTED: cationic peroxidase 1-like              480   5e-166   
ref|XP_009597807.1|  PREDICTED: peroxidase 2-like                       479   7e-166   
ref|XP_004249044.1|  PREDICTED: peroxidase 2-like                       479   1e-165   
ref|XP_009775854.1|  PREDICTED: peroxidase 2-like                       478   2e-165   
ref|XP_009625317.1|  PREDICTED: cationic peroxidase 1-like              474   6e-164   
ref|XP_004249054.1|  PREDICTED: peroxidase 70-like                      474   8e-164   
ref|XP_006365360.1|  PREDICTED: peroxidase 70-like                      474   9e-164   
ref|XP_004253400.1|  PREDICTED: peroxidase 70-like                      472   6e-163   
ref|XP_006367398.1|  PREDICTED: peroxidase 4-like                       469   5e-162   
ref|XP_006365356.1|  PREDICTED: cationic peroxidase 1-like              469   7e-162   
ref|XP_004249056.1|  PREDICTED: peroxidase 70-like                      469   1e-161   
ref|XP_004249055.1|  PREDICTED: cationic peroxidase 1                   468   1e-161   
ref|XP_006365357.1|  PREDICTED: cationic peroxidase 1-like              468   2e-161   
ref|XP_006365355.1|  PREDICTED: peroxidase 4-like                       463   1e-159   
ref|XP_009795618.1|  PREDICTED: peroxidase 2-like                       463   2e-159   
ref|XP_007033588.1|  Peroxidase superfamily protein                     462   1e-158   
ref|XP_009597808.1|  PREDICTED: peroxidase 2-like                       461   2e-158   
ref|XP_006365358.1|  PREDICTED: cationic peroxidase 1-like              459   6e-158   
gb|AHL39188.1|  class III peroxidase                                    451   1e-154   
ref|XP_002268412.1|  PREDICTED: cationic peroxidase 1                   450   4e-154   Vitis vinifera
ref|XP_002323055.2|  peroxidase family protein                          449   8e-154   Populus trichocarpa [western balsam poplar]
emb|CDP06406.1|  unnamed protein product                                455   1e-152   
ref|XP_011019031.1|  PREDICTED: peroxidase 2-like                       444   5e-152   
ref|XP_011003588.1|  PREDICTED: peroxidase 2-like                       444   5e-152   
ref|XP_002531319.1|  Peroxidase 2 precursor, putative                   443   2e-151   Ricinus communis
gb|AHL39144.1|  class III peroxidase                                    442   2e-151   
ref|XP_002308244.1|  peroxidase family protein                          440   2e-150   Populus trichocarpa [western balsam poplar]
ref|XP_007033587.1|  Peroxidase superfamily protein                     440   3e-150   
gb|KDP22789.1|  hypothetical protein JCGZ_00376                         437   2e-149   
ref|XP_007033582.1|  Peroxidase superfamily protein                     437   4e-149   
gb|KDP22792.1|  hypothetical protein JCGZ_00379                         434   4e-148   
ref|XP_010041728.1|  PREDICTED: peroxidase P7-like                      434   4e-148   
gb|KDP22791.1|  hypothetical protein JCGZ_00378                         434   7e-148   
ref|XP_007033538.1|  Peroxidase superfamily protein                     434   7e-148   
ref|XP_002531320.1|  Cationic peroxidase 1 precursor, putative          432   5e-147   Ricinus communis
ref|XP_010066484.1|  PREDICTED: peroxidase 70-like                      431   1e-146   
ref|XP_010042071.1|  PREDICTED: peroxidase 70-like                      430   3e-146   
ref|XP_010066504.1|  PREDICTED: peroxidase 70-like                      429   6e-146   
gb|ABK59095.1|  peroxidase 1                                            428   1e-145   Sesbania rostrata
ref|XP_010042156.1|  PREDICTED: peroxidase P7-like                      427   2e-145   
ref|XP_010264469.1|  PREDICTED: peroxidase 2-like                       427   4e-145   
ref|XP_010066472.1|  PREDICTED: peroxidase 70-like                      427   4e-145   
ref|XP_011003590.1|  PREDICTED: peroxidase 2-like                       426   9e-145   
ref|XP_002323056.1|  peroxidase family protein                          425   2e-144   Populus trichocarpa [western balsam poplar]
gb|KDO49649.1|  hypothetical protein CISIN_1g021171mg                   424   4e-144   
ref|XP_006481156.1|  PREDICTED: cationic peroxidase 1-like              422   2e-143   
ref|XP_010041993.1|  PREDICTED: peroxidase P7-like                      421   6e-143   
ref|XP_010041911.1|  PREDICTED: peroxidase P7-like                      421   1e-142   
ref|XP_010041825.1|  PREDICTED: peroxidase P7-like                      418   9e-142   
ref|XP_007134679.1|  hypothetical protein PHAVU_010G066900g             417   4e-141   
ref|XP_003517000.1|  PREDICTED: peroxidase 52-like isoform 1            414   5e-140   
ref|XP_006576455.1|  PREDICTED: cationic peroxidase 1-like              413   8e-140   
ref|XP_011095108.1|  PREDICTED: cationic peroxidase 1-like              412   2e-139   
ref|XP_003522108.1|  PREDICTED: cationic peroxidase 1-like              412   2e-139   
ref|XP_003517003.1|  PREDICTED: cationic peroxidase 1                   412   2e-139   
ref|XP_003522112.1|  PREDICTED: cationic peroxidase 1-like              411   4e-139   
ref|XP_003522118.1|  PREDICTED: cationic peroxidase 1-like              411   7e-139   
ref|XP_007134677.1|  hypothetical protein PHAVU_010G066700g             410   7e-139   
gb|KHN33217.1|  Cationic peroxidase 1                                   410   9e-139   
ref|XP_003522116.1|  PREDICTED: cationic peroxidase 1-like              408   6e-138   
gb|KEH29221.1|  peroxidase family protein                               407   2e-137   
ref|XP_007134678.1|  hypothetical protein PHAVU_010G066800g             407   3e-137   
gb|KDP22790.1|  hypothetical protein JCGZ_00377                         406   7e-137   
ref|XP_009775408.1|  PREDICTED: cationic peroxidase 1-like              402   3e-136   
gb|KHN33222.1|  Cationic peroxidase 1                                   404   3e-136   
ref|XP_003522106.1|  PREDICTED: cationic peroxidase 1-like              402   2e-135   
ref|XP_009775853.1|  PREDICTED: cationic peroxidase 1-like              399   3e-135   
ref|XP_003522119.1|  PREDICTED: peroxidase 52-like                      400   1e-134   
ref|XP_010256953.1|  PREDICTED: cationic peroxidase 1-like              393   6e-132   
gb|KEH29222.1|  peroxidase family protein                               393   8e-132   
ref|XP_004514549.1|  PREDICTED: cationic peroxidase 1-like              390   9e-131   
ref|XP_003551178.1|  PREDICTED: cationic peroxidase 1-like              384   2e-128   
ref|XP_007146854.1|  hypothetical protein PHAVU_006G075700g             383   6e-128   
ref|XP_003522104.1|  PREDICTED: peroxidase 2-like                       382   3e-127   
gb|KHN44823.1|  Peroxidase 52                                           376   6e-126   
ref|XP_007142067.1|  hypothetical protein PHAVU_008G249700g             378   7e-126   
gb|KHN46627.1|  Peroxidase 4                                            377   9e-126   
ref|NP_001242396.1|  uncharacterized protein LOC100812163 precursor     377   2e-125   
gb|AFK40000.1|  unknown                                                 377   2e-125   
gb|KHN44819.1|  Cationic peroxidase 1                                   374   4e-125   
gb|KHN33216.1|  Cationic peroxidase 1                                   374   4e-125   
gb|KHN33220.1|  Cationic peroxidase 1                                   372   1e-124   
ref|NP_001241243.1|  uncharacterized protein LOC100816056 precursor     374   3e-124   
ref|XP_007146855.1|  hypothetical protein PHAVU_006G075800g             373   4e-124   
ref|XP_004149369.1|  PREDICTED: cationic peroxidase 1-like              373   4e-124   
ref|XP_003615990.1|  Peroxidase                                         373   5e-124   
gb|KHN33221.1|  Cationic peroxidase 1                                   370   6e-124   
ref|XP_008463818.1|  PREDICTED: cationic peroxidase 1-like              374   8e-124   
emb|CDP16309.1|  unnamed protein product                                371   3e-123   
ref|XP_003615976.1|  Peroxidase                                         370   4e-123   
ref|XP_007142068.1|  hypothetical protein PHAVU_008G249800g             370   9e-123   
ref|XP_003519282.1|  PREDICTED: peroxidase 4-like                       369   1e-122   
ref|XP_003615981.1|  Peroxidase                                         369   2e-122   
ref|XP_010264470.1|  PREDICTED: peroxidase P7-like                      369   2e-122   
gb|KHN46098.1|  Peroxidase 4                                            369   3e-122   
ref|XP_004149367.1|  PREDICTED: peroxidase 4-like                       369   3e-122   
ref|XP_006468149.1|  PREDICTED: cationic peroxidase 1-like              368   3e-122   
ref|XP_004242492.1|  PREDICTED: cationic peroxidase 1                   368   4e-122   
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                      367   9e-122   
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1            367   1e-121   
ref|XP_008463816.1|  PREDICTED: peroxidase P7-like                      367   1e-121   
gb|AGZ15377.1|  peroxidase 4-like protein                               366   4e-121   
ref|XP_010263838.1|  PREDICTED: cationic peroxidase 1-like isofor...    365   4e-121   
ref|XP_004302590.1|  PREDICTED: cationic peroxidase 1-like              365   5e-121   
gb|ACJ11762.1|  class III peroxidase                                    365   7e-121   Gossypium hirsutum [American cotton]
ref|XP_004294748.1|  PREDICTED: cationic peroxidase 1-like              365   8e-121   
ref|XP_007033589.1|  Peroxidase superfamily protein                     365   9e-121   
ref|XP_010256952.1|  PREDICTED: peroxidase 4-like                       363   1e-120   
gb|KHN33214.1|  Cationic peroxidase 1                                   362   1e-120   
ref|XP_008782619.1|  PREDICTED: cationic peroxidase 1-like              363   2e-120   
gb|EMS48893.1|  Peroxidase 52                                           363   3e-120   
ref|XP_003615979.1|  Peroxidase                                         363   3e-120   
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                      363   3e-120   
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                      363   3e-120   
ref|XP_006848018.1|  hypothetical protein AMTR_s00029p00173190          363   3e-120   
ref|XP_003552297.1|  PREDICTED: cationic peroxidase 1-like              363   3e-120   
ref|XP_010263840.1|  PREDICTED: cationic peroxidase 1-like              363   4e-120   
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                       363   4e-120   
ref|XP_006843744.1|  hypothetical protein AMTR_s00007p00229000          362   5e-120   
ref|XP_006843746.1|  hypothetical protein AMTR_s00007p00230210          362   1e-119   
ref|XP_006595847.1|  PREDICTED: peroxidase 4-like                       362   1e-119   
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                      362   1e-119   
ref|XP_010261061.1|  PREDICTED: cationic peroxidase 1-like              361   2e-119   
ref|XP_006596457.1|  PREDICTED: cationic peroxidase 1-like              360   2e-119   
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                       361   2e-119   
ref|XP_007206479.1|  hypothetical protein PRUPE_ppa018750mg             361   2e-119   
gb|ACU17608.1|  unknown                                                 361   3e-119   Glycine max [soybeans]
ref|XP_006833057.1|  hypothetical protein AMTR_s00170p00037010          360   3e-119   
ref|NP_001241115.1|  uncharacterized protein LOC100811170 precursor     360   4e-119   
ref|XP_006848008.1|  hypothetical protein AMTR_s00029p00168370          360   4e-119   
ref|NP_001241914.1|  uncharacterized protein LOC100790279 precursor     360   4e-119   
ref|XP_010260327.1|  PREDICTED: peroxidase P7-like                      360   5e-119   
ref|XP_006486214.1|  PREDICTED: peroxidase 4-like                       360   5e-119   
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810          360   5e-119   
ref|XP_011021040.1|  PREDICTED: peroxidase P7-like                      360   6e-119   
gb|KHN44724.1|  Peroxidase 4                                            360   7e-119   
gb|ABK21858.1|  unknown                                                 360   7e-119   Picea sitchensis
ref|XP_003634480.1|  PREDICTED: cationic peroxidase 1                   359   9e-119   
tpe|CAH69378.1|  TPA: class III peroxidase 136 precursor                359   1e-118   
ref|XP_010921099.1|  PREDICTED: peroxidase P7-like                      359   1e-118   
ref|XP_004490698.1|  PREDICTED: cationic peroxidase 1-like              359   1e-118   
ref|XP_006848019.1|  hypothetical protein AMTR_s00029p00173440          359   1e-118   
ref|XP_011021015.1|  PREDICTED: cationic peroxidase 1-like              359   1e-118   
ref|XP_007141708.1|  hypothetical protein PHAVU_008G218500g             359   1e-118   
ref|XP_003534655.2|  PREDICTED: cationic peroxidase 1-like              360   2e-118   
ref|XP_008244639.1|  PREDICTED: peroxidase 4-like                       358   2e-118   
ref|XP_010937975.1|  PREDICTED: cationic peroxidase 1-like              358   2e-118   
ref|XP_011070595.1|  PREDICTED: lignin-forming anionic peroxidase...    358   2e-118   
ref|XP_002285723.1|  PREDICTED: cationic peroxidase 1 isoform X1        358   3e-118   Vitis vinifera
ref|XP_004140450.1|  PREDICTED: lignin-forming anionic peroxidase...    358   4e-118   
ref|XP_002283995.1|  PREDICTED: cationic peroxidase 1-like              358   4e-118   Vitis vinifera
ref|XP_004977590.1|  PREDICTED: cationic peroxidase 1-like              358   4e-118   
ref|XP_008384732.1|  PREDICTED: peroxidase P7-like                      358   4e-118   
ref|XP_004296027.1|  PREDICTED: cationic peroxidase 1-like              358   5e-118   
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor        357   6e-118   Gossypium hirsutum [American cotton]
ref|XP_009369546.1|  PREDICTED: peroxidase P7-like                      357   6e-118   
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                      357   6e-118   
ref|XP_002319422.1|  peroxidase precursor family protein                357   6e-118   Populus trichocarpa [western balsam poplar]
ref|NP_001065566.1|  Os11g0112200                                       357   7e-118   Oryza sativa Japonica Group [Japonica rice]
gb|ACU23245.1|  unknown                                                 357   7e-118   Glycine max [soybeans]
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                      357   7e-118   
ref|XP_009775239.1|  PREDICTED: cationic peroxidase 1-like              357   8e-118   
ref|XP_010066394.1|  PREDICTED: cationic peroxidase 1-like              357   8e-118   
ref|XP_006470332.1|  PREDICTED: peroxidase 4-like                       357   9e-118   
ref|XP_010938275.1|  PREDICTED: peroxidase P7-like                      357   9e-118   
ref|XP_010921094.1|  PREDICTED: cationic peroxidase 1-like              357   1e-117   
ref|XP_010264472.1|  PREDICTED: cationic peroxidase 1-like              357   1e-117   
ref|XP_008782621.1|  PREDICTED: peroxidase P7-like                      357   1e-117   
ref|XP_011070596.1|  PREDICTED: lignin-forming anionic peroxidase...    357   1e-117   
emb|CDP08160.1|  unnamed protein product                                357   1e-117   
ref|XP_009608056.1|  PREDICTED: lignin-forming anionic peroxidase       357   1e-117   
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                      357   1e-117   
gb|EEC75221.1|  hypothetical protein OsI_11488                          357   2e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g             356   2e-117   
ref|XP_009785653.1|  PREDICTED: cationic peroxidase 1-like              356   2e-117   
ref|XP_006664869.1|  PREDICTED: cationic peroxidase 1-like              356   2e-117   
emb|CAD67479.1|  peroxidase                                             356   3e-117   Asparagus officinalis
emb|CDP07980.1|  unnamed protein product                                356   3e-117   
ref|XP_010922691.1|  PREDICTED: peroxidase 4-like                       355   4e-117   
ref|XP_010041557.1|  PREDICTED: cationic peroxidase 1-like              355   4e-117   
ref|XP_011070600.1|  PREDICTED: lignin-forming anionic peroxidase...    355   4e-117   
gb|AHL39176.1|  class III peroxidase                                    355   4e-117   
ref|XP_008782618.1|  PREDICTED: cationic peroxidase 1-like              356   5e-117   
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                      355   5e-117   
ref|XP_002450134.1|  hypothetical protein SORBIDRAFT_05g001030          355   6e-117   Sorghum bicolor [broomcorn]
ref|XP_010931328.1|  PREDICTED: cationic peroxidase 1-like              355   6e-117   
ref|XP_009594465.1|  PREDICTED: cationic peroxidase 1-like              355   6e-117   
ref|XP_007048724.1|  Peroxidase superfamily protein                     355   6e-117   
ref|XP_010931330.1|  PREDICTED: peroxidase 4-like                       355   6e-117   
tpe|CAH69282.1|  TPA: class III peroxidase 40 precursor                 355   6e-117   
ref|XP_006470943.1|  PREDICTED: lignin-forming anionic peroxidase...    355   6e-117   
ref|XP_007142069.1|  hypothetical protein PHAVU_008G249900g             355   7e-117   
ref|XP_004500339.1|  PREDICTED: cationic peroxidase 1-like              355   7e-117   
gb|ABF95843.1|  Peroxidase 52 precursor, putative, expressed            355   8e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003552299.1|  PREDICTED: cationic peroxidase 1-like              355   8e-117   
ref|XP_008776455.1|  PREDICTED: peroxidase 70-like                      354   9e-117   
ref|XP_008384726.1|  PREDICTED: peroxidase P7-like                      354   1e-116   
ref|XP_003519281.1|  PREDICTED: peroxidase 4-like                       355   1e-116   
ref|XP_010041648.1|  PREDICTED: cationic peroxidase 1-like              354   1e-116   
dbj|BAM05634.1|  peroxidase 2                                           355   1e-116   
emb|CAH10839.1|  peroxidase                                             354   1e-116   Picea abies
ref|XP_010035984.1|  PREDICTED: cationic peroxidase 1-like              354   1e-116   
gb|KHN29529.1|  Cationic peroxidase 1                                   353   2e-116   
dbj|BAM05635.1|  peroxidase 2                                           354   2e-116   
ref|XP_006378807.1|  hypothetical protein POPTR_0010s24330g             353   3e-116   
ref|XP_009420366.1|  PREDICTED: peroxidase P7-like                      353   3e-116   
ref|XP_008460239.1|  PREDICTED: lignin-forming anionic peroxidase...    353   3e-116   
gb|KHN44723.1|  Peroxidase 4                                            353   3e-116   
gb|AHL39166.1|  class III peroxidase                                    353   3e-116   
ref|XP_003545648.1|  PREDICTED: peroxidase 4                            353   3e-116   
ref|XP_010035985.1|  PREDICTED: cationic peroxidase 1-like              353   4e-116   
ref|XP_010552918.1|  PREDICTED: peroxidase P7-like                      353   4e-116   
ref|XP_007206242.1|  hypothetical protein PRUPE_ppa015551mg             353   4e-116   
ref|NP_001289531.1|  lignin-forming anionic peroxidase precursor        353   5e-116   
ref|XP_006378808.1|  hypothetical protein POPTR_0010s24340g             352   5e-116   
gb|KHN46099.1|  Cationic peroxidase 1                                   352   6e-116   
ref|XP_010664359.1|  PREDICTED: cationic peroxidase 1 isoform X3        352   6e-116   
ref|XP_006387938.1|  hypothetical protein POPTR_0466s00210g             352   6e-116   
ref|XP_008244539.1|  PREDICTED: peroxidase P7-like                      352   6e-116   
ref|XP_010261059.1|  PREDICTED: cationic peroxidase 1-like isofor...    352   6e-116   
ref|XP_003616748.1|  Peroxidase                                         352   7e-116   
emb|CDP13933.1|  unnamed protein product                                352   7e-116   
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                      352   7e-116   
ref|XP_003557955.1|  PREDICTED: peroxidase P7-like                      352   8e-116   
ref|XP_006468150.1|  PREDICTED: peroxidase 52-like                      351   8e-116   
ref|XP_011070599.1|  PREDICTED: lignin-forming anionic peroxidase...    352   8e-116   
ref|XP_010264466.1|  PREDICTED: peroxidase 4-like                       352   9e-116   
gb|AFR44628.1|  class III secretory peroxidase                          352   1e-115   
ref|XP_009622973.1|  PREDICTED: cationic peroxidase 1-like              352   1e-115   
ref|XP_008354764.1|  PREDICTED: peroxidase 4-like                       352   1e-115   
ref|XP_007011229.1|  Peroxidase superfamily protein                     352   1e-115   
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like              352   1e-115   
ref|XP_008358939.1|  PREDICTED: peroxidase P7-like                      351   1e-115   
ref|XP_008245160.1|  PREDICTED: cationic peroxidase 1-like              352   1e-115   
ref|XP_008810563.1|  PREDICTED: peroxidase 4-like                       351   2e-115   
ref|XP_002281755.1|  PREDICTED: peroxidase P7                           351   2e-115   Vitis vinifera
ref|XP_009416317.1|  PREDICTED: cationic peroxidase 1-like              351   2e-115   
gb|ABV24960.2|  putative secretory peroxidase                           351   2e-115   Catharanthus roseus [chatas]
gb|KHN40655.1|  Cationic peroxidase 1                                   351   2e-115   
ref|XP_008370240.1|  PREDICTED: cationic peroxidase 1-like              351   2e-115   
ref|XP_007205544.1|  hypothetical protein PRUPE_ppa008590mg             351   2e-115   
gb|KDP21681.1|  hypothetical protein JCGZ_03352                         351   2e-115   
ref|XP_004305595.1|  PREDICTED: lignin-forming anionic peroxidase...    351   2e-115   
ref|XP_010067586.1|  PREDICTED: peroxidase 4-like                       351   3e-115   
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like              350   3e-115   
ref|XP_010067580.1|  PREDICTED: peroxidase 4-like                       350   3e-115   
ref|XP_003556178.1|  PREDICTED: lignin-forming anionic peroxidase...    350   4e-115   
ref|XP_008384729.1|  PREDICTED: peroxidase 4-like isoform X1            350   4e-115   
ref|XP_003601028.1|  Peroxidase                                         350   4e-115   
ref|XP_009354386.1|  PREDICTED: peroxidase 4-like                       350   4e-115   
ref|XP_009373126.1|  PREDICTED: cationic peroxidase 1-like              350   5e-115   
ref|XP_009410536.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    350   5e-115   
dbj|BAM05637.1|  peroxidase 2                                           350   5e-115   
gb|ACN33662.1|  unknown                                                 350   6e-115   Zea mays [maize]
ref|XP_010695716.1|  PREDICTED: peroxidase 4-like                       350   6e-115   
ref|XP_008244444.1|  PREDICTED: peroxidase 4-like                       350   7e-115   
gb|ADN96692.1|  peroxidase 5                                            350   7e-115   
ref|XP_006470944.1|  PREDICTED: lignin-forming anionic peroxidase...    350   7e-115   
ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like              349   7e-115   
ref|XP_008384730.1|  PREDICTED: peroxidase 4-like isoform X2            349   9e-115   
ref|XP_002319407.1|  peroxidase family protein                          348   9e-115   Populus trichocarpa [western balsam poplar]
ref|XP_009369543.1|  PREDICTED: peroxidase 4-like                       350   9e-115   
ref|XP_004505714.1|  PREDICTED: lignin-forming anionic peroxidase...    349   1e-114   
gb|AES90060.2|  lignin-forming anionic peroxidase                       349   1e-114   
gb|KHN00767.1|  Lignin-forming anionic peroxidase                       349   1e-114   
ref|NP_001242089.1|  uncharacterized protein LOC100815671 precursor     349   1e-114   
gb|ABR18139.1|  unknown                                                 349   1e-114   Picea sitchensis
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                      349   1e-114   
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                      349   1e-114   
ref|XP_003607863.1|  Peroxidase                                         349   1e-114   
gb|KHN33215.1|  Peroxidase 70                                           347   1e-114   
ref|XP_010685963.1|  PREDICTED: cationic peroxidase 1-like              350   1e-114   
ref|NP_001147443.1|  peroxidase 52 precursor                            349   2e-114   Zea mays [maize]
ref|XP_010270786.1|  PREDICTED: lignin-forming anionic peroxidase...    348   2e-114   
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  348   2e-114   Ricinus communis
ref|XP_002441703.1|  hypothetical protein SORBIDRAFT_08g000990          348   2e-114   Sorghum bicolor [broomcorn]
ref|XP_006470886.1|  PREDICTED: lignin-forming anionic peroxidase...    348   2e-114   
ref|XP_002281731.1|  PREDICTED: peroxidase P7                           348   2e-114   Vitis vinifera
ref|NP_001131000.1|  uncharacterized protein LOC100192105 precursor     348   2e-114   
gb|KHG18057.1|  Peroxidase 52 -like protein                             348   3e-114   
ref|XP_011024237.1|  PREDICTED: lignin-forming anionic peroxidase...    348   3e-114   
ref|XP_004490699.1|  PREDICTED: cationic peroxidase 1-like              348   3e-114   
gb|EMT01627.1|  Peroxidase 52                                           348   3e-114   
ref|XP_008233849.1|  PREDICTED: peroxidase 4-like                       348   3e-114   
ref|XP_010543687.1|  PREDICTED: peroxidase 52                           348   3e-114   
ref|XP_011080739.1|  PREDICTED: peroxidase 4-like                       348   3e-114   
ref|XP_010270787.1|  PREDICTED: lignin-forming anionic peroxidase...    347   3e-114   
ref|XP_003538325.1|  PREDICTED: cationic peroxidase 1-like              348   3e-114   
ref|XP_011076613.1|  PREDICTED: peroxidase P7                           348   3e-114   
ref|XP_002278996.1|  PREDICTED: peroxidase 4                            348   4e-114   
ref|XP_010246463.1|  PREDICTED: peroxidase P7-like                      347   4e-114   
ref|XP_003615995.1|  Peroxidase                                         348   4e-114   
ref|XP_007205551.1|  hypothetical protein PRUPE_ppa008607mg             348   5e-114   
ref|XP_010031113.1|  PREDICTED: peroxidase 4-like                       348   5e-114   
ref|XP_009410539.1|  PREDICTED: cationic peroxidase 1-like              347   5e-114   
ref|XP_010270788.1|  PREDICTED: lignin-forming anionic peroxidase...    348   5e-114   
gb|EMS66985.1|  Peroxidase 4                                            347   5e-114   
ref|XP_007205557.1|  hypothetical protein PRUPE_ppa008642mg             347   5e-114   
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      347   6e-114   
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                      347   6e-114   
emb|CBI19219.3|  unnamed protein product                                352   6e-114   
gb|AFK49124.1|  unknown                                                 347   6e-114   
emb|CDP04067.1|  unnamed protein product                                347   7e-114   
ref|XP_002521867.1|  Lignin-forming anionic peroxidase precursor,...    347   7e-114   
ref|XP_006470885.1|  PREDICTED: lignin-forming anionic peroxidase...    347   8e-114   
ref|XP_002284007.1|  PREDICTED: cationic peroxidase 1 isoform X2        347   8e-114   
ref|XP_008782622.1|  PREDICTED: peroxidase P7-like                      347   8e-114   
ref|XP_004303193.1|  PREDICTED: peroxidase 52-like                      347   1e-113   
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                       347   1e-113   
gb|EYU46001.1|  hypothetical protein MIMGU_mgv1a018175mg                346   1e-113   
emb|CAL25300.1|  properoxidase                                          346   1e-113   
ref|XP_007011215.1|  Peroxidase superfamily protein isoform 1           347   1e-113   
ref|XP_007218699.1|  hypothetical protein PRUPE_ppa008820mg             346   1e-113   
ref|XP_004307711.1|  PREDICTED: peroxidase 4-like                       346   1e-113   
ref|XP_010041464.1|  PREDICTED: cationic peroxidase 1-like              346   1e-113   
gb|AAP42508.1|  anionic peroxidase swpb3                                346   1e-113   
gb|KDO60611.1|  hypothetical protein CISIN_1g020951mg                   346   2e-113   
ref|XP_009408893.1|  PREDICTED: peroxidase P7-like                      346   2e-113   
ref|XP_006466288.1|  PREDICTED: peroxidase 4-like                       346   2e-113   
ref|XP_010270789.1|  PREDICTED: lignin-forming anionic peroxidase...    346   2e-113   
ref|XP_010067589.1|  PREDICTED: peroxidase P7-like isoform X1           346   2e-113   
ref|XP_007045349.1|  Lignin-forming anionic peroxidase                  346   2e-113   
ref|XP_008374511.1|  PREDICTED: peroxidase P7-like isoform X1           346   2e-113   
ref|XP_002311022.2|  hypothetical protein POPTR_0008s02340g             346   2e-113   
ref|XP_010921098.1|  PREDICTED: cationic peroxidase 1-like              345   2e-113   
ref|XP_007045348.1|  Lignin-forming anionic peroxidase                  346   3e-113   
ref|XP_010921101.1|  PREDICTED: peroxidase 4-like                       345   3e-113   
ref|XP_002450133.1|  hypothetical protein SORBIDRAFT_05g001010          346   3e-113   
gb|EYU46002.1|  hypothetical protein MIMGU_mgv1a009759mg                346   3e-113   
ref|XP_010045399.1|  PREDICTED: peroxidase 4-like                       345   3e-113   
ref|XP_009388702.1|  PREDICTED: peroxidase P7-like                      350   3e-113   
gb|KDP22793.1|  hypothetical protein JCGZ_00380                         344   3e-113   
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                      345   3e-113   
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                      345   3e-113   
emb|CAN81400.1|  hypothetical protein VITISV_038539                     345   4e-113   
ref|XP_008235963.1|  PREDICTED: peroxidase P7-like                      345   4e-113   
ref|XP_008228933.1|  PREDICTED: peroxidase P7-like                      345   4e-113   
ref|XP_007146853.1|  hypothetical protein PHAVU_006G075600g             345   4e-113   
ref|XP_011032836.1|  PREDICTED: lignin-forming anionic peroxidase...    345   5e-113   
ref|XP_011024238.1|  PREDICTED: peroxidase 5-like                       347   5e-113   
ref|XP_004140410.1|  PREDICTED: lignin-forming anionic peroxidase...    345   5e-113   
ref|XP_009404515.1|  PREDICTED: peroxidase P7-like                      345   5e-113   
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g             345   5e-113   
ref|XP_010256954.1|  PREDICTED: cationic peroxidase 1-like              345   5e-113   
ref|XP_008343635.1|  PREDICTED: peroxidase 4-like                       345   6e-113   
ref|XP_004984445.1|  PREDICTED: peroxidase 52-like                      345   6e-113   
gb|AFW64595.1|  hypothetical protein ZEAMMB73_885092                    345   6e-113   
gb|KHG09190.1|  Peroxidase 4                                            345   6e-113   
gb|ACI03401.1|  peroxidase 1                                            344   7e-113   
ref|XP_004294750.1|  PREDICTED: cationic peroxidase 1-like              344   7e-113   
ref|XP_002269918.1|  PREDICTED: peroxidase 4                            345   7e-113   
ref|XP_009404514.1|  PREDICTED: peroxidase P7-like                      344   7e-113   
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                      344   8e-113   
dbj|BAA82306.1|  peroxidase                                             344   8e-113   
ref|XP_004977588.1|  PREDICTED: peroxidase 4-like                       344   8e-113   
ref|XP_011070598.1|  PREDICTED: lignin-forming anionic peroxidase...    344   8e-113   
dbj|BAK00939.1|  predicted protein                                      344   9e-113   
ref|XP_010650833.1|  PREDICTED: cationic peroxidase 1-like              343   9e-113   
gb|KHG17773.1|  Peroxidase 52 -like protein                             344   1e-112   
ref|XP_003551179.1|  PREDICTED: cationic peroxidase 1-like              344   1e-112   
ref|XP_008374568.1|  PREDICTED: peroxidase 4-like                       344   1e-112   
ref|XP_010423480.1|  PREDICTED: peroxidase 52                           344   1e-112   
gb|KHN46100.1|  Cationic peroxidase 1                                   343   1e-112   
ref|XP_008364165.1|  PREDICTED: peroxidase 4-like                       343   2e-112   
gb|KEH34419.1|  anionic peroxidase swpb3 protein                        343   2e-112   
ref|XP_004505715.1|  PREDICTED: lignin-forming anionic peroxidase...    343   2e-112   
ref|XP_010066359.1|  PREDICTED: cationic peroxidase 1-like              343   2e-112   
ref|XP_009786874.1|  PREDICTED: peroxidase P7                           343   2e-112   
ref|XP_010452439.1|  PREDICTED: peroxidase 52-like                      343   2e-112   
ref|XP_006379469.1|  hypothetical protein POPTR_0008s02330g             343   2e-112   
ref|XP_004958680.1|  PREDICTED: peroxidase 70-like                      343   2e-112   
gb|AAR31106.1|  peroxidase precursor                                    343   2e-112   
gb|AAL93151.1|AF485265_1  class III peroxidase                          343   2e-112   
ref|XP_009381203.1|  PREDICTED: peroxidase P7-like                      343   2e-112   
ref|XP_010030093.1|  PREDICTED: lignin-forming anionic peroxidase...    343   2e-112   
ref|XP_010041552.1|  PREDICTED: peroxidase P7-like                      343   2e-112   
ref|XP_002269145.1|  PREDICTED: lignin-forming anionic peroxidase       343   2e-112   
ref|XP_007215699.1|  hypothetical protein PRUPE_ppa008808mg             343   2e-112   
ref|XP_010035986.1|  PREDICTED: cationic peroxidase 1-like              343   3e-112   
ref|XP_009358287.1|  PREDICTED: cationic peroxidase 1-like              343   3e-112   
ref|XP_008374539.1|  PREDICTED: peroxidase 4-like isoform X1            343   3e-112   
pdb|1SCH|A  Chain A, Peanut Peroxidase                                  342   3e-112   
ref|XP_006664870.1|  PREDICTED: peroxidase 4-like                       343   4e-112   
ref|XP_011008654.1|  PREDICTED: peroxidase P7                           342   4e-112   
ref|XP_003538964.1|  PREDICTED: lignin-forming anionic peroxidase...    342   4e-112   
ref|XP_007131640.1|  hypothetical protein PHAVU_011G030200g             342   5e-112   
gb|ABK23423.1|  unknown                                                 342   5e-112   
gb|AHL39158.1|  class III peroxidase                                    342   5e-112   
ref|XP_006589469.1|  PREDICTED: lignin-forming anionic peroxidase...    342   5e-112   
gb|AAP76387.1|  class III peroxidase                                    343   5e-112   
sp|P22195.2|PER1_ARAHY  RecName: Full=Cationic peroxidase 1; AltN...    342   5e-112   
ref|XP_011070597.1|  PREDICTED: lignin-forming anionic peroxidase...    342   6e-112   
gb|EYU20115.1|  hypothetical protein MIMGU_mgv1a025851mg                342   6e-112   
gb|AAR31108.1|  peroxidase precursor                                    342   7e-112   
ref|XP_010685954.1|  PREDICTED: cationic peroxidase 1-like              342   7e-112   
ref|XP_010685962.1|  PREDICTED: cationic peroxidase 1-like              343   8e-112   
ref|XP_006842568.1|  hypothetical protein AMTR_s00077p00148760          341   8e-112   
ref|XP_006361366.1|  PREDICTED: lignin-forming anionic peroxidase...    342   8e-112   
ref|XP_008229652.1|  PREDICTED: cationic peroxidase 1-like              342   9e-112   
ref|XP_010689732.1|  PREDICTED: peroxidase P7-like                      342   1e-111   
ref|XP_010683551.1|  PREDICTED: cationic peroxidase 1-like              342   1e-111   
ref|XP_009781728.1|  PREDICTED: lignin-forming anionic peroxidase...    341   1e-111   
ref|XP_009384773.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    343   1e-111   
dbj|BAJ97638.1|  predicted protein                                      341   1e-111   
ref|XP_008374518.1|  PREDICTED: peroxidase P7-like isoform X2           341   1e-111   
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like              341   1e-111   
ref|XP_003602462.1|  Peroxidase                                         341   1e-111   
gb|ACU82387.2|  peroxidase 1                                            341   1e-111   
ref|XP_010654887.1|  PREDICTED: lignin-forming anionic peroxidase...    342   1e-111   
ref|XP_006662662.1|  PREDICTED: peroxidase 4-like                       341   1e-111   
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                       341   2e-111   
ref|XP_004978554.1|  PREDICTED: peroxidase 4-like                       342   2e-111   
ref|XP_009371984.1|  PREDICTED: cationic peroxidase 1-like              341   2e-111   
ref|XP_008354739.1|  PREDICTED: cationic peroxidase 1-like              341   2e-111   
ref|XP_006351919.1|  PREDICTED: lignin-forming anionic peroxidase...    341   2e-111   
ref|XP_004296028.1|  PREDICTED: cationic peroxidase 1-like              341   2e-111   
ref|XP_008455297.1|  PREDICTED: peroxidase P7-like                      341   2e-111   
ref|XP_008369323.1|  PREDICTED: peroxidase 4-like                       341   2e-111   
ref|XP_010087168.1|  Cationic peroxidase 1                              340   2e-111   
emb|CBI22007.3|  unnamed protein product                                344   2e-111   
ref|XP_009395400.1|  PREDICTED: peroxidase P7-like                      341   2e-111   
ref|XP_009419701.1|  PREDICTED: cationic peroxidase 1-like              341   2e-111   
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like              341   2e-111   
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                      340   2e-111   
ref|XP_004510041.1|  PREDICTED: peroxidase 52-like                      340   3e-111   
ref|XP_006361306.1|  PREDICTED: peroxidase 4-like                       340   3e-111   
ref|XP_007011212.1|  Peroxidase superfamily protein                     340   3e-111   
ref|XP_010087166.1|  Peroxidase 4                                       340   3e-111   
emb|CAN80097.1|  hypothetical protein VITISV_011206                     340   3e-111   
ref|NP_001151940.1|  peroxidase 52 precursor                            341   3e-111   
gb|AAB02554.1|  cationic peroxidase                                     340   3e-111   
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like              340   4e-111   
ref|XP_002521852.1|  Lignin-forming anionic peroxidase precursor,...    340   4e-111   
ref|XP_002269169.1|  PREDICTED: lignin-forming anionic peroxidase       340   4e-111   
ref|XP_004297785.1|  PREDICTED: lignin-forming anionic peroxidase...    340   4e-111   
ref|XP_006848015.1|  hypothetical protein AMTR_s00029p00170340          341   4e-111   
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like              340   5e-111   
ref|XP_010067582.1|  PREDICTED: peroxidase P7-like                      340   5e-111   
gb|KEH34511.1|  peroxidase family protein                               340   5e-111   
ref|XP_009378928.1|  PREDICTED: peroxidase P7-like                      339   5e-111   
ref|XP_008229747.1|  PREDICTED: cationic peroxidase 1-like              340   6e-111   
gb|AFK33633.1|  unknown                                                 340   6e-111   
emb|CAH10840.1|  peroxidase                                             340   6e-111   
ref|XP_010695664.1|  PREDICTED: peroxidase P7-like                      339   6e-111   
ref|XP_003623567.1|  Peroxidase                                         339   6e-111   
ref|XP_007206549.1|  hypothetical protein PRUPE_ppa018900mg             339   6e-111   
gb|AAX53172.1|  peroxidase                                              339   7e-111   
ref|XP_008374548.1|  PREDICTED: peroxidase 4-like isoform X2            339   7e-111   
gb|KHN46282.1|  Peroxidase 4                                            340   7e-111   
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                       340   7e-111   
ref|XP_008450825.1|  PREDICTED: peroxidase P7-like                      339   7e-111   
ref|XP_003538328.1|  PREDICTED: peroxidase 4-like                       340   8e-111   
ref|XP_007206416.1|  hypothetical protein PRUPE_ppa018664mg             338   8e-111   
ref|XP_004978553.1|  PREDICTED: peroxidase 4-like                       340   8e-111   
ref|XP_010067590.1|  PREDICTED: peroxidase P7-like isoform X2           339   8e-111   
gb|EPS63041.1|  hypothetical protein M569_11749                         339   8e-111   
ref|XP_010689719.1|  PREDICTED: peroxidase 4-like                       339   8e-111   
tpe|CAH69372.1|  TPA: class III peroxidase 130 precursor                339   8e-111   
emb|CBI27503.3|  unnamed protein product                                340   9e-111   
ref|XP_008343098.1|  PREDICTED: peroxidase P7-like                      339   9e-111   
ref|XP_008343097.1|  PREDICTED: peroxidase P7-like                      339   9e-111   
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                       339   1e-110   
ref|XP_010045401.1|  PREDICTED: peroxidase 4-like                       339   1e-110   
ref|XP_010066439.1|  PREDICTED: cationic peroxidase 1-like              339   1e-110   
emb|CAD67478.1|  peroxidase                                             338   1e-110   
ref|XP_010683553.1|  PREDICTED: cationic peroxidase 1-like              339   1e-110   
ref|XP_004491048.1|  PREDICTED: peroxidase 4-like                       339   1e-110   
ref|XP_008244108.1|  PREDICTED: peroxidase 4                            339   1e-110   
ref|XP_009801852.1|  PREDICTED: lignin-forming anionic peroxidase...    338   2e-110   
gb|EPS67864.1|  hypothetical protein M569_06908                         338   2e-110   
ref|XP_010925616.1|  PREDICTED: peroxidase P7-like                      338   2e-110   
ref|NP_001169614.1|  uncharacterized protein LOC100383495 precursor     339   2e-110   
gb|ACF08095.1|  class III peroxidase                                    338   2e-110   
ref|XP_010915490.1|  PREDICTED: peroxidase P7-like                      338   2e-110   
ref|XP_009365290.1|  PREDICTED: peroxidase P7-like                      338   2e-110   
ref|XP_011021038.1|  PREDICTED: peroxidase 4-like                       338   2e-110   
emb|CAD67477.1|  peroxidase                                             338   2e-110   
ref|XP_011033755.1|  PREDICTED: peroxidase P7-like                      338   2e-110   
ref|XP_010093550.1|  Cationic peroxidase 1                              338   2e-110   
emb|CDP04065.1|  unnamed protein product                                338   2e-110   
gb|ADN96693.1|  peroxidase 6                                            338   2e-110   
ref|XP_002270068.2|  PREDICTED: cationic peroxidase 1-like              338   2e-110   
emb|CAN73051.1|  hypothetical protein VITISV_015511                     337   3e-110   
gb|ACF08094.1|  class III peroxidase                                    338   3e-110   
ref|XP_006351920.1|  PREDICTED: lignin-forming anionic peroxidase...    338   3e-110   
ref|XP_009371986.1|  PREDICTED: cationic peroxidase 1-like isofor...    337   3e-110   
gb|AAY89058.1|  class III peroxidase                                    338   3e-110   
ref|XP_010915492.1|  PREDICTED: peroxidase P7-like                      337   4e-110   
ref|XP_002450132.1|  hypothetical protein SORBIDRAFT_05g001000          338   4e-110   
ref|XP_009603345.1|  PREDICTED: lignin-forming anionic peroxidase...    337   4e-110   
ref|XP_003562452.1|  PREDICTED: peroxidase 2-like                       337   4e-110   
gb|KEH29224.1|  class III peroxidase                                    338   5e-110   
ref|XP_010683552.1|  PREDICTED: cationic peroxidase 1-like              337   5e-110   
ref|XP_002320417.1|  peroxidase family protein                          337   5e-110   
ref|XP_009371985.1|  PREDICTED: cationic peroxidase 1-like isofor...    337   5e-110   
ref|XP_004500341.1|  PREDICTED: peroxidase 4-like                       337   5e-110   
ref|XP_006370761.1|  Peroxidase 4 precursor family protein              337   5e-110   
gb|KDP25492.1|  hypothetical protein JCGZ_20648                         337   6e-110   
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350              337   6e-110   



>ref|XP_009610471.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=317

 Score =   481 bits (1238),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 230/294 (78%), Positives = 257/294 (87%), Gaps = 0/294 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LS  FY  VCP+ALPTI  +V+ AI++ERRMG SLLRLHFHDCFVNGCDASILLD T T
Sbjct  24    ELSDDFYEDVCPEALPTINRVVKAAIQKERRMGASLLRLHFHDCFVNGCDASILLDQTAT  83

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             IDSEK A ANNNSARGFEVID+IKSEVD+ CGRPVVSCADILAVAARDSVVAL GPTWEV
Sbjct  84    IDSEKTARANNNSARGFEVIDKIKSEVDKACGRPVVSCADILAVAARDSVVALHGPTWEV  143

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             KLGRRDSTTAS+  ANN++P+PFMDL  L  NFKNQGL+ +DLVALSGGHTLGFAQCFTF
Sbjct  144   KLGRRDSTTASRTMANNDIPSPFMDLPALINNFKNQGLDEEDLVALSGGHTLGFAQCFTF  203

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R RIY + +IDS FA QRQANCP +GG+S+LASLDPTPA FD+KYF NLV KKG+L SDQ
Sbjct  204   RDRIYSETNIDSTFASQRQANCPRSGGDSNLASLDPTPALFDSKYFSNLVSKKGILHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             ALF+GGQTDDLV+ YS N G FS DFA+SMIKMG+IKPLTGN G+IRVNCR+VN
Sbjct  264   ALFSGGQTDDLVKTYSTNLGTFSKDFAESMIKMGNIKPLTGNQGQIRVNCRKVN  317



>ref|XP_009788801.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=318

 Score =   480 bits (1235),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 258/295 (87%), Gaps = 1/295 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DLS  FY  VCP+ALPTI+ +VEDAI++ERRMG SLLRLHFHDCFVNGCDAS+LLD T T
Sbjct  24    DLSDDFYEDVCPKALPTIKRVVEDAIRKERRMGASLLRLHFHDCFVNGCDASVLLDQTAT  83

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             IDSEK A ANNNSARGFEVID+IKS VD+VCGRPVVSCADILAVAARDSVVAL GPTWEV
Sbjct  84    IDSEKTARANNNSARGFEVIDKIKSAVDKVCGRPVVSCADILAVAARDSVVALHGPTWEV  143

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             KLGRRDSTTAS+ TANN++P+PFMDL  L  NFK QGL+ +DLVALSGGHTLGFAQCFTF
Sbjct  144   KLGRRDSTTASRTTANNDIPSPFMDLPALINNFKKQGLDKEDLVALSGGHTLGFAQCFTF  203

Query  512   RQRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             R RIY +  +IDS FARQRQANCP  GG+S+LASLDPTPA FD+KYF NLV KKGLL SD
Sbjct  204   RNRIYNETNNIDSTFARQRQANCPRRGGDSNLASLDPTPALFDSKYFSNLVSKKGLLHSD  263

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             QALF+GG+TDDLV+ YS+N   FS DFAKSMIKMG+IKPLTG  G+IRVNCR+VN
Sbjct  264   QALFSGGKTDDLVKKYSKNLRTFSKDFAKSMIKMGNIKPLTGRQGQIRVNCRKVN  318



>ref|XP_009597807.1| PREDICTED: peroxidase 2-like [Nicotiana tomentosiformis]
Length=317

 Score =   479 bits (1234),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 229/294 (78%), Positives = 256/294 (87%), Gaps = 0/294 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LS  FY  VCP+ALPTI  +V+ AI++ERRMG SLLRLHFHDCFVNGCDASILLD T T
Sbjct  24    ELSDDFYEDVCPEALPTINRVVKAAIQKERRMGASLLRLHFHDCFVNGCDASILLDQTAT  83

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             IDSEK A ANNNSARGFEVID+IKSEVD+ CGRPVVSCADILAVAARDSVVAL GPTWEV
Sbjct  84    IDSEKTARANNNSARGFEVIDKIKSEVDKACGRPVVSCADILAVAARDSVVALHGPTWEV  143

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             KLGRRDSTTAS+  ANN++P+PFMDL  L  NFKNQGL+ +DLVALSGGHTLGFAQCFTF
Sbjct  144   KLGRRDSTTASRTMANNDIPSPFMDLPALINNFKNQGLDEEDLVALSGGHTLGFAQCFTF  203

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R RIY + +IDS FA QRQANCP +GG+S+LASLDPTPA FD+KYF NLV KKG+L SDQ
Sbjct  204   RDRIYSETNIDSTFASQRQANCPRSGGDSNLASLDPTPALFDSKYFSNLVSKKGILHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             ALF+GGQTDDLV+ YS N G FS DF +SMIKMG+IKPLTGN G+IRVNCR+VN
Sbjct  264   ALFSGGQTDDLVKTYSTNLGTFSKDFTESMIKMGNIKPLTGNQGQIRVNCRKVN  317



>ref|XP_004249044.1| PREDICTED: peroxidase 2-like [Solanum lycopersicum]
Length=320

 Score =   479 bits (1232),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 231/295 (78%), Positives = 258/295 (87%), Gaps = 1/295 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DLS  FY+ +CPQALPTI+ +VEDAI+QERRMG SLLRLHFHDCFVNGCDASILLD T T
Sbjct  26    DLSDDFYDDICPQALPTIKSVVEDAIRQERRMGASLLRLHFHDCFVNGCDASILLDQTDT  85

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             IDSEK A ANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVAL GPTWEV
Sbjct  86    IDSEKTARANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALHGPTWEV  145

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             +LGRRDSTTAS+ TA+N++P P MDL  L +NFK QGL+ +DLVALSGGHTLGFAQC TF
Sbjct  146   ELGRRDSTTASRTTADNDIPTPLMDLPALIDNFKKQGLDEEDLVALSGGHTLGFAQCSTF  205

Query  512   RQRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             R RIY +  +IDS FA QRQANCP +GG+S+LASLDPTPA FD+KYF NLV KKGLL SD
Sbjct  206   RNRIYDETNNIDSTFASQRQANCPRSGGDSNLASLDPTPALFDSKYFSNLVSKKGLLHSD  265

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             QALF+GG+TD+LV+ YS N   FSNDFA SMIKMG+IKPLTGN G+IRV+CR+VN
Sbjct  266   QALFSGGETDELVKTYSTNLRTFSNDFAGSMIKMGNIKPLTGNQGQIRVDCRKVN  320



>ref|XP_009775854.1| PREDICTED: peroxidase 2-like [Nicotiana sylvestris]
Length=318

 Score =   478 bits (1231),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 229/295 (78%), Positives = 259/295 (88%), Gaps = 1/295 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DLS  FY  VCP+ALPTI+ +VEDA+++ERRMG SLLRLHFHDCFVNGCDAS+LLD T T
Sbjct  24    DLSDDFYEDVCPEALPTIKRVVEDAVRKERRMGASLLRLHFHDCFVNGCDASVLLDQTAT  83

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             IDSEK A ANNNSARGFEVID+IKSEVD+ CGRPVVSCADILAVAARDSVVAL GPTWEV
Sbjct  84    IDSEKTARANNNSARGFEVIDKIKSEVDKACGRPVVSCADILAVAARDSVVALHGPTWEV  143

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             KLGRRDSTTAS+ TANN++P+PFMDL  L  NFKNQGL+ +DLVALSGGHTLGFAQCFTF
Sbjct  144   KLGRRDSTTASRTTANNDIPSPFMDLPALINNFKNQGLDEEDLVALSGGHTLGFAQCFTF  203

Query  512   RQRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             R RIY +  +IDS FA QRQANCP +GG+S+LASLDPT A FD+KYF NLV KKGLL SD
Sbjct  204   RDRIYNETNNIDSTFASQRQANCPRSGGDSNLASLDPTAALFDSKYFSNLVSKKGLLHSD  263

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             QALF+GG+TD+LV+ YS N G FS DFA+SMIKMG+IKPLTG+ G+IRVNCR+VN
Sbjct  264   QALFSGGETDNLVKTYSTNLGTFSKDFAESMIKMGNIKPLTGSQGQIRVNCRKVN  318



>ref|XP_009625317.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=321

 Score =   474 bits (1221),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 229/294 (78%), Positives = 255/294 (87%), Gaps = 1/294 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DLS  FY  VCP+ALPTI+ +VE AI++ERRMG SLLRLHFHDCFVNGCDASILLD T T
Sbjct  24    DLSDDFYEDVCPKALPTIKRVVEHAIRKERRMGASLLRLHFHDCFVNGCDASILLDQTAT  83

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             IDSEK A ANNNSARGFEVID+IKSEVD+ CGRPVVSCADILAVAARDSVVAL GPTWEV
Sbjct  84    IDSEKTARANNNSARGFEVIDKIKSEVDKACGRPVVSCADILAVAARDSVVALHGPTWEV  143

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             KLGRRDSTTAS+ TANN++P PFMDL  L  NFK QGL+ KDLVALSGGHTLGFAQCFTF
Sbjct  144   KLGRRDSTTASRSTANNDIPTPFMDLPALINNFKKQGLDEKDLVALSGGHTLGFAQCFTF  203

Query  512   RQRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             R RIY +  +I+S FARQRQANCP +G +S+LASLDPTPA FD+KYF NLV KKGLL SD
Sbjct  204   RNRIYNETNNIESTFARQRQANCPRSGSDSNLASLDPTPALFDSKYFSNLVSKKGLLHSD  263

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRV  174
             QALF+GG+TDDLV+ YS+N   FS DFA+SMIKMG+IKPLTG  G+IRVNCR+V
Sbjct  264   QALFSGGKTDDLVKKYSKNLRTFSKDFAESMIKMGNIKPLTGKQGQIRVNCRKV  317



>ref|XP_004249054.1| PREDICTED: peroxidase 70-like [Solanum lycopersicum]
Length=319

 Score =   474 bits (1220),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 229/295 (78%), Positives = 256/295 (87%), Gaps = 1/295 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DLS  FY+ +CPQALPTI+ +VEDAI QERRMG SLLRLHFHDCFVNGCDASILLD T T
Sbjct  25    DLSDDFYDDICPQALPTIKRVVEDAISQERRMGASLLRLHFHDCFVNGCDASILLDQTST  84

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             IDSEK A ANNNSARGFEVIDRIKSEVD+VCGR VVSCADILAVAARDSVVAL GPTWEV
Sbjct  85    IDSEKTARANNNSARGFEVIDRIKSEVDKVCGRSVVSCADILAVAARDSVVALHGPTWEV  144

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             +LGRRDSTTAS+ TANN++P P MDL  L +NFK QGL+ +DLVALSGGHTLGFAQCFTF
Sbjct  145   ELGRRDSTTASRTTANNDIPTPLMDLPALIDNFKKQGLDEEDLVALSGGHTLGFAQCFTF  204

Query  512   RQRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             R RIY +  +IDS FA QRQANCP +GG+S+LASLDPT A FD+KYF NLV KKGLL SD
Sbjct  205   RNRIYNETNNIDSTFASQRQANCPRSGGDSNLASLDPTSALFDSKYFSNLVSKKGLLHSD  264

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             QALF+GG+TD+LV+ YS +   FS DFAKSMIKMG+IKPLTGN G+IR++CRRVN
Sbjct  265   QALFSGGETDELVKTYSTDLRTFSKDFAKSMIKMGNIKPLTGNEGQIRIDCRRVN  319



>ref|XP_006365360.1| PREDICTED: peroxidase 70-like [Solanum tuberosum]
Length=320

 Score =   474 bits (1220),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 224/293 (76%), Positives = 255/293 (87%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSPSFYNHVCPQALP I+ +VE A+++ERRMG SLLRLHFHDCFVNGCDASILLD T TI
Sbjct  27    LSPSFYNHVCPQALPAIKRVVEAAVRKERRMGASLLRLHFHDCFVNGCDASILLDKTATI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK A+ NNNS RGF+VID+IKSEVD+ CGR +VSCADI+AVAARDSVVALGGPTWEV 
Sbjct  87    DSEKTAIPNNNSIRGFDVIDKIKSEVDKCCGRSIVSCADIVAVAARDSVVALGGPTWEVP  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+TTAS+ TANN++P PF+DL  L  NFK QGL+ KDLVALSGGHTLGFAQC TFR
Sbjct  147   LGRRDATTASRTTANNDIPPPFLDLPALINNFKKQGLDEKDLVALSGGHTLGFAQCSTFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +I+S FA QR+ANCP NGGN++LA LDPTPA FD+KYF NL+ KKGLL SDQA
Sbjct  207   NRIYNDTNIESTFASQRKANCPRNGGNTNLAPLDPTPALFDSKYFSNLLSKKGLLHSDQA  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GGQTD+LV+ YS N G+FS DFA+SMIKMG+IKPLTGN G+IRVNCR+VN
Sbjct  267   LFNGGQTDNLVKKYSTNLGSFSKDFAESMIKMGNIKPLTGNQGQIRVNCRKVN  319



>ref|XP_004253400.1| PREDICTED: peroxidase 70-like [Solanum lycopersicum]
Length=319

 Score =   472 bits (1215),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 224/293 (76%), Positives = 254/293 (87%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSPSFYNHVCP+ALP I+ +VEDA+++ERRMG SLLRLHFHDCFVNGCDASILLD T TI
Sbjct  26    LSPSFYNHVCPEALPAIKRVVEDAVRKERRMGASLLRLHFHDCFVNGCDASILLDKTATI  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK A+ NNNS RGF+VID+IKSEVD+ CGR +VSCADI+AVAARDSVVALGGPTWEV 
Sbjct  86    DSEKTAIPNNNSIRGFDVIDKIKSEVDKCCGRSIVSCADIVAVAARDSVVALGGPTWEVP  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  ANN++P P +DL  L  +FK QGLN KDLVALSGGHTLGFAQC TFR
Sbjct  146   LGRRDSTTASRTKANNDIPPPTLDLPALINSFKKQGLNEKDLVALSGGHTLGFAQCSTFR  205

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +IDS FA QR+ANCP +GGN++LA LDPTPA FD+KYF NLV KKGLL SDQA
Sbjct  206   NRIYNDTNIDSTFASQRKANCPRSGGNTNLAPLDPTPALFDSKYFSNLVSKKGLLHSDQA  265

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GGQTD+LV+ YS N G+FS DFA+SMIKMG+IKPLTGN G+IRVNCR+VN
Sbjct  266   LFNGGQTDNLVKKYSTNLGSFSKDFAESMIKMGNIKPLTGNQGQIRVNCRKVN  318



>ref|XP_006367398.1| PREDICTED: peroxidase 4-like [Solanum tuberosum]
Length=319

 Score =   469 bits (1208),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 226/295 (77%), Positives = 255/295 (86%), Gaps = 1/295 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DLS  FY+ +CPQALPTIR +VEDA++QERRMG SLLRLHFHDCFVNGCDASILLD T T
Sbjct  25    DLSDDFYDDICPQALPTIRRVVEDAVRQERRMGASLLRLHFHDCFVNGCDASILLDQTAT  84

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             IDSEK + ANNNSARGFEVIDRIKSEVD+VCGRPVVSCADILAVAARDSVVAL GPTWEV
Sbjct  85    IDSEKTSRANNNSARGFEVIDRIKSEVDKVCGRPVVSCADILAVAARDSVVALHGPTWEV  144

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             +LGRRDSTTAS+ TANN++P P MDL  L +NFK QGL+ +DLVALSGGHTLGFAQC TF
Sbjct  145   ELGRRDSTTASRTTANNDIPTPLMDLPALIDNFKKQGLDEEDLVALSGGHTLGFAQCSTF  204

Query  512   RQRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             R RIY +  +IDS FA QRQANCP +GG+S+LASLDPT A FD+KYF NLV KKGLL SD
Sbjct  205   RNRIYDETNNIDSTFASQRQANCPRSGGDSNLASLDPTSALFDSKYFSNLVSKKGLLHSD  264

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             QALF+GG+TD+LV+ Y  N   FS DFA+SMIKMG+IKPL GN G+IRV+CR+VN
Sbjct  265   QALFSGGETDELVKTYRTNLRTFSKDFAESMIKMGNIKPLIGNEGQIRVDCRKVN  319



>ref|XP_006365356.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
 ref|XP_006365359.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score =   469 bits (1207),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 222/294 (76%), Positives = 255/294 (87%), Gaps = 0/294 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DLS  FY+H+CP+ALPTI+ +VEDA+++ERRMG SLLRLHFHDCFVNGCDASILLD T T
Sbjct  24    DLSDDFYHHICPKALPTIKRVVEDAVRKERRMGASLLRLHFHDCFVNGCDASILLDQTST  83

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             I+SEK + ANNNSARGFEVID+IKSEVD+VCGR VVSCADILAVAARDSVVAL GP+W+V
Sbjct  84    INSEKTSRANNNSARGFEVIDKIKSEVDKVCGRQVVSCADILAVAARDSVVALHGPSWKV  143

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             KLGRRDSTTAS+  AN+N+P PFMDL  L +NFK QGL+ +DLVALSG HTLGFAQCFTF
Sbjct  144   KLGRRDSTTASRTAANDNIPTPFMDLPALIKNFKKQGLDEEDLVALSGSHTLGFAQCFTF  203

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R RIY + +ID  F RQRQANCP +GG+S+LA LDPTPA FD+KYF +L  KKGLL SDQ
Sbjct  204   RNRIYNETNIDPTFRRQRQANCPRSGGDSNLAPLDPTPALFDSKYFSDLRSKKGLLHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             ALF+GG+TDDLV  YS+N G FS DFA+SMIKMGDIKPLTG  G+IRVNCR+VN
Sbjct  264   ALFSGGKTDDLVEKYSKNLGMFSKDFAESMIKMGDIKPLTGKRGQIRVNCRKVN  317



>ref|XP_004249056.1| PREDICTED: peroxidase 70-like [Solanum lycopersicum]
Length=319

 Score =   469 bits (1206),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 227/295 (77%), Positives = 255/295 (86%), Gaps = 1/295 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DLS  FY+ +CPQALPTI+ +VEDAI QERRMG SLLRLHFHDCFVNGCDASILLD T T
Sbjct  25    DLSDDFYDDICPQALPTIKRVVEDAISQERRMGASLLRLHFHDCFVNGCDASILLDQTAT  84

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             IDSEK A ANNNSARGFEVIDRIKSEVD+VCGR VVSCADILAVAARDSVVAL GPTWEV
Sbjct  85    IDSEKTARANNNSARGFEVIDRIKSEVDKVCGRSVVSCADILAVAARDSVVALHGPTWEV  144

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             +LGRRDSTTAS+ TANN++P P MDL  L +NFK QGL+ +DLVALSGGHTLGFAQCFTF
Sbjct  145   ELGRRDSTTASRTTANNDIPTPLMDLPALIDNFKKQGLDEEDLVALSGGHTLGFAQCFTF  204

Query  512   RQRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             R RIY +  +IDS FA QRQANCP +GG+S+LASLDPT A FD+KYF NLV KKGLL SD
Sbjct  205   RNRIYNETNNIDSTFASQRQANCPRSGGDSNLASLDPTSALFDSKYFSNLVSKKGLLHSD  264

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             QALF+GG+TD+LV+ YS +   FS DFAKSM+KMG+IK LTGN G+IRV+CR+VN
Sbjct  265   QALFSGGETDELVKTYSTDLRTFSKDFAKSMLKMGNIKLLTGNQGQIRVDCRKVN  319



>ref|XP_004249055.1| PREDICTED: cationic peroxidase 1 [Solanum lycopersicum]
Length=317

 Score =   468 bits (1205),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/294 (76%), Positives = 255/294 (87%), Gaps = 0/294 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LS  FY+H+CP+ALPTI+ +V DA+++ERRMG SLLRLHFHDCFVNGCDASILLD T T
Sbjct  24    ELSDDFYHHICPKALPTIKRVVVDAVRKERRMGASLLRLHFHDCFVNGCDASILLDQTST  83

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             I+SEK + ANNNSARGFEVID+IKSEVD+VCGRPVVSCADILAVAARDSVVAL GP+W+V
Sbjct  84    INSEKTSRANNNSARGFEVIDKIKSEVDKVCGRPVVSCADILAVAARDSVVALHGPSWKV  143

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             KLGRRDSTTAS+  ANNN+P PFMDL  L +NFK QGL+ KDLVALSGGHTLGFAQCFTF
Sbjct  144   KLGRRDSTTASRTAANNNIPTPFMDLPALIKNFKKQGLDEKDLVALSGGHTLGFAQCFTF  203

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R RIY +  ID  F RQRQANCP +GG+S+LA LDPTPA FD+KYF +L  KKGLL SDQ
Sbjct  204   RNRIYNETTIDPTFRRQRQANCPRSGGDSNLAPLDPTPALFDSKYFSDLRSKKGLLHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             ALF+GG+TDDLV  YS++ G FS DFA+SMIKMG+IKPLTG  G+IRVNCR+VN
Sbjct  264   ALFSGGKTDDLVEKYSKDLGMFSKDFAQSMIKMGNIKPLTGKRGQIRVNCRKVN  317



>ref|XP_006365357.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score =   468 bits (1205),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/294 (76%), Positives = 254/294 (86%), Gaps = 0/294 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DLS  FY+H+CP+ALPTI+ +VEDA+++ERRMG SLLRLHFHDCFVNGCDASILLD T T
Sbjct  24    DLSDDFYHHICPKALPTIKRVVEDAVRKERRMGASLLRLHFHDCFVNGCDASILLDQTST  83

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             I+SEK + ANNNSARGFEVID+IKSEVD+VCGR VVSCADILAVAARDSVVAL GP+W+V
Sbjct  84    INSEKTSRANNNSARGFEVIDKIKSEVDKVCGRQVVSCADILAVAARDSVVALHGPSWKV  143

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             KLGRRDSTTAS+  AN+N+P PFMDL  L +NFK QGL+ +DLVALSG HTLGFAQCFTF
Sbjct  144   KLGRRDSTTASRTAANDNIPTPFMDLPALIKNFKKQGLDEEDLVALSGSHTLGFAQCFTF  203

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R RIY + +ID  F RQRQANCP +GG+S+LA LDPTPA FD+KYF +L  KKGLL SDQ
Sbjct  204   RNRIYNETNIDPTFRRQRQANCPRSGGDSNLAPLDPTPALFDSKYFSDLRSKKGLLHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             ALF+GG TDDLV  YS+N G FS DFA+SMIKMGDIKPLTG  G+IRVNCR+VN
Sbjct  264   ALFSGGNTDDLVEKYSKNLGMFSKDFAESMIKMGDIKPLTGKRGQIRVNCRKVN  317



>ref|XP_006365355.1| PREDICTED: peroxidase 4-like [Solanum tuberosum]
Length=319

 Score =   463 bits (1192),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 226/295 (77%), Positives = 252/295 (85%), Gaps = 1/295 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DLS  FY+ +CPQALPTIR +VEDA++QERRMG SLLRLHFHDCFVNGCDASILLD T T
Sbjct  25    DLSDDFYDDICPQALPTIRRVVEDAVRQERRMGASLLRLHFHDCFVNGCDASILLDQTAT  84

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             ID EK A  NNNSARG EVIDRIKSEVDRVCG PVVSCADILAVAARDSVVAL GPTWEV
Sbjct  85    IDCEKTARPNNNSARGCEVIDRIKSEVDRVCGGPVVSCADILAVAARDSVVALHGPTWEV  144

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             +LGRRDSTTAS+ TANN++P P MDL  L +NFK QGL+ +DLVALSG HTLGFAQC TF
Sbjct  145   ELGRRDSTTASRTTANNDIPTPLMDLPALIDNFKKQGLDEEDLVALSGAHTLGFAQCSTF  204

Query  512   RQRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             R RIY +  +IDS FA QRQANCP +GG+S+LASLDPTPA FD+KYF NLV KKGLL SD
Sbjct  205   RNRIYNEITNIDSTFASQRQANCPRSGGDSNLASLDPTPALFDSKYFSNLVSKKGLLHSD  264

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             QALF+GG+TD+LV+ YS N   FS DFAKSMIKMG+IK LTGN G+IRV+CR+VN
Sbjct  265   QALFSGGETDELVKTYSTNLRTFSKDFAKSMIKMGNIKLLTGNQGQIRVDCRKVN  319



>ref|XP_009795618.1| PREDICTED: peroxidase 2-like [Nicotiana sylvestris]
Length=319

 Score =   463 bits (1191),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/294 (74%), Positives = 255/294 (87%), Gaps = 1/294 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP FY++VCPQALPTI+ +VEDA+ +ERRMG SLLRLHFHDCFV GCDASILLD T TI
Sbjct  26    LSPYFYDYVCPQALPTIKRVVEDAVTEERRMGASLLRLHFHDCFVQGCDASILLDQTETI  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK A  NNNS RGFEVID+IKSEVD+ CG P+VSCADI+AVAARDSVVALGGPTWEV+
Sbjct  86    DSEKTARPNNNSIRGFEVIDKIKSEVDKACGHPIVSCADIVAVAARDSVVALGGPTWEVQ  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTA+++ ANN++P PF+DL  L  NFKNQGL+ KDLVALSGGHTLGFAQCFTFR
Sbjct  146   LGRRDSTTANRNMANNDIPPPFLDLPALINNFKNQGLDEKDLVALSGGHTLGFAQCFTFR  205

Query  509   QRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY +  +IDS FA QRQA+CP +GG+S+LA LDPTP  FD +YF NL+ KKGLL SDQ
Sbjct  206   DRIYNETNNIDSTFASQRQADCPRSGGDSNLAPLDPTPVLFDTEYFSNLLCKKGLLHSDQ  265

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             ALF+GGQTD+LV++YS N G F+ DFA+SMIKMG+IKPLTG+ G+IRVNCR+VN
Sbjct  266   ALFSGGQTDNLVQIYSTNLGTFAKDFAESMIKMGNIKPLTGDQGQIRVNCRKVN  319



>ref|XP_007033588.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04514.1| Peroxidase superfamily protein [Theobroma cacao]
Length=339

 Score =   462 bits (1188),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 215/294 (73%), Positives = 251/294 (85%), Gaps = 0/294 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP +Y ++CP+ALPTI+ +VE A+ +ERRMG SLLRLHFHDCFVNGCDASILLD TP I
Sbjct  46    LSPYYYKNICPEALPTIKKLVEAAVYKERRMGASLLRLHFHDCFVNGCDASILLDPTPNI  105

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA+ANNNSARGFEVID+IK+EVD+VCG PVVSCADILAVAARDSVVALGGP+W+V+
Sbjct  106   DSEKNAVANNNSARGFEVIDQIKAEVDKVCGHPVVSCADILAVAARDSVVALGGPSWKVR  165

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  AN ++P+PFMDL  L  NFKNQGLN +DLVALSGGHT+GFAQCFTFR
Sbjct  166   LGRRDSTTASRTQANLDIPSPFMDLPALINNFKNQGLNQRDLVALSGGHTIGFAQCFTFR  225

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY   +ID  FA++R+  CP  G N++LA LDPTPA+FD  YF NLVK++GLL+SDQ 
Sbjct  226   NRIYNATNIDPAFAKERRVTCPRTGENTNLAPLDPTPAFFDTAYFNNLVKQRGLLISDQE  285

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNY  168
             LF GG TD+LV+ YS    AF  DFAKSMIKMG+IKPLTGN G+IRVNCR+VNY
Sbjct  286   LFNGGSTDNLVKTYSLYPEAFWKDFAKSMIKMGNIKPLTGNQGQIRVNCRKVNY  339



>ref|XP_009597808.1| PREDICTED: peroxidase 2-like [Nicotiana tomentosiformis]
Length=319

 Score =   461 bits (1185),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 219/294 (74%), Positives = 255/294 (87%), Gaps = 1/294 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY+ VCP+ALPTI+ +VEDA+KQERRMG SLLRLHFHDCFV GCDASILLD T TI
Sbjct  26    LSAYFYDFVCPEALPTIKRVVEDAVKQERRMGASLLRLHFHDCFVQGCDASILLDQTETI  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK A ANNNS RGFEVID+IKSEVD+ CG P+VSCADI+AVAARDSVVALGGPTWEV+
Sbjct  86    DSEKTARANNNSIRGFEVIDQIKSEVDKACGHPIVSCADIVAVAARDSVVALGGPTWEVQ  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTA++  ANN++P PF+DL  L  NFKNQGL+ KDLVALSGGHTLGFAQCFTFR
Sbjct  146   LGRRDSTTANRTMANNDIPPPFLDLPALINNFKNQGLDEKDLVALSGGHTLGFAQCFTFR  205

Query  509   QRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY +  +IDS FA QRQA+CP +GG+S+ ASLDPTPA FD++YF+NL+  KGLL SDQ
Sbjct  206   DRIYNETNNIDSTFASQRQADCPRSGGDSNFASLDPTPALFDSEYFRNLLCNKGLLHSDQ  265

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             ALF+GG+TD+LV++YS N G F+ DFA+SMIKMG+IKPL GN G+IRVNCR+VN
Sbjct  266   ALFSGGKTDNLVQIYSTNLGTFAKDFAESMIKMGNIKPLIGNQGQIRVNCRKVN  319



>ref|XP_006365358.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=320

 Score =   459 bits (1182),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 225/296 (76%), Positives = 251/296 (85%), Gaps = 2/296 (1%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVN-GCDASILLDSTP  876
             DLS  FY+ +CPQALPTIR +VED ++QERRMG SLLRLHFHDCFVN  CDASILLD T 
Sbjct  25    DLSDDFYDDICPQALPTIRRVVEDTVRQERRMGASLLRLHFHDCFVNVSCDASILLDQTA  84

Query  875   TIDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWE  696
             TIDSEK A  NNNSARGFEVID IKSEVDRVCGRPVVSCADILAVAARDSVVAL GPTWE
Sbjct  85    TIDSEKTARPNNNSARGFEVIDIIKSEVDRVCGRPVVSCADILAVAARDSVVALHGPTWE  144

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V+LGRRDSTTAS+ TANN++P P MDL  L +NFK QGL+ +DLVALSG HTLGFAQC T
Sbjct  145   VELGRRDSTTASRTTANNDIPTPLMDLPALIDNFKKQGLDEEDLVALSGAHTLGFAQCST  204

Query  515   FRQRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVS  339
             FR RIY +  +IDS FA QRQANCP +GG+S+LASLDPT A FD+KYF NLV KKGLL S
Sbjct  205   FRNRIYNEINNIDSTFASQRQANCPRSGGDSNLASLDPTSALFDSKYFSNLVSKKGLLHS  264

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQALF+GG+TD+LV+ YS N   FS DFAKSMIKMG+IK LTGN G+IRV+CR+VN
Sbjct  265   DQALFSGGETDELVKTYSTNLRTFSKDFAKSMIKMGNIKLLTGNQGQIRVDCRKVN  320



>gb|AHL39188.1| class III peroxidase [Populus trichocarpa]
Length=320

 Score =   451 bits (1160),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 213/293 (73%), Positives = 248/293 (85%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP +YNHVCP+AL TI+ +VE A+ +ERRMG SLLRLHFHDCFVNGCDASILLDST TI
Sbjct  28    LSPYYYNHVCPKALATIKRVVEAAVYKERRMGASLLRLHFHDCFVNGCDASILLDSTSTI  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNAL N NS RGFEVID++KSEVD++CGRPVVSCADI+AVAARDSVVALGGPTW V+
Sbjct  88    DSEKNALPNINSLRGFEVIDQVKSEVDKICGRPVVSCADIVAVAARDSVVALGGPTWAVQ  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGR+DSTTAS+D ANN+LP+PFMDL  L  NFK QGLN +DLVALSGGHTLG AQCFTFR
Sbjct  148   LGRKDSTTASRDKANNDLPSPFMDLPALINNFKRQGLNERDLVALSGGHTLGSAQCFTFR  207

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RI+ + +ID KF +QR+  CP+ GG+S+LA LDPTPA+FD  YF +LVKK+GLL SDQA
Sbjct  208   NRIHNETNIDPKFVKQRKPTCPLVGGDSNLAPLDPTPAHFDVAYFNSLVKKRGLLRSDQA  267

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS N  AF  DFAKSM+KMG+I  LTG  G++R+NCR+VN
Sbjct  268   LFNGGSTDGLVKAYSSNAKAFWADFAKSMVKMGNINVLTGKQGQVRLNCRKVN  320



>ref|XP_002268412.1| PREDICTED: cationic peroxidase 1 [Vitis vinifera]
Length=318

 Score =   450 bits (1157),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 214/293 (73%), Positives = 245/293 (84%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP FYN VCP+ALPTI+ +VE A+++E+RMG SLLRLHFHDCFVNGCDASILLD+T TI
Sbjct  26    LSPYFYNKVCPKALPTIKRVVEAAVQKEKRMGASLLRLHFHDCFVNGCDASILLDATSTI  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA AN NSARGF V+D IKS+VD+VCGRPVVSCADILAVAARDSVVALGGP+W V+
Sbjct  86    DSEKNAGANANSARGFNVVDDIKSQVDKVCGRPVVSCADILAVAARDSVVALGGPSWTVQ  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  ANNN+P+PFMDL  L   F NQGL+ KDLVALSGGH +GFAQC  F+
Sbjct  146   LGRRDSTTASRTDANNNIPSPFMDLPALITRFSNQGLDTKDLVALSGGHVIGFAQCNFFK  205

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + +ID  FAR RQ+ CP NGG++ LA LDPT A FD  YF NLVK++GLL SDQA
Sbjct  206   NRIYNESNIDPAFARARQSTCPPNGGDTKLAPLDPTAARFDTGYFTNLVKRRGLLHSDQA  265

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS N GAFS DFAKSM+KMG+IKPLTG  G+IRVNCR+VN
Sbjct  266   LFNGGSTDTLVKTYSTNFGAFSADFAKSMVKMGNIKPLTGKKGQIRVNCRKVN  318



>ref|XP_002323055.2| peroxidase family protein [Populus trichocarpa]
 gb|EEF04816.2| peroxidase family protein [Populus trichocarpa]
Length=320

 Score =   449 bits (1154),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 212/293 (72%), Positives = 247/293 (84%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP +YNHVCP+AL TI+ +VE A+ +ERRMG SLLRLHFHDCFVNGCDASILLDST TI
Sbjct  28    LSPYYYNHVCPKALATIKRVVEAAVYKERRMGASLLRLHFHDCFVNGCDASILLDSTSTI  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNAL N NS RGFEVID++KSEVD++CGRPVVSCADI+AVAARDSVVALGGPTW V+
Sbjct  88    DSEKNALPNINSLRGFEVIDQVKSEVDKICGRPVVSCADIVAVAARDSVVALGGPTWAVQ  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGR+DS TAS+D ANN+LP+PFMDL  L  NFK QGLN +DLVALSGGHTLG AQCFTFR
Sbjct  148   LGRKDSNTASRDKANNDLPSPFMDLPALINNFKRQGLNERDLVALSGGHTLGSAQCFTFR  207

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RI+ + +ID KF +QR+  CP+ GG+S+LA LDPTPA+FD  YF +LVKK+GLL SDQA
Sbjct  208   NRIHNETNIDPKFVKQRKPTCPLVGGDSNLAPLDPTPAHFDVAYFNSLVKKRGLLRSDQA  267

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS N  AF  DFAKSM+KMG+I  LTG  G++R+NCR+VN
Sbjct  268   LFNGGSTDGLVKAYSSNAKAFWADFAKSMVKMGNINVLTGKQGQVRLNCRKVN  320



>emb|CDP06406.1| unnamed protein product [Coffea canephora]
Length=559

 Score =   455 bits (1170),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 222/295 (75%), Positives = 249/295 (84%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++YN VCPQALPTIR +VE A+ QERRMG SLLRLHFHDCFVNGCDASILLD+TPTI
Sbjct  265   LSPAYYNRVCPQALPTIRRMVEVAVSQERRMGASLLRLHFHDCFVNGCDASILLDATPTI  324

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNAL N NSARGFEVIDRIK++VD+VCGRPVVSCADILAVAARDSVVALGGP+W V+
Sbjct  325   DSEKNALPNANSARGFEVIDRIKAQVDKVCGRPVVSCADILAVAARDSVVALGGPSWAVQ  384

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  ANN++P+P MDL  L  +FK QGLNVKDLVALSGGHTLGFAQC  FR
Sbjct  385   LGRRDSTTASRSVANNDIPSPLMDLPALISSFKKQGLNVKDLVALSGGHTLGFAQCRLFR  444

Query  509   QRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY +  +ID  FA QRQA CP  GG+S+L+ LDP+PA FD  YF NLV K+GLL SDQ
Sbjct  445   NRIYNETNNIDPSFASQRQATCPRAGGDSNLSPLDPSPAAFDTAYFSNLVSKRGLLHSDQ  504

Query  332   ALF-AGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             ALF AGG T DLV+ YS N  AFS DFA SMIKMG+IKPLTG+ G+IR NCR+VN
Sbjct  505   ALFGAGGPTQDLVKSYSTNLLAFSADFANSMIKMGNIKPLTGSQGQIRFNCRKVN  559


 Score =   286 bits (732),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 178/250 (71%), Gaps = 4/250 (2%)
 Frame = -1

Query  959  MGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEKNALANNNSARGFEVIDRIKSEVDRVC  780
            MG SLLRLHFHDCF  GCDAS+LLD T     EK A  NNNS RGFEVID IKS+++  C
Sbjct  1    MGASLLRLHFHDCF--GCDASVLLDDTANFTGEKTAGPNNNSLRGFEVIDSIKSQLETSC  58

Query  779  GRPVVSCADILAVAARDSVVALGGPTWEVKLGRRDSTTASKDTANNNLPNPFMDLSQLTE  600
               VVSCADIL VAARD VVALGGP+W + LGRRDSTTAS   AN+N+P P ++L+ L  
Sbjct  59   PG-VVSCADILTVAARDGVVALGGPSWNIPLGRRDSTTASLSAANSNIPGPGLNLNALIS  117

Query  599  NFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRIYGDKDIDSKFARQRQANCPMNGGNSSL  420
             F N+G   ++LVALSGGHT+G A+C  FR RIY + +I++ FA   QANCP +GG+++L
Sbjct  118  AFANKGFTARELVALSGGHTIGQARCLLFRNRIYNEANINASFAAAVQANCPRSGGDNNL  177

Query  419  ASLDPT-PAYFDAKYFKNLVKKKGLLVSDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSM  243
            + LD T P  FD  YF+NL  +KGLL SDQ LF+GG T+  V  YS N   F  DFA +M
Sbjct  178  SPLDTTSPISFDNAYFRNLQTQKGLLHSDQQLFSGGSTNAQVNTYSSNSATFFTDFANAM  237

Query  242  IKMGDIKPLT  213
            +KM ++ PLT
Sbjct  238  VKMDNLSPLT  247



>ref|XP_011019031.1| PREDICTED: peroxidase 2-like [Populus euphratica]
Length=321

 Score =   444 bits (1143),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 210/293 (72%), Positives = 241/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y++VCP+ALPTI+ +VE A+  ERRMG SLLRLHFHDCFVNGCDASILLDST   
Sbjct  29    LSPNYYDYVCPKALPTIKRVVEAAVYNERRMGASLLRLHFHDCFVNGCDASILLDSTSAF  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA  N NS RGFEVIDRIK EVD+ CGRPVVSCADILAVAARDSVVALGGPTW V+
Sbjct  89    DSEKNANPNINSIRGFEVIDRIKLEVDKACGRPVVSCADILAVAARDSVVALGGPTWAVQ  148

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TASK TANN++P PFMDL  L  NFK  GLN KDLV LSG HTLGFAQCFTF+
Sbjct  149   LGRRDSITASKTTANNDIPAPFMDLPDLINNFKKHGLNKKDLVVLSGAHTLGFAQCFTFK  208

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + +ID KFAR+R+  CP  GG+S+LA LDPTP++FDA+Y+ +L+KK+GL  SDQA
Sbjct  209   DRIYNETNIDPKFARERKLTCPRTGGDSNLAPLDPTPSFFDARYYNDLLKKRGLFHSDQA  268

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS N  AF  DFA SM+KMG+IKPLTG  G+IR+NCR VN
Sbjct  269   LFNGGSTDSLVKAYSSNAKAFWTDFANSMVKMGNIKPLTGKQGQIRLNCRMVN  321



>ref|XP_011003588.1| PREDICTED: peroxidase 2-like [Populus euphratica]
Length=320

 Score =   444 bits (1142),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 211/293 (72%), Positives = 246/293 (84%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP +YN VCP+ALPTI+ +VE A+ +ERRMG SLLRLHFHDCFVNGCDASILLDST TI
Sbjct  28    LSPYYYNRVCPKALPTIKRVVEAAVYKERRMGASLLRLHFHDCFVNGCDASILLDSTSTI  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNAL N NS +GFEVID++K EVD++CGRPVVSCADI+AVAARDSVVALGGPTW V+
Sbjct  88    DSEKNALPNINSLKGFEVIDQVKLEVDKICGRPVVSCADIVAVAARDSVVALGGPTWAVQ  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGR+DSTTAS+D ANN+LP+PFMDL  L  NFK QGLN +DLVALSGGHTLG AQCFTFR
Sbjct  148   LGRKDSTTASRDKANNDLPSPFMDLPALINNFKRQGLNERDLVALSGGHTLGSAQCFTFR  207

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RI+ + +ID KF +QR++ CP  GG+S+LA LDPTPA FD  YF +LVKK+GLL SDQA
Sbjct  208   NRIHNETNIDPKFVKQRKSTCPRIGGDSNLAPLDPTPARFDVAYFNSLVKKRGLLRSDQA  267

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS N  AF  DFAKSM+KMG+I  LTG  G++R+NCR+VN
Sbjct  268   LFNGGSTDGLVKAYSSNPKAFWADFAKSMVKMGNINILTGKQGQVRLNCRKVN  320



>ref|XP_002531319.1| Peroxidase 2 precursor, putative [Ricinus communis]
 gb|EEF31069.1| Peroxidase 2 precursor, putative [Ricinus communis]
Length=323

 Score =   443 bits (1139),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 213/296 (72%), Positives = 243/296 (82%), Gaps = 1/296 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP +Y+ VCP+ALPTI+ I+E A+ +E RMG SLLRLHFHDCFVNGCDAS+LLDS+PTI
Sbjct  27    LSPYYYDKVCPEALPTIKRIIEAAVYEEPRMGASLLRLHFHDCFVNGCDASVLLDSSPTI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA+AN NSARGFEVID+IK  VD VCG PVVSCADIL VAARDSVVALGGPTW V+
Sbjct  87    DSEKNAVANLNSARGFEVIDQIKLAVDEVCGHPVVSCADILTVAARDSVVALGGPTWTVQ  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  AN ++P+PFMDL  L  NFKNQGLN KDLVALSGGHTLGFA+CF F+
Sbjct  147   LGRRDSTTASRTQANRDIPSPFMDLPALINNFKNQGLNEKDLVALSGGHTLGFAKCFVFK  206

Query  509   QRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY D K ID KFA+ R++ CP  GG+++LA LDPTPA FD  YF NL+ K+GLL SDQ
Sbjct  207   DRIYNDTKTIDPKFAKARRSTCPRTGGDTNLAPLDPTPANFDIAYFTNLINKRGLLHSDQ  266

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNYY  165
              LF GG TD LV  YS N  AFS DF KSM+KMG+IKPLTG  GEIR+NCR+VN Y
Sbjct  267   QLFVGGSTDALVTKYSLNAKAFSADFVKSMVKMGNIKPLTGKQGEIRLNCRKVNDY  322



>gb|AHL39144.1| class III peroxidase [Populus trichocarpa]
Length=321

 Score =   442 bits (1138),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 208/293 (71%), Positives = 241/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y++VCP+ALPTI+ +VE A+  ERRMG SLLRLHFHDCFVNGCDASILLDST   
Sbjct  29    LSPNYYDYVCPKALPTIKRVVEAAVYNERRMGASLLRLHFHDCFVNGCDASILLDSTSAF  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA  N NS RGFEVIDRIK EVD+ CGRPVVSCADILAVAARDSVVALGGPTW V+
Sbjct  89    DSEKNANPNINSIRGFEVIDRIKLEVDKACGRPVVSCADILAVAARDSVVALGGPTWAVQ  148

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTASK TANN++P PFMDL  L  NFK  GLN KDLV LSG HT+GFAQCFTF+
Sbjct  149   LGRRDSTTASKTTANNDIPAPFMDLPDLINNFKKHGLNKKDLVVLSGAHTIGFAQCFTFK  208

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + +ID KFAR+R+  CP  GG+S+LA L+PTP+YFDA+Y+ +L+KK+GL  SDQA
Sbjct  209   DRIYNETNIDPKFARERKLTCPRTGGDSNLAPLNPTPSYFDARYYNDLLKKRGLFHSDQA  268

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS N  AF  DFA SM+KMG+I PLTG  G+ R+NCR+VN
Sbjct  269   LFNGGSTDSLVKAYSSNAKAFWTDFANSMVKMGNINPLTGKQGQTRLNCRKVN  321



>ref|XP_002308244.1| peroxidase family protein [Populus trichocarpa]
 gb|EEE91767.1| peroxidase family protein [Populus trichocarpa]
Length=321

 Score =   440 bits (1132),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 208/293 (71%), Positives = 240/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y++VCP+ALPTI+ +VE A+  ERRMG SLLRLHFHDCFVNGCDASILLDST   
Sbjct  29    LSPNYYDYVCPKALPTIKRVVEAAVYNERRMGASLLRLHFHDCFVNGCDASILLDSTSAF  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA  N NS RGFEVIDRIK EVD+ CGRPVVSCADILAVAARDSVVALGGPTW V+
Sbjct  89    DSEKNANPNINSIRGFEVIDRIKLEVDKACGRPVVSCADILAVAARDSVVALGGPTWAVQ  148

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTASK TANN++P PFMDL  L  NFK  GLN KDLV LSG HT GFAQCFTF+
Sbjct  149   LGRRDSTTASKTTANNDIPAPFMDLPDLIINFKKHGLNKKDLVVLSGAHTTGFAQCFTFK  208

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + +ID KFAR+R+  CP  GG+S+LA L+PTP+YFDA+Y+ +L+KK+GL  SDQA
Sbjct  209   DRIYNETNIDPKFARERKLTCPRTGGDSNLAPLNPTPSYFDARYYNDLLKKRGLFHSDQA  268

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS N  AF  DFA SM+KMG+I PLTG  G+ R+NCR+VN
Sbjct  269   LFNGGSTDSLVKAYSSNAKAFWTDFANSMVKMGNINPLTGKQGQTRLNCRKVN  321



>ref|XP_007033587.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04513.1| Peroxidase superfamily protein [Theobroma cacao]
Length=316

 Score =   440 bits (1131),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 211/293 (72%), Positives = 241/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP FY+ VCPQALP I+ IV+ A+ +ERRMG SLLRLHFHDCFVNGCD S+LLDST T+
Sbjct  24    LSPKFYDKVCPQALPAIKKIVQAAVHRERRMGASLLRLHFHDCFVNGCDGSLLLDSTSTM  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA  N NS RGFEV+D+IK+EVDRVCGRPVVSCADILAVAARDSVVALGGP+W+V+
Sbjct  84    DSEKNARGNFNSVRGFEVVDQIKAEVDRVCGRPVVSCADILAVAARDSVVALGGPSWKVR  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  A+  LP+  MDL  L  NFKNQGLN +DLVALSGGHT+G +QC  FR
Sbjct  144   LGRRDSTTASRTLADTVLPSASMDLPALINNFKNQGLNQRDLVALSGGHTIGLSQCSIFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY   +ID  FA++R+  CP  GGN++LASLDPTPA FD  YFKNLVKK+GLL SDQA
Sbjct  204   NRIYNATNIDPAFAKERRETCPRVGGNTNLASLDPTPARFDTAYFKNLVKKRGLLTSDQA  263

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV  YS N  AF +DFAKSMIKMG+IKPLTG  G+IRVNCR+VN
Sbjct  264   LFNGGSTDKLVETYSLNPDAFWDDFAKSMIKMGNIKPLTGKQGQIRVNCRKVN  316



>gb|KDP22789.1| hypothetical protein JCGZ_00376 [Jatropha curcas]
Length=317

 Score =   437 bits (1125),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 209/293 (71%), Positives = 240/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP +Y+ +CP+ALPTI+ +VE A+ +ERRMG SLLRLHFHDCFV+GCDASILLDS+PTI
Sbjct  25    LSPFYYDRLCPKALPTIKRVVEAAVYRERRMGASLLRLHFHDCFVHGCDASILLDSSPTI  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA+ N NSARGFEVID+IKSEVD+ CGRPVVSCADILAVAARDSVVALGGPTW V+
Sbjct  85    DSEKNAVPNANSARGFEVIDQIKSEVDKACGRPVVSCADILAVAARDSVVALGGPTWRVQ  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDST A KD AN +LP+PF+DL  L   FK QGLN KDLV LSGGHTLGFAQC  FR
Sbjct  145   LGRRDSTAAFKDIANTDLPSPFLDLPGLINAFKKQGLNEKDLVVLSGGHTLGFAQCGAFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + +ID KFAR R+  CP  GGN++LA LDPTPA FD  YF NL  +KGLL SDQ 
Sbjct  205   DRIYNETNIDPKFARVRRLTCPRTGGNTNLAPLDPTPARFDVAYFTNLKNQKGLLHSDQQ  264

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF+GG TD LV  YS N  AF  DF +SMIKMG+I+PLTGN G++R+NCR+VN
Sbjct  265   LFSGGSTDSLVNTYSSNAKAFWQDFGQSMIKMGNIEPLTGNQGQVRLNCRKVN  317



>ref|XP_007033582.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04508.1| Peroxidase superfamily protein [Theobroma cacao]
Length=323

 Score =   437 bits (1124),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 208/292 (71%), Positives = 241/292 (83%), Gaps = 0/292 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP FY+ VCPQALP I+ IV+ A+ +ERRMG SLLRLHFHDCFVNGCD S+LLDST T+
Sbjct  24    LSPKFYDKVCPQALPAIKKIVQAAVHRERRMGASLLRLHFHDCFVNGCDGSLLLDSTSTM  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA  N NS RGFEV+D+IK+EVDRVCGRPVVSCADILAVAARDSVVALGGP+W+V+
Sbjct  84    DSEKNARGNFNSVRGFEVVDQIKAEVDRVCGRPVVSCADILAVAARDSVVALGGPSWKVR  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  A+  LP+  MDL  L  NFKNQGLN +DLVALSGGHT+G +QC  FR
Sbjct  144   LGRRDSTTASRTLADTVLPSASMDLPALINNFKNQGLNQRDLVALSGGHTIGLSQCSIFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY   +ID  FA++R+A CP+ GGN++LA LDPTPA FD  YFKNLVKK+GLL SDQA
Sbjct  204   NRIYNATNIDPAFAKERRATCPLVGGNTNLAPLDPTPARFDTAYFKNLVKKRGLLTSDQA  263

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRV  174
             LF GG TD LV+ YS N  AF +DFAKSMIK G+IKPLTG  G+IRVNCR++
Sbjct  264   LFNGGSTDKLVKFYSLNPDAFWDDFAKSMIKTGNIKPLTGKQGQIRVNCRKI  315



>gb|KDP22792.1| hypothetical protein JCGZ_00379 [Jatropha curcas]
Length=321

 Score =   434 bits (1117),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 207/294 (70%), Positives = 242/294 (82%), Gaps = 1/294 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP +Y+ VCP+ALPTI+ ++E A+ +ERRMG SLLRLHFHDCFVNGCDAS+LLD +PTI
Sbjct  28    LSPYYYDKVCPEALPTIKRLIEAAVYKERRMGASLLRLHFHDCFVNGCDASVLLDPSPTI  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA+AN NSARGFEVID+IK EVD+VCGRPVVSCADILAVAARDSVVALGGPTW V+
Sbjct  88    DSEKNAVANVNSARGFEVIDQIKLEVDKVCGRPVVSCADILAVAARDSVVALGGPTWTVQ  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  AN ++P+PFMDL  L  NFKNQGLN KDLV+LSGGHT+GFA+C  FR
Sbjct  148   LGRRDSTTASRTKANRDIPSPFMDLPALITNFKNQGLNKKDLVSLSGGHTIGFARCIVFR  207

Query  509   QRIYGDKD-IDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY + + ID KFARQR+  CP   GN++LA LD +PA FD  YF +L+ K+GLL SDQ
Sbjct  208   NRIYNEANTIDPKFARQRRLTCPRVDGNTNLAPLDSSPARFDTAYFTDLINKRGLLHSDQ  267

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD LV+ YS N   FS DFA SM+KMG+IKPLTG  G+IR NCR+VN
Sbjct  268   QLFVGGSTDGLVKTYSSNAEIFSADFANSMVKMGNIKPLTGKQGQIRCNCRKVN  321



>ref|XP_010041728.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=325

 Score =   434 bits (1117),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 209/295 (71%), Positives = 243/295 (82%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P +YN+ CPQALPTIR +V+ A+K+ERRMG SLLRLHFHDCFVNGCDAS+LLD TPTI
Sbjct  31    LTPYYYNYACPQALPTIRQVVKAAVKKERRMGASLLRLHFHDCFVNGCDASVLLDPTPTI  90

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             D+EK A ANNNSARGFEVID+IK EVD+VCGR VVSCADILAVAARDSVV LGGP W V+
Sbjct  91    DTEKLAGANNNSARGFEVIDQIKEEVDKVCGRAVVSCADILAVAARDSVVLLGGPWWNVR  150

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+ TAN +LP PFMDLS LT +F+ QGL+ KDLV LSGGHTLGFAQCFTF+
Sbjct  151   LGRRDSTTASRTTANTDLPAPFMDLSTLTSSFQKQGLDAKDLVVLSGGHTLGFAQCFTFK  210

Query  509   QRIYGDKDIDSKFARQRQANCP--MNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
              R + D DI  KFA++ Q+ CP   +  +S+LA LDPT   FD  Y+KNL+K+KGLL SD
Sbjct  211   DRAHNDSDIHPKFAKKLQSICPRAQSESDSNLAKLDPTSTRFDTLYYKNLLKQKGLLRSD  270

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             QALF  G TD+LVR YS +  AF  DFAKSM+KMG+IKPLTGN G++R NCRRVN
Sbjct  271   QALFGSGNTDELVRTYSDDATAFWKDFAKSMVKMGNIKPLTGNLGQVRNNCRRVN  325



>gb|KDP22791.1| hypothetical protein JCGZ_00378 [Jatropha curcas]
Length=321

 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 207/294 (70%), Positives = 242/294 (82%), Gaps = 1/294 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP +Y+ VCP+ALPTI+ ++E A+ +ERRMG SLLRLHFHDCFVNGCDAS+LLD +PTI
Sbjct  28    LSPYYYDKVCPEALPTIKRLIEAAVYKERRMGASLLRLHFHDCFVNGCDASVLLDPSPTI  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA+AN NSARGFEVID+IK EVD+VCGRPVVSCADILAVAARDSVVALGGPTW V+
Sbjct  88    DSEKNAVANVNSARGFEVIDQIKLEVDKVCGRPVVSCADILAVAARDSVVALGGPTWTVQ  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  AN ++P+PFMDL  L  NFKNQGLN KDLV+LSGGHT+GFA+C  FR
Sbjct  148   LGRRDSTTASRRKANRDIPSPFMDLPALINNFKNQGLNKKDLVSLSGGHTIGFARCIVFR  207

Query  509   QRIYGDKD-IDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY + + ID KFARQR+  CP   GN++LA LD +PA FD  YF +L+ K+GLL SDQ
Sbjct  208   NRIYNEANTIDPKFARQRRLTCPRVDGNTNLAPLDSSPARFDTAYFTDLINKRGLLHSDQ  267

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD LV+ YS N   FS DFA SM+KMG+IKPLTG  G+IR NCR+VN
Sbjct  268   QLFVGGSTDGLVKTYSSNAEIFSADFANSMVKMGNIKPLTGKQGQIRCNCRKVN  321



>ref|XP_007033538.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04464.1| Peroxidase superfamily protein [Theobroma cacao]
Length=316

 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 208/293 (71%), Positives = 241/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY+ VCPQALP I+ +V+ A+ +ERRMG SLLRLHFHDCFVNGCD S+LLDST T+
Sbjct  24    LSSKFYDKVCPQALPAIKKVVQAAVHRERRMGASLLRLHFHDCFVNGCDGSLLLDSTSTM  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA  N NS RGFEV+D+IK+EVD VCGRPVVSCADILAVAARDSVVALGGP+W+V+
Sbjct  84    DSEKNARGNFNSVRGFEVVDQIKAEVDSVCGRPVVSCADILAVAARDSVVALGGPSWKVR  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  A+  LP+  MDL  L +NFKNQGLN +DLVALSGGHT+G +QC  FR
Sbjct  144   LGRRDSTTASRTLADTVLPSASMDLPALIDNFKNQGLNQRDLVALSGGHTIGLSQCSIFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY   +ID  FA++R+A CP  GGN++LA LDPTPA FD  YFKNLVKK+GLL SDQA
Sbjct  204   NRIYNATNIDPPFAKERRATCPRVGGNTNLAPLDPTPARFDTAYFKNLVKKRGLLTSDQA  263

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS N  AF +DFAKSMIKMG+IKPLTG  G+IRVNCR+VN
Sbjct  264   LFNGGSTDKLVKTYSLNPDAFWDDFAKSMIKMGNIKPLTGKRGQIRVNCRKVN  316



>ref|XP_002531320.1| Cationic peroxidase 1 precursor, putative [Ricinus communis]
 gb|EEF31070.1| Cationic peroxidase 1 precursor, putative [Ricinus communis]
Length=319

 Score =   432 bits (1110),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 204/294 (69%), Positives = 243/294 (83%), Gaps = 1/294 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSPS+Y+ VCP AL TI+ +VE A+ +ERRMG SLLRLHFHDCFVNGCDAS+LLDS+P+I
Sbjct  26    LSPSYYDQVCPNALTTIKRVVEAAVSRERRMGASLLRLHFHDCFVNGCDASLLLDSSPSI  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA  N NSARGFEVID+IKSEVD VCGRP VSCADILAVAARDSVVALGGPTWEV+
Sbjct  86    DSEKNAAPNVNSARGFEVIDQIKSEVDEVCGRPAVSCADILAVAARDSVVALGGPTWEVQ  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDST+AS+  A+ ++P+PFMDL  L E FKNQGL+ +DLVALSG HTLGFAQC  FR
Sbjct  146   LGRRDSTSASRTMADTDIPSPFMDLPALIEKFKNQGLDEEDLVALSGAHTLGFAQCRVFR  205

Query  509   QRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY +  DID +FA QR+++CP  GG+++L+ LDPTPAYFD  YF NL   KGLL SDQ
Sbjct  206   NRIYNESNDIDPEFAEQRRSSCPGTGGDANLSPLDPTPAYFDISYFTNLKNNKGLLHSDQ  265

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD++V  Y+ +   F  DFA+SM+KMG+IKPLTGN G++R+NCR VN
Sbjct  266   QLFSGGSTDEIVLSYNSDAEEFWEDFAESMVKMGNIKPLTGNQGQVRLNCRNVN  319



>ref|XP_010066484.1| PREDICTED: peroxidase 70-like [Eucalyptus grandis]
Length=321

 Score =   431 bits (1107),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 204/294 (69%), Positives = 240/294 (82%), Gaps = 0/294 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DL+P FY++VCPQALP I+ +VE A++QERRMG SLLRLHFHDCFVNGCD SILLDST T
Sbjct  28    DLTPYFYDYVCPQALPAIKRVVEGAVQQERRMGASLLRLHFHDCFVNGCDGSILLDSTAT  87

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             I+SEK A  NNNSARGFEVID+IK+EVDRVCGRPVVSCADILAV ARDSVVALGGP+W+V
Sbjct  88    IESEKFAAPNNNSARGFEVIDQIKAEVDRVCGRPVVSCADILAVTARDSVVALGGPSWKV  147

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             +LGRRDS  AS+ TANN++P P MDL  L  NFK QGL VKDLVALSG HT+GFAQCFTF
Sbjct  148   QLGRRDSMMASRTTANNDIPAPNMDLPALINNFKKQGLKVKDLVALSGAHTIGFAQCFTF  207

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R R + D +I+  FA+  ++ CP  G +S+LASLDPTPA FD  Y+ NL+ +KGLL SDQ
Sbjct  208   RNRTFNDSNINQAFAKNLRSYCPRTGSDSNLASLDPTPARFDTLYYNNLLTQKGLLHSDQ  267

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             AL  G    +LV+ YS N+ AF  DFAKSM++MG+IKPLTGN G+IR NCRRV+
Sbjct  268   ALSTGESALELVKSYSYNYEAFWKDFAKSMVRMGNIKPLTGNQGQIRSNCRRVD  321



>ref|XP_010042071.1| PREDICTED: peroxidase 70-like [Eucalyptus grandis]
 gb|KCW88295.1| hypothetical protein EUGRSUZ_A00682 [Eucalyptus grandis]
Length=321

 Score =   430 bits (1105),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 203/293 (69%), Positives = 241/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P FY++VCPQALP I+ +VE A++QERRMG SLLRLHFHDCFVNGCD SILLDST TI
Sbjct  29    LTPYFYDYVCPQALPAIKRVVEGAVQQERRMGASLLRLHFHDCFVNGCDGSILLDSTATI  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             +SEK A  NNNSARGFEVID+IK+EVDRVCGRPVVSCADILA+ ARDSVVALGGP+W+V+
Sbjct  89    ESEKFAAPNNNSARGFEVIDQIKAEVDRVCGRPVVSCADILAITARDSVVALGGPSWKVQ  148

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+ TANN++P P MDL  L  NFK QGL VKDLVALSG HT+GFAQCFTFR
Sbjct  149   LGRRDSTTASRTTANNDIPAPNMDLPALINNFKRQGLKVKDLVALSGAHTIGFAQCFTFR  208

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              R + D +I+  FA+  ++ CP  G +S+LASLDPTPA FD  Y+ NL+ +KGLL SDQA
Sbjct  209   NRTFNDSNINQAFAKNLRSYCPRTGSDSNLASLDPTPARFDTLYYNNLLTQKGLLHSDQA  268

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L  G    +LV+ YS ++ AF  DFAKSM++MG+IKPLTGN G+IR NCRRV+
Sbjct  269   LSTGESALELVKSYSYDYEAFWKDFAKSMVRMGNIKPLTGNQGQIRSNCRRVD  321



>ref|XP_010066504.1| PREDICTED: peroxidase 70-like [Eucalyptus grandis]
Length=321

 Score =   429 bits (1103),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 203/293 (69%), Positives = 240/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P FY++VCPQALP I+ +VE A++QERRMG SLLRLHFHDCFVNGCD SILLDST TI
Sbjct  29    LTPYFYDYVCPQALPAIKRVVEGAVQQERRMGASLLRLHFHDCFVNGCDGSILLDSTATI  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             +SEK A  NNNSARGFEVID+IK+EVDRVCG PVVSCADILAV ARDSVVALGGP+W+V+
Sbjct  89    ESEKFAAPNNNSARGFEVIDQIKAEVDRVCGHPVVSCADILAVTARDSVVALGGPSWKVR  148

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+ TANN++P P MDL  L  NFK QGL VKDLVALSG HT+GFAQCFTFR
Sbjct  149   LGRRDSTTASRTTANNDIPAPNMDLPALINNFKRQGLKVKDLVALSGAHTIGFAQCFTFR  208

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              R + D +I+  FA+  ++ CP  G +S+LASLDPTPA FD  Y+ NL+ +KGLL SDQA
Sbjct  209   NRTFNDSNINQAFAKNLRSYCPRTGSDSNLASLDPTPARFDTLYYNNLLTQKGLLHSDQA  268

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L  G    +LV+ YS ++ AF  DFAKSM++MG+IKPLTGN G+IR NCRR+N
Sbjct  269   LSTGESALELVKSYSHDYEAFWKDFAKSMVRMGNIKPLTGNQGQIRSNCRRLN  321



>gb|ABK59095.1| peroxidase 1 [Sesbania rostrata]
Length=321

 Score =   428 bits (1100),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 241/295 (82%), Gaps = 0/295 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y++ CP AL TI+ +VE A+ +ERRMG SLLRLHFHDCFVNGCD SILLD T +I
Sbjct  27    LSPNYYDYTCPNALSTIKSVVEGAVWKERRMGASLLRLHFHDCFVNGCDGSILLDPTSSI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA  N  SARGFEV+D IK  VD  CG+PVVSCADILAVAARDSVVALGGPTWEV+
Sbjct  87    DSEKNAGPNFQSARGFEVVDDIKKAVDAACGKPVVSCADILAVAARDSVVALGGPTWEVQ  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+D AN ++P PF  LSQL ENFKN+GL+ KDLV LSGGHT+G+A+C TFR
Sbjct  147   LGRRDSTTASRDAANKDIPAPFFSLSQLIENFKNKGLDEKDLVVLSGGHTIGYARCATFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D DI+S+FA+Q +  CP+NGG+S+L+ LDPT A FD  Y+ NL++ KGLL SDQ 
Sbjct  207   DHIYKDTDINSEFAQQLKYICPINGGDSNLSPLDPTAANFDVAYYSNLLQTKGLLHSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNYY  165
             LF GG TD+LV+ YS    AF  DFAKSMIKMG+I+PLTG+ GE+RV+CR+VNYY
Sbjct  267   LFNGGSTDELVKQYSYYPEAFFQDFAKSMIKMGNIQPLTGDQGEVRVDCRKVNYY  321



>ref|XP_010042156.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=323

 Score =   427 bits (1099),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 202/293 (69%), Positives = 241/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P FY++VCPQALP I+ +VE A++QERRMG SLLRLHFHDCFVNGCDASILLD TPTI
Sbjct  31    LTPYFYDYVCPQALPAIKRVVEAAVQQERRMGASLLRLHFHDCFVNGCDASILLDPTPTI  90

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK A  NNNSARGFEVID+IK+EVD+ CG  +VSCADILAVAARDSVVALGGP+WEV+
Sbjct  91    DSEKFANPNNNSARGFEVIDQIKAEVDKACGYSLVSCADILAVAARDSVVALGGPSWEVQ  150

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDST AS+ TAN+++P P MDL  L   F+ QGL+ +DLVALSG HT+GFAQCFTFR
Sbjct  151   LGRRDSTMASRTTANSDIPAPNMDLPALINTFQKQGLDTRDLVALSGAHTIGFAQCFTFR  210

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              R Y D +I + FAR  ++ CP  G + +LA LDP+PA FDA YF NL+ +KGLL SDQA
Sbjct  211   NRTYNDDNIATSFARSLRSLCPRTGEDGNLAGLDPSPAQFDALYFHNLLAQKGLLHSDQA  270

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L++GG TD+LV+ YS +  AF +DFAKSMIKMG+IKPL GN G+IR NCRR+N
Sbjct  271   LYSGGSTDELVKTYSDDAEAFWDDFAKSMIKMGNIKPLIGNQGQIRSNCRRLN  323



>ref|XP_010264469.1| PREDICTED: peroxidase 2-like [Nelumbo nucifera]
Length=320

 Score =   427 bits (1097),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 206/294 (70%), Positives = 236/294 (80%), Gaps = 0/294 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LSP+FYN VCPQALPTI+ IVE+A+K+E RMG SLLRLHFHDCFVNGCDASILLD T +
Sbjct  25    NLSPTFYNKVCPQALPTIKKIVEEAVKKETRMGASLLRLHFHDCFVNGCDASILLDRTSS  84

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
               SEK A  NNNS RGF V+D+IKS VD+ CG PVVSCADILAVAARDSVVALGGPTW+V
Sbjct  85    FLSEKTAPPNNNSVRGFNVVDKIKSAVDKACGGPVVSCADILAVAARDSVVALGGPTWKV  144

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
              LGRRDSTTA++  A  NLP+PF +LS L  NFKNQGLN KDLVALSGGHT+G A+C  F
Sbjct  145   LLGRRDSTTANRTLATVNLPSPFSNLSTLISNFKNQGLNRKDLVALSGGHTIGLARCIIF  204

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R RIY D +I   +AR RQA CP++GG+++ A LD T + FD  YF NLVK+KGLL SDQ
Sbjct  205   RSRIYNDTNIHPSYARARQAICPVSGGDNNFAPLDHTRSLFDTVYFTNLVKRKGLLHSDQ  264

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD LV+ YS N  AFS  FAKSMIKMG+IKPLTG  G+IRVNCR+VN
Sbjct  265   ELFNGGSTDSLVKTYSTNFKAFSAAFAKSMIKMGNIKPLTGKKGQIRVNCRKVN  318



>ref|XP_010066472.1| PREDICTED: peroxidase 70-like [Eucalyptus grandis]
Length=323

 Score =   427 bits (1097),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 203/293 (69%), Positives = 239/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP FY++VCPQALPTI+ +VE A++QERRMG SLLRLHFHDCFVNGCD SILLD TPTI
Sbjct  31    LSPDFYDYVCPQALPTIKRVVEAAVQQERRMGASLLRLHFHDCFVNGCDRSILLDPTPTI  90

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK A  NNNSARGFEVID+IK+EVDRVCGRPVVSCADILAV ARDSVV LGGP+W+V+
Sbjct  91    DSEKLAFPNNNSARGFEVIDQIKAEVDRVCGRPVVSCADILAVTARDSVVELGGPSWKVR  150

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+ TAN+++P P MDL  L  NFK QGL VKDLVALSG HT+GFAQC  FR
Sbjct  151   LGRRDSMTASRTTANSDIPAPNMDLPALINNFKRQGLKVKDLVALSGAHTIGFAQCRVFR  210

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +I+  FA+  Q++CP  G +++LASLDP+PA FD  Y+ NL+ +KGLL SDQA
Sbjct  211   DRIYNDSNINHAFAKNLQSSCPRTGSDTNLASLDPSPARFDTLYYNNLLTQKGLLHSDQA  270

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L     T +LV+ YS ++ AF  DFAKSM++MG+IKPL GN G+IR NCRRVN
Sbjct  271   LSTDESTLELVKSYSYDYDAFWKDFAKSMVRMGNIKPLIGNQGQIRSNCRRVN  323



>ref|XP_011003590.1| PREDICTED: peroxidase 2-like [Populus euphratica]
Length=321

 Score =   426 bits (1095),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 201/293 (69%), Positives = 236/293 (81%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y+HVCP+ALP I+ +VE AI +ERRMG SLLRLHFHDCFV+GCDASILLDST   
Sbjct  29    LSPNYYDHVCPKALPAIKRVVEAAINKERRMGASLLRLHFHDCFVHGCDASILLDSTSAF  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK A  N NS RGFEVID+IK EVD+VCGRPVVSCADI+AVAARDSVV LGGPTW V+
Sbjct  89    DSEKKAGPNKNSTRGFEVIDQIKLEVDKVCGRPVVSCADIVAVAARDSVVVLGGPTWAVQ  148

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTA K TA+ ++P PFM+L+ L  NFK  GL+ +DLVALSG HT+G AQCF FR
Sbjct  149   LGRRDSTTARKTTADKDIPTPFMNLTDLISNFKKHGLDERDLVALSGAHTIGSAQCFAFR  208

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + +ID KFAR+R+  CP  GGNS+LA+LDPT A FD KYF  L+KK+GLL SDQ 
Sbjct  209   DRIYNETNIDPKFARKRRLTCPRTGGNSNLAALDPTHANFDVKYFNKLLKKRGLLHSDQE  268

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV  YS +  AF  DFAKSM+KMG+I PLTG  G++R+NCR+VN
Sbjct  269   LFNGGSTDSLVEAYSSDAKAFYADFAKSMMKMGNINPLTGKRGQVRLNCRKVN  321



>ref|XP_002323056.1| peroxidase family protein [Populus trichocarpa]
 gb|EEF04817.1| peroxidase family protein [Populus trichocarpa]
 gb|AHL39189.1| class III peroxidase [Populus trichocarpa]
Length=321

 Score =   425 bits (1092),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 201/293 (69%), Positives = 237/293 (81%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y+HVCP+ALP I+ +VE A+ +ERRMG SLLRLHFHDCFV+GCDASILLDST   
Sbjct  29    LSPNYYDHVCPKALPAIKRVVEAAVNKERRMGASLLRLHFHDCFVHGCDASILLDSTSAF  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK A  N NS RGFEVID+IK EVD+VCGRPVVSCADILAVAARDSVV LGGPTW V+
Sbjct  89    DSEKKAGPNKNSIRGFEVIDQIKLEVDKVCGRPVVSCADILAVAARDSVVVLGGPTWAVQ  148

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTA K TA+ ++P P M+L+ L  NFK  GL+ +DLVALSG HT+G AQCFTFR
Sbjct  149   LGRRDSTTARKTTADKDIPTPLMNLTDLINNFKKHGLDERDLVALSGAHTIGSAQCFTFR  208

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + +ID KFAR+R+ +CP  GGNS+LA+LDPT A FD KYF  L+KK+GLL SDQ 
Sbjct  209   DRIYNEANIDPKFARERRLSCPRTGGNSNLAALDPTHANFDVKYFNKLLKKRGLLHSDQE  268

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV  YS +  AF  DFAKSM+KMG+I PLTG  G++R+NCR+VN
Sbjct  269   LFNGGSTDSLVEAYSSDAKAFWADFAKSMMKMGNINPLTGKRGQVRLNCRKVN  321



>gb|KDO49649.1| hypothetical protein CISIN_1g021171mg [Citrus sinensis]
Length=316

 Score =   424 bits (1090),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 202/293 (69%), Positives = 239/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP +Y+ VCP+ALPTI+ IVE A+++E RMG SLLRLHFHDCFV GCDASILLD T TI
Sbjct  23    LSPCYYDKVCPEALPTIKRIVEAAVEKEGRMGASLLRLHFHDCFVQGCDASILLDDTSTI  82

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA+ NNNS RGFEVID IK E+D+VC RPVVSCADILAVAARDSVVALGGPTW+V 
Sbjct  83    DSEKNAIPNNNSVRGFEVIDLIKKELDKVCKRPVVSCADILAVAARDSVVALGGPTWKVP  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTA++  ANN++P+PF++L+ L  +F+ QGLN  DLVALSGGHT+GFA+C  FR
Sbjct  143   LGRRDSTTANRTLANNDIPSPFLNLTGLISSFRRQGLNETDLVALSGGHTIGFARCSAFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY   +ID  FA++RQ  CP  GG+S+LA  DPTP  FD KYF +L++K+GLL+SDQA
Sbjct  203   NRIYNATNIDPDFAKERQRTCPSTGGDSNLAPFDPTPLTFDGKYFSSLLQKRGLLISDQA  262

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS N  AFS DFA SMIKMG+I  LTGN G+IR NCRR+N
Sbjct  263   LFNGGSTDGLVKTYSLNFKAFSADFANSMIKMGNINVLTGNKGQIRSNCRRLN  315



>ref|XP_006481156.1| PREDICTED: cationic peroxidase 1-like [Citrus sinensis]
Length=316

 Score =   422 bits (1086),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 202/293 (69%), Positives = 238/293 (81%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP +Y+ VCP+ALPTI+ IVE A+++E RMG SLLRLHFHDCFV GCDASILLD T TI
Sbjct  23    LSPCYYDKVCPEALPTIKRIVEAAVEKEGRMGASLLRLHFHDCFVQGCDASILLDDTSTI  82

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA+ NNNS RGFEVID IK E+D+VC RPVVSCADILAVAARDSVVALGGPTW+V 
Sbjct  83    DSEKNAIPNNNSVRGFEVIDLIKKELDKVCKRPVVSCADILAVAARDSVVALGGPTWKVP  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTA++  ANN++P+PF++L+ L  +F+ QGLN  DLVALSGGHT+GFA+C  FR
Sbjct  143   LGRRDSTTANRTLANNDIPSPFLNLTGLISSFRRQGLNETDLVALSGGHTIGFARCSAFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY   +ID  FA++RQ  CP  GG+S+LA  DPTP  FD KYF +L++K+GLL+SDQA
Sbjct  203   NRIYNATNIDPDFAKERQRTCPSTGGDSNLAPFDPTPLTFDGKYFSSLLQKRGLLISDQA  262

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS N  AFS  FA SMIKMG+I  LTGN G+IR NCRRVN
Sbjct  263   LFNGGSTDGLVKTYSLNFKAFSAGFANSMIKMGNINVLTGNKGQIRSNCRRVN  315



>ref|XP_010041993.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=323

 Score =   421 bits (1083),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 199/293 (68%), Positives = 238/293 (81%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P FY++VCPQALP I+ +VE A++QERRMG SL RLHFHDCFVNGCDASILLD TPTI
Sbjct  31    LTPYFYDYVCPQALPAIKRVVEAAVQQERRMGASLFRLHFHDCFVNGCDASILLDPTPTI  90

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK A  NNNSARGFEVID+IK+EVD+ CG  +VSCADILAVAARDSVVALGGP+WEV+
Sbjct  91    DSEKFANPNNNSARGFEVIDQIKAEVDKACGYSLVSCADILAVAARDSVVALGGPSWEVQ  150

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+ TAN+++P P MDL  L   F+ QGL+ +DLVALSG HT+GFAQC  FR
Sbjct  151   LGRRDSTTASRTTANSDIPAPNMDLPALISTFQKQGLDTRDLVALSGAHTIGFAQCVNFR  210

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              R Y D +I + FAR  ++ CP  G + +LA LDP+PA FDA YF NL+ +KGLL SDQA
Sbjct  211   NRTYNDDNIATSFARSLRSLCPRTGEDGNLAGLDPSPAQFDALYFHNLLAQKGLLHSDQA  270

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L++GG TD+LV+ YS +  AF +DFAKSMIKMG+IKP  GN G+IR NCRR+N
Sbjct  271   LYSGGSTDELVKTYSDDAEAFWDDFAKSMIKMGNIKPWIGNQGQIRSNCRRLN  323



>ref|XP_010041911.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=323

 Score =   421 bits (1081),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 199/293 (68%), Positives = 239/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P FY++VCPQALP I+ +VE A++QERRMG SLLRLHFHDCFVNGCDASILLD TPTI
Sbjct  31    LTPYFYDYVCPQALPAIKRVVEAAVQQERRMGASLLRLHFHDCFVNGCDASILLDPTPTI  90

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK A  NNNSARGFEVID+IK+EVD+ CG  +VSCADILAVAARDSVVALGGP+WEV+
Sbjct  91    DSEKFANPNNNSARGFEVIDQIKAEVDKACGYSLVSCADILAVAARDSVVALGGPSWEVQ  150

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+ TAN+++P P MDL  L   F+ QGL+ +DLVALSG HT+GFAQC  FR
Sbjct  151   LGRRDSTTASRTTANSDIPAPNMDLPALINTFQKQGLDTRDLVALSGAHTIGFAQCVNFR  210

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              R Y D ++ + FAR  ++ CP  G + +LA LDP+PA FDA YF NL+ +KGLL SDQA
Sbjct  211   NRTYNDDNVATSFARSLRSLCPRTGEDGNLAGLDPSPAQFDALYFHNLLAQKGLLHSDQA  270

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L++GG TD+LV+ YS +  AF + FAKSMIKMG+IKPL GN G+IR NCRR+N
Sbjct  271   LYSGGSTDELVKTYSDDAEAFWDYFAKSMIKMGNIKPLIGNQGQIRSNCRRLN  323



>ref|XP_010041825.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=323

 Score =   418 bits (1075),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 197/293 (67%), Positives = 238/293 (81%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P FY++ CPQALP ++ IVE A++QERRMG SLLRLHFHDCFVNGCDASILLD +PTI
Sbjct  31    LTPHFYDYACPQALPAVQRIVEAAVQQERRMGASLLRLHFHDCFVNGCDASILLDPSPTI  90

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK A  NNNSARGFEVID+IK+EVD+ CG  +VSCADILA+AARDSVVALGGP+WEV+
Sbjct  91    DSEKLAFPNNNSARGFEVIDQIKAEVDKACGYSLVSCADILAIAARDSVVALGGPSWEVQ  150

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDST AS+ TAN ++P P MDL  L   F+ QGL+ +DLVALSG HT+GFAQC  FR
Sbjct  151   LGRRDSTRASRTTANTDIPAPNMDLPSLISTFQKQGLDTRDLVALSGAHTIGFAQCRVFR  210

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              R Y D +I + FA   ++ CP  G +S+LA LDP+PA FDA YF NL+ +KGLL SDQA
Sbjct  211   NRTYNDANIAADFAGSLRSLCPRTGEDSNLAGLDPSPAQFDALYFHNLLAQKGLLHSDQA  270

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L++GG TD+LV+ YS +  AF +DFAKSMIKMG+IKPL GN G+IR+NCR+VN
Sbjct  271   LYSGGSTDELVKTYSDDAEAFWDDFAKSMIKMGNIKPLIGNQGQIRLNCRKVN  323



>ref|XP_007134679.1| hypothetical protein PHAVU_010G066900g [Phaseolus vulgaris]
 gb|ESW06673.1| hypothetical protein PHAVU_010G066900g [Phaseolus vulgaris]
Length=319

 Score =   417 bits (1071),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/294 (67%), Positives = 235/294 (80%), Gaps = 0/294 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LS  +Y++ CP+AL TI+ +VE A+++ERRMG SL RLHFHDCFVNGCD SILLDST +
Sbjct  26    ELSSHYYDYSCPKALSTIKTVVETAVQKERRMGASLTRLHFHDCFVNGCDGSILLDSTSS  85

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             IDSEKN+ AN  SARGFEV+D IK  VD  CG+PVVSCADILAVAARDSVVALGGPTW+V
Sbjct  86    IDSEKNSNANFESARGFEVVDEIKQAVDEACGKPVVSCADILAVAARDSVVALGGPTWKV  145

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             KLGRRDSTTAS+  A+ N+P PF  LS+L  NF+N GL+ KDLV L+GGHTLG+A+C TF
Sbjct  146   KLGRRDSTTASRAAADANIPAPFFSLSELITNFRNHGLDEKDLVVLAGGHTLGYARCATF  205

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R RIY D +IDS FA+  +  CP  GG+S+L+ LDPT A FD  Y+ NLV+KKGLL SDQ
Sbjct  206   RDRIYEDSNIDSDFAKDLKYICPTTGGDSNLSPLDPTAAQFDKNYYSNLVQKKGLLHSDQ  265

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD+LV+ YS +   F  DFA SMIKMG+I+PLTGN GEIRVNCR++N
Sbjct  266   ELFNGGSTDELVKEYSYDTEDFYEDFANSMIKMGNIQPLTGNQGEIRVNCRKIN  319



>ref|XP_003517000.1| PREDICTED: peroxidase 52-like isoform 1 [Glycine max]
Length=319

 Score =   414 bits (1063),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 198/293 (68%), Positives = 233/293 (80%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  +Y++ CP AL TIR +VE A+++ERRMG SLLRLHFHDCFVNGCD SILLD + TI
Sbjct  27    LSHDYYDYTCPNALSTIRSVVEAAVQKERRMGASLLRLHFHDCFVNGCDGSILLDPSSTI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNAL N  SARGFEV+D IK  VD  CG+PVVSCADILAVAARDSVVALGGP+W+V+
Sbjct  87    DSEKNALPNFQSARGFEVVDEIKEAVDEACGKPVVSCADILAVAARDSVVALGGPSWKVR  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS++ AN N+P PF  LS+L  NFK+ GLN +DLVALSGGHT+G A+C TFR
Sbjct  147   LGRRDSTTASREAANANIPAPFFSLSELINNFKSHGLNERDLVALSGGHTIGNARCATFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D +I+  FA++ +  CP  GG+S+LA LD + A FD+ YF +LV KKGLL SDQ 
Sbjct  207   DHIYNDSNINPHFAKELKHICPREGGDSNLAPLDRSAARFDSAYFSDLVHKKGLLHSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV++YS N   F  DFAKSMIKMG+IKPLTGN GEIR+NCRRVN
Sbjct  267   LFNGGSTDALVKIYSHNTKGFHKDFAKSMIKMGNIKPLTGNRGEIRLNCRRVN  319



>ref|XP_006576455.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=319

 Score =   413 bits (1062),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 195/293 (67%), Positives = 236/293 (81%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y++ CP+AL TI+ +VE ++++ERRMG SLLRLHFHDCFVNGCD SILLDST +I
Sbjct  27    LSPNYYDYSCPKALSTIKSVVEASVQKERRMGASLLRLHFHDCFVNGCDGSILLDSTSSI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA AN  SARGFEV+D IK  VD  CG+PVVSCADILAVAARDSVVALGGP+W+V+
Sbjct  87    DSEKNAAANLQSARGFEVVDDIKKAVDEACGKPVVSCADILAVAARDSVVALGGPSWKVR  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS++ A+ ++P PF  LS+L  NFKN GL+ KDLV LSGGH++GFA+C TF+
Sbjct  147   LGRRDSTTASREAADASIPAPFFSLSELITNFKNHGLDEKDLVVLSGGHSIGFARCVTFK  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D +ID  FA+Q +  CP NGG+S+L+ LD T A FD  Y+ NLV+KKGLL SDQ 
Sbjct  207   DHIYNDSNIDPNFAQQLRYICPTNGGDSNLSPLDSTAAKFDINYYSNLVQKKGLLHSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD+LV+ YS +   F  DFA SMIKMG+I+PLTGN GEIRVNCR VN
Sbjct  267   LFNGGSTDELVKEYSDDTEDFYEDFANSMIKMGNIQPLTGNQGEIRVNCRNVN  319



>ref|XP_011095108.1| PREDICTED: cationic peroxidase 1-like [Sesamum indicum]
Length=324

 Score =   412 bits (1060),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 200/295 (68%), Positives = 234/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DL P+FY+ +CPQALP I  +VE+A++QE R+G SLLRLHFHDCFVNGCD SILLD+T  
Sbjct  28    DLDPNFYDEICPQALPAIERVVEEAVQQEPRIGASLLRLHFHDCFVNGCDGSILLDTTCD  87

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
               SEK A+ NNNSARGF+V+DRIK EVDR CG PVVSCADILAVAARDSVVALGGP WEV
Sbjct  88    FTSEKFAVPNNNSARGFDVVDRIKWEVDRACGGPVVSCADILAVAARDSVVALGGPNWEV  147

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             +LGRRDSTTAS D AN ++P+P MDL  L   F N GLN++DLV LSG HT+GFAQC  F
Sbjct  148   QLGRRDSTTASIDKANTDIPSPSMDLPALITTFSNHGLNLQDLVVLSGSHTIGFAQCSLF  207

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R RIY + +IDS FA ++QA CP+ GG+S+LA LDPT A FD KYF NLV KKGLL SDQ
Sbjct  208   RNRIYNENNIDSSFASKQQATCPLTGGDSNLAPLDPTAALFDTKYFDNLVMKKGLLHSDQ  267

Query  332   ALF-AGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF AG +TD LV+ YS +  AF+ DF  SMIKMG+I PLTG+ G+IR NCR+VN
Sbjct  268   QLFNAGCETDSLVQAYSSDPDAFAMDFVNSMIKMGNICPLTGDQGQIRCNCRKVN  322



>ref|XP_003522108.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=319

 Score =   412 bits (1059),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 195/293 (67%), Positives = 235/293 (80%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y++ CP+AL TI+ +VE ++ +ERRMG SLLRLHFHDCFVNGCD SILLDST +I
Sbjct  27    LSPNYYDYSCPKALSTIKSVVEASVLKERRMGASLLRLHFHDCFVNGCDGSILLDSTSSI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA AN  SARGFEV+D IK  VD  CG+PVVSCADILAVAARDSVVALGGP+W+V+
Sbjct  87    DSEKNAAANLQSARGFEVVDDIKKAVDEACGKPVVSCADILAVAARDSVVALGGPSWKVR  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS++ A+ ++P PF  LS+L  NFKN GL+ KDLV LSGGH++GFA+C TF+
Sbjct  147   LGRRDSTTASREAADASIPAPFFSLSELITNFKNHGLDEKDLVVLSGGHSIGFARCVTFK  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D +ID  FA+Q +  CP NGG+S+L+ LD T A FD  Y+ NLV+KKGLL SDQ 
Sbjct  207   DHIYNDSNIDPNFAQQLKYICPTNGGDSNLSPLDSTAAKFDINYYSNLVQKKGLLHSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD+LV+ YS +   F  DFA SMIKMG+I+PLTGN GEIRVNCR VN
Sbjct  267   LFNGGSTDELVKEYSDDTEDFYEDFANSMIKMGNIQPLTGNQGEIRVNCRNVN  319



>ref|XP_003517003.1| PREDICTED: cationic peroxidase 1 [Glycine max]
Length=319

 Score =   412 bits (1059),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 194/293 (66%), Positives = 234/293 (80%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y++ CP AL TI+ +VE A+++E RMG SLLRLHFHDCFVNGCD S+LLDST +I
Sbjct  27    LSPNYYDYSCPNALSTIKSVVEAAVQKEHRMGASLLRLHFHDCFVNGCDGSVLLDSTSSI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA AN  SARGFEV+D IK  VD+ CG+PVVSCADILAVAARDSVVALGGP+W+V 
Sbjct  87    DSEKNAAANFQSARGFEVVDDIKKAVDQACGKPVVSCADILAVAARDSVVALGGPSWKVS  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS++ A+ ++P PF  LS L  NFKN GL+ KDLV LSGGH++G+A+C TFR
Sbjct  147   LGRRDSTTASREAADASIPAPFFSLSDLITNFKNHGLDEKDLVVLSGGHSIGYARCVTFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D +ID+ FA+Q +  CP NGG+S+L+ LD T A FD  Y+ NLV+KKGLL SDQ 
Sbjct  207   DHIYNDSNIDANFAKQLKYICPTNGGDSNLSPLDSTAANFDVTYYSNLVQKKGLLHSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD+LV+ YS +   F  DFA SMIKMG+I+PLTGN GEIRVNCR VN
Sbjct  267   LFNGGSTDELVKEYSDDTEDFYEDFANSMIKMGNIQPLTGNQGEIRVNCRNVN  319



>ref|XP_003522112.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=319

 Score =   411 bits (1057),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 194/293 (66%), Positives = 235/293 (80%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y++ CP+AL TI+ +VE ++++ERRMG SLLRLHFHDCFVNGCD SILLDST +I
Sbjct  27    LSPNYYDYSCPKALSTIKSVVEASVQKERRMGASLLRLHFHDCFVNGCDGSILLDSTSSI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA AN  SARGFEV+D IK  VD  CG+PVVSCADILAVAARDSVVALGGP+W+V+
Sbjct  87    DSEKNAAANLQSARGFEVVDDIKKAVDEACGKPVVSCADILAVAARDSVVALGGPSWKVR  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS++ A+ ++P PF  LS+L  NFKN GL+ KDLV LSGGH++GFA+C TF+
Sbjct  147   LGRRDSTTASREAADASIPAPFFSLSELITNFKNHGLDEKDLVVLSGGHSIGFARCVTFK  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D +ID  FA+Q +  CP NGG+S+L+ LD T A FD  Y+ NLV+KKGLL SDQ 
Sbjct  207   DHIYNDSNIDPHFAQQLKYICPTNGGDSNLSPLDSTAAKFDINYYSNLVQKKGLLHSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD+LV+ YS +   F  DFA SMIKMG+I+ LTGN GEIRVNCR VN
Sbjct  267   LFNGGSTDELVKEYSDDTEDFYEDFANSMIKMGNIQSLTGNQGEIRVNCRNVN  319



>ref|XP_003522118.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=321

 Score =   411 bits (1056),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 232/295 (79%), Gaps = 0/295 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y++ CP AL TI+ +VE A+++E RMG SLLRLHFHDCFVNGCD SILLD +PTI
Sbjct  27    LSPNYYDYACPNALSTIKSVVEAAVQKEYRMGASLLRLHFHDCFVNGCDGSILLDPSPTI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA AN  S RGFEV+D IK  VD  CG PVVSCADILAVAARDSVVALGGPTWEV+
Sbjct  87    DSEKNAFANFQSVRGFEVVDDIKQAVDEACGTPVVSCADILAVAARDSVVALGGPTWEVQ  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTASK+ A+ N+P PF  LSQL  NFKN GL+ KDLV LSGGHT+G+A+C TF+
Sbjct  147   LGRRDSTTASKEAADANIPAPFFSLSQLITNFKNHGLDEKDLVVLSGGHTIGYARCVTFK  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D +ID  FA+  +  CP NGG+ +LA LD T A FD  Y+ NLV+K GLL SDQ 
Sbjct  207   DHIYNDSNIDPNFAQYLKYICPRNGGDLNLAPLDSTAANFDLNYYSNLVQKNGLLHSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNYY  165
             LF GG TD+LV+ YS +  AF  +FA SM+KMG+I+PLTG+ GEIRV+CR+VN Y
Sbjct  267   LFNGGSTDELVKQYSYDTEAFYVEFANSMVKMGNIQPLTGDQGEIRVSCRKVNNY  321



>ref|XP_007134677.1| hypothetical protein PHAVU_010G066700g [Phaseolus vulgaris]
 gb|ESW06671.1| hypothetical protein PHAVU_010G066700g [Phaseolus vulgaris]
Length=319

 Score =   410 bits (1055),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 192/293 (66%), Positives = 232/293 (79%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP +Y++ CP AL +IR +VE A+++E+RMG SLLRLHFHDCFVNGCD SILLD +P+I
Sbjct  27    LSPDYYDYSCPNALSSIRSVVEAAVQKEQRMGASLLRLHFHDCFVNGCDGSILLDPSPSI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNAL N  S RGFEV+D IK  VD  CG+PVVSCADILAVAARDSVVALGGPTWEV+
Sbjct  87    DSEKNALPNFQSIRGFEVVDEIKQAVDEACGKPVVSCADILAVAARDSVVALGGPTWEVR  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS++ AN N+P PF  LS+L  NFK+ GLN KDLV LSGGHT+G+A+C TFR
Sbjct  147   LGRRDSTTASREAANANIPAPFFSLSELISNFKSHGLNEKDLVVLSGGHTIGYARCATFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D +I+ +F ++ +  CP  GG+ +LA LD T A FD+ YF +L+ +KG+L SDQ 
Sbjct  207   DHIYDDSNINQRFGKELKYICPKKGGDFNLAPLDRTAAQFDSVYFSDLIHRKGILHSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS N  AF  DFAKSMIKMG+IKPLTG+ GE+R+NCR VN
Sbjct  267   LFNGGSTDALVKRYSYNSKAFHKDFAKSMIKMGNIKPLTGSKGEVRLNCRTVN  319



>gb|KHN33217.1| Cationic peroxidase 1 [Glycine soja]
Length=319

 Score =   410 bits (1055),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 194/293 (66%), Positives = 235/293 (80%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y++ CP+AL TI+ +VE ++++ERRMG SLLRLHFHDCFVNGCD SILLDST +I
Sbjct  27    LSPNYYDYSCPKALSTIKSVVEASVQKERRMGASLLRLHFHDCFVNGCDGSILLDSTSSI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA AN  SARGFEV+D IK  VD  CG+PVVSCADILAVAARDSVVALGGP+W+V+
Sbjct  87    DSEKNAAANLQSARGFEVVDDIKKAVDEACGKPVVSCADILAVAARDSVVALGGPSWKVR  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS++ A+ ++P PF  LS+L  NFKN GL+ KDLV LSGGH++GFA+C TF+
Sbjct  147   LGRRDSTTASREAADASIPAPFFSLSELITNFKNHGLDEKDLVVLSGGHSIGFARCVTFK  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D +ID  FA+Q +  CP NGG+S+L+ LD T A FD  Y+ NLV+KKGLL SDQ 
Sbjct  207   DHIYNDSNIDPNFAQQLRYICPTNGGDSNLSPLDSTAAKFDINYYSNLVQKKGLLHSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD+LV+ YS +   F  DFA SMIKMG+I+ LTGN GEIRVNCR VN
Sbjct  267   LFNGGSTDELVKEYSDDTEDFYEDFANSMIKMGNIQSLTGNQGEIRVNCRNVN  319



>ref|XP_003522116.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=319

 Score =   408 bits (1049),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 193/293 (66%), Positives = 234/293 (80%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y++ CP AL TI+ +VE ++++ERR+G SLLRLHFHDCFVNGCD SILLDST +I
Sbjct  27    LSPNYYDYSCPSALSTIKSVVEASVQKERRIGASLLRLHFHDCFVNGCDGSILLDSTSSI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA AN  SARGFEV+D IK  VD  CG+ VVSCADILAVAARDSVVALGGP+W+V+
Sbjct  87    DSEKNAAANLQSARGFEVVDDIKKAVDEACGKAVVSCADILAVAARDSVVALGGPSWKVR  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS++ A+ ++P PF  LS+L  NFKN GL+ KDLV LSGGH++GFA+C TF+
Sbjct  147   LGRRDSTTASREAADASIPAPFFSLSELITNFKNHGLDEKDLVVLSGGHSIGFARCVTFK  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D +ID  FA+Q +  CP NGG+S+L+ LD T A FD  Y+ NLV+KKGLL SDQ 
Sbjct  207   DHIYNDSNIDPNFAQQLRYICPTNGGDSNLSPLDSTAAKFDINYYSNLVQKKGLLHSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD+LV+ YS +   F  DFA SMIKMG+I+PLTGN GEIRVNCR VN
Sbjct  267   LFNGGSTDELVKEYSDDTEDFYEDFANSMIKMGNIQPLTGNQGEIRVNCRNVN  319



>gb|KEH29221.1| peroxidase family protein [Medicago truncatula]
Length=321

 Score =   407 bits (1047),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 199/295 (67%), Positives = 234/295 (79%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+ ++Y++ CP AL TIR +VE A+++E RMGGSLLRLHFHDCFVNGCD SILLDSTP++
Sbjct  27    LTTNYYDYTCPNALSTIRSVVEAAVEKENRMGGSLLRLHFHDCFVNGCDGSILLDSTPSM  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA  N NSARGFEV+D IK  VD+ CG+PVVSCADILAVAARDSVVALGGP+W+VK
Sbjct  87    DSEKNANPNINSARGFEVVDEIKDAVDKACGKPVVSCADILAVAARDSVVALGGPSWKVK  146

Query  689   LGRRDSTTASK-DTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             LGRRDS TAS+ D  + N+P P   LSQL +NF N+GLN KDLVALSG HT+GF++C  F
Sbjct  147   LGRRDSKTASRADADSGNIPGPAFSLSQLIKNFDNKGLNEKDLVALSGAHTIGFSRCLLF  206

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSD  336
             R RIY DK+ID+ FA+Q Q  CP  GG+S+LA+LD  TPA FD  Y+  L+KKKGLL SD
Sbjct  207   RDRIYNDKNIDANFAKQLQDICPREGGDSNLAALDCVTPAKFDEAYYMELIKKKGLLHSD  266

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q L  G  T  LVR Y R+  AF NDFAKSMIKMG+IKPLTG+ GEIR NCRR N
Sbjct  267   QELLNGDYTGSLVRKYRRDTSAFYNDFAKSMIKMGNIKPLTGSQGEIRSNCRRAN  321



>ref|XP_007134678.1| hypothetical protein PHAVU_010G066800g [Phaseolus vulgaris]
 gb|ESW06672.1| hypothetical protein PHAVU_010G066800g [Phaseolus vulgaris]
Length=320

 Score =   407 bits (1045),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 190/294 (65%), Positives = 230/294 (78%), Gaps = 0/294 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y++ CP AL TI+ +VE A+++E RMG SLLRLHFHDCFVNGCD SILLD +PTI
Sbjct  27    LSPNYYDYSCPNALSTIKSVVEAAVQKENRMGASLLRLHFHDCFVNGCDGSILLDPSPTI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNAL N  S RGFEV+D IK  VD  CG+PVVSCADILA+ ARDSVVALGGPTWEV+
Sbjct  87    DSEKNALPNVRSLRGFEVVDEIKQAVDEACGKPVVSCADILAIVARDSVVALGGPTWEVQ  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS++ AN N+P PF  LS+L  NFKN GL+ KDLV LSGGHT+G+A+C  F+
Sbjct  147   LGRRDSTTASREAANANIPAPFFSLSELITNFKNHGLDEKDLVVLSGGHTIGYARCANFK  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D +ID  FA+  +  CP NGG+ +L+ LD T A FD  Y+ NLV K GLL SDQ 
Sbjct  207   AHIYNDSNIDPDFAQYLKYICPRNGGDQNLSPLDSTAANFDVAYYSNLVNKNGLLHSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNY  168
             LF GG TD LV+ YS ++ AF  DFA SMIKMG+I+P+TG+ G++RVNCR+VNY
Sbjct  267   LFNGGSTDALVQQYSYDNEAFFEDFASSMIKMGNIQPITGDQGQVRVNCRKVNY  320



>gb|KDP22790.1| hypothetical protein JCGZ_00377 [Jatropha curcas]
Length=326

 Score =   406 bits (1043),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 228/295 (77%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTP--  876
             L P +Y+ +CP+ALPTI+ +VE A+++E+RMG SLLRLHFHDCFVNGCDAS+LLD +P  
Sbjct  24    LCPHYYDKLCPEALPTIKRVVEAAVRKEKRMGASLLRLHFHDCFVNGCDASVLLDPSPSP  83

Query  875   TIDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWE  696
             TIDSEK AL N NS RGFEVID+IKSEVD  CG  VVSCADIL VAARDSVVALGGPTW+
Sbjct  84    TIDSEKEALPNKNSIRGFEVIDQIKSEVDEACGGSVVSCADILTVAARDSVVALGGPTWK  143

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGR+DSTTA+K  A  +LP PF+DL  L + FK QGLN  DLVALSGGHT+GF+QC  
Sbjct  144   VPLGRKDSTTANKTKAETDLPGPFLDLPALIDAFKKQGLNETDLVALSGGHTIGFSQCGA  203

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             FR RIY + +ID +FA++R+  CP  G N++LA  DPTPA FD  YF +L   KGLL SD
Sbjct  204   FRDRIYNETNIDPEFAQERRLTCPRTGNNTNLAPFDPTPASFDVAYFNSLTNLKGLLHSD  263

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF GG TD LV  YS N  AF  DF KSMI+MG+IKPLTGN GE+R NCR VN
Sbjct  264   QQLFNGGSTDALVSTYSSNPEAFRADFIKSMIRMGNIKPLTGNEGEVRSNCRVVN  318



>ref|XP_009775408.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=250

 Score =   402 bits (1032),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 196/250 (78%), Positives = 219/250 (88%), Gaps = 1/250 (0%)
 Frame = -1

Query  917  VNGCDASILLDSTPTIDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVA  738
            + GCDAS+LLD T TIDSEK A ANNNSARGFEVID+IKSEVD+ CGRPVVSCADILAVA
Sbjct  1    MQGCDASVLLDQTATIDSEKTARANNNSARGFEVIDKIKSEVDKACGRPVVSCADILAVA  60

Query  737  ARDSVVALGGPTWEVKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVA  558
            ARDSVVAL GPTWEVKLGRRDSTTAS+ TANN++P+PFMDL  L  NFKNQGL+ +DLVA
Sbjct  61   ARDSVVALHGPTWEVKLGRRDSTTASRTTANNDIPSPFMDLPALINNFKNQGLDEEDLVA  120

Query  557  LSGGHTLGFAQCFTFRQRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAK  381
            LSGGHTLGFAQCFTFR RIY +  +IDS FA QRQANCP +GG+S+LASLDPT A FD+K
Sbjct  121  LSGGHTLGFAQCFTFRDRIYNETNNIDSTFASQRQANCPRSGGDSNLASLDPTAALFDSK  180

Query  380  YFKNLVKKKGLLVSDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNG  201
            YF NLV KKGLL SDQALF+GG+TD+LV+ YS N G FS DFA+SMIKMG+IKPLTGN G
Sbjct  181  YFSNLVSKKGLLHSDQALFSGGETDNLVKTYSTNIGTFSKDFAESMIKMGNIKPLTGNQG  240

Query  200  EIRVNCRRVN  171
            +IRVNCRRVN
Sbjct  241  QIRVNCRRVN  250



>gb|KHN33222.1| Cationic peroxidase 1 [Glycine soja]
Length=319

 Score =   404 bits (1038),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 192/293 (66%), Positives = 232/293 (79%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  +Y++ CP AL TIR +VE A+++E RMG SLLRLHFHDCFVNGCD SILLD +PTI
Sbjct  27    LSRDYYDYSCPNALSTIRSVVEAAVQKEHRMGASLLRLHFHDCFVNGCDGSILLDPSPTI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK+A+ +  S + F+++D IK  VD+ CG+PVVSCADIL VAARDSVVALGGPTWEV+
Sbjct  87    DSEKSAVPDFQSDKAFKLVDEIKEAVDQACGKPVVSCADILTVAARDSVVALGGPTWEVR  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDST AS+D AN N+P+PF  LS+L  NFK+ GLN KDLVALSGGHT+G A+C TFR
Sbjct  147   LGRRDSTIASRDAANANIPSPFFSLSELISNFKSHGLNEKDLVALSGGHTIGNARCATFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D +I+  FA++ +  CP  GG+S++A LD T A FD+ YF++LV KKGLL SDQ 
Sbjct  207   DHIYNDSNINPHFAKELKYICPREGGDSNIAPLDRTAAQFDSAYFRDLVHKKGLLRSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS+N   F  DFAKSMIKMG+IKPLTGN GEIR+NCRRVN
Sbjct  267   LFNGGSTDALVKKYSQNTKVFRQDFAKSMIKMGNIKPLTGNRGEIRLNCRRVN  319



>ref|XP_003522106.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=321

 Score =   402 bits (1033),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 231/295 (78%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y+  CP+AL TI+ +VE  +K+ERRMG SLLRLHFHDCFVNGCD S+LLDST +I
Sbjct  27    LSPNYYDFSCPKALSTIKSVVEATVKKERRMGASLLRLHFHDCFVNGCDGSVLLDSTSSI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK A  N  SARGFEVID IK  VD  CG+PVVSCADI+AVAARDSVVALGGPTW+V+
Sbjct  87    DSEKKATPNFKSARGFEVIDDIKKAVDEACGKPVVSCADIVAVAARDSVVALGGPTWKVE  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  AN N+P P  +LSQL  NFKN GL+ KDLV LSGGH++GFA+C  FR
Sbjct  147   LGRRDSTTASRKAANANIPAPTFNLSQLITNFKNHGLDEKDLVVLSGGHSIGFARCIFFR  206

Query  509   QRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSD  336
               IY D  +ID KFA++ +  CP  GG+S+LA LD T P +F+  Y+ NLV+KKGLL SD
Sbjct  207   NHIYNDSNNIDPKFAKRLKHICPKKGGDSNLAPLDKTGPNHFEIGYYSNLVQKKGLLHSD  266

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF GG TD LVR YS  H AF  DFA SMIKMG+ +PLTGN GEIRVNCR+VN
Sbjct  267   QELFNGGYTDALVRQYSYGHVAFFEDFANSMIKMGNTRPLTGNQGEIRVNCRKVN  321



>ref|XP_009775853.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
 ref|XP_009775855.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=250

 Score =   399 bits (1025),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 194/250 (78%), Positives = 219/250 (88%), Gaps = 1/250 (0%)
 Frame = -1

Query  917  VNGCDASILLDSTPTIDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVA  738
            + GCDAS+LLD T TIDSEK A ANNNSARGFEVID+IKSEVD+ CGRPVVSCADILAVA
Sbjct  1    MQGCDASVLLDQTATIDSEKTARANNNSARGFEVIDKIKSEVDKACGRPVVSCADILAVA  60

Query  737  ARDSVVALGGPTWEVKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVA  558
            ARDSVVAL GPTWEVKLGRRDSTTAS+ TANN++P+PFMDL  L  NFKNQGL+ +DLVA
Sbjct  61   ARDSVVALHGPTWEVKLGRRDSTTASRTTANNDIPSPFMDLPALINNFKNQGLDEEDLVA  120

Query  557  LSGGHTLGFAQCFTFRQRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAK  381
            LSGGHTLGFAQCFTFR RIY +  +IDS FA QRQANCP +GG+S+LASLDPT A FD+K
Sbjct  121  LSGGHTLGFAQCFTFRDRIYNETNNIDSTFASQRQANCPRSGGDSNLASLDPTAALFDSK  180

Query  380  YFKNLVKKKGLLVSDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNG  201
            YF NLV KKGLL SDQALF+GG+TD+LV+ YS N G FS DFA+SMIKMG+IKPLTG+ G
Sbjct  181  YFSNLVSKKGLLHSDQALFSGGETDNLVKTYSTNLGTFSKDFAESMIKMGNIKPLTGSQG  240

Query  200  EIRVNCRRVN  171
            +IRVNCR+VN
Sbjct  241  QIRVNCRKVN  250



>ref|XP_003522119.1| PREDICTED: peroxidase 52-like [Glycine max]
Length=319

 Score =   400 bits (1028),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/293 (65%), Positives = 230/293 (78%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  +Y++ CP AL TIR +VE A+++ERRMG SLLR HF DCFVNGCD SILLD +PTI
Sbjct  27    LSRDYYDYSCPNALSTIRSVVEAAVQKERRMGASLLRTHFRDCFVNGCDGSILLDPSPTI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK+A+ +  S + F+++D IK  VD+ CG+PVVSCADIL VAARDSVVALGGPTWEV+
Sbjct  87    DSEKSAVPDFQSDKAFKLVDEIKEAVDQACGKPVVSCADILTVAARDSVVALGGPTWEVR  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDST AS+D AN N+P+PF  LS+L  NFK+ GLN KDLVALSGGHT+G A+C TFR
Sbjct  147   LGRRDSTIASRDAANANIPSPFFSLSELISNFKSHGLNEKDLVALSGGHTIGNARCATFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D +I+  FA++ +  CP  GG+S++A LD T A FD+ YF++LV KKGLL SDQ 
Sbjct  207   DHIYNDSNINPHFAKELKYICPREGGDSNIAPLDRTAAQFDSAYFRDLVHKKGLLRSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD LV+ YS N   F  DFAKSMIKMG+IKPLTGN GEIR+NCRRVN
Sbjct  267   LFNGGSTDALVKKYSHNTKVFRQDFAKSMIKMGNIKPLTGNRGEIRLNCRRVN  319



>ref|XP_010256953.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=324

 Score =   393 bits (1010),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 232/297 (78%), Gaps = 4/297 (1%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LSP+FY+ VCPQALPTI+  VE A+K+E RMG SLLRLHFHDCFV+GCDASILLD+   
Sbjct  28    NLSPTFYDKVCPQALPTIKKTVEAAVKKESRMGASLLRLHFHDCFVHGCDASILLDNATG  87

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             I +EK    NNNS RG+ V+D+IK+ VD+VCG PVVSCADILAVAARDSVVALGGPTW+V
Sbjct  88    IQTEKTTPPNNNSVRGYGVVDQIKAAVDKVCGGPVVSCADILAVAARDSVVALGGPTWQV  147

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             +LGRRDS++A  +    +LP P  +LS L  NF   GLNV+DLVALSGGHT+G A+C TF
Sbjct  148   QLGRRDSSSAYANE-TTDLPGPASNLSALITNFNKHGLNVRDLVALSGGHTIGLARCTTF  206

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R  IY D +I   FAR RQA CP +GG+++LA LD T + FD  YFKNL+K+KGLL SDQ
Sbjct  207   RSHIYNDINIHPSFARNRQAICPQSGGDNNLAPLDHTASLFDTVYFKNLLKRKGLLHSDQ  266

Query  332   ALF---AGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF   AG  T+ LV+ YS N GAF++DFA SMIKMG+I+PLTG  G++RVNCR+VN
Sbjct  267   ELFNGAAGSTTNSLVKTYSSNFGAFASDFANSMIKMGNIRPLTGKQGQVRVNCRKVN  323



>gb|KEH29222.1| peroxidase family protein [Medicago truncatula]
Length=321

 Score =   393 bits (1009),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 226/291 (78%), Gaps = 2/291 (1%)
 Frame = -1

Query  1037  FYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEK  858
             +Y++ CP AL TI+ +V+ A+++E RMG SLLRLHFHDCFVNGCD SILLDSTP++DSEK
Sbjct  31    YYDYTCPNALSTIKSVVKAAVQRENRMGASLLRLHFHDCFVNGCDGSILLDSTPSMDSEK  90

Query  857   NALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVKLGRR  678
             NA  N NSARGFEV+D IK  VD+ CG+PVVSCADILA+AARDSVVALGGP+W+VKLGRR
Sbjct  91    NANPNINSARGFEVVDEIKDAVDKACGKPVVSCADILAIAARDSVVALGGPSWKVKLGRR  150

Query  677   DSTTASK-DTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRI  501
             DS TAS+ D  + N+P P   LSQL +NF NQGLN KDLVALSG HT+GF++CF FR RI
Sbjct  151   DSKTASRADADSGNIPGPAFSLSQLIKNFDNQGLNEKDLVALSGAHTIGFSRCFLFRDRI  210

Query  500   YGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSDQALF  324
             Y D +I++ FA+Q Q  CP  GG+S+LA LD  T A FD  Y+  L+KKKGLL SDQ L 
Sbjct  211   YKDNNINAYFAKQLQNVCPREGGDSNLAPLDSVTSAKFDVAYYSQLIKKKGLLHSDQELL  270

Query  323   AGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              GG T  LVR Y R+   F  DFAKSMIKMG+IKPLTG  GE+R NCRR N
Sbjct  271   KGGYTGALVRKYRRDTRTFYKDFAKSMIKMGNIKPLTGKQGEVRYNCRRAN  321



>ref|XP_004514549.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=319

 Score =   390 bits (1002),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 182/293 (62%), Positives = 224/293 (76%), Gaps = 0/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P++Y++ CP AL TI  +V+ A+++E RMG SLLRLHFHDCFVNGCD SILLDSTP++
Sbjct  27    LTPNYYDYTCPNALTTIESVVKAAVQKEHRMGASLLRLHFHDCFVNGCDGSILLDSTPSM  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNA  N  S RGFEV+D IK  VD  CG+PVVSCADILAVAARDS+VALGGP+W V+
Sbjct  87    DSEKNANPNIQSVRGFEVVDEIKQAVDEACGKPVVSCADILAVAARDSIVALGGPSWNVR  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  A+ ++P PF  +SQL +NF N GLN KDLVALSG HT+GF++C  FR
Sbjct  147   LGRRDSKTASRGDADTDIPAPFFSISQLIKNFNNHGLNEKDLVALSGAHTIGFSRCVQFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RI+ D +I+  FA + +  CP  GG+S+LA LD TPA FD  YF +L+K+KG+L SDQ 
Sbjct  207   DRIFNDTNINPYFANKLKHICPRQGGDSNLAPLDVTPAQFDTSYFSDLIKRKGVLHSDQE  266

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L  GG T  LVR Y R+   F  DF KSMIKMG++KPLTG+ GEIR NCR+ N
Sbjct  267   LLNGGYTSALVRKYRRDTKTFYKDFVKSMIKMGNMKPLTGSQGEIRYNCRKAN  319



>ref|XP_003551178.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
 gb|KHN48393.1| Cationic peroxidase 1 [Glycine soja]
Length=322

 Score =   384 bits (987),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/298 (65%), Positives = 226/298 (76%), Gaps = 5/298 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P FYN+VCPQALP I+ +V+ AI +ERR+G SLLRLHFHDCFVNGCD SILLD TP  
Sbjct  25    LTPDFYNNVCPQALPIIKSVVQRAIFRERRIGASLLRLHFHDCFVNGCDGSILLDDTPNF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--WE  696
               EK AL N NS RG EV+D IK+ VDR C RPVVSCADILAVAARDSV  LGG    ++
Sbjct  85    TGEKTALPNINSIRGLEVVDEIKAAVDRACKRPVVSCADILAVAARDSVSILGGSLYWYK  144

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRDS TASKD AN+NLP PF  LSQL  +F++ GL++KDLVALSG HT+GFAQC T
Sbjct  145   VLLGRRDSRTASKDAANSNLPPPFFSLSQLLSSFQSHGLDLKDLVALSGAHTIGFAQCAT  204

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVS  339
             FR RIY D +ID  FA   Q  CP +GG+S+LA LD  +P+  D  Y+ +L+ KKGLL S
Sbjct  205   FRNRIYNDTNIDPNFASSLQGTCPRSGGDSNLAPLDRFSPSRVDTSYYTSLLSKKGLLHS  264

Query  338   DQALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF   GG++D LV+LYSRN  AF+ DF  SMIKMG++KPL GN GEIRVNCR VN
Sbjct  265   DQELFKGDGGESDTLVKLYSRNPFAFARDFKASMIKMGNMKPLIGNAGEIRVNCRSVN  322



>ref|XP_007146854.1| hypothetical protein PHAVU_006G075700g [Phaseolus vulgaris]
 gb|ESW18848.1| hypothetical protein PHAVU_006G075700g [Phaseolus vulgaris]
Length=324

 Score =   383 bits (984),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 225/298 (76%), Gaps = 5/298 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP FYN VCPQALP I+ +V+ AI +ERRMG SLLRLHFHDCFVNGCD S+LLD TP  
Sbjct  27    LSPEFYNMVCPQALPIIKSVVQRAIFRERRMGASLLRLHFHDCFVNGCDGSVLLDDTPNF  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--WE  696
               EK AL N  S RG EV+D IK+ VD+ C RPVVSCADILA+AARDSV  LGG    ++
Sbjct  87    TGEKTALPNIGSIRGLEVVDEIKAAVDKACKRPVVSCADILAIAARDSVSILGGSLYWYK  146

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRD+ TASKD AN+NLP PF  LSQL  +F++ GL++KDLVALSG HT+GFAQC T
Sbjct  147   VPLGRRDARTASKDAANSNLPPPFFSLSQLLSSFQSHGLDLKDLVALSGAHTIGFAQCST  206

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
             FR RIY D +ID  FA   Q+ CP +GG+S+LA LD  TP+  D  Y+  L+++KGLL S
Sbjct  207   FRNRIYNDTNIDPNFASSLQSTCPKSGGDSNLAPLDRVTPSRVDTSYYTALLRQKGLLHS  266

Query  338   DQALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF   G ++D LV+LYS N  AF+ DF  SMIKMG++KPLTGN GEIRVNCRRVN
Sbjct  267   DQELFKGDGSESDSLVKLYSSNPFAFARDFKASMIKMGNMKPLTGNAGEIRVNCRRVN  324



>ref|XP_003522104.1| PREDICTED: peroxidase 2-like [Glycine max]
Length=325

 Score =   382 bits (980),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 225/295 (76%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP++Y   CP AL  I+ IVE A+++E RMG SLLRLHFHDCFVNGCD SILLDS+PTI
Sbjct  31    LSPNYYEFSCPNALTAIQIIVEAAVQKEPRMGASLLRLHFHDCFVNGCDGSILLDSSPTI  90

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEK+AL N NS RGFEV+D IK  VD  CG+P+VSCADILAVAARDSVV LGGPTWEV+
Sbjct  91    DSEKDALPNINSVRGFEVVDDIKKAVDEACGQPIVSCADILAVAARDSVVTLGGPTWEVQ  150

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTASK+ AN NLP P  DLS+L  NF N  L+VKDLV LSG HT+GF+ C  F+
Sbjct  151   LGRRDSTTASKEAANANLPAPSFDLSELINNFNNHSLDVKDLVVLSGAHTIGFSFCKFFK  210

Query  509   QRIYGDKDIDSKFARQRQANCPMNG-GNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSD  336
              R+Y D +I+  +A+Q +  CP++G G+ +L  LD T P  F+ +YF +L + KGLL SD
Sbjct  211   DRVYNDTNINPIYAQQLRNICPIDGSGDFNLGPLDQTSPLLFNLQYFSDLFQYKGLLHSD  270

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF GG TD +V  YS ++ AF  DFA SMIKMG+I+PLTG  GEIRVNCR VN
Sbjct  271   QELFNGGCTDAMVERYSYDYIAFFQDFANSMIKMGNIQPLTGTQGEIRVNCRVVN  325



>gb|KHN44823.1| Peroxidase 52 [Glycine soja]
Length=263

 Score =   376 bits (965),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 182/263 (69%), Positives = 210/263 (80%), Gaps = 0/263 (0%)
 Frame = -1

Query  959  MGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEKNALANNNSARGFEVIDRIKSEVDRVC  780
            MG SLLRLHFHDCFVNGCD SILLD + TIDSEKNAL N  SARGFEV+D IK  VD  C
Sbjct  1    MGASLLRLHFHDCFVNGCDGSILLDPSSTIDSEKNALPNFQSARGFEVVDEIKEAVDEAC  60

Query  779  GRPVVSCADILAVAARDSVVALGGPTWEVKLGRRDSTTASKDTANNNLPNPFMDLSQLTE  600
            G+PVVSCADILAVAARDSVVALGGP+W+V+LGRRDSTTAS++ AN N+P PF  LS+L  
Sbjct  61   GKPVVSCADILAVAARDSVVALGGPSWKVRLGRRDSTTASREAANANIPAPFFSLSELIN  120

Query  599  NFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRIYGDKDIDSKFARQRQANCPMNGGNSSL  420
            NFK+ GLN +DLVALSGGHT+G A+C TFR  IY D +I+  FA++ +  CP  GG+S+L
Sbjct  121  NFKSHGLNERDLVALSGGHTIGNARCATFRDHIYNDSNINPHFAKELKHICPREGGDSNL  180

Query  419  ASLDPTPAYFDAKYFKNLVKKKGLLVSDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMI  240
            A LD + A FD+ YF +LV KKGLL SDQ LF GG TD LV++YS N   F  DFAKSMI
Sbjct  181  APLDRSAARFDSAYFSDLVHKKGLLHSDQELFNGGSTDALVKIYSHNTKGFHKDFAKSMI  240

Query  239  KMGDIKPLTGNNGEIRVNCRRVN  171
            KMG+IKPLTGN GEIR+NCRRVN
Sbjct  241  KMGNIKPLTGNRGEIRLNCRRVN  263



>ref|XP_007142067.1| hypothetical protein PHAVU_008G249700g [Phaseolus vulgaris]
 gb|ESW14061.1| hypothetical protein PHAVU_008G249700g [Phaseolus vulgaris]
Length=332

 Score =   378 bits (971),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 223/298 (75%), Gaps = 4/298 (1%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LS  FY+ VCPQALP IR +V+ AI +E R+G SLLRLHFHDCFVNGCD SILLD T  
Sbjct  35    NLSSHFYDKVCPQALPVIRTVVQRAINREPRIGASLLRLHFHDCFVNGCDGSILLDDTKN  94

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--W  699
                EK A ANNNSARGF V+D IK+ VD+ C RPVVSCADILA+AARDSV   GG    +
Sbjct  95    FIGEKTAFANNNSARGFSVVDEIKAAVDKACKRPVVSCADILAIAARDSVAIYGGKHFWY  154

Query  698   EVKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCF  519
             +V LGRRD+ TAS+  AN+NLP P    SQL  NF++ GLNVKDLVALSGGHT+GFA+C 
Sbjct  155   QVLLGRRDARTASRSAANSNLPPPTFSFSQLVSNFQSHGLNVKDLVALSGGHTIGFARCT  214

Query  518   TFRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVS  339
             TFR RIY + +ID +FA   +  CP +GG+++L  LDPTPA  D KYF +LV KKGLL S
Sbjct  215   TFRNRIYNESNIDPRFAASLRNTCPRSGGDNNLQKLDPTPARVDTKYFTDLVHKKGLLHS  274

Query  338   DQALFAGG--QTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF G   ++D LV+LYS+N  AF+ DF  SMIKMG++KPLTG  GEIR +CRR+N
Sbjct  275   DQELFKGQGRESDKLVQLYSKNTLAFARDFKASMIKMGNLKPLTGRQGEIRCHCRRIN  332



>gb|KHN46627.1| Peroxidase 4 [Glycine soja]
Length=305

 Score =   377 bits (967),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 216/297 (73%), Gaps = 4/297 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P+FY  VCPQALP IR +V   I +ERR+G SLLRLHFHDCFVNGCD S+LLD T   
Sbjct  8     LTPNFYKKVCPQALPIIRSVVHREIIRERRIGASLLRLHFHDCFVNGCDGSVLLDDTRNF  67

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGP--TWE  696
               EK AL N NS RG EV+D IK  VD+ C RPVVSCADILA AARDSV  LGGP   + 
Sbjct  68    TGEKTALPNLNSIRGLEVVDEIKEAVDKACKRPVVSCADILATAARDSVAILGGPHLRYS  127

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRD+ TASKD AN NLP PF   SQL  NFK  GL++KDLVALSGGHTLGFA+C T
Sbjct  128   VLLGRRDARTASKDAANANLPPPFFSFSQLLSNFKFHGLDLKDLVALSGGHTLGFARCTT  187

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             FR RIY D +I+  FA   +  CP  G +++LA LDPTPA  D  YFK L+ KKGLL SD
Sbjct  188   FRDRIYNDTNINPTFAASLRKTCPRVGADNNLAPLDPTPATVDTSYFKELLCKKGLLHSD  247

Query  335   QALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q L+   G ++D LV LYSRN  AF+ DF  SMIKMG++KPLTGN GEIR NCRRVN
Sbjct  248   QELYKGNGSESDKLVELYSRNPFAFARDFKASMIKMGNMKPLTGNKGEIRRNCRRVN  304



>ref|NP_001242396.1| uncharacterized protein LOC100812163 precursor [Glycine max]
 gb|ACU21160.1| unknown [Glycine max]
Length=324

 Score =   377 bits (967),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 215/297 (72%), Gaps = 4/297 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P+FY  VCPQALP IR +V   I +ERR+G SLLRLHFHDCFVNGCD S+LLD T   
Sbjct  27    LTPNFYKKVCPQALPIIRSVVHREIIRERRIGASLLRLHFHDCFVNGCDGSVLLDDTRNF  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGP--TWE  696
               EK AL N NS RG EV+D IK  VD+ C RPVVSCADILA AARDSV  LGGP   + 
Sbjct  87    TGEKTALPNLNSIRGLEVVDEIKEAVDKACKRPVVSCADILATAARDSVAILGGPHLRYS  146

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRD+ TASKD AN NLP PF   SQL  NFK  GL++KDLVALSGGHTLGFA+C T
Sbjct  147   VLLGRRDARTASKDAANANLPPPFFSFSQLLSNFKFHGLDLKDLVALSGGHTLGFARCTT  206

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             FR RIY D +I+  FA   +  CP  G  ++LA LDPTPA  D  YFK L+ KKGLL SD
Sbjct  207   FRDRIYNDTNINPTFAASLRKTCPRVGAGNNLAPLDPTPATVDTSYFKELLCKKGLLHSD  266

Query  335   QALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q L+   G ++D LV LYSRN  AF+ DF  SMIKMG++KPLTGN GEIR NCRRVN
Sbjct  267   QELYKGNGSESDKLVELYSRNPFAFARDFKASMIKMGNMKPLTGNKGEIRRNCRRVN  323



>gb|AFK40000.1| unknown [Lotus japonicus]
Length=323

 Score =   377 bits (967),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/297 (62%), Positives = 223/297 (75%), Gaps = 4/297 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSPSFYN VCPQALP I  +V  AI +ERR+G SLLRLHFHDCFVNGCD S+LLD T   
Sbjct  27    LSPSFYNKVCPQALPVINSVVRRAILRERRIGASLLRLHFHDCFVNGCDGSVLLDDTRNF  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--WE  696
               EK A  NNNS RGF+V+D IK  VD+ C RPVVSCADILA+AARDSV  LGGP+  ++
Sbjct  87    IGEKTAFPNNNSIRGFDVVDEIKKAVDKACKRPVVSCADILAIAARDSVAILGGPSLVYK  146

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRD+ TAS+  AN+NLP P   LSQLT NFK+ GLNV+DLVALSGGHT+GFA+C T
Sbjct  147   VLLGRRDARTASRAAANSNLPPPTFSLSQLTSNFKSHGLNVRDLVALSGGHTIGFARCTT  206

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             FR R Y + +IDS FA   +  CP  GG+++LA+LD T A  D +Y+  L++KKGLL SD
Sbjct  207   FRNRAYNETNIDSNFAASLRKQCPRRGGDNNLATLDATTARVDTRYYSALLQKKGLLHSD  266

Query  335   QALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF   G ++D LV+LYSR+  AF+ DF  SMIKMG++K LTG  GE+R NCR++N
Sbjct  267   QELFKGQGSESDKLVKLYSRSSLAFARDFKASMIKMGNLKLLTGRQGEVRRNCRKIN  323



>gb|KHN44819.1| Cationic peroxidase 1 [Glycine soja]
Length=263

 Score =   374 bits (959),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 179/263 (68%), Positives = 210/263 (80%), Gaps = 0/263 (0%)
 Frame = -1

Query  959  MGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEKNALANNNSARGFEVIDRIKSEVDRVC  780
            MG SLLRLHFHDCFVNGCD S+LLDST +IDSEKNA AN  SARGFEV+D IK  VD+ C
Sbjct  1    MGASLLRLHFHDCFVNGCDGSVLLDSTSSIDSEKNAAANFQSARGFEVVDDIKKAVDQAC  60

Query  779  GRPVVSCADILAVAARDSVVALGGPTWEVKLGRRDSTTASKDTANNNLPNPFMDLSQLTE  600
            G+PVVSCADILAVAARDSVVALGGP+W+V LGRRDSTTAS++ A+ ++P PF  LS L  
Sbjct  61   GKPVVSCADILAVAARDSVVALGGPSWKVSLGRRDSTTASREAADASIPAPFFSLSDLIT  120

Query  599  NFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRIYGDKDIDSKFARQRQANCPMNGGNSSL  420
            NFKN GL+ KDLV LSGGH++G+A+C TFR  IY D +ID+ FA+Q +  CP NGG+S+L
Sbjct  121  NFKNHGLDEKDLVVLSGGHSIGYARCVTFRDHIYNDSNIDANFAKQLKYICPTNGGDSNL  180

Query  419  ASLDPTPAYFDAKYFKNLVKKKGLLVSDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMI  240
            + LD T A FD  Y+ NLV+KKGLL SDQ LF GG TD+LV+ YS +   F  DFA SMI
Sbjct  181  SPLDSTAANFDVTYYSNLVQKKGLLHSDQELFNGGSTDELVKEYSDDTEDFYEDFANSMI  240

Query  239  KMGDIKPLTGNNGEIRVNCRRVN  171
            KMG+I+PLTGN GEIRVNCR VN
Sbjct  241  KMGNIQPLTGNQGEIRVNCRNVN  263



>gb|KHN33216.1| Cationic peroxidase 1 [Glycine soja]
Length=263

 Score =   374 bits (959),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 180/263 (68%), Positives = 210/263 (80%), Gaps = 0/263 (0%)
 Frame = -1

Query  959  MGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEKNALANNNSARGFEVIDRIKSEVDRVC  780
            MG SLLRLHFHDCFVNGCD SILLDST +IDSEKNA AN  SARGFEV+D IK  VD  C
Sbjct  1    MGASLLRLHFHDCFVNGCDGSILLDSTSSIDSEKNAAANLQSARGFEVVDDIKKAVDEAC  60

Query  779  GRPVVSCADILAVAARDSVVALGGPTWEVKLGRRDSTTASKDTANNNLPNPFMDLSQLTE  600
            G+PVVSCADILAVAARDSVVALGGP+W+V+LGRRDSTTAS++ A+ ++P PF  LS+L  
Sbjct  61   GKPVVSCADILAVAARDSVVALGGPSWKVRLGRRDSTTASREAADASIPAPFFSLSELIT  120

Query  599  NFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRIYGDKDIDSKFARQRQANCPMNGGNSSL  420
            NFKN GL+ KDLV LSGGH++GFA+C TF+  IY D +ID  FA+Q +  CP NGG+S+L
Sbjct  121  NFKNHGLDEKDLVVLSGGHSIGFARCVTFKDHIYNDSNIDPHFAQQLKYICPTNGGDSNL  180

Query  419  ASLDPTPAYFDAKYFKNLVKKKGLLVSDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMI  240
            + LD T A FD  Y+ NLV+KKGLL SDQ LF GG TD+LV+ YS +   F  DFA SMI
Sbjct  181  SPLDSTAAKFDINYYSNLVQKKGLLHSDQELFNGGSTDELVKEYSDDTEDFYEDFANSMI  240

Query  239  KMGDIKPLTGNNGEIRVNCRRVN  171
            KMG+I+PLTGN GEIRVNCR VN
Sbjct  241  KMGNIQPLTGNQGEIRVNCRNVN  263



>gb|KHN33220.1| Cationic peroxidase 1 [Glycine soja]
Length=263

 Score =   372 bits (956),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/263 (68%), Positives = 210/263 (80%), Gaps = 0/263 (0%)
 Frame = -1

Query  959  MGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEKNALANNNSARGFEVIDRIKSEVDRVC  780
            MG SLLRLHFHDCFVNGCD SILLDST +IDSEKNA AN  SARGFEV+D IK  VD  C
Sbjct  1    MGASLLRLHFHDCFVNGCDGSILLDSTSSIDSEKNAAANLQSARGFEVVDDIKKAVDEAC  60

Query  779  GRPVVSCADILAVAARDSVVALGGPTWEVKLGRRDSTTASKDTANNNLPNPFMDLSQLTE  600
            G+PVVSCADILAVAARDSVVALGGP+W+V+LGRRDSTTAS++ A+ ++P PF  LS+L  
Sbjct  61   GKPVVSCADILAVAARDSVVALGGPSWKVRLGRRDSTTASREAADASIPAPFFSLSELIT  120

Query  599  NFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRIYGDKDIDSKFARQRQANCPMNGGNSSL  420
            NFKN GL+ KDLV LSGGH++GFA+C TF+  IY D +ID  FA+Q +  CP NGG+S+L
Sbjct  121  NFKNHGLDEKDLVVLSGGHSIGFARCVTFKDHIYNDSNIDPNFAQQLRYICPTNGGDSNL  180

Query  419  ASLDPTPAYFDAKYFKNLVKKKGLLVSDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMI  240
            + LD T A FD  Y+ NLV+KKGLL SDQ LF GG TD+LV+ YS +   F  DFA SMI
Sbjct  181  SPLDSTAAKFDINYYSNLVQKKGLLHSDQELFNGGSTDELVKEYSDDTEDFYEDFANSMI  240

Query  239  KMGDIKPLTGNNGEIRVNCRRVN  171
            KMG+I+PLTGN GEIRVNCR VN
Sbjct  241  KMGNIQPLTGNQGEIRVNCRNVN  263



>ref|NP_001241243.1| uncharacterized protein LOC100816056 precursor [Glycine max]
 gb|ACU20213.1| unknown [Glycine max]
 gb|KHN48394.1| Peroxidase 4 [Glycine soja]
Length=325

 Score =   374 bits (960),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 220/299 (74%), Gaps = 6/299 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P+FY  VCPQALP IR +V  AI +ERR+G SLLRLHFHDCFVNGCD S+LLD T   
Sbjct  27    LTPNFYKKVCPQALPIIRSVVHRAIIRERRIGASLLRLHFHDCFVNGCDGSVLLDDTHNF  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGP--TWE  696
               EK AL N NS RG EV+D IK+ VD+ C RP VSCADILA+AARDSV  LGGP   + 
Sbjct  87    TGEKTALPNLNSIRGLEVVDEIKAAVDKACNRPAVSCADILAIAARDSVAILGGPHLWYG  146

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRD+ TASKD AN NLP PF + SQL  NF + GL++KDLVALSGGHT+GFA+C T
Sbjct  147   VLLGRRDARTASKDAANANLPPPFFNFSQLLSNFNSHGLDLKDLVALSGGHTIGFARCTT  206

Query  515   FRQRIYGDK--DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLV  342
             FR RIY D   +I+  FA   +  CP  GG+++LA LDPTPA  D  YFK L+ KKGLL 
Sbjct  207   FRDRIYNDTMANINPTFAASLRKTCPRVGGDNNLAPLDPTPATVDTSYFKELLCKKGLLH  266

Query  341   SDQALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             SDQ L+   G ++D LV LYSRN  AF+ DF  SMIKMG++KPLTGN GEIR NCRRVN
Sbjct  267   SDQELYKGNGSESDKLVELYSRNPFAFARDFKASMIKMGNMKPLTGNKGEIRRNCRRVN  325



>ref|XP_007146855.1| hypothetical protein PHAVU_006G075800g [Phaseolus vulgaris]
 gb|ESW18849.1| hypothetical protein PHAVU_006G075800g [Phaseolus vulgaris]
Length=323

 Score =   373 bits (958),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 221/297 (74%), Gaps = 4/297 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P+FY+ VCP+ALP IR +V+ AI +ERR+G SLLRLHFHDCFVNGCD S+LLD T   
Sbjct  27    LTPNFYDKVCPKALPIIRSLVQQAINRERRIGASLLRLHFHDCFVNGCDGSVLLDDTKKF  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--WE  696
               EK AL N NS RGFEV+D IK+ VD+ C   VVSCADILA AARDSV  LGGP   + 
Sbjct  87    IGEKTALPNLNSIRGFEVVDEIKAAVDKACKGHVVSCADILATAARDSVAILGGPNLWYS  146

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRD+ +ASKD AN NLP PF   SQL  NFK+ G+N+KDLVALSGGHT+G A+C T
Sbjct  147   VLLGRRDARSASKDAANANLPPPFFSFSQLLTNFKSHGMNLKDLVALSGGHTIGSARCGT  206

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             FR RIY D +I+  FA   +  CP  GG+S+LA LDPTP+  D  Y+K L+ KKGLL SD
Sbjct  207   FRDRIYNDTNINPSFAASLRRTCPRVGGDSNLAPLDPTPSSVDTSYYKELLCKKGLLHSD  266

Query  335   QALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q L+   G ++D LV+LYS N  AF+NDF  SMIKMG++KPLTG NGEIR NCRR+N
Sbjct  267   QELYKGDGSESDKLVKLYSMNPSAFANDFKDSMIKMGNLKPLTGRNGEIRRNCRRIN  323



>ref|XP_004149369.1| PREDICTED: cationic peroxidase 1-like [Cucumis sativus]
 ref|XP_004173237.1| PREDICTED: cationic peroxidase 1-like [Cucumis sativus]
 gb|KGN47226.1| hypothetical protein Csa_6G216940 [Cucumis sativus]
Length=320

 Score =   373 bits (958),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 218/295 (74%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P+FYN+VCP+AL TI+ +V  AI++E RMG SLLRLHFHDCFVNGCD S+LLD T T 
Sbjct  26    LTPNFYNNVCPRALSTIKSVVSKAIRREPRMGASLLRLHFHDCFVNGCDGSVLLDDTATF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGF+V+D+IK++V++VC   VVSCADILAVAARDSV  LGGP ++V 
Sbjct  86    TGEKTAFPNANSIRGFDVVDQIKTQVNKVCKENVVSCADILAVAARDSVAILGGPNYKVL  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             +GRRD+ TAS + AN NLP PF   SQL  NF++ GL +KDLV LS GHTLG A+C +FR
Sbjct  146   VGRRDARTASANDANRNLPPPFFSFSQLLSNFQSHGLELKDLVLLSAGHTLGLARCTSFR  205

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +IDSKFA   Q NCP +GG+ +L  LD +P +FD  YFK L+  KGLL SDQ 
Sbjct  206   SRIYNDTNIDSKFATTLQKNCPQSGGDDNLKGLDKSPNFFDNAYFKALLTNKGLLHSDQE  265

Query  329   LFAGGQ--TDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG   +DDLV+ YSR    F  DF  SMIKMG++ PLTG NGEIR NCR VN
Sbjct  266   LFGGGNNDSDDLVKYYSRYPNDFKKDFGSSMIKMGNMNPLTGTNGEIRTNCRFVN  320



>ref|XP_003615990.1| Peroxidase [Medicago truncatula]
 gb|AAB48986.1| peroxidase precursor [Medicago truncatula]
 gb|AES98948.1| peroxidase family protein [Medicago truncatula]
Length=325

 Score =   373 bits (958),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 224/296 (76%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P FY++VCPQALPTI+ +V  AI +E+R+G SLLRLHFHDCFVNGCD S+LLD TP  
Sbjct  29    LTPHFYDNVCPQALPTIKSVVLHAILREKRIGASLLRLHFHDCFVNGCDGSVLLDDTPNF  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--WE  696
               EK AL N NS RGF V+D IK+ VD+VC  PVVSCADILA AARDSV  LGGP   + 
Sbjct  89    TGEKTALPNINSIRGFSVVDEIKAAVDKVCKGPVVSCADILATAARDSVAILGGPQFFYN  148

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRD+ TASK  AN NLP+P  + SQL  NFK+QGLNVKDLVALSGGHT+GFA+C T
Sbjct  149   VLLGRRDARTASKAAANANLPSPTFNFSQLISNFKSQGLNVKDLVALSGGHTIGFARCTT  208

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             FR RIY + +ID  FA   +  CP NGG+++L  LD TP   +  Y+++L+ K+G+L SD
Sbjct  209   FRNRIYNETNIDPIFAASLRKTCPRNGGDNNLTPLDFTPTRVENTYYRDLLYKRGVLHSD  268

Query  335   QALF--AGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRV  174
             Q LF   G ++D LV+LYS+N  AF++DF  S+IKMG+IKPLTG  GEIR+NCRRV
Sbjct  269   QQLFKGQGSESDKLVQLYSKNTFAFASDFKTSLIKMGNIKPLTGRQGEIRLNCRRV  324



>gb|KHN33221.1| Cationic peroxidase 1 [Glycine soja]
Length=265

 Score =   370 bits (951),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 179/265 (68%), Positives = 207/265 (78%), Gaps = 0/265 (0%)
 Frame = -1

Query  959  MGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEKNALANNNSARGFEVIDRIKSEVDRVC  780
            MG SLLRLHFHDCFVNGCD SILLD +PTIDSEKNA AN  S RGFEV+D IK  VD  C
Sbjct  1    MGASLLRLHFHDCFVNGCDGSILLDPSPTIDSEKNAFANFQSVRGFEVVDDIKQAVDEAC  60

Query  779  GRPVVSCADILAVAARDSVVALGGPTWEVKLGRRDSTTASKDTANNNLPNPFMDLSQLTE  600
            G PVVSCADILAV ARDSVVALGGPTWEV+LGRRDSTTASK+ A+ N+P PF  LSQL  
Sbjct  61   GTPVVSCADILAVVARDSVVALGGPTWEVQLGRRDSTTASKEAADANIPAPFFSLSQLIT  120

Query  599  NFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRIYGDKDIDSKFARQRQANCPMNGGNSSL  420
            NFKN GL+ KDLV LSGGHT+G+A+C TF+  IY D +ID  FA+  +  CP NGG+ +L
Sbjct  121  NFKNHGLDEKDLVVLSGGHTIGYARCVTFKDHIYNDSNIDPNFAQYLKYICPRNGGDLNL  180

Query  419  ASLDPTPAYFDAKYFKNLVKKKGLLVSDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMI  240
            A LD T A FD  Y+ NLV+K GLL SDQ LF GG TD+LV+ YS +  AF  +FA SM+
Sbjct  181  APLDSTAANFDLNYYSNLVQKNGLLHSDQELFNGGSTDELVKQYSYDTEAFYVEFANSMV  240

Query  239  KMGDIKPLTGNNGEIRVNCRRVNYY  165
            KMG+I+PLTG+ GEIRV+CR+VN Y
Sbjct  241  KMGNIQPLTGDQGEIRVSCRKVNNY  265



>ref|XP_008463818.1| PREDICTED: cationic peroxidase 1-like [Cucumis melo]
Length=369

 Score =   374 bits (961),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 218/295 (74%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+  FYN+VCP+AL TI+ +V  AIK+E RMG SLLRLHFHDCFVNGCD S+LLD T   
Sbjct  75    LTQDFYNNVCPKALSTIKSVVSKAIKREPRMGASLLRLHFHDCFVNGCDGSVLLDDTTNF  134

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A AN NS RGFEV+D+IK++VDRVC   VVSCADILA+AARDSV  LGGP ++V 
Sbjct  135   TGEKTAPANANSIRGFEVVDQIKTQVDRVCKGNVVSCADILAIAARDSVSILGGPKYKVL  194

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             +GRRD+ TAS D A  NLP PF   +QL  NF++ GL++KDLV LS GHTLG A+C TFR
Sbjct  195   VGRRDARTASFDNARRNLPPPFFSFTQLLSNFQSHGLDLKDLVVLSAGHTLGVARCSTFR  254

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +ID+KFA   Q NCP +GG+ +L  LD TP +FD  YFK L+  KGLL SDQ 
Sbjct  255   TRIYNDTNIDTKFATTLQRNCPQSGGDDNLKGLDKTPNFFDNAYFKALLTNKGLLHSDQE  314

Query  329   LFAGGQ--TDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG   +DDLV+ YSR   AF NDF  SMIKMG++ PLTG +GEIR NCR VN
Sbjct  315   LFGGGNSDSDDLVKYYSRYPSAFRNDFGSSMIKMGNMNPLTGTDGEIRANCRLVN  369



>emb|CDP16309.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   371 bits (952),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/297 (62%), Positives = 226/297 (76%), Gaps = 5/297 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY+  CP+AL TIR  +  A+ +ERRM  SL+RLHFHDCFV GCD S+LLD T TI
Sbjct  27    LSPTFYDATCPRALDTIRTSIRRAVSRERRMAASLIRLHFHDCFVQGCDGSVLLDQTSTI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              SEK ALANNNSARGFEVI+  K EV+++C   VVSCADIL+VAARD+ VA+GGPTW+VK
Sbjct  87    QSEKTALANNNSARGFEVIEAAKLEVEKICP-GVVSCADILSVAARDASVAVGGPTWQVK  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  A++NLP+PF +L  L   F+N+GL+ +D+VALSG HT+G AQCF FR
Sbjct  146   LGRRDSTTASRSAADSNLPSPFANLGDLITKFQNKGLSPRDMVALSGSHTIGQAQCFVFR  205

Query  509   QRIYGD-KDIDSKFARQRQANCP--MNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLV  342
              R+Y +  DID+ FA  R+  CP  +  G+S+LA LD  TP  FD  YFKNL++KKGLL+
Sbjct  206   NRVYSNGTDIDAGFASTRRRQCPSAIGNGDSNLAPLDLVTPNSFDNNYFKNLMRKKGLLI  265

Query  341   SDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             SDQ LF+GG TD +V  YSRN G F  DFA +M+KMGDI+PLTG +G IR  C  VN
Sbjct  266   SDQVLFSGGSTDSIVAEYSRNPGTFLADFASAMVKMGDIEPLTGTSGIIRKVCSAVN  322



>ref|XP_003615976.1| Peroxidase [Medicago truncatula]
 gb|AES98934.1| peroxidase family protein [Medicago truncatula]
Length=323

 Score =   370 bits (951),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 181/297 (61%), Positives = 223/297 (75%), Gaps = 4/297 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS ++Y+ +CPQALP I+ +V+ AI +E RMG SLLRLHFHDCFVNGCD SILLD TPT 
Sbjct  25    LSSNYYDEICPQALPIIKSVVKQAIIREPRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--WE  696
               EK A+ N NS RGFEV+D+IK+ VD+ C RP++SCADILA+AARDSV  LGG    ++
Sbjct  85    IGEKTAIPNINSLRGFEVVDQIKAAVDKACKRPIISCADILAIAARDSVAILGGHKYWYQ  144

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRDS  AS+D AN NLP  F + SQL  NF++QGLN+KDLV LSGGHT+GF++C  
Sbjct  145   VLLGRRDSRFASRDAANINLPPAFFNFSQLIANFQSQGLNLKDLVVLSGGHTIGFSRCTN  204

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             FR RI+ D +I++ FA   Q  CP  GG+ +LA  D TP+  D KY+K L+ KKGLL SD
Sbjct  205   FRSRIFNDTNINTNFAANLQKTCPRIGGDDNLAPFDSTPSRVDTKYYKALLHKKGLLHSD  264

Query  335   QALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF   G Q+D LV+LYS++  AF+ DF  SMIKMG+IKPLTG NGEIR NCR+VN
Sbjct  265   QELFKGDGSQSDRLVQLYSKHSHAFAYDFGVSMIKMGNIKPLTGKNGEIRCNCRKVN  321



>ref|XP_007142068.1| hypothetical protein PHAVU_008G249800g [Phaseolus vulgaris]
 gb|ESW14062.1| hypothetical protein PHAVU_008G249800g [Phaseolus vulgaris]
Length=324

 Score =   370 bits (949),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 183/297 (62%), Positives = 219/297 (74%), Gaps = 4/297 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP +Y+ +CP+ALP I  +V+ AI  E+RMG SLLRLHFHDCFVNGCD S+LLD TP  
Sbjct  28    LSPDYYDKLCPEALPIIYSVVKKAIVAEKRMGASLLRLHFHDCFVNGCDGSVLLDDTPFF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--WE  696
               EK A AN NS RGFEV+D IK+ VD+VC RPVVSCADILAVAARDSV  LGG    +E
Sbjct  88    LGEKTAFANLNSIRGFEVVDEIKAAVDKVCKRPVVSCADILAVAARDSVAILGGKQYWYE  147

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRD+  AS+D AN NLP PF +  QL  NF+  GLN+KDLV LSGGHT+G A+C T
Sbjct  148   VLLGRRDARKASRDAANANLPPPFFNFQQLLANFQTHGLNLKDLVVLSGGHTIGLARCTT  207

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             FR RI+ D +ID KFA   + +CP  GG+SSLA LD T + FD  Y+  L+ KKGLL SD
Sbjct  208   FRDRIFNDTNIDPKFAATLRKSCPRRGGDSSLAPLDATSSKFDITYYNALLYKKGLLHSD  267

Query  335   QALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF   G ++D LV+LYS +  AF+ DF  SMIKMG++KPLTG+ GEIR NCR+VN
Sbjct  268   QELFKGDGSESDRLVQLYSNDPYAFAKDFGVSMIKMGNLKPLTGSYGEIRYNCRKVN  324



>ref|XP_003519282.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=323

 Score =   369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 186/301 (62%), Positives = 218/301 (72%), Gaps = 7/301 (2%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LSP FY+ VCPQALP I+ +V+ AI +ERR+G SLLRLHFHDCFVNGCD SILLD T  
Sbjct  23    NLSPHFYDKVCPQALPVIKSVVQRAIIRERRIGASLLRLHFHDCFVNGCDGSILLDDTRN  82

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGP--TW  699
                EK AL N NS RGF V+D IK  VD+ C RPVVSCADILA+AARDSV   GGP   +
Sbjct  83    FTGEKTALPNLNSVRGFSVVDEIKEAVDKACKRPVVSCADILAIAARDSVAIYGGPHYWY  142

Query  698   EVKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCF  519
             +V LGRRD+ TASK  AN+NLP P    SQL  NFK+ GLNV+DLVALSGGHTLGFA+C 
Sbjct  143   QVLLGRRDARTASKAAANSNLPPPSFSFSQLVSNFKSHGLNVRDLVALSGGHTLGFARCS  202

Query  518   TFRQRIYGDKD---IDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGL  348
             TFR RIY   +   ID KFA   +  CP +GG+++L   D TPA  D  Y+ NL+ KKGL
Sbjct  203   TFRNRIYNASNNNIIDPKFAASSRKTCPRSGGDNNLHPFDATPARVDTAYYTNLLHKKGL  262

Query  347   LVSDQALF--AGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRV  174
             L SDQ LF   G ++D LV+LYSR+   F+ DF  SMIKMG++KPLTG  GEIR NCRRV
Sbjct  263   LHSDQELFKGKGTESDKLVQLYSRSPLVFATDFKASMIKMGNMKPLTGKKGEIRCNCRRV  322

Query  173   N  171
             N
Sbjct  323   N  323



>ref|XP_003615981.1| Peroxidase [Medicago truncatula]
 gb|AES98939.1| peroxidase family protein [Medicago truncatula]
Length=323

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/297 (61%), Positives = 220/297 (74%), Gaps = 4/297 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P++Y+ +CP+ALP I+ IV+ AI +E RMG SLLRLHFHDCFVNGCD S+LLD TPT 
Sbjct  25    LTPNYYDRICPKALPVIKSIVKQAIIREPRMGASLLRLHFHDCFVNGCDGSVLLDDTPTF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--WE  696
               EK A  N NS RGFEV+D+IK+ V + C R VVSCADILA+AARDSV  LGG    ++
Sbjct  85    IGEKTAFPNINSIRGFEVVDQIKAAVTKACKRDVVSCADILAIAARDSVAILGGKQYWYQ  144

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRDS  AS+D AN NLP PF + SQL  NFK+ GLN+KDLV LSGGHT+GF++C  
Sbjct  145   VLLGRRDSRFASRDAANTNLPPPFFNFSQLITNFKSHGLNLKDLVVLSGGHTIGFSKCTN  204

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             FR RIY D ++D+ FA   Q  CP  GG+ +LA  D TP+  D KY+K L+ K+GLL SD
Sbjct  205   FRNRIYNDTNLDTNFAANLQKTCPKIGGDDNLAPFDSTPSRVDTKYYKALLNKQGLLHSD  264

Query  335   QALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF   G Q+D LV+LYS+N  AF+ DF  SMIKMG++KPLTG  GEIR NCR+VN
Sbjct  265   QELFKGDGSQSDRLVQLYSKNSYAFAYDFGVSMIKMGNLKPLTGKKGEIRCNCRKVN  321



>ref|XP_010264470.1| PREDICTED: peroxidase P7-like [Nelumbo nucifera]
Length=319

 Score =   369 bits (946),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 214/295 (73%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L P FY+ VCPQALPTIR IVE AI++E RMG SLLRLHFHDCFVNGCD S+LLD TP  
Sbjct  25    LVPDFYDQVCPQALPTIRTIVEQAIEREPRMGASLLRLHFHDCFVNGCDGSVLLDDTPDF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGFEV+D IK+ VD VC   VVSCADILAVAARDSV  LGGP+++V 
Sbjct  85    IGEKTANPNNNSIRGFEVVDEIKAAVDSVCYGNVVSCADILAVAARDSVATLGGPSYQVL  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             +GRRDS TAS+D ANNN+P PF D   L   F  QGL+++DLV LSGGHT+G A+CF+FR
Sbjct  145   VGRRDSRTASRDDANNNIPAPFQDFQDLLSKFNQQGLSLEDLVVLSGGHTIGLARCFSFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +IDS FA   +  CP +GG+     LD T A FD  YF  L++ KGLL SDQ 
Sbjct  205   DRIYNDTNIDSGFAGYLRTICPQSGGDDVTQPLDDTTADFDTVYFSKLLQTKGLLHSDQQ  264

Query  329   LFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF   G  +D LVR YS N  AF  DF  +MIKMG+IKPLTG +GEIR+NCR+ N
Sbjct  265   LFKGDGSASDGLVRYYSNNPQAFWADFGVAMIKMGNIKPLTGTDGEIRMNCRKRN  319



>gb|KHN46098.1| Peroxidase 4 [Glycine soja]
Length=323

 Score =   369 bits (946),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 186/301 (62%), Positives = 218/301 (72%), Gaps = 7/301 (2%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LSP FY+ VCPQALP I+ +V+ AI +ERR+G SLLRLHFHDCFVNGCD SILLD T  
Sbjct  23    NLSPHFYDKVCPQALPVIKSVVQRAIIRERRIGASLLRLHFHDCFVNGCDGSILLDDTRN  82

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGP--TW  699
                EK AL N NS RGF V+D IK  VD+ C RPVVSCADILA+AARDSV   GGP   +
Sbjct  83    FTGEKTALPNLNSVRGFSVVDEIKEAVDKACKRPVVSCADILAIAARDSVAIYGGPHYWY  142

Query  698   EVKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCF  519
             +V LGRRD+ TASK  AN+NLP P    SQL  NFK+ GLNV+DLVALSGGHTLGFA+C 
Sbjct  143   QVLLGRRDARTASKAAANSNLPPPSFSFSQLVSNFKSHGLNVRDLVALSGGHTLGFARCS  202

Query  518   TFRQRIYGDKD---IDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGL  348
             TFR RIY   +   ID KFA   +  CP +GG+++L   D TPA  D  Y+ NL+ KKGL
Sbjct  203   TFRNRIYNASNNNIIDPKFAASARKTCPRSGGDNNLHPFDATPARVDTAYYTNLLHKKGL  262

Query  347   LVSDQALF--AGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRV  174
             L SDQ LF   G ++D LV+LYSR+   F+ DF  SMIKMG++KPLTG  GEIR NCRRV
Sbjct  263   LHSDQELFKGKGTESDKLVQLYSRSPLVFARDFKASMIKMGNMKPLTGKKGEIRCNCRRV  322

Query  173   N  171
             N
Sbjct  323   N  323



>ref|XP_004149367.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
 ref|XP_004169152.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
 gb|KGN47225.1| hypothetical protein Csa_6G216930 [Cucumis sativus]
Length=320

 Score =   369 bits (946),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 223/295 (76%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+ +FYN+VCP+AL TI+ +V +AIK E RMG SLLRLHFHDCFVNGCD S+LLD T T 
Sbjct  26    LTSNFYNNVCPKALSTIKSVVLNAIKNEPRMGASLLRLHFHDCFVNGCDGSVLLDDTSTF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK AL N NS RGFEVID+IK++V++ C   +VSCADILAVAARDSV  LGGP ++V 
Sbjct  86    TREKTALPNANSIRGFEVIDQIKTQVNQACNGNLVSCADILAVAARDSVAILGGPNYKVL  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             +GRRD+ T S + AN NLP PF +++QL  NF++ GL++KDLV LS GHTLG+A+C +FR
Sbjct  146   VGRRDARTTSVNDANRNLPPPFFNVTQLLSNFQSHGLDLKDLVVLSAGHTLGYARCTSFR  205

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +IDSKFA   Q NCP +GG+ +L+ LD TP  FD  YFK L+  KGLL SDQ 
Sbjct  206   NRIYNDTNIDSKFAATLQGNCPQSGGDDNLSGLDKTPYSFDNAYFKFLLSNKGLLHSDQE  265

Query  329   LFAGGQ--TDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG   +D+LV+ Y+    AF NDFA SMIKMG++ PLTG++GE+R NCR VN
Sbjct  266   LFGGGNGDSDNLVKYYNTYPNAFKNDFASSMIKMGNMNPLTGSDGEVRANCRVVN  320



>ref|XP_006468149.1| PREDICTED: cationic peroxidase 1-like [Citrus sinensis]
Length=305

 Score =   368 bits (944),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 221/294 (75%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS + Y++ CP+AL TI+ IV +A+ +E RMG SLLRLHFHDCFVNGCDAS+LLD T + 
Sbjct  13    LSSNHYDNTCPKALSTIKSIVHNAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSSF  72

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK+A AN NS RGFEVID +KS+V+ +C   VVSCADILAVAARDSVVA GGP+W V+
Sbjct  73    TGEKSASANANSIRGFEVIDSVKSKVESLC-PGVVSCADILAVAARDSVVAFGGPSWTVQ  131

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS    N N+P+P MDL+ L  NF  +GL+ K++VALSG HT+G A+C  FR
Sbjct  132   LGRRDSTTASSSAVNTNIPSPLMDLNDLISNFAKKGLSAKEMVALSGAHTIGQARCLLFR  191

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQ  333
             QRIY + +IDS+FA   ++NCP +GG+ +L+SLD T P  FD  YF++LV  KG+  SDQ
Sbjct  192   QRIYNETNIDSEFATSLKSNCPSSGGDDNLSSLDATSPVLFDNGYFRDLVNNKGVFHSDQ  251

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD  V  YS N G F  DFA +M+KMG++ PLTG +G+IR NCR++N
Sbjct  252   QLFNGGSTDSQVTTYSTNIGTFYADFANAMVKMGNLSPLTGTDGQIRTNCRKIN  305



>ref|XP_004242492.1| PREDICTED: cationic peroxidase 1 [Solanum lycopersicum]
Length=314

 Score =   368 bits (944),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 225/295 (76%), Gaps = 2/295 (1%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             DLS  +Y   CP+A+ TI+  V +A+  ERRMG SLLRLHFHDCFVNGCDAS+LLD T  
Sbjct  21    DLSSDYYEKSCPKAMYTIKNAVANAVTNERRMGASLLRLHFHDCFVNGCDASVLLDDTTD  80

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
                EK+A  N+NS RGF+VID+IKS+++++C   +VSCADI+AVAARDSVV LGGP+W V
Sbjct  81    FTGEKSAKPNSNSIRGFDVIDKIKSQIEKLC-PGIVSCADIIAVAARDSVVLLGGPSWTV  139

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             +LGRRDSTTAS DTAN+++P+P +DL+ L  NF N+G   K++VALSGGHT+G AQC TF
Sbjct  140   ELGRRDSTTASLDTANSDIPSPSLDLNDLITNFANKGFTAKEMVALSGGHTIGKAQCTTF  199

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSD  336
             R R+Y + +IDS  A   ++NCP  GG+ +L+SLD  TP  FD  ++KNLV  KG+L SD
Sbjct  200   RARVYNETNIDSSLATSLKSNCPSTGGDDTLSSLDATTPVLFDNHFYKNLVNNKGILHSD  259

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q L++GG TD  V+ YS N  AF  DFAK+M+K+G++ PLTG NG+IR NCR++N
Sbjct  260   QQLYSGGSTDSQVKSYSTNPIAFDADFAKAMVKLGNLSPLTGTNGQIRTNCRKIN  314



>ref|XP_010695731.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   367 bits (943),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 179/296 (60%), Positives = 219/296 (74%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+ +FY+  CP  L T+  +V+ AI +E RMG SLLRL FHDCFVNGCD SILLD T + 
Sbjct  28    LTTNFYSKSCPNLLTTVNSVVQSAINKESRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK AL N+ S RGFEVID+IKS V++ C   VVSCADIL + ARDSVV LGGPTW VK
Sbjct  88    TGEKTALPNSGSVRGFEVIDQIKSAVEKAC-PGVVSCADILTITARDSVVILGGPTWNVK  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANNN+P P   LSQL  +F NQGL+  D+VAL+GGHT+G A+C +FR
Sbjct  147   LGRRDARTASRTAANNNIPQPNFSLSQLMSSFSNQGLSTTDMVALAGGHTIGQARCTSFR  206

Query  509   QRIYGDKDIDSKFARQRQANCP--MNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +ID+ FA+ RQANCP   N G+++LA LD  TP  FD KY+KNLV +KGLL S
Sbjct  207   TRIYNESNIDASFAKTRQANCPRSSNSGSNNLAPLDLQTPNSFDNKYYKNLVSQKGLLHS  266

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF+GG T+ LV+ Y  N   F+ DF  +MIKMGDIKPLTG+NGE+R NCR+ N
Sbjct  267   DQQLFSGGSTNSLVQTYGSNPSRFNADFIAAMIKMGDIKPLTGSNGEVRKNCRKTN  322



>ref|XP_003523269.1| PREDICTED: peroxidase 52-like isoform 1 [Glycine max]
Length=320

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 218/296 (74%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY H CP    +++  V+ AI +E RMG SLLRL FHDCFVNGCD SILLD T + 
Sbjct  26    LSTNFYYHSCPNLFSSVKSTVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGFEVID IKS V++VC   VVSCADILA+AARDSV  LGGPTW VK
Sbjct  86    TGEKNANPNRNSARGFEVIDNIKSAVEKVC-PGVVSCADILAIAARDSVQILGGPTWNVK  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANN +P P  +L+QL   F   GL+ KDLVALSGGHT+G A+C  FR
Sbjct  145   LGRRDARTASQSAANNGIPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +I++ FAR RQ +CP     G+++LA LD  TP  FD  YFKNLV+KKGLL S
Sbjct  205   ARIYNETNIETAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLHS  264

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +VR YS N G FS+DFA +MIKMGDI PLTG+NGEIR NCRR+N
Sbjct  265   DQQLFNGGSTDSIVRGYSTNPGTFSSDFAAAMIKMGDISPLTGSNGEIRKNCRRIN  320



>ref|XP_008463816.1| PREDICTED: peroxidase P7-like [Cucumis melo]
Length=322

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 218/295 (74%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+ +FYN+VCP+AL TI+ +V  AIK E RMG SLLRLHFHDCFVNGCD S+LLD T T 
Sbjct  28    LTHNFYNNVCPKALSTIKSVVSKAIKNEPRMGASLLRLHFHDCFVNGCDGSVLLDDTDTF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGFEV+D+IK++V++ C   V+SCADILAVAARDSV  LGGP ++V 
Sbjct  88    TGEKTAFPNANSIRGFEVVDQIKTQVNQACKGNVMSCADILAVAARDSVAILGGPNYKVL  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ T S + AN NLP PF   +QL  NF++ GL++KDLV LS GHTLG+A+C +FR
Sbjct  148   LGRRDARTTSVNDANGNLPPPFFSFTQLLSNFQSLGLDLKDLVVLSAGHTLGYARCTSFR  207

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +ID KFA   Q NCP +GG+ +L  LD TP  FD  YFK L+  KGLL SDQ 
Sbjct  208   NRIYNDTNIDLKFAATLQENCPQSGGDDNLNGLDKTPHLFDNAYFKALLTNKGLLHSDQE  267

Query  329   LFAGGQ--TDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG   +D+LV+ YS N  AF NDFA SMIKMG++ PLTG++GEIR NCR VN
Sbjct  268   LFGGGNGDSDNLVKHYSTNPNAFKNDFASSMIKMGNMNPLTGSDGEIRTNCRLVN  322



>gb|AGZ15377.1| peroxidase 4-like protein [Phaseolus vulgaris]
Length=329

 Score =   366 bits (939),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 183/300 (61%), Positives = 221/300 (74%), Gaps = 6/300 (2%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LS  FY+ VCP+ALP IR +V+ AI +E R+G SLLRLHFHDCFVNGCD SILLD T  
Sbjct  30    NLSSHFYDKVCPEALPVIRTVVQRAINREPRIGASLLRLHFHDCFVNGCDGSILLDDTKN  89

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGP--TW  699
                EK A ANNNSARGF V+D IK+ VD+ C RPVVSCADILA+AARDSV   GG    +
Sbjct  90    FIGEKTAFANNNSARGFSVVDEIKAAVDKACKRPVVSCADILAIAARDSVAIYGGKHFWY  149

Query  698   EVKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCF  519
             +V LGRRD+ TAS+  AN+NLP P    SQL  NF++ GLNVKDLVALSG HT+GFA+C 
Sbjct  150   QVLLGRRDARTASRSAANSNLPPPTFSFSQLVSNFQSHGLNVKDLVALSGSHTIGFARCT  209

Query  518   TFRQRIYG--DKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLL  345
             TFR +IY   +  ID +FA   +  CP +GG+++L  LDPTPA  D KYF +LV KKGLL
Sbjct  210   TFRSKIYNGINNIIDPRFAASLRNTCPRSGGDNNLQKLDPTPARVDTKYFTDLVHKKGLL  269

Query  344   VSDQALFAGG--QTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              SDQ LF G   ++D LV+LYS+N  AF+ DF  SMIKMG++KPLTG  GEIR +CRR+N
Sbjct  270   HSDQELFKGQGRESDKLVQLYSKNTLAFARDFKASMIKMGNLKPLTGRQGEIRCHCRRIN  329



>ref|XP_010263838.1| PREDICTED: cationic peroxidase 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010263839.1| PREDICTED: cationic peroxidase 1-like isoform X2 [Nelumbo nucifera]
Length=318

 Score =   365 bits (938),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 216/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CP AL  I+  V  A+ +ERRMG SLLRLHFHDCFVNGCDASILLD T + 
Sbjct  26    LSSNFYATSCPSALSIIKSAVTSAVAKERRMGASLLRLHFHDCFVNGCDASILLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NSARGF+VID IKS+++  C   VVSCADILAVA+RDSVVALGG +W V+
Sbjct  86    TGEKTAAPNANSARGFDVIDTIKSQLESAC-PGVVSCADILAVASRDSVVALGGTSWTVQ  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS D ANNNLP+PF+DLS L   F N+G   K+LV LSGGH++G A+C  FR
Sbjct  145   LGRRDSTTASLDDANNNLPSPFLDLSDLISAFANKGFTAKELVVLSGGHSIGQARCSLFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPA-YFDAKYFKNLVKKKGLLVSDQ  333
              RIY + ++DS FA+  ++NCP  GG+++LA+LD T +  FD  YF NL+  KGLL SDQ
Sbjct  205   SRIYNETNVDSSFAKSIKSNCPSAGGDNTLANLDTTTSTVFDNAYFTNLLNNKGLLHSDQ  264

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD  VR YS N   F +DF  +MIKMG++ PLTG +G+IR NCR+VN
Sbjct  265   QLFNGGSTDAQVRAYSTNSATFFSDFGNAMIKMGNLSPLTGTSGQIRTNCRKVN  318



>ref|XP_004302590.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=317

 Score =   365 bits (937),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 220/294 (75%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP+AL TI+  V+ A+  E RMG SLLRLHFHDCFVNGCDAS+LLD T   
Sbjct  25    LSSTFYSSSCPKALATIKSAVDSAVSSEARMGASLLRLHFHDCFVNGCDASVLLDDTANF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A AN NS RGF+V+D IKS+++ +C   V SC+DILAVAARDSVVALGGP+W V+
Sbjct  85    TGEKTAGANANSLRGFDVVDTIKSQLESLC-PGVFSCSDILAVAARDSVVALGGPSWTVQ  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   AN N+P P ++LS L  +F N+G N K+LVALSG HT+G A+C TFR
Sbjct  144   LGRRDSTTASLSAANTNIPAPTLNLSALLTSFSNKGFNAKELVALSGSHTIGQARCTTFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              R+Y + +IDS FA   +ANCP +GG+++L+ LD  TP  FD  YFKNLV +KGLL SDQ
Sbjct  204   ARLYNEANIDSSFATSLKANCPSSGGDANLSPLDVTTPNKFDNAYFKNLVSQKGLLHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG T+  V  Y  N G FS DFAK+M+KMG++ PLTG NG+IR +C++VN
Sbjct  264   QLFSGGSTNAQVNAYVSNPGTFSTDFAKAMVKMGNLSPLTGTNGQIRTDCKKVN  317



>gb|ACJ11762.1| class III peroxidase [Gossypium hirsutum]
Length=323

 Score =   365 bits (937),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 218/294 (74%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP+AL TI+  V  A+  E RMG SL RLHFHDCFVNGCD SILLD T  +
Sbjct  31    LSSTFYSTTCPRALSTIKSAVNSAVSNEARMGASLPRLHFHDCFVNGCDGSILLDDTANM  90

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A+ N+NSARGFEVID IKS+V+ +C   VVSCADI+AVAARDSVVALGGP+W V 
Sbjct  91    TGEKTAVPNSNSARGFEVIDTIKSQVESLC-PGVVSCADIVAVAARDSVVALGGPSWIVL  149

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   AN+N+P P ++LS L   F N+G   K++VALSG HT+G A+C TFR
Sbjct  150   LGRRDSTTASLSAANSNIPAPTLNLSGLITAFSNKGFTAKEMVALSGSHTIGQARCTTFR  209

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAY-FDAKYFKNLVKKKGLLVSDQ  333
              RIY + +IDS FA   +ANCP NGG++SL+ LD T +  FD  YFKNL  +KGLL SDQ
Sbjct  210   TRIYNETNIDSTFATSLRANCPSNGGDNSLSPLDTTSSTSFDNAYFKNLQGQKGLLHSDQ  269

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  V  YS N G+F+ DFA +M+KMG++ PLTG +G+IR NCR+ N
Sbjct  270   QLFSGGSTDSQVNAYSSNLGSFTTDFANAMVKMGNLSPLTGTSGQIRTNCRKAN  323



>ref|XP_004294748.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=320

 Score =   365 bits (936),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 219/295 (74%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+  FY++VCPQALP IR IV  A+K E RMG SLLRLHFHDCFVNGCD S+LLD T T 
Sbjct  26    LNACFYDNVCPQALPKIREIVRQAVKDEPRMGASLLRLHFHDCFVNGCDGSVLLDDTSTF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A+ N  S RGFEVID+IK+ VD+ C + VVSCADILAVAARDSV  LGGP++EV+
Sbjct  86    TGEKTAVPNAGSIRGFEVIDKIKAAVDKSCKKTVVSCADILAVAARDSVYLLGGPSYEVQ  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+TTAS + AN NLP PF   SQL  +F++ GL++KDLV LS  HT+G A+C TF+
Sbjct  146   LGRRDATTASANDANRNLPPPFFSFSQLLSSFQSHGLDLKDLVLLSSAHTIGQARCTTFK  205

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +I++ FA   + NCP  GG+++L  LD TP  FD  YF +L+K KGLL SDQ 
Sbjct  206   DRIYNDTNINANFAASAKQNCPRTGGDNNLRPLDATPKKFDTTYFSSLLKSKGLLHSDQE  265

Query  329   LFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF   G  +D LV+ YS +   F NDF+ SMIKMG+IKPLTGN GE+RVNCR++N
Sbjct  266   LFKGDGSDSDKLVQHYSTSLYDFWNDFSVSMIKMGNIKPLTGNAGEVRVNCRKIN  320



>ref|XP_007033589.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04515.1| Peroxidase superfamily protein [Theobroma cacao]
Length=322

 Score =   365 bits (936),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 216/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CP+AL TI+  V+ A+ +E RMG SLLRLHFHDCFVNGCDASILLD T  I
Sbjct  30    LSSNFYATTCPRALATIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASILLDDTANI  89

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RG+EVID IKS+++ +C   VVSCADI+AVAARDSVVALGGP+W V 
Sbjct  90    TGEKTAGPNNNSVRGYEVIDTIKSQLESLC-PAVVSCADIVAVAARDSVVALGGPSWSVL  148

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS + AN+N+P P + LS L   F N+G   K++VALSG HT+G A+C TFR
Sbjct  149   LGRRDSTTASLNAANSNIPAPTLSLSGLISAFSNKGFTAKEMVALSGSHTIGQARCTTFR  208

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY +  ID  FA   +ANCP  GG+++L+ LD T P  FD  Y+KNL  +KGLL SDQ
Sbjct  209   SRIYNETTIDPSFATSLRANCPSTGGDNNLSPLDTTSPTSFDNAYYKNLQSQKGLLHSDQ  268

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  V  YS N G+F  DFA +MIKMG++ PLTG +G+IR NCR+VN
Sbjct  269   QLFSGGSTDSQVNAYSSNLGSFRTDFANAMIKMGNLSPLTGTSGQIRTNCRKVN  322



>ref|XP_010256952.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=302

 Score =   363 bits (933),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/293 (62%), Positives = 218/293 (74%), Gaps = 18/293 (6%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY+ VCPQALPTI+ +V+ A+++ERRMG SLLRLHFHDCFV+GCDASILLD  P I
Sbjct  28    LSPTFYDKVCPQALPTIKKMVQAAVQKERRMGASLLRLHFHDCFVHGCDASILLDEAPGI  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              +EK    NNNS RG+EVID+IKS+VD+VC  PVVSCADI+ VAARDSVVALGGPTW+V 
Sbjct  88    RTEKTTAPNNNSVRGYEVIDQIKSKVDQVCRGPVVSCADIVTVAARDSVVALGGPTWKVP  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDST A  D   ++LP P   LS L  NFK QGL+ +DLVALSGGHT+G A+C    
Sbjct  148   LGRRDSTDAYPD-ETSDLPGPASSLSTLLANFKKQGLDARDLVALSGGHTIGLARCI---  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
                         FAR  Q++C  + G  +L  LD TP +FD  YFK+LVK KG L SDQA
Sbjct  204   ------------FARPEQSDC--SRGGQTLGPLDSTPTHFDTVYFKSLVKNKGFLPSDQA  249

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF G  TD LV++YS N GAFS DFA+SMIKMG+I+PLTG +G+IRVNC + N
Sbjct  250   LFNGSSTDSLVKIYSLNPGAFSADFARSMIKMGNIRPLTGTHGQIRVNCGKRN  302



>gb|KHN33214.1| Cationic peroxidase 1 [Glycine soja]
Length=265

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/265 (68%), Positives = 207/265 (78%), Gaps = 2/265 (1%)
 Frame = -1

Query  959  MGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEKNALANNNSARGFEVIDRIKSEVDRVC  780
            MG SLLRLHFHDCFVNGCD S+LLDST +IDSEK A  N  SARGFEVID IK  VD  C
Sbjct  1    MGASLLRLHFHDCFVNGCDGSVLLDSTSSIDSEKKATPNFKSARGFEVIDDIKKAVDEAC  60

Query  779  GRPVVSCADILAVAARDSVVALGGPTWEVKLGRRDSTTASKDTANNNLPNPFMDLSQLTE  600
            G+PVVSCADI+AVAARDSVVALGGPTW+V+LGRRDSTTAS+  AN N+P P  +LSQL  
Sbjct  61   GKPVVSCADIVAVAARDSVVALGGPTWKVELGRRDSTTASRKAANANIPAPTFNLSQLIT  120

Query  599  NFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRIYGDK-DIDSKFARQRQANCPMNGGNSS  423
            NFKN GL+ KDLV LSGGH++GFA+C  FR  IY D  +ID KFA++ +  CP  GG+S+
Sbjct  121  NFKNHGLDEKDLVVLSGGHSIGFARCVFFRNHIYNDSNNIDPKFAKRLKHICPKKGGDSN  180

Query  422  LASLDPT-PAYFDAKYFKNLVKKKGLLVSDQALFAGGQTDDLVRLYSRNHGAFSNDFAKS  246
            LA LD T P +F+  Y+ NLV+KKGLL SDQ LF GG TD LVR YS  H AF  DFA S
Sbjct  181  LAPLDKTGPNHFEIGYYSNLVQKKGLLHSDQELFNGGYTDALVRQYSYGHVAFFEDFANS  240

Query  245  MIKMGDIKPLTGNNGEIRVNCRRVN  171
            MIKMG+ +PLTGN GEIRVNCR+VN
Sbjct  241  MIKMGNTRPLTGNQGEIRVNCRKVN  265



>ref|XP_008782619.1| PREDICTED: cationic peroxidase 1-like [Phoenix dactylifera]
Length=320

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 218/295 (74%), Gaps = 3/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY+  CP+AL TI+  V+ A+ +ERRMG SLLRLHFHDCFV GCD S+LLD T T 
Sbjct  27    LSPTFYDTSCPKALSTIQSAVKAAVAKERRMGASLLRLHFHDCFVQGCDGSVLLDDTSTF  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGF+VID IKS V+ VC +  VSCADILAVAARDSVVALGGP+W V+
Sbjct  87    TGEKTAGPNNNSIRGFDVIDTIKSRVEAVC-KQTVSCADILAVAARDSVVALGGPSWTVQ  145

Query  689   LGRRDSTTASKDTANNNLPNPFM-DLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             LGRRDSTTAS   AN+++P+P   DLS L   F  +GL   D+VALSG HT+G A+C +F
Sbjct  146   LGRRDSTTASLSLANSDIPSPITSDLSALISAFSKKGLATSDMVALSGAHTIGQARCTSF  205

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSD  336
             R RIY + +IDS FA   Q+NCP++GG+S+LA LD  TP  FD  Y++NL+ KKGLL SD
Sbjct  206   RNRIYNETNIDSSFATSLQSNCPVSGGDSNLAPLDVSTPTIFDNFYYRNLLNKKGLLHSD  265

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF GG TD  V  YS N   F +DFA +M+ MG+I PLTG +GEIR++CR+ N
Sbjct  266   QQLFNGGSTDSQVSSYSTNSAKFFSDFASAMVNMGNISPLTGTSGEIRISCRKTN  320



>gb|EMS48893.1| Peroxidase 52 [Triticum urartu]
Length=312

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/298 (59%), Positives = 219/298 (73%), Gaps = 3/298 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L P FY+ +CP ALP IR +VE+A+  E RMG SLLRLHFHDCFVNGCD SILLD TP  
Sbjct  15    LDPHFYDKLCPAALPAIRKVVEEAVAVEPRMGASLLRLHFHDCFVNGCDGSILLDDTPFF  74

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGF+VIDRIK  V+  C   VVSCAD++AVAARDSVVALGGP+++V 
Sbjct  75    TGEKKAAPNVNSVRGFDVIDRIKDAVNAACRGNVVSCADVVAVAARDSVVALGGPSYDVH  134

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+  AS+  ANN++P P  DL +L  NF + GL V+DLV LSGGHTLGF++C  FR
Sbjct  135   LGRRDARGASQAAANNSIPAPTFDLDRLVSNFASHGLTVQDLVVLSGGHTLGFSRCTNFR  194

Query  509   QRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             +R+Y +   +D+  A Q +  CP+ GG+ +LA LDPTPA FD  Y+ +L++ +GLL SDQ
Sbjct  195   ERLYNETATLDASLAAQLRGPCPLAGGDDNLAPLDPTPARFDGGYYGSLLRSRGLLHSDQ  254

Query  332   ALFAG--GQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNYY  165
              LFAG  G TD LVR Y  +  AF  DFA++M++MG + PLTG++GEIR NCR+VNYY
Sbjct  255   QLFAGGLGPTDALVRFYGADPEAFGRDFAEAMVRMGGLSPLTGSSGEIRANCRKVNYY  312



>ref|XP_003615979.1| Peroxidase [Medicago truncatula]
 gb|AES98937.1| peroxidase family protein [Medicago truncatula]
Length=323

 Score =   363 bits (933),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/297 (60%), Positives = 216/297 (73%), Gaps = 4/297 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P++Y+ +CP+ALP I  IV+ AI +E RMG SLLRLHFHDCFVNGCD S+LLD TPT 
Sbjct  25    LTPNYYDRICPKALPIINSIVKQAIIREPRMGASLLRLHFHDCFVNGCDGSVLLDDTPTF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--WE  696
               EK A  N NS RGFEV+D+IK  V + C R VVSCADILA+AARDSV  LGG    ++
Sbjct  85    IGEKTAFPNINSIRGFEVVDQIKEAVTKACKRDVVSCADILAIAARDSVAILGGKQYWYQ  144

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRDS  AS+D AN NLP PF + SQL  NFK+ GLN+KDLV LSGGHT+GF++C  
Sbjct  145   VLLGRRDSRFASRDAANTNLPPPFFNFSQLITNFKSHGLNLKDLVVLSGGHTIGFSKCTN  204

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             FR RI+ D +ID+ FA   Q  CP  GG+ +LA  D TP   D  Y+K L+ K+GLL SD
Sbjct  205   FRDRIFNDTNIDTNFAANLQKTCPKIGGDDNLAPFDSTPNKVDTSYYKALLYKRGLLHSD  264

Query  335   QALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF   G Q+D LV+LYS+N  AF+ DF  SMIKMG++KPLTG  GEIR NCR+VN
Sbjct  265   QELFKGDGSQSDRLVQLYSKNSYAFAYDFGVSMIKMGNLKPLTGKKGEIRCNCRKVN  321



>ref|XP_008369321.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 221/296 (75%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY+  CP+   T++  V  AI++E RMG SLLRLHFHDCFVNGCD S+LLD T + 
Sbjct  25    LSTKFYSSSCPKLFSTVKSTVHSAIQKETRMGASLLRLHFHDCFVNGCDGSLLLDDTSSF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA+ N NSARGF V+D+IKS V+  C   VVSCADILA+AAR+SV  LGGP+W+VK
Sbjct  85    TGEKNAVPNKNSARGFNVVDKIKSAVENACP-GVVSCADILAIAARESVTVLGGPSWDVK  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANN++P P  +L+QL   F   GL+ +DLVALSG HT+G A+C TFR
Sbjct  144   LGRRDTRTASQAAANNSIPPPTRNLNQLVSTFNALGLSTRDLVALSGSHTIGQARCTTFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + ++DS  A+ RQ+NCP     G+++LA LD  +P +FD  YFKNL++ KGLL S
Sbjct  204   PRIYNETNLDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTFFDNSYFKNLIQNKGLLHS  263

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +VR YS ++  FS+DFAK+MIKMGDIKPLTG+NGEIR NCR+ N
Sbjct  264   DQQLFNGGSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSNGEIRKNCRKPN  319



>ref|XP_008374580.1| PREDICTED: peroxidase P7-like [Malus domestica]
 ref|XP_008354170.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 222/296 (75%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP+   T++  V+ AI++E RMG SLLRLHFHDCFVNGCD S+LLD T + 
Sbjct  25    LSTNFYSSSCPRLFSTVKSTVQSAIQKEARMGASLLRLHFHDCFVNGCDGSLLLDDTSSF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGF+V+D IKS V+ VC   VVSCADILA+AARDSVV LGGP+W VK
Sbjct  85    TGEKNAAPNRNSARGFDVVDNIKSAVENVCP-GVVSCADILAIAARDSVVTLGGPSWNVK  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANNN+P P  +L+QL   F   GL+ +DLVALSG HT+G A+C +FR
Sbjct  144   LGRRDARTASQAAANNNIPPPTRNLNQLISTFSAVGLSTRDLVALSGSHTIGQARCTSFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + ++DS  A+ R++NCP     G+++LA LD  TP  FD  YFKNL++ KGLL S
Sbjct  204   PRIYNETNLDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTSFDNNYFKNLIQNKGLLHS  263

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +VR YS ++ AFS+DFA +MIKMGDIKPLTG++GEIR NCR+ N
Sbjct  264   DQQLFNGGSTDSIVRAYSNSYNAFSSDFASAMIKMGDIKPLTGSSGEIRKNCRKTN  319



>ref|XP_006848018.1| hypothetical protein AMTR_s00029p00173190 [Amborella trichopoda]
 gb|ERN09599.1| hypothetical protein AMTR_s00029p00173190 [Amborella trichopoda]
Length=321

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/290 (62%), Positives = 215/290 (74%), Gaps = 2/290 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY+  CP AL TIR  +  AI  ERRMG SL+RLHFHDCFVNGCDAS+LLDST + 
Sbjct  29    LSSKFYDSSCPNALSTIRTAIHAAISAERRMGASLIRLHFHDCFVNGCDASLLLDSTSSF  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             +SE+NA+ N  SARGF+VI++ KS V+ +C   VVSCADILAVAARDS V LGGP+W VK
Sbjct  89    ESEQNAIQNIESARGFQVIEKAKSRVESICP-GVVSCADILAVAARDSSVKLGGPSWTVK  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TASK  A   LP     L  L   F+ +GL+ KDLVALSG HT+G AQCFTFR
Sbjct  148   LGRRDSATASKSEAERELPLFTTPLDSLISRFRRKGLSAKDLVALSGAHTIGQAQCFTFR  207

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY   +IDS FAR+R+  CP NGG+S LA LD  TP  FD  YFK L++KKGLL SDQ
Sbjct  208   DRIYNHTNIDSGFARKRRNRCPSNGGDSKLAPLDLVTPTSFDNNYFKILMQKKGLLESDQ  267

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNC  183
              LF GG TD++VR YS++  AF +DFA++M+KMGDI+PLTG+ G+IR  C
Sbjct  268   VLFNGGSTDEIVRSYSKSRSAFYSDFAEAMVKMGDIEPLTGSAGQIRARC  317



>ref|XP_003552297.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=316

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/294 (62%), Positives = 211/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CP AL TI+  V  A+  ERRMG SLLRLHFHDCFV GCDAS+LLD T + 
Sbjct  24    LSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTSSF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N  S RGF VID IKS+V+ +C   VVSCADILAVAARDSVVALGGPTW V+
Sbjct  84    KGEKTAGPNAGSIRGFNVIDTIKSKVESLC-PGVVSCADILAVAARDSVVALGGPTWTVQ  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS  +AN++LP P   LS L  +F N+G + K+LVALSG HT+G AQC +FR
Sbjct  143   LGRRDSTTASLSSANSDLPAPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY D +IDS FA+  Q NCP  GG S+LA LD T P  FD  YFKNL  KKGLL SDQ
Sbjct  203   TRIYNDTNIDSSFAKSLQGNCPSTGGGSTLAPLDTTSPNTFDNAYFKNLQSKKGLLHSDQ  262

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD  V  YS N  +F  DFA +MIKMG++ PLTG++G+IR NCR+ N
Sbjct  263   ELFNGGSTDSQVNSYSSNPASFKTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  316



>ref|XP_010263840.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=318

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 217/294 (74%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP+AL  I+  V+ A+  ERRMG SLLRLHFHDCFVNGCDASILLD T T 
Sbjct  26    LSSTFYDTSCPRALSIIKSAVDSAVSSERRMGASLLRLHFHDCFVNGCDASILLDDTSTF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK AL N NS RGF+VID IKS+++  C   VVSCADILAVAARDSVVALGG +W V+
Sbjct  86    TGEKTALPNANSVRGFDVIDTIKSQLESAC-PGVVSCADILAVAARDSVVALGGTSWTVQ  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS + ANN+LP PF+DLS L   F N+G    +LV LSG HT+G A+C TFR
Sbjct  145   LGRRDSTTASLNDANNDLPAPFLDLSALISAFANKGFTANELVVLSGAHTIGQARCTTFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPA-YFDAKYFKNLVKKKGLLVSDQ  333
              RI+ + +IDS+FA   ++NCP +GG+++LA+LD T A  FD  +F NL+  KGLL SDQ
Sbjct  205   DRIHNETNIDSQFATSMKSNCPSSGGDNNLANLDTTTATTFDNVFFTNLLSNKGLLHSDQ  264

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD  VR YS N   F +DF  +MIKMG++ PLTG +G++R NCRRVN
Sbjct  265   QLFNGGSTDSQVRTYSTNSATFFSDFGNAMIKMGNLSPLTGTSGQLRTNCRRVN  318



>ref|XP_003519407.1| PREDICTED: peroxidase 4-like [Glycine max]
 gb|KHN38568.1| Peroxidase 4 [Glycine soja]
Length=324

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 219/296 (74%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L  +FY   CP+   T++  VE AI +E RMG SLLRL FHDCFVNGCD SILLD T + 
Sbjct  30    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  89

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGFEVID+IKS V++VC   VVSCADILA+AARDSV  LGGPTW+VK
Sbjct  90    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCP-GVVSCADILAIAARDSVEILGGPTWDVK  148

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  ANN++P P  +L+QL   F   GL+ KDLVALSGGHT+G A+C TFR
Sbjct  149   LGRRDSRTASQSAANNDIPRPTSNLNQLISRFNALGLSTKDLVALSGGHTIGQARCTTFR  208

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +IDS FAR RQ+ CP     G+++LA +D  TP +FD  YFKNL++KKGL+ S
Sbjct  209   ARIYNETNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPRFFDNHYFKNLIQKKGLIHS  268

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +VR YS N  +F  DF+ +MI+MGDI PLTG+ GEIR NCRRVN
Sbjct  269   DQQLFNGGSTDSIVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  324



>ref|XP_006843744.1| hypothetical protein AMTR_s00007p00229000 [Amborella trichopoda]
 gb|ERN05419.1| hypothetical protein AMTR_s00007p00229000 [Amborella trichopoda]
Length=318

 Score =   362 bits (930),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 179/296 (60%), Positives = 218/296 (74%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P +Y + CP+ALPTIR  V+ AI  ++R+G  LLRL FHDCFVNGCD S+LLD T T 
Sbjct  24    LTPHYYAYSCPKALPTIRSAVKSAISNDKRVGAQLLRLFFHDCFVNGCDGSLLLDDTSTF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGF ++D IKS V++ C   VVSCAD LAVAARDSVV LGGP W+VK
Sbjct  84    IGEKNAAPNRNSARGFNIVDNIKSAVEKACPG-VVSCADTLAVAARDSVVLLGGPDWQVK  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANN++P P  +L+QL  +F NQGL+ KD+VALSGGHT+G A+C   R
Sbjct  143   LGRRDARTASQAAANNSIPPPTFNLNQLINSFANQGLSQKDMVALSGGHTIGVARCINIR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNG--GNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +ID  FA+ RQ+NCP     G++++  LD  TP  FD KYFKNL+ KKGLL S
Sbjct  203   NRIYNETNIDPSFAKTRQSNCPRTAGSGDNNVNPLDLQTPTAFDNKYFKNLINKKGLLHS  262

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG +D LVR YS N   F  DF  +MIKMGDIKPLTG+NGEIR NCR++N
Sbjct  263   DQQLFNGGSSDSLVRSYSSNSDLFDKDFVAAMIKMGDIKPLTGSNGEIRKNCRKIN  318



>ref|XP_006843746.1| hypothetical protein AMTR_s00007p00230210 [Amborella trichopoda]
 gb|ERN05421.1| hypothetical protein AMTR_s00007p00230210 [Amborella trichopoda]
Length=318

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/297 (61%), Positives = 217/297 (73%), Gaps = 6/297 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P +Y + CP+ALPTIR  V+ AI  ++R+G  LLRL FHDCFVNGCD S+LLD T T 
Sbjct  24    LTPHYYAYSCPKALPTIRSAVKSAISNDKRVGAQLLRLFFHDCFVNGCDGSLLLDDTSTF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGF ++D IKS V++ C   VVSCAD LAVAARDSVV LGGP W+VK
Sbjct  84    IGEKNAQPNRNSARGFNIVDNIKSAVEKACPG-VVSCADTLAVAARDSVVLLGGPDWQVK  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANN++P P  +L+QL  +F NQGL+ KD+VALSGGHTLG A+C   R
Sbjct  143   LGRRDARTASQAAANNSIPPPTFNLNQLINSFANQGLSQKDMVALSGGHTLGVARCINIR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP----TPAYFDAKYFKNLVKKKGLLV  342
              RIY + +ID  FA+ RQ+NCP   G S   +++P    TP  FD KYFKNL+ KKGLL 
Sbjct  203   DRIYNETNIDPSFAKTRQSNCPRTAG-SGDNNVNPLELQTPTAFDNKYFKNLINKKGLLH  261

Query  341   SDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             SDQ LF GG  D LVR YS N   F+ DF  +MIKMGDIKPLTG+NGEIR NCR++N
Sbjct  262   SDQQLFNGGSADSLVRSYSSNSDLFNKDFVAAMIKMGDIKPLTGSNGEIRKNCRKIN  318



>ref|XP_006595847.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=326

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 217/296 (73%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L  +FY   CP+   T++  VE AI +E RMG SLLRL FHDCFVNGCD SILLD T + 
Sbjct  32    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  91

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGFEVID+IKS V++VC   VVSCADILA+AARDSV  L GPTW+VK
Sbjct  92    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCP-GVVSCADILAIAARDSVEILRGPTWDVK  150

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  ANN +P P  +L+QL   F   GL+ KDLVALSGGHT+G A+C TFR
Sbjct  151   LGRRDSRTASQSAANNGIPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFR  210

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +IDS FAR RQ+ CP     G+++LA +D  TP +FD  YFKNL++KKGL+ S
Sbjct  211   ARIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPTFFDNHYFKNLIQKKGLIHS  270

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD LVR YS N  +F  DF+ +MI+MGDI PLTG+ GEIR NCRRVN
Sbjct  271   DQELFNGGSTDSLVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  326



>ref|XP_009369255.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/296 (60%), Positives = 220/296 (74%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY+  CP+   T++  V  AI++E R G SLLRLHFHDCFVNGCD S+LLD T + 
Sbjct  25    LSTKFYSSSCPKLFSTVKSTVRSAIQKETRTGASLLRLHFHDCFVNGCDGSLLLDDTSSF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA+ N NSARGF V+D+IKS V+ VC   VVSCADILA+AARDSV  LGGP+W+VK
Sbjct  85    TGEKNAVPNKNSARGFNVVDKIKSAVENVCP-GVVSCADILAIAARDSVTILGGPSWDVK  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANN++P P  +L+QL   F   GL+ +DLVALSG HT+G A+C TFR
Sbjct  144   LGRRDTRTASQAAANNSIPPPTRNLNQLISTFNALGLSTRDLVALSGSHTIGQARCTTFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + ++DS  A+ RQ+NCP     G+++LA LD  +P  FD  YFKNL++KKGLL S
Sbjct  204   PRIYNETNLDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFKNLIQKKGLLHS  263

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +VR Y  ++  FS+DFAK+MIKMGDIKPLTG+NGEIR NCR+ N
Sbjct  264   DQQLFNGGSTDSIVRAYRNSYSTFSSDFAKAMIKMGDIKPLTGSNGEIRKNCRKPN  319



>ref|XP_010261061.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=317

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 214/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY   CP+AL  IR  V  A+ +ERRMG SLLRLHFHDCFVNGCDASILLD   T 
Sbjct  25    LSPNFYASSCPRALSIIRSAVSIAVARERRMGASLLRLHFHDCFVNGCDASILLDDNSTF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGF+V+D IKS+++  C   VVSCADILAVAARDSVVALGG +W V+
Sbjct  85    TGEKTAAPNANSVRGFDVVDTIKSQLESAC-PGVVSCADILAVAARDSVVALGGSSWTVQ  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS + ANNNLP+PF DLS L   F N+G   K+LVALSG HT+G A+C  FR
Sbjct  144   LGRRDSTTASLNAANNNLPSPFSDLSALLSAFSNKGFTAKELVALSGSHTIGQARCTIFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY + +I+S +A   +ANCP +GG+++LA LD  T   FD  YF NL+  +GLL SDQ
Sbjct  204   SRIYNETNINSAYATSLKANCPSSGGDNNLAGLDASTSTVFDNAYFTNLLNNRGLLHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  VR YS N   F +DF  +MIKMG++ PLTG +G+IR NCR+VN
Sbjct  264   QLFSGGSTDAQVRAYSSNSATFLSDFGNAMIKMGNLSPLTGTSGQIRNNCRKVN  317



>ref|XP_006596457.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=301

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 216/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+ + Y   CPQAL  IR +V  A+ ++ RMG SLLRLHFHDCFVNGCDAS+LLD+T T 
Sbjct  9     LTSNCYESTCPQALSIIRTVVIGAVAKDHRMGASLLRLHFHDCFVNGCDASVLLDNTSTF  68

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK+A AN NS RGFEVID IK++V+  C   VVSCADILA+AARDSVVALGGP+W V 
Sbjct  69    TGEKSAGANVNSLRGFEVIDDIKTKVEAAC-PGVVSCADILAIAARDSVVALGGPSWNVG  127

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTASKD+A  ++P+P MDLS L  +F  +G N K++VALSG HT G A+C  FR
Sbjct  128   LGRRDSTTASKDSATTDIPSPLMDLSALISSFSKKGFNTKEMVALSGAHTTGQARCQLFR  187

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              R+Y +  I+S FA   ++NCP  GG+S+L+ LD  T   FD  YFKNL+ KKGLL SDQ
Sbjct  188   GRVYNESSIESNFATSLKSNCPSTGGDSNLSPLDVTTSVLFDTAYFKNLINKKGLLHSDQ  247

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  V  YS +  AF  DFA +M+KMG++ PLTG +G+IR NCR+VN
Sbjct  248   QLFSGGSTDSQVTAYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRTNCRKVN  301



>ref|XP_010256947.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=321

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 219/296 (74%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP    T++  V  AI +E RMG SLLRL FHDCFVNGCD SILLD T + 
Sbjct  27    LSTNFYSKTCPNVFTTVKSAVRSAISKESRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGF+V+D IKS+V++VC   VVSCADILA+AARDSVV LGG +W VK
Sbjct  87    TGEKNANPNRNSARGFDVVDDIKSKVEKVC-PGVVSCADILAIAARDSVVILGGTSWNVK  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  ANNN+P P  +L+ L  +F+++GL+ KD+VALSGGHT+G A+C  FR
Sbjct  146   LGRRDSKTASQSAANNNIPPPTSNLNNLISSFQSKGLSTKDMVALSGGHTIGQARCTNFR  205

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +I+S FA+ RQ  CP +   G+++LA LD  TP  FD  YFKNL+ +KGLL S
Sbjct  206   ARIYNESNIESSFAKTRQGRCPSSSGSGDNNLAPLDLQTPTAFDNNYFKNLINQKGLLHS  265

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD  VR YS N   F++DFA +MIKMGDI PLTG+NGEIR NCRRVN
Sbjct  266   DQQLFNGGSTDSQVRTYSNNPSTFNSDFAAAMIKMGDISPLTGSNGEIRKNCRRVN  321



>ref|XP_007206479.1| hypothetical protein PRUPE_ppa018750mg [Prunus persica]
 gb|EMJ07678.1| hypothetical protein PRUPE_ppa018750mg [Prunus persica]
Length=322

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 211/295 (72%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FYN VCPQALP IR +V+ AI  E R+G SLLRLHFHDCFVNGCD S+LLD T   
Sbjct  28    LSSGFYNKVCPQALPAIRKVVKRAISHEPRIGASLLRLHFHDCFVNGCDGSVLLDDTANF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGF VID IK  VD+ C + VVSCADILAVAARDSV  LGGP +EV+
Sbjct  88    TGEKTAFPNLNSIRGFNVIDDIKKAVDKACYKSVVSCADILAVAARDSVSILGGPDYEVQ  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS + AN NLP P    SQL  NF+  GLN+KDL+ LS  HT+G A+C TFR
Sbjct  148   LGRRDARTASVNDANRNLPPPVFSFSQLLSNFQAHGLNLKDLIVLSAAHTIGLARCTTFR  207

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +ID KFA   + NCP  GG+++   LD T   FD  YFK L+++KGLL SDQ 
Sbjct  208   ARIYNDTNIDPKFAASAKYNCPTTGGDNNTRPLDSTTRRFDNVYFKALLQQKGLLHSDQE  267

Query  329   LFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L+   G  +D LV  YSRN  +F+ DFA SMIKMG+IKPLTGNNGE+R+NCR++N
Sbjct  268   LYKNNGTDSDKLVLKYSRNSESFAKDFANSMIKMGNIKPLTGNNGEVRLNCRKIN  322



>gb|ACU17608.1| unknown [Glycine max]
Length=320

 Score =   361 bits (926),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 215/296 (73%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY H CP    +++  V+ AI +E RMG SLLRL FHDCFVNGCD SILLD T + 
Sbjct  26    LSTNFYYHSCPNLFSSVKSAVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGFEVID IKS V++VC   VVSCADILA+AARDSV  LGGPTW VK
Sbjct  86    TGEKNANPNRNSARGFEVIDNIKSAVEKVC-PGVVSCADILAIAARDSVQILGGPTWNVK  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANN +P P  +L+QL   F   GL+ KDLVALSGGHT+G A+C  FR
Sbjct  145   LGRRDARTASQSAANNGIPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +I + FAR RQ +CP     G+++LA LD  TP  FD  YFKNLV+KKG L S
Sbjct  205   ARIYNETNIGTAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGFLHS  264

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +VR YS N G F +DFA +MIKMGDI PLTG+NGE+R NCRR+N
Sbjct  265   DQQLFNGGSTDSIVRGYSTNPGTFPSDFAAAMIKMGDISPLTGSNGEVRKNCRRIN  320



>ref|XP_006833057.1| hypothetical protein AMTR_s00170p00037010 [Amborella trichopoda]
 gb|ERM98335.1| hypothetical protein AMTR_s00170p00037010 [Amborella trichopoda]
Length=315

 Score =   360 bits (925),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 211/293 (72%), Gaps = 1/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP  L  +R  +  A+ +E R+G S+LRL FHDCFVNGCDASILLD T   
Sbjct  24    LSSTFYSSSCPNLLSIVRTAMTQAVNREARLGASILRLFFHDCFVNGCDASILLDDTANF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGFEVID IK+ V+  CG  VVSCADILA+A RD VV LGGPTW V 
Sbjct  84    TGEKNAAPNRNSARGFEVIDTIKTRVNAACGN-VVSCADILALATRDGVVLLGGPTWTVP  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  AN+ +P+PF  L+ L   F+ +GL  +++ ALSGGHT+GFA+C TFR
Sbjct  143   LGRRDARTASQSAANSQIPSPFSSLTTLISMFQAKGLTAREMTALSGGHTIGFARCSTFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + +ID+ FAR R+A CP  GG+++LA LD T   FD  Y++NLV ++GLL SDQ 
Sbjct  203   TRIYNETNIDATFARTRRATCPATGGDTNLAPLDQTQTQFDNNYYQNLVNRRGLLHSDQE  262

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG  D LVR YS N   FS+DFA +M+ MG+I PLTG NGEIR NCRR+N
Sbjct  263   LFNGGSQDALVRTYSTNGATFSSDFASAMVNMGNISPLTGTNGEIRNNCRRIN  315



>ref|NP_001241115.1| uncharacterized protein LOC100811170 precursor [Glycine max]
 gb|ACU23405.1| unknown [Glycine max]
 gb|KHN08837.1| Peroxidase 4 [Glycine soja]
Length=327

 Score =   360 bits (925),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 182/299 (61%), Positives = 216/299 (72%), Gaps = 6/299 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP FY+ VCPQALP I+ +V+ AI +ERR+G SLLRLHFHDCFVNGCD SILLD T   
Sbjct  29    LSPHFYDKVCPQALPVIKSVVQRAIIRERRIGASLLRLHFHDCFVNGCDGSILLDDTRNF  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGP--TWE  696
               EK AL N NS RGF V+D IK+ VD+ C R VVSCADILA+AARDS+   GGP   ++
Sbjct  89    TGEKTALPNLNSVRGFSVVDEIKAAVDKACKRHVVSCADILAIAARDSIAIYGGPHYWYQ  148

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRD+ TASK  AN+NLP P    SQL  NFK+ GLNV+DLVALSGGHT+GFA+C T
Sbjct  149   VLLGRRDARTASKAAANSNLPPPTFSFSQLVSNFKSHGLNVRDLVALSGGHTIGFARCTT  208

Query  515   FRQRIY--GDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLV  342
             FR RIY   +  ID  FA   +  CP +GG+++L  LD TP   D  Y+ +L+ KKGLL 
Sbjct  209   FRNRIYNVSNNIIDPTFAASVRKTCPKSGGDNNLHPLDATPTRVDTTYYTDLLHKKGLLH  268

Query  341   SDQALF--AGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             SDQ LF   G ++D LV+LYSR   AF+ DF  SMIKMG++KPLTG  GEIR NCRRVN
Sbjct  269   SDQELFKGKGTESDKLVQLYSRIPLAFARDFKASMIKMGNMKPLTGRQGEIRCNCRRVN  327



>ref|XP_006848008.1| hypothetical protein AMTR_s00029p00168370 [Amborella trichopoda]
 gb|ERN09589.1| hypothetical protein AMTR_s00029p00168370 [Amborella trichopoda]
Length=324

 Score =   360 bits (925),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/290 (61%), Positives = 215/290 (74%), Gaps = 2/290 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+ +FY+  CP AL TIR  +  AI  ERRMG SL+RLHFHDCFVNGCDAS+LLDST + 
Sbjct  32    LTSNFYDSTCPNALSTIRTAIRTAISAERRMGASLIRLHFHDCFVNGCDASLLLDSTSSF  91

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             +SE+NA+ N NSARGF VI+  KS V+ +C   VVSC+DILAVAARDS VA+GGP+W V 
Sbjct  92    ESEQNAIQNINSARGFHVIENAKSRVESIC-PGVVSCSDILAVAARDSSVAMGGPSWTVN  150

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TASKD A   LP     L  L   F  +GL+ KD+VALSG HT+G AQCFTFR
Sbjct  151   LGRRDSATASKDEAERELPLFTAPLDDLISLFGRKGLSAKDMVALSGAHTIGQAQCFTFR  210

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY   +ID+ FAR+R+ NCP  GG+S+LA+LD  TP  FD  YFK L++KKGLL SDQ
Sbjct  211   DRIYNHTNIDAGFARKRRGNCPSTGGDSNLAALDLVTPTSFDNNYFKILMQKKGLLESDQ  270

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNC  183
              LF GG TDD+VR YS +  AF +DFA +M+KMGDI+PLTG+ G+IR  C
Sbjct  271   VLFNGGSTDDIVRSYSNSRSAFYSDFAAAMVKMGDIEPLTGSAGQIRARC  320



>ref|NP_001241914.1| uncharacterized protein LOC100790279 precursor [Glycine max]
 gb|ACU17865.1| unknown [Glycine max]
Length=320

 Score =   360 bits (925),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 217/296 (73%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY H CP    T++  V+ AI +E RMG SLLR  FHDCFVNGCD SILLD T + 
Sbjct  26    LSTNFYYHSCPNLFSTVKSTVQSAISKETRMGASLLRPFFHDCFVNGCDGSILLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARG+EVID IKS V++ C   VVSCADILA+AARDSV  LGGP+W VK
Sbjct  86    TGEKNANPNRNSARGYEVIDNIKSAVEKAC-PGVVSCADILAIAARDSVQILGGPSWNVK  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             +GRRD+ TAS+  ANN +P P  +L+QL   F   GL+ KDLVALSGGHT+G A+C  FR
Sbjct  145   VGRRDARTASQSAANNGIPPPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +ID+ FAR RQ +CP     G+++LA+LD  TP  FD  YFKNLV+KKGLL S
Sbjct  205   ARIYNESNIDTAFARARQQSCPRTSGSGDNNLATLDLQTPTEFDNYYFKNLVQKKGLLHS  264

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +VR YS N  +FS+DFA +MIKMGDI PLTG+NGEIR NCRR+N
Sbjct  265   DQQLFNGGSTDSIVRGYSTNPSSFSSDFAAAMIKMGDISPLTGSNGEIRKNCRRIN  320



>ref|XP_010260327.1| PREDICTED: peroxidase P7-like [Nelumbo nucifera]
Length=324

 Score =   360 bits (925),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 218/295 (74%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L P FY+  CPQALPTI+ IVE AI++E RMG SLLRLHFHDCFVNGCD S+LLD TP  
Sbjct  30    LYPDFYDKACPQALPTIKKIVEQAIEREPRMGASLLRLHFHDCFVNGCDGSLLLDDTPDF  89

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGFEV+D IK+ V+ VC   VVSCADILAVAARDSV ALGGP+++V 
Sbjct  90    TGEKTANPNRNSVRGFEVVDEIKAAVNSVCYGNVVSCADILAVAARDSVAALGGPSYQVL  149

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             +GRRD+ TASK+ ANNN+P P ++   L   F+ QGL  +DLV LSG HT+G A+C TFR
Sbjct  150   VGRRDAKTASKNDANNNIPAPTLEFQGLLSKFQAQGLGQEDLVVLSGAHTIGLARCATFR  209

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +IDS FA + +  CP +GG+++L  LD T   FD +YF +L+++KGLL SDQ 
Sbjct  210   DRIYNDTNIDSGFAGELRMKCPRSGGDNNLQPLDDTSTSFDTEYFDDLLEQKGLLHSDQQ  269

Query  329   LFAG-GQTDD-LVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF G G T D LVR Y+ N  AF  DF  SMIKMG++KPLTG NGEIR+NCR+VN
Sbjct  270   LFKGDGSTSDGLVRYYNDNPTAFWEDFGVSMIKMGNLKPLTGTNGEIRMNCRKVN  324



>ref|XP_006486214.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=319

 Score =   360 bits (924),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 217/296 (73%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY + C   LPT++ +V+ A+ +E RMG SLLRL FHDCFVNGCD S+LLD T + 
Sbjct  25    LSTNFYANTCKNLLPTVKSVVQSAVSKEARMGASLLRLFFHDCFVNGCDGSVLLDDTSSF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA+ N NSARGFEVID IKS V++ C    VSCADILA+ ARDSVV LGGP+WEVK
Sbjct  85    TGEKNAVPNRNSARGFEVIDNIKSAVEKAC-PGAVSCADILAITARDSVVLLGGPSWEVK  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  AN+ +P P  +L+QLT  F   GL+ KDLVAL+GGHT+G A+C +FR
Sbjct  144   LGRRDSRTASQSAANSGIPPPTSNLNQLTSRFNALGLSNKDLVALAGGHTIGQARCTSFR  203

Query  509   QRIYGDKDIDSKFARQRQANCP-MNG-GNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
               IY + +ID+ FAR RQ NCP  NG G+++LA LD  TP  FD  YFKNLV +KGLL S
Sbjct  204   AHIYNETNIDASFARTRQGNCPRANGTGDNNLAPLDLQTPTSFDNNYFKNLVNRKGLLHS  263

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD  VR YS N   FS+DF   MIKMGDI PLTG+ GEIR NCRR+N
Sbjct  264   DQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGEIRKNCRRIN  319



>ref|XP_006842420.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
 gb|ERN04095.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
Length=315

 Score =   360 bits (924),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 215/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FYN  CP AL TI+  V  A+  E RMG SLLRLHFHDCFVNGCD S+LLD   T 
Sbjct  23    LSSTFYNSSCPNALSTIQTAVRSAVNNESRMGASLLRLHFHDCFVNGCDGSLLLDDNATF  82

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGFEV+D IKS+++ +C   VVSCADILAVAARDSVV LGGPTW V 
Sbjct  83    TGEKTARPNNNSVRGFEVVDNIKSQLESLC-PGVVSCADILAVAARDSVVVLGGPTWTVL  141

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS  TAN+++P P + LS L  +F N+GL+  ++VALSG HT+G A+C TFR
Sbjct  142   LGRRDSTTASLSTANSDIPAPSLSLSGLITSFSNKGLSSSEMVALSGSHTIGQARCTTFR  201

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQ  333
               IY + +IDS +A   ++NCP +GG+++L+ LD T P  FD  Y+KNLV KKGLL SDQ
Sbjct  202   THIYNETNIDSTYATSLKSNCPFSGGDNNLSPLDVTSPTVFDNAYYKNLVNKKGLLHSDQ  261

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD  V  Y+ +   F  DFAK+M+KMG+I PLTG++G++R NCR+VN
Sbjct  262   ELFNGGSTDSQVTGYTSSSSTFPTDFAKAMVKMGNISPLTGSSGQVRTNCRKVN  315



>ref|XP_011021040.1| PREDICTED: peroxidase P7-like [Populus euphratica]
Length=320

 Score =   360 bits (924),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 217/296 (73%), Gaps = 3/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P FY+ VCP ALP IR I + AI++E RMG SLLR+HFHDCFVNGCD S+LLD T   
Sbjct  24    LTPDFYDKVCPPALPIIRKITKQAIRREPRMGASLLRMHFHDCFVNGCDGSVLLDDTANF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK AL N NS RGFEV+D+IKS ++R C   VVSCADILAVAARDSV  LGGP +EV 
Sbjct  84    TGEKTALPNLNSLRGFEVVDQIKSAINRACSANVVSCADILAVAARDSVKLLGGPAYEVL  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TASK+ AN NLP PF + SQL  NF++ GLN+ DLV LS GHT+G A+C TFR
Sbjct  144   LGRRDSRTASKNDANTNLPPPFFNFSQLLSNFQSHGLNLTDLVVLSAGHTIGLARCTTFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +I+SKFA   + +CP  GG+++   LD T   FDA+YF++L+ KKGLL SDQ 
Sbjct  204   DRIYNDTNINSKFAASLKNSCPRTGGDNNTNPLDSTTTRFDAQYFRDLIAKKGLLHSDQE  263

Query  329   LFA--GGQTDDLVRLYSR-NHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF   G  +D LV+ Y   N   F  DF+ SMIKMG++KPLTG NGEIR+NCR+VN
Sbjct  264   LFKGDGSGSDPLVQYYGYINPDRFLTDFSASMIKMGNMKPLTGINGEIRMNCRKVN  319



>gb|KHN44724.1| Peroxidase 4 [Glycine soja]
Length=318

 Score =   360 bits (923),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 217/296 (73%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L  +FY   CP+   T++  VE AI +E RMG SLLRL FHDCFVNGCD SILLD T + 
Sbjct  24    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGFEVID+IKS V++VC   VVSCADILA+AARDSV  L GPTW+VK
Sbjct  84    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCP-GVVSCADILAIAARDSVEILRGPTWDVK  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  ANN +P P  +L+QL   F   GL+ KDLVALSGGHT+G A+C TFR
Sbjct  143   LGRRDSRTASQSAANNGIPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +IDS FAR RQ+ CP     G+++LA ++  TP +FD  YFKNL++KKGL+ S
Sbjct  203   ARIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPINFATPTFFDNHYFKNLIQKKGLIHS  262

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD LVR YS N  +F  DF+ +MI+MGDI PLTG+ GEIR NCRRVN
Sbjct  263   DQELFNGGSTDSLVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  318



>gb|ABK21858.1| unknown [Picea sitchensis]
Length=326

 Score =   360 bits (924),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 216/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L P FY+  CP A   +  +V  A+ +E+RMG SLLRLHFHDCFVNGCD SILLD T T 
Sbjct  34    LCPRFYDISCPSAFSIVNSVVTQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTSTF  93

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A+ N NS RGFEVID IK++V+  C   VVSCADI+A+AARD+VV LGGPTW V 
Sbjct  94    QGEKTAVPNKNSVRGFEVIDAIKTQVEAACP-GVVSCADIVAIAARDAVVQLGGPTWLVL  152

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   AN+NLP P  +LS L  +F++ GL+++DLVALSG HT+G A+C  FR
Sbjct  153   LGRRDSTTASLSAANSNLPPPASNLSALISSFQSHGLSIRDLVALSGSHTIGQARCTNFR  212

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RI+ + +ID  FAR RQANCP  GG+ +LA LD  TP  FD  Y+KNL +++GLL SDQ
Sbjct  213   NRIHSESNIDLSFARARQANCPSTGGDDNLAPLDLLTPTTFDNNYYKNLERRRGLLHSDQ  272

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD+LV  Y+    AFS DFA +M+KMG I+PLTGNNGEIR NCR++N
Sbjct  273   QLFNGGSTDNLVSFYTTYPIAFSIDFAVAMVKMGSIEPLTGNNGEIRKNCRKIN  326



>ref|XP_003634480.1| PREDICTED: cationic peroxidase 1 [Vitis vinifera]
Length=318

 Score =   359 bits (922),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 177/293 (60%), Positives = 211/293 (72%), Gaps = 1/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY   CP+ALPTIR  V  A+ +E+RMG SLLRLHFHDCFV GCDASILLD T T 
Sbjct  25    LSPNFYARSCPRALPTIRTAVNKAVAKEKRMGASLLRLHFHDCFVLGCDASILLDDTATF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RG+EVID IKS+V+ +C   VVSCADI+AVAARDSVVALGGPTW V+
Sbjct  85    TGEKTAGPNNNSVRGYEVIDTIKSQVESLC-PGVVSCADIVAVAARDSVVALGGPTWTVR  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   A  +LP P ++LSQL   F  +GL  K++V LSG HT+G A+C +FR
Sbjct  144   LGRRDSTTASFSAARTDLPGPNLNLSQLISAFSKKGLTTKEMVVLSGTHTIGKARCTSFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
               IY D DID  FA  +Q  CP +GG+ +L+ LD T   FD  YF+ L +KKGLL SDQ 
Sbjct  204   NHIYNDTDIDPAFAASKQKICPRSGGDDNLSPLDGTTTVFDNVYFRGLKEKKGLLHSDQE  263

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L+ GG TD +V  YS N   F  D A +M+KMG+I PLTG NG+IR NCR+VN
Sbjct  264   LYNGGSTDSIVETYSINTATFFRDVANAMVKMGNISPLTGTNGQIRTNCRKVN  316



>tpe|CAH69378.1| TPA: class III peroxidase 136 precursor [Oryza sativa Japonica 
Group]
Length=317

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 217/294 (74%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP ALPTIR  V  AI +E RMG SLLRLHFHDCFVNGCD S+LLD TPT 
Sbjct  25    LSANFYDKSCPNALPTIRIAVRSAIARENRMGASLLRLHFHDCFVNGCDGSVLLDDTPTF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGF+VID IK+ ++ +C + VVSCADILAVAAR+SVVALGGPTW V+
Sbjct  85    TGEKTAAPNNNSLRGFDVIDNIKAHIEGICPQ-VVSCADILAVAARESVVALGGPTWVVQ  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS DTANN++P P  DL  LT++F N+GL+  D++ALSG HT+G A+C  FR
Sbjct  144   LGRRDSTTASLDTANNDIPAPTFDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVNFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY + +ID+  A   ++NCP   G+++++ LD  TP  FD  Y+KNL+ KKG+L SDQ
Sbjct  204   NRIYSETNIDTSLATSLKSNCPNTTGDNNISPLDASTPYAFDNFYYKNLLNKKGVLHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG  D     YS N   F  DF+ +M+KMG+I P+TG++G+IR NCR+VN
Sbjct  264   QLFNGGSADSQTTTYSSNMATFFTDFSAAMVKMGNINPITGSSGQIRKNCRKVN  317



>ref|XP_010921099.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=320

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 220/296 (74%), Gaps = 3/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L P FY+ +CP+ALPTIR +VE A+ +E RMG SLLRLHFHDCFVNGCD SILLD TPT 
Sbjct  25    LDPHFYDKLCPEALPTIRMMVEQAVAREPRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGF+V+D IK+ V+  C   VVSCADILAVAARDSVVALGGP++EV+
Sbjct  85    TGEKTAAPNNNSVRGFDVVDSIKAAVNTACKGNVVSCADILAVAARDSVVALGGPSYEVQ  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             +GRRDS TAS+D ANNN+P P ++ S L  NF++ GL++KDLV LSGGHT+G A+C  FR
Sbjct  145   VGRRDSRTASRDAANNNIPAPTLNFSALLSNFQSHGLSMKDLVVLSGGHTIGQARCTNFR  204

Query  509   QRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
              R+Y +   ID+  A   +  CP++GG+++L+ LD TP  FD  YFK L++KKGLL SDQ
Sbjct  205   SRLYNETATIDATLASALKPVCPISGGDNNLSPLDQTPTSFDGVYFKGLLQKKGLLHSDQ  264

Query  332   ALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF   G  +D LV  Y +N  AF  DF  SM+KMG++ PLTG  GEIR++CR+VN
Sbjct  265   QLFNGDGSGSDGLVLYYGKNPDAFWEDFGVSMLKMGNMSPLTGPVGEIRMDCRKVN  320



>ref|XP_004490698.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=323

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/297 (60%), Positives = 219/297 (74%), Gaps = 4/297 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS ++YN VCPQAL  +  IV+ AI  E RMG SLLRLHFHDCFVNGCD S+LLD TP  
Sbjct  27    LSSNYYNKVCPQALQIVESIVKQAIIHEPRMGASLLRLHFHDCFVNGCDGSVLLDDTPNF  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--WE  696
               EK+AL N NS RGFEV+D+IK+ +D  C   VVSCADILA+AARDS+  LGG T  +E
Sbjct  87    VGEKSALPNINSLRGFEVVDQIKATLDISCKGHVVSCADILAIAARDSIAILGGYTYWYE  146

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRD+  AS+D AN NLP PF++L+QL  +FK+ GLN++DLV LSG HT+GFA+C +
Sbjct  147   VLLGRRDARNASRDAANINLPAPFLNLTQLITSFKSHGLNLRDLVVLSGAHTIGFAKCSS  206

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             FR RIY D +ID  FA   + +CP  GG+ +LA LD TP   D  Y+K+L+ KKGLL SD
Sbjct  207   FRDRIYNDTNIDYNFASNLRNSCPRIGGDDNLAPLDATPKKVDTIYYKSLLYKKGLLHSD  266

Query  335   QALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF   G Q+D LV+LYS+N  AF+ DF  SMIKMG++KPLTG  GEIR NCR+VN
Sbjct  267   QELFKGDGSQSDALVKLYSKNSYAFAKDFGVSMIKMGNLKPLTGKKGEIRCNCRKVN  323



>ref|XP_006848019.1| hypothetical protein AMTR_s00029p00173440 [Amborella trichopoda]
 gb|ERN09600.1| hypothetical protein AMTR_s00029p00173440 [Amborella trichopoda]
Length=318

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/290 (62%), Positives = 214/290 (74%), Gaps = 2/290 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP AL TIR  +  AI  ERRMG SL+RLHFHDCFVNGCDAS+LLD T + 
Sbjct  26    LSSNFYDSFCPHALSTIRSKIRSAISAERRMGASLIRLHFHDCFVNGCDASLLLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              SEKNA ANNNS RGFEVID +KS+V+ +C   VVSCADILAVAARDS  A+GGPTW VK
Sbjct  86    SSEKNARANNNSTRGFEVIDAVKSKVESIC-PGVVSCADILAVAARDSSKAMGGPTWTVK  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  AN NLP+   +L +L   F  +GLN +DLVALSG HT+G AQC TFR
Sbjct  145   LGRRDSATASETDANANLPSFTDNLDELISLFSRKGLNTQDLVALSGSHTIGQAQCSTFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RI+ + +IDS FA  RQ  CP +G +++LA LD  TP  FD  YFKNL++ KGLL SDQ
Sbjct  205   DRIHNEANIDSGFASTRQRGCPTSGSDTNLAPLDLVTPTSFDNNYFKNLLQLKGLLHSDQ  264

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNC  183
              LF  G TD LVR YS +   F +DFA +M+KMGDI PLTG++G+IR NC
Sbjct  265   VLFNNGSTDGLVRTYSESRSTFYSDFASAMVKMGDIGPLTGSSGQIRTNC  314



>ref|XP_011021015.1| PREDICTED: cationic peroxidase 1-like [Populus euphratica]
Length=316

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 213/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CP+AL TIR  V  A+ +E RMG SLLRLHFHDCFVNGCDAS+LLD T + 
Sbjct  24    LSTNFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSSF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RG++VID IKS+++ +C   VVSCADILAVAARDSVVAL GP+W V+
Sbjct  84    TGEKTAGPNANSLRGYDVIDTIKSQLESIC-PGVVSCADILAVAARDSVVALSGPSWTVQ  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   AN++LP+P MDLS L  +F N+G   K++VALSG HT+G A+C  FR
Sbjct  143   LGRRDSTTASLSAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLMFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSDQ  333
              R+Y +  +DS  A   ++NCP  G + SL+SLD  TP  FD  YFKNLV  KGLL SDQ
Sbjct  203   NRVYNETSLDSTLATSLKSNCPDTGSDDSLSSLDATTPVTFDNSYFKNLVNNKGLLHSDQ  262

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  V+ YS N+  F  DFA +M+KMG I PLTG++G+IR NC +VN
Sbjct  263   QLFSGGTTDSQVKTYSINYATFYADFASAMVKMGSISPLTGSDGQIRTNCAKVN  316



>ref|XP_007141708.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
 gb|ESW13702.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
Length=320

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 218/296 (74%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L  +FY+  CP+ L T++C VE AI +E RMG SLLRL FHDCFVNGCD SILLD T + 
Sbjct  26    LYTNFYSSSCPKLLDTVKCAVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGF+VID+IKS V+ VC   VVSCADILA+AARDSV  LGGP+W VK
Sbjct  86    TGEKNARPNKNSARGFDVIDKIKSAVEEVC-PGVVSCADILAIAARDSVHILGGPSWNVK  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  ANN +P P  +++QL   F + GL+ KDLVALSG HT+G A+C TFR
Sbjct  145   LGRRDSRTASQSAANNGIPPPTSNVNQLISRFNSLGLSPKDLVALSGAHTIGQARCTTFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +IDS FA  RQ+ CP N   G+++LA LD  TP +FD  YFKNL++KKGLL S
Sbjct  205   ARIYNETNIDSSFAHIRQSTCPPNSGSGDNNLAPLDLATPTFFDNHYFKNLIQKKGLLHS  264

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF G  TD LVR Y+ N G+F  DF+ +MIKMGDI PLTG+ GEIR  CRRVN
Sbjct  265   DQQLFNGASTDSLVRTYNTNPGSFFADFSAAMIKMGDISPLTGSLGEIRNKCRRVN  320



>ref|XP_003534655.2| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=342

 Score =   360 bits (923),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 212/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CP AL TI+  V  A+  ERRMG SLLRLHFHDCFV GCDAS+LLD T + 
Sbjct  50    LSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTSSF  109

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N  S RGF+VID IKS+V+ +C   VVSCADILAVAARDSVVALGG TW V+
Sbjct  110   TGEKTAGPNAGSIRGFDVIDTIKSKVESLC-PGVVSCADILAVAARDSVVALGGTTWTVQ  168

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS  +AN++LP P   LS L  +F N+G + K+LVALSG HT+G AQC +FR
Sbjct  169   LGRRDSTTASLSSANSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFR  228

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY D +IDS FA+  Q NCP  GG+S+LA LD T P  FD  YFKNL  KKGLL SDQ
Sbjct  229   TRIYNDTNIDSSFAKSLQGNCPSTGGDSNLAPLDTTSPNTFDNAYFKNLQSKKGLLHSDQ  288

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD  V  YS N  +F  DFA +MIKMG++ PLTG++G+IR NCR+ N
Sbjct  289   ELFNGGSTDSQVNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  342



>ref|XP_008244639.1| PREDICTED: peroxidase 4-like [Prunus mume]
Length=322

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 210/295 (71%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FYN VCPQALP IR +V+ AI QE R+G SLLRLHFHDCFVNGCD S+LLD T   
Sbjct  28    LSSGFYNKVCPQALPAIRKVVKRAISQEPRIGASLLRLHFHDCFVNGCDGSVLLDDTANF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGF VID IK  VD+ C + VVSCADILAVAARDSV  LGGP ++V+
Sbjct  88    IGEKTAFPNLNSIRGFNVIDDIKKAVDKACYKSVVSCADILAVAARDSVSILGGPDYKVQ  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+  AS + AN NLP P    SQL  NF+  GLN+KDLV LS  HT+G A+C TFR
Sbjct  148   LGRRDARNASVNDANRNLPPPLFSFSQLLSNFQAHGLNLKDLVVLSAAHTIGLARCTTFR  207

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +ID KFA   + NCP  GG+++   LD T   FD  YFK L+++KGLL SDQ 
Sbjct  208   ARIYNDTNIDPKFAASAKYNCPTTGGDNNTRPLDSTTRRFDNVYFKALLQQKGLLHSDQE  267

Query  329   LFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L+   G  +D LV  YSRN  +F+ DFA SMI MG+IKPLTGNNGE+RVNCR++N
Sbjct  268   LYKNNGTDSDKLVLKYSRNSESFAKDFANSMINMGNIKPLTGNNGEVRVNCRKIN  322



>ref|XP_010937975.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=322

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/297 (60%), Positives = 220/297 (74%), Gaps = 3/297 (1%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LSP FY  VCP ALPTI+ IV+ AI  E RMG SL+RLHFHDCFVNGCD SILLD TP+
Sbjct  24    ELSPDFYEEVCPLALPTIKLIVQQAIAFESRMGASLIRLHFHDCFVNGCDGSILLDDTPS  83

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
             +  EK A+ NN+S RGF+V+DRIKS V+  C   VVSCADILAVAARDSVVALGG +++V
Sbjct  84    LTGEKTAVPNNDSLRGFDVVDRIKSAVNLACLGNVVSCADILAVAARDSVVALGGSSYDV  143

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
              LGRRD+TTAS+D AN N+P PF+DL  L  NFK+ GL ++DLV LSG HTLGF++C  +
Sbjct  144   LLGRRDATTASRDAANANIPAPFLDLPDLIANFKSHGLGLEDLVVLSGAHTLGFSRCVVY  203

Query  512   RQRIYGDKD-IDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             R RIY +   ID  FA   +A CP +G + SL+ LD +PA FD  Y+++LV++KGLL SD
Sbjct  204   RNRIYNETSTIDGDFAASLRAVCPPSGDDDSLSPLDESPASFDTAYYQDLVERKGLLHSD  263

Query  335   QALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF   G   D+LV+ YS N  AF   F  +MIK+G++ PLTG++GEIR NCR VN
Sbjct  264   QQLFKGDGSLADELVQKYSENLDAFWAAFGVAMIKLGNMSPLTGSDGEIRENCRAVN  320



>ref|XP_011070595.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 216/295 (73%), Gaps = 3/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSPSFY+  CP AL TIR  +  A+ +ERRM  SL+RLHFHDCFV GCDASILLD TPTI
Sbjct  29    LSPSFYDTTCPNALSTIRTSIRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDETPTI  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              SEK A  N NSARG+EV++  K EV+R+C   VVSCADIL +AARD+ VA+GGP+W VK
Sbjct  89    QSEKTAFPNVNSARGYEVVEAAKLEVERICP-GVVSCADILTLAARDASVAVGGPSWSVK  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  AN++LP P   L  L   F N+GL+ +D+VALSG HT+G AQCF FR
Sbjct  148   LGRRDSTTASRSLANSDLPGPSSSLDALISGFGNKGLSARDMVALSGAHTIGQAQCFLFR  207

Query  509   QRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSD  336
              RIY +  DID+ FA  R+  CP N G+++LA LD  TP  FD  YFKNL+++KGLL SD
Sbjct  208   DRIYSNGTDIDAGFASTRRRQCPQNSGDANLAPLDLVTPNSFDNNYFKNLMQRKGLLQSD  267

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF+GG TD +V  YSR    F++DFA +MIKMG+I+ LTG NG IR  C  +N
Sbjct  268   QVLFSGGSTDSIVSEYSRTPQTFASDFANAMIKMGEIELLTGQNGIIRRVCSAIN  322



>ref|XP_002285723.1| PREDICTED: cationic peroxidase 1 isoform X1 [Vitis vinifera]
Length=317

 Score =   358 bits (919),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 173/293 (59%), Positives = 213/293 (73%), Gaps = 1/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CP+AL TIR  V +A+ +ERRMG SLLRLHFHDCFV GCDASILLD T + 
Sbjct  24    LSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTASF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N +S RG+EVID IKS+V+ +C   VVSCADI+AVAARDSVVALGGPTW ++
Sbjct  84    TGEKTAGPNKDSVRGYEVIDTIKSQVESLC-PGVVSCADIVAVAARDSVVALGGPTWTLQ  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS  TAN++LP P  DLS L   F N+G   K++VALSG HT+G A+C +FR
Sbjct  143   LGRRDSTTASLSTANSDLPGPASDLSTLISRFSNKGFTTKEMVALSGTHTIGKARCTSFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + +ID+ FA  +Q  CP  GG+++L+ LD T   FD  YF+NL  KKGLL SDQ 
Sbjct  203   SRIYNETNIDAAFATSKQKICPSTGGDNNLSDLDETTTVFDNVYFRNLKAKKGLLHSDQQ  262

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L+ GG TD +V  YS N   F  D A +MIKMG++ PLTG NGEIR +C+++N
Sbjct  263   LYNGGSTDSIVETYSTNSATFFTDVANAMIKMGNLSPLTGTNGEIRTDCKKIN  315



>ref|XP_004140450.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis sativus]
 ref|XP_004170186.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis sativus]
 gb|KGN50790.1| hypothetical protein Csa_5G262770 [Cucumis sativus]
Length=320

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 216/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY+  CP AL TIR ++  A+ QERRM  SL+RLHFHDCFV GCDASILLD TP++
Sbjct  28    LSPTFYDQTCPTALTTIRTVIRQAVSQERRMAASLIRLHFHDCFVQGCDASILLDDTPSM  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               E+NA  N NSARG+ VI + K+EV++ C    VSCADILAVAARD+  ++GGP+W VK
Sbjct  88    IGEQNAAPNINSARGYGVIHKAKTEVEKRC-PGTVSCADILAVAARDASFSVGGPSWTVK  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDST+ASK  A + LP+    L +L   F N+GL+ +D+VALSG HT+G +QCF FR
Sbjct  147   LGRRDSTSASKTLAESELPHFQESLDRLISIFANKGLSTRDMVALSGSHTIGQSQCFLFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY   +ID+ FAR RQ NCP +GGN +LA LD  TP  FD  YFKNL++ KGLL +DQ
Sbjct  207   NRIYNQSNIDAGFARTRQRNCPSSGGNGNLAPLDLVTPNSFDNNYFKNLIQMKGLLETDQ  266

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD++V  YSRN   F +DFA +MIKMGDI+PLTG  GEIR  C  VN
Sbjct  267   VLFSGGSTDNIVTEYSRNPSTFKSDFAAAMIKMGDIQPLTGLEGEIRNICGAVN  320



>ref|XP_002283995.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=316

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 213/293 (73%), Gaps = 1/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY   CP+AL TIR  V +A+ +ERRMG SLLRLHFHDCFV GCDASILLD T   
Sbjct  24    LSPNFYASSCPRALSTIRTAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTANF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RG++VID IKS+++ +C   VVSCADI+AVAARDSVVALGGPTW V+
Sbjct  84    TGEKTAGPNNNSLRGYDVIDTIKSQMESLC-PGVVSCADIVAVAARDSVVALGGPTWTVQ  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             +GRRDSTTAS  TAN +LP P  DL  LT  F N+G   +++VALSG HT+G AQC  FR
Sbjct  143   MGRRDSTTASLSTANADLPAPTSDLDVLTSLFSNKGFTTQEMVALSGTHTIGKAQCIKFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + ++D+ FA+ +Q  CP  GG+ +L+ LD T   FD  YFK+L++KKGLL SDQ 
Sbjct  203   YRIYNETNVDAAFAKSKQKICPWTGGDENLSDLDETTTVFDTVYFKDLIEKKGLLHSDQQ  262

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L+ G  TD +V  YS +   F  D A +M+KMG++ PLTG +GEIR NCR++N
Sbjct  263   LYNGNSTDSMVETYSTDSTTFFTDVANAMVKMGNLSPLTGTDGEIRTNCRKIN  315



>ref|XP_004977590.1| PREDICTED: cationic peroxidase 1-like [Setaria italica]
Length=317

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 217/294 (74%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+ +FY+  CP AL TI+  V+ A+ +E RMG SLLRLHFHDCFVNGCD S+LLD TPT 
Sbjct  25    LTANFYDKSCPNALYTIQTAVKSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDTPTF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A+ NNNS RGF+VID IK++++ +C + VVSCADILAVAARDSVV LGGPTW V 
Sbjct  85    TGEKTAVPNNNSIRGFDVIDSIKAQIEGICPQ-VVSCADILAVAARDSVVTLGGPTWVVN  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS D ANN++P P  DLS LT++F N+GL   D++ALSGGHT+G A+C  FR
Sbjct  144   LGRRDSTTASLDAANNDIPKPTFDLSDLTKSFSNKGLTATDMIALSGGHTIGQARCVNFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY + +ID+  A   ++NCP   G+++++ LD  TP  FD  Y+KNL+ KKG+L SDQ
Sbjct  204   NRIYSEANIDTSLATSLKSNCPNKTGDNNISPLDASTPYVFDNFYYKNLLNKKGVLHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG  D     YS N   F  DF+ +M+KMG+I PLTG++G+IR NCR+VN
Sbjct  264   QLFNGGSADSQTTTYSSNMAKFFTDFSAAMVKMGNISPLTGSSGQIRKNCRKVN  317



>ref|XP_008384732.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=322

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 210/295 (71%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+  FY   CPQALP IR  VE AIK+E RMG SL+RLHFHDCFVNGCD SILLD T   
Sbjct  28    LTTHFYTKGCPQALPAIRKAVERAIKREPRMGASLVRLHFHDCFVNGCDXSILLDDTSNF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A+ N NS RG  V+D IK  VD+ C + VVSCADILAVAARDSV  LGGPT++V+
Sbjct  88    TGEKTAVPNANSIRGLNVVDDIKKAVDKACKKSVVSCADILAVAARDSVSILGGPTYKVQ  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS + AN NLP PF +  QL  NF+  GLN+KDLV LS  HTLG A+C TFR
Sbjct  148   LGRRDARTASVNDANRNLPPPFFNFPQLLSNFEAHGLNLKDLVVLSAAHTLGLARCTTFR  207

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +ID +FA   + NCP +GG+ +   LD T   FD  YF+ L+K KGLL SDQ 
Sbjct  208   ARIYNDTNIDPQFAALAKKNCPTSGGDDNTRPLDATSKRFDTVYFEALLKSKGLLHSDQE  267

Query  329   LFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF   G  +D LV+ YS+N  AF  DFA SMIKMG+IKPLTGN GE+R++CR++N
Sbjct  268   LFKGNGSDSDKLVQHYSKNSAAFGKDFANSMIKMGNIKPLTGNEGEVRLDCRKIN  322



>ref|XP_004296027.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=324

 Score =   358 bits (918),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 212/295 (72%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+ +FYN VCPQALPTIR +V+ AI +E R+G SLLRLHFHDCFVNGCD SILLD     
Sbjct  28    LTANFYNKVCPQALPTIRRVVKQAIHREPRIGASLLRLHFHDCFVNGCDGSILLDDAAKF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK AL N NS RGF VID IK  V++ C R VVSCADILAVAARDSV  L GP ++V 
Sbjct  88    TGEKTALPNANSVRGFNVIDDIKKAVNKACKRNVVSCADILAVAARDSVNILQGPQYKVL  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+  AS + AN NLP PF   +QL  NF++ GLN+KDLV LS  HT+G A+C TF+
Sbjct  148   LGRRDARNASLNDANRNLPPPFFSFAQLLSNFQSHGLNLKDLVVLSAAHTIGQARCTTFK  207

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
             QRIY D +ID KFA   + NCP +GG+  +  LD TP  FD  YFK+L+K KGLL SDQ 
Sbjct  208   QRIYNDTNIDPKFAAFAKKNCPSSGGDDKIEPLDATPRRFDTVYFKSLLKNKGLLHSDQE  267

Query  329   LFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF   G  +D LV  YS +  AF  DF+KSMIKMG++KPLTG  GE+R+NCR++N
Sbjct  268   LFKGNGSASDKLVHHYSSHSSAFGKDFSKSMIKMGNMKPLTGTAGEVRLNCRKIN  322



>gb|AAD43561.1|AF155124_1 bacterial-induced peroxidase precursor [Gossypium hirsutum]
Length=316

 Score =   357 bits (917),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 212/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY   CP     +R  +  A+ +E R+G S+LRL FHDCFVNGCD SILLD T T 
Sbjct  24    LSPNFYASSCPNLQTIVRNAMSRAVNRETRIGASILRLFFHDCFVNGCDGSILLDDTATF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA+ N NSARGFEVID IK+ V+  C    VSCADILA+AARD V  LGGPTW+V 
Sbjct  84    TGEKNAVPNRNSARGFEVIDTIKTNVEAACS-ATVSCADILALAARDGVALLGGPTWQVP  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANN +P+PF +L+ LT +F  +GL+ +DL ALSGGHT+G A+C TFR
Sbjct  143   LGRRDARTASQSAANNQIPSPFANLATLTSSFAAKGLSTRDLTALSGGHTIGLARCTTFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY D +ID+ FA  R+ANCP +GG+++LA LD  TP  FD  YF+NLV ++GLL SDQ
Sbjct  203   GRIYNDTNIDANFAATRRANCPASGGDNNLAPLDIQTPTRFDNDYFRNLVARRGLLHSDQ  262

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG  D LVR YS N   FS DFA +M+KMG+I PLTG  GEIR NCR VN
Sbjct  263   ELFNGGSQDALVRTYSNNPATFSADFAAAMVKMGNISPLTGTQGEIRRNCRVVN  316



>ref|XP_009369546.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=322

 Score =   357 bits (917),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 210/295 (71%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+  +Y   CPQALP IR  VE AIK+E RMG SL+RLHFHDCFVNGCD S+LLD T   
Sbjct  28    LNTHYYTKGCPQALPAIRKAVERAIKREPRMGASLVRLHFHDCFVNGCDGSVLLDDTSNF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK AL N NS RG  V+D IK  VD+ C + VVSCADILAVAARDSV  LGGPT++V+
Sbjct  88    TGEKTALPNVNSIRGLNVVDDIKKAVDKACKKSVVSCADILAVAARDSVSILGGPTYKVQ  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS + AN NLP PF +  QL  NF+  GLN+KDLV LS  HTLG A+C TFR
Sbjct  148   LGRRDARTASVNDANRNLPPPFFNFPQLLSNFEAHGLNLKDLVVLSAAHTLGLARCTTFR  207

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +ID KFA   + NCP +GG+ +   LD T   FD  YF+ L+K KGLL SDQ 
Sbjct  208   ARIYNDTNIDPKFAALAKKNCPTSGGDDNTRPLDATSKRFDTVYFEALLKSKGLLHSDQE  267

Query  329   LFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF   G  +D LV+ YS+N  AF  DFA SMIKMG+IKPLTGN GE+R++CR++N
Sbjct  268   LFKGNGSDSDKLVQRYSKNSAAFGKDFANSMIKMGNIKPLTGNEGEVRLDCRKIN  322



>ref|XP_009363847.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
 ref|XP_009363901.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   357 bits (917),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/296 (59%), Positives = 219/296 (74%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY+  CP+   T++  V  AI++E RMG SLLRLHFHDCFVNGCD S+LLD T + 
Sbjct  25    LSTKFYSSSCPKLFSTVKSTVRSAIQKETRMGASLLRLHFHDCFVNGCDGSLLLDDTSSF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA+ N NSARGF V+D+IK  V+ VC   VVSCADILA+AARDSV  LGGP+W+VK
Sbjct  85    TGEKNAVPNKNSARGFNVVDKIKFAVENVCP-GVVSCADILAIAARDSVTILGGPSWDVK  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANN++P P  +L+QL   F   GL+ +DLVALSG HT+G A+C TFR
Sbjct  144   LGRRDTRTASQAAANNSIPPPTRNLNQLISTFNALGLSTRDLVALSGSHTIGQARCTTFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              R+Y + ++DS  A+ RQ+NCP     G+++LA LD  +P  FD  YFKNL++KKGLL S
Sbjct  204   PRVYNETNLDSSLAKTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFKNLIQKKGLLHS  263

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF  G TD +VR YS ++  FS+DFAK+MIKMGDIKPLTG+ GEIR NCR+ N
Sbjct  264   DQQLFNRGSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSKGEIRKNCRKPN  319



>ref|XP_002319422.1| peroxidase precursor family protein [Populus trichocarpa]
 gb|EEE95345.1| peroxidase precursor family protein [Populus trichocarpa]
 gb|AHL39179.1| class III peroxidase [Populus trichocarpa]
Length=320

 Score =   357 bits (917),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 216/296 (73%), Gaps = 3/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P FY+ VCPQALP IR I + AI++E RMG SLLR+HFHDCFVNGCD S+LLD T   
Sbjct  24    LTPDFYDKVCPQALPIIRKITKQAIRREPRMGASLLRMHFHDCFVNGCDGSVLLDDTANF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK AL N NS RGFEV+D+IKS +++ C   VVSCADILAVAARDSV  LGGP ++V 
Sbjct  84    TGEKTALPNLNSLRGFEVVDQIKSAINQACSANVVSCADILAVAARDSVNLLGGPAYKVL  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TASK+ AN NLP PF + SQL  NF++ GLN+ DLV LS GHT+G A+C TFR
Sbjct  144   LGRRDSRTASKNDANTNLPPPFFNFSQLLSNFQSHGLNLTDLVVLSAGHTIGLARCTTFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +I+ KFA   + +CP  GG+++    D T   FDA+YF++L+ KKGLL SDQ 
Sbjct  204   DRIYNDTNINYKFAASLKYSCPRTGGDNNTKPFDSTTTRFDAQYFRDLLAKKGLLHSDQE  263

Query  329   LFA--GGQTDDLVRLYSR-NHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF   G  +D LV+ Y   N   F  DF+ SM+KMG++KPLTG NGEIR+NCR+VN
Sbjct  264   LFKGDGSGSDSLVKYYGYINPDRFLTDFSASMVKMGNMKPLTGTNGEIRMNCRKVN  319



>ref|NP_001065566.1| Os11g0112200 [Oryza sativa Japonica Group]
 tpe|CAH69373.1| TPA: class III peroxidase 131 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF27411.1| Os11g0112200 [Oryza sativa Japonica Group]
Length=317

 Score =   357 bits (917),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 217/294 (74%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP AL TIR  V  A+ +E RMG SLLRLHFHDCFVNGCD S+LLD TPT 
Sbjct  25    LSANFYDKSCPNALSTIRTAVRSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDTPTF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGF+VID IK++V+ +C + VVSCADILAVAARDSV ALGGPTW V+
Sbjct  85    TGEKTAAPNNNSLRGFDVIDNIKAQVEGICPQ-VVSCADILAVAARDSVFALGGPTWVVQ  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS DTANN++P P +DL  LT++F N+GL+  D++ALSG HT+G A+C  FR
Sbjct  144   LGRRDSTTASLDTANNDIPAPTLDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVNFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY + +ID+  A   ++NCP   G+++++ LD  TP  FD  Y+KNL+ KKG+L SDQ
Sbjct  204   NRIYSETNIDTSLATSLKSNCPNTTGDNNISPLDASTPYTFDNFYYKNLLNKKGVLHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG  D     YS N   F  DF+ +++KMG+I PLTG++G+IR NCR+VN
Sbjct  264   QLFNGGSADSQTTTYSSNMATFFTDFSAAIVKMGNIDPLTGSSGQIRKNCRKVN  317



>gb|ACU23245.1| unknown [Glycine max]
Length=326

 Score =   357 bits (917),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/296 (61%), Positives = 215/296 (73%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L  +FY   CP+   T++  VE AI +E RMG SLLRL FHDCFVNGCD SILLD T + 
Sbjct  32    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  91

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGFEVID+IKS V++VC   VVSCADILA+AARDSV  L GPTW+VK
Sbjct  92    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCP-GVVSCADILAIAARDSVEILRGPTWDVK  150

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  ANN +P P  +L+QL   F   GL+ KDLVALSGGHT+G A+C TFR
Sbjct  151   LGRRDSRTASQSAANNGIPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFR  210

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +IDS FAR RQ+ CP     G+++LA +D  TP +FD  YFKNL++KKG + S
Sbjct  211   ARIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPTFFDNHYFKNLIQKKGFIHS  270

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD LV  YS N  +F  DF+ +MI+MGDI PLTG+ GEIR NCRRVN
Sbjct  271   DQELFNGGSTDSLVGTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  326



>ref|XP_008233851.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=319

 Score =   357 bits (917),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 175/296 (59%), Positives = 219/296 (74%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP+    +R  V+ AI+ E R+G SLLRLHFHDCFVNGCD S+LLD T + 
Sbjct  25    LSTNFYSSSCPRVFSAVRSTVQSAIRNEARIGASLLRLHFHDCFVNGCDGSLLLDDTSSF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA+ N NSARGF+V+D IKS V+ VC   VVSCADILA+AARDSV  LGGP+W VK
Sbjct  85    TGEKNAVPNRNSARGFDVVDNIKSAVENVCP-GVVSCADILAIAARDSVAILGGPSWNVK  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANNN+P P  +L+QL   F   GL+ +DLVALSG HT+G ++C  FR
Sbjct  144   LGRRDARTASQAAANNNIPPPTSNLNQLISRFNALGLSTRDLVALSGSHTIGQSRCIQFR  203

Query  509   QRIYGDKDIDSKFARQRQANCP--MNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + ++DS FA+ R++NCP     G+++LA LD  TP  FD  YFKNL++KKGLL S
Sbjct  204   PRIYNETNLDSSFAQTRRSNCPRASGSGDNNLAPLDLQTPTAFDNNYFKNLIQKKGLLHS  263

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +VR YS ++  FS+DF  ++IKMGDIKPLTG+NGEIR NCR+ N
Sbjct  264   DQQLFNGGSTDSIVRTYSNSYNTFSSDFVSAIIKMGDIKPLTGSNGEIRKNCRKPN  319



>ref|XP_009775239.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=320

 Score =   357 bits (916),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 217/294 (74%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  +Y   CP+A+ TI+  V +A+ +ERRMG SLLRLHFHDCFVNGCDASILLD T   
Sbjct  28    LSADYYEKSCPKAIYTIKNAVTNAVAKERRMGASLLRLHFHDCFVNGCDASILLDDTSDF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N+NS RGF++ID IKS+V+++C   +VSCADI+A+AARDSV  LGG TW V 
Sbjct  88    TGEKTAKPNSNSLRGFDLIDTIKSQVEKLCP-GIVSCADIIAIAARDSVEILGGSTWNVL  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS  +AN+++P+P MDLS L   F N+G   K++VAL+G HT+G AQC TFR
Sbjct  147   LGRRDSTTASLSSANSDIPSPLMDLSDLITKFDNKGFTAKEMVALAGAHTIGQAQCTTFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
             +R+Y +  IDS  A   ++NCP  GG+ SL++LD  TPA FD  YFKNLVK KG+L SDQ
Sbjct  207   ERVYNETTIDSSLATSLKSNCPSTGGDDSLSALDAATPAIFDNHYFKNLVKNKGILHSDQ  266

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  V  YS     F+ DFAK+++KMG++ PLTG NG+IR NCR++N
Sbjct  267   QLFSGGSTDSQVTTYSTRPITFAADFAKAIVKMGNLSPLTGTNGQIRTNCRKIN  320



>ref|XP_010066394.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   357 bits (916),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 213/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP AL TI+  V  A+  E RMG SLLRLHFHDCFVNGCDASILLD T   
Sbjct  27    LSSTFYSKSCPSALRTIKSGVSSAVSSEARMGASLLRLHFHDCFVNGCDASILLDDTTNF  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A ANNNS RG+EVID IKS ++  C   VVSCADILA+AARDSVVALGGP+W V 
Sbjct  87    TGEKTAGANNNSIRGYEVIDTIKSHLESSC-PGVVSCADILAIAARDSVVALGGPSWTVL  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   AN+++P P + LS L  +F N+G   K++VALSG HT+G A+C +FR
Sbjct  146   LGRRDSTTASLTDANSDIPAPTLSLSDLITSFSNKGFTAKEMVALSGSHTIGQARCTSFR  205

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQ  333
              R+Y + DI++ FA    ANCP +GG+++L+ LD T P YFD  YFKNL  +KGLL SDQ
Sbjct  206   TRLYNENDINATFATSLNANCPSSGGDNNLSPLDTTSPTYFDNAYFKNLQTQKGLLHSDQ  265

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  V  YS N   F  DFA +M+ MG++ PLTG++G+IR NCR+VN
Sbjct  266   QLFSGGSTDAQVNTYSSNSATFMTDFANAMVTMGNLSPLTGSSGQIRKNCRKVN  319



>ref|XP_006470332.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=320

 Score =   357 bits (916),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 216/296 (73%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY + C   LPT++ +V+ AI +E RMG SLLRL FHDCFVNGCD S+LLD T + 
Sbjct  26    LSTNFYANTCKNLLPTVKSVVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA AN NSARGF+VID IKS V++ C   VVSCADILA+ ARDSVV LGGP+W VK
Sbjct  86    TGEKNANANRNSARGFQVIDNIKSAVEKAC-PGVVSCADILAITARDSVVILGGPSWRVK  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS   AN+ +P P  +L+QLT  F   GL+ KDLVAL+GGHT+G A+C +FR
Sbjct  145   LGRRDARTASLSAANSGIPAPTSNLNQLTSRFNALGLSNKDLVALAGGHTIGQARCTSFR  204

Query  509   QRIYGDKDIDSKFARQRQANCP-MNG-GNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
               IY + +ID+ FAR RQ NCP  NG G+++LA LD  TP  FD  YFKNLV +KGLL S
Sbjct  205   AHIYNETNIDASFARTRQGNCPRANGTGDNNLAPLDLQTPTCFDNNYFKNLVNRKGLLHS  264

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD  VR YS N   FS+DF   MIKMGDI PLTG+ GEIR NCRRVN
Sbjct  265   DQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGEIRKNCRRVN  320



>ref|XP_010938275.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=318

 Score =   357 bits (916),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 215/295 (73%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L P FY+HVCPQALP I+ +VE A+ ++ RMGGSLLRLHFHDCFVNGCD S+LLD  P  
Sbjct  24    LCPDFYDHVCPQALPAIKAVVERAVARQPRMGGSLLRLHFHDCFVNGCDGSVLLDDAPGF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS +GF+VID IK+ V+  C   VVSCADILA+AARDSV ALGGP + V 
Sbjct  84    TGEKTATPNLNSLKGFKVIDEIKNAVNEACHGNVVSCADILAIAARDSVAALGGPPYMVL  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS + ANN+LP P  + SQL  NF + GL++KDLV LSGGHT+G A+C  F+
Sbjct  144   LGRRDSRTASLNDANNDLPPPVFNFSQLLSNFGSHGLDLKDLVVLSGGHTIGQARCTNFK  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              R+Y + +ID  FA   +  CP +GG+++LA LD TPA FD  YF  L++ +GLL SDQ 
Sbjct  204   DRLYNETNIDQGFAGALRNYCPRSGGDNNLAPLDATPASFDTAYFNGLLQGRGLLHSDQQ  263

Query  329   LFAG--GQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF G  G +D LV  YS N  AF  DFA SM+KMG+IKPLTGN GEIR+NCR+VN
Sbjct  264   LFKGDHGASDGLVSFYSGNPYAFWADFAVSMVKMGNIKPLTGNQGEIRMNCRKVN  318



>ref|XP_010921094.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=321

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 216/296 (73%), Gaps = 3/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP FY+ VCPQALPTI+  VE AI  E RMG SL+RLHFHDCFVNGCD SILLD T T 
Sbjct  24    LSPDFYDAVCPQALPTIKQTVEQAIALEPRMGASLVRLHFHDCFVNGCDGSILLDDTSTF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGF+VID+IK  V+ VC   VVSCADILAVAARDSVVALGG +++V 
Sbjct  84    TGEKTAGPNKNSVRGFDVIDQIKDAVNDVCSENVVSCADILAVAARDSVVALGGSSYDVL  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             +GRRDSTTASKD AN ++P+PF DLS L  NF++ GL ++DLV LSG HTLGFA+C +FR
Sbjct  144   VGRRDSTTASKDAANTSIPSPFSDLSALVSNFESHGLALEDLVVLSGAHTLGFARCVSFR  203

Query  509   QRIYGDKD-IDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY +   ID  +A   QA CP +G + +L+ LD TPA FD  Y+++L+   GLL SDQ
Sbjct  204   NRIYNETSTIDGDYAASLQAVCPPSGDDDNLSQLDDTPASFDTAYYQDLMGSMGLLHSDQ  263

Query  332   ALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF   G   D+LV+ Y  +  AFS DF  +MIKMG+I PLTG++GEIR NCR VN
Sbjct  264   QLFMGNGSAADELVQNYGGDPDAFSADFGAAMIKMGNISPLTGSDGEIRKNCRVVN  319



>ref|XP_010264472.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=325

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 217/294 (74%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS ++Y+  CP+A  TI+  V  A+ +E+RMG SLLRLHFHDCFVNGCD SILLD T + 
Sbjct  33    LSSTYYDTSCPKAFSTIKSGVTAAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTSSF  92

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A AN NS RGF+VID IKS+V+ VC   VVSCADILAVAARDSVVALGGP+W V+
Sbjct  93    TGEKTATANANSVRGFDVIDTIKSKVESVC-PGVVSCADILAVAARDSVVALGGPSWTVQ  151

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+TTAS   AN+++P P +DLS LT  F  +GL  K++VALSG HT+G A+C +FR
Sbjct  152   LGRRDATTASLSAANSDIPAPTLDLSDLTSAFSKKGLTAKEMVALSGAHTIGQARCTSFR  211

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY + +I+S  A   ++NCP  GG+S+L+ LD T P  FD  YFKNLV  KGLL SDQ
Sbjct  212   SRIYNETNINSSLATSLKSNCPSTGGDSNLSPLDATSPTAFDNAYFKNLVNNKGLLHSDQ  271

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              L+ GG TD  V  YS N   FS+DFA +M+KMG+I PLTG+NGEIR NCR+ N
Sbjct  272   QLYNGGSTDSQVSSYSSNSATFSSDFASAMVKMGNISPLTGSNGEIRTNCRKTN  325



>ref|XP_008782621.1| PREDICTED: peroxidase P7-like [Phoenix dactylifera]
Length=322

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/299 (60%), Positives = 219/299 (73%), Gaps = 3/299 (1%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LSP FY+ VCP+ALPTI+ +VE AI  E RMG SL+RLHFHDCFVNGCD SILLD TPT
Sbjct  24    ELSPDFYDEVCPKALPTIKLLVEQAIALEPRMGASLVRLHFHDCFVNGCDGSILLDDTPT  83

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
                EK A  NNNS RGF++ID+IK+ V+  C   VVSCADILAVAARDSVV LGG  + V
Sbjct  84    FTGEKMAGPNNNSVRGFDLIDQIKAAVNEECQGNVVSCADILAVAARDSVVVLGGSCYNV  143

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
              LGRRD+TTAS+D AN N+P+P +DL  L  +F++ GL V+DLV LSG HTLGF++C  F
Sbjct  144   LLGRRDATTASRDAANTNIPSPSLDLPDLIASFESHGLGVEDLVVLSGAHTLGFSRCVVF  203

Query  512   RQRIYGDKD-IDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSD  336
             R RIY D   ID  FA   QA CP++G +S+LA LD +P  FD  Y+++LV+ +GLL SD
Sbjct  204   RNRIYNDTACIDGDFAADLQAVCPVSGEDSNLAPLDESPVSFDTAYYQDLVESRGLLHSD  263

Query  335   QALFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNYY  165
             Q LF   G  TD+LVR YS +  AF  DF  +MIKMG+I PLTG +GEIR +CR VN Y
Sbjct  264   QQLFKGDGSLTDELVRKYSDDPDAFWADFGPAMIKMGNISPLTGCDGEIREHCRFVNGY  322



>ref|XP_011070596.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 215/295 (73%), Gaps = 3/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSPSFY+  CP AL TIR  +  A+ +ERRM  SL+RLHFHDCFV GCDASILLD TPTI
Sbjct  29    LSPSFYDTTCPNALSTIRTSIRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDETPTI  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              SEK A  N NSARG+EV++  K EV+R+C   VVSCADIL +AARD+ VA+GGP+W VK
Sbjct  89    QSEKTAFPNVNSARGYEVVEAAKREVERICP-GVVSCADILTLAARDASVAVGGPSWNVK  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  AN++LP P   L  L   F N+GL+ +D+VALSG HT+G AQCF FR
Sbjct  148   LGRRDSTTASRALANSDLPGPSSSLDALISGFGNKGLSARDMVALSGAHTIGQAQCFLFR  207

Query  509   QRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSD  336
              RIY +  DID+ FA  R+  CP N G+ +LA LD  TP  FD  YFKNL+++KGLL SD
Sbjct  208   DRIYSNGTDIDAGFASTRRRQCPQNSGDGNLAPLDLVTPNSFDNNYFKNLMQRKGLLQSD  267

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF+GG TD +V  YSR    F++DFA +MIKMG+I+ LTG NG IR  C  +N
Sbjct  268   QVLFSGGSTDSIVSEYSRTPQTFASDFANAMIKMGEIELLTGQNGIIRRVCSAIN  322



>emb|CDP08160.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/298 (60%), Positives = 218/298 (73%), Gaps = 5/298 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP FY+  CP+AL TIR  +  A+ +ERRM  SL+RLHFHDCFV GCD S+LLD+T + 
Sbjct  28    LSPKFYDGTCPKALSTIRSSIRRAVSRERRMAASLIRLHFHDCFVQGCDGSVLLDATSSF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              SEK A AN NS RGFEVI+  K EV+++C   VVSCADIL+VAARD+ VA+GGPTW+VK
Sbjct  88    QSEKTAPANRNSVRGFEVIEAAKREVEKICP-GVVSCADILSVAARDASVAVGGPTWQVK  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   A  +LP+PF  LS L   F  +GL+ +++VALSG HT+G AQCF FR
Sbjct  147   LGRRDSTTASFSLAQTDLPSPFASLSDLISKFAAKGLSAREMVALSGSHTIGQAQCFVFR  206

Query  509   QRIYGD-KDIDSKFARQRQANCP-MNG-GNSSLASLD-PTPAYFDAKYFKNLVKKKGLLV  342
              RIY +  DID+ FA  R+  CP  NG G+S LA LD  TP  FD  YFKNL++KKGLL+
Sbjct  207   NRIYSNGTDIDAGFASTRRRQCPAANGVGDSKLAPLDLVTPNSFDNNYFKNLMRKKGLLI  266

Query  341   SDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNY  168
             SDQ LF+GG TD +V  YS+N   F +DFA +M+KMGDI+PLTG NG IR  C  VNY
Sbjct  267   SDQVLFSGGSTDSIVSEYSKNPRTFLSDFASAMVKMGDIEPLTGQNGIIRKICSAVNY  324



>ref|XP_009608056.1| PREDICTED: lignin-forming anionic peroxidase [Nicotiana tomentosiformis]
Length=319

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 216/295 (73%), Gaps = 3/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY++ CP AL TIR  +  AI  ERRM  SL+RLHFHDCFV GCDASILLD TP+I
Sbjct  26    LSATFYDNTCPNALNTIRTSIRQAISNERRMAASLIRLHFHDCFVQGCDASILLDETPSI  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             +SEK AL N  SARGF +I+  K EV+++C   VVSCADIL VAARD+  A+GGP+W VK
Sbjct  86    ESEKTALPNLGSARGFGIIEDAKREVEKICPE-VVSCADILTVAARDASAAVGGPSWTVK  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTASK  A  +LP PF  L++L  +F ++GL+ +D+VALSG HT+G AQCF FR
Sbjct  145   LGRRDSTTASKTLAETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHTIGQAQCFLFR  204

Query  509   QRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSD  336
              RIYG+  DID+ FA  R+  CP  G N +LA LD  TP  FD  YFKNL++KKGLL SD
Sbjct  205   DRIYGNGTDIDAGFASTRKRQCPQEGENGNLAPLDLVTPNQFDNNYFKNLIQKKGLLQSD  264

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF GG TD++V  YS +  AFS+DFA +MIKMGDI PLTG NG IR  C  VN
Sbjct  265   QVLFNGGSTDNIVSEYSNSPRAFSSDFAAAMIKMGDISPLTGQNGIIRKVCGSVN  319



>ref|XP_010695722.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/296 (58%), Positives = 217/296 (73%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP  L T++ +V+ A+  E RMG SLLRL FHDCFVNGCD S+LLD T + 
Sbjct  29    LSTNFYSSSCPNLLSTVKSVVQSAVNNEARMGASLLRLFFHDCFVNGCDGSVLLDDTSSF  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N  S RGF+V+D+IK+ V++ C   VVSCADILA++ARDSVV LGGPTW VK
Sbjct  89    TGEKNAFPNAGSLRGFDVVDQIKTAVEKAC-PGVVSCADILAISARDSVVILGGPTWNVK  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+TTAS+  AN N+P P   LS L ++F +QGL+  D+VALSG HT+G A+C TFR
Sbjct  148   LGRRDATTASQSAANTNIPAPTASLSALIKSFSDQGLSTTDMVALSGAHTIGQARCTTFR  207

Query  509   QRIYGDKDIDSKFARQRQANCP--MNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +ID+ FA+ RQANCP     G+++LA LD  TP  FD KY+ NLV +KGLL S
Sbjct  208   TRIYNESNIDASFAKTRQANCPSASTSGSNNLAPLDIQTPNTFDNKYYNNLVNQKGLLHS  267

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF+GG T+ LV+ YS N   F+ DF  +MI MGD+KPLTG+NG+IR NCR+ N
Sbjct  268   DQQLFSGGSTNALVQTYSSNPSRFNTDFVAAMINMGDVKPLTGSNGQIRKNCRKTN  323



>gb|EEC75221.1| hypothetical protein OsI_11488 [Oryza sativa Indica Group]
Length=326

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 217/301 (72%), Gaps = 6/301 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L P FY+ +CP ALPTI+ IVE+A+  E RMG SLLRLHFHDCFVNGCD SILLD TP  
Sbjct  26    LDPHFYDGLCPAALPTIKRIVEEAVAAEPRMGASLLRLHFHDCFVNGCDGSILLDDTPFF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NS RGF+VIDRIK  V+  C R VVSCADI+AVAARDS+VALGGP++ V 
Sbjct  86    TGEKNAAPNMNSVRGFDVIDRIKDAVNAACRRNVVSCADIVAVAARDSIVALGGPSYHVP  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  AN+++P P ++L  L  +F  QGL+V+DLV LSG HTLGF++C  FR
Sbjct  146   LGRRDARTASQAAANSSIPAPTLNLDGLVSSFAAQGLSVQDLVLLSGAHTLGFSRCTNFR  205

Query  509   QRIYGD-KDIDSKFARQRQANCP--MNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVS  339
              R+Y +   +D+  A      CP     G+ +LA LDPTPA FDA Y+ +L++ +GLL S
Sbjct  206   DRLYNETTTLDASLAASLGGTCPRTAGAGDDNLAPLDPTPARFDAAYYASLLRARGLLHS  265

Query  338   DQALFAG---GQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNY  168
             DQ LFAG   G TD LVR Y+ N  AF  DFA+SM++M  + PL G+ GE+RVNCR+VNY
Sbjct  266   DQQLFAGGGLGATDGLVRFYAANPDAFRRDFAESMVRMASLSPLVGSQGEVRVNCRKVNY  325

Query  167   Y  165
             Y
Sbjct  326   Y  326



>ref|XP_007137608.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
 gb|ESW09602.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
Length=320

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 220/296 (74%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CP+ L T++  ++ AI +E R+G SLLRL FHDCFVNGCD SILLD T + 
Sbjct  26    LSTNFYYTSCPKLLSTVKSSMQSAISKETRIGASLLRLFFHDCFVNGCDGSILLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARG+EVID IKS V++VC   VVSCADILA+AARDSV  LGGPTW+VK
Sbjct  86    TGEKNANPNRNSARGYEVIDSIKSAVEKVC-PGVVSCADILAIAARDSVGILGGPTWDVK  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  AN+ +P P  +L+QL   F   GL+ KD+VALSGGHT+G ++C +FR
Sbjct  145   LGRRDARTASQSAANSAIPPPTSNLNQLISKFSAVGLSTKDMVALSGGHTIGQSRCTSFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +ID+ FAR RQ++CP     G+++LA LD  TP  FD  YFKNLV+KKGLL S
Sbjct  205   ARIYNESNIDTSFARTRQSSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLHS  264

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +VR YS N  +FS+DF  +MIKMGDI PLTG+ GE+R NCRR+N
Sbjct  265   DQQLFNGGSTDSIVRGYSTNPSSFSSDFVTAMIKMGDITPLTGSKGEVRKNCRRIN  320



>ref|XP_009785653.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 213/294 (72%), Gaps = 1/294 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +L+ +FY+  CP  L  I+  V  AI +E RMG SLLRLHFHDCFVNGCDAS+LLD T +
Sbjct  22    ELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDDTSS  81

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
                EK A  N+ S RGF+VID IK++V+  C   VVSCADILAVAARDSVV LGGP+W V
Sbjct  82    FTGEKTANPNSGSLRGFDVIDTIKTQVESTCA-GVVSCADILAVAARDSVVKLGGPSWNV  140

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
              LGRRDSTTAS   ANN++P P ++LS L  +F N+G N +++VALSG HT+G A+C TF
Sbjct  141   LLGRRDSTTASLSAANNDIPAPTLNLSSLISSFSNKGFNSREMVALSGSHTIGQARCTTF  200

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R R+Y + +I+S F    +ANCP NGG+++L+ LD +P  FD  Y+KNL  +KG+L SDQ
Sbjct  201   RDRLYNETNINSSFGTTIKANCPQNGGDNNLSPLDTSPTSFDNVYYKNLQSQKGILHSDQ  260

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD +V  YS N   F  DFA +M+KMG++ PLTG NG+IR NCR++N
Sbjct  261   QLFNGGSTDSIVNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRKNCRKIN  314



>ref|XP_006664869.1| PREDICTED: cationic peroxidase 1-like [Oryza brachyantha]
Length=317

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 215/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP AL TIR  V  AI +E RMG SLLRLHFHDCFV GCD S+LLD TPT 
Sbjct  25    LSANFYDKSCPNALSTIRTAVRSAITKENRMGASLLRLHFHDCFVKGCDGSVLLDDTPTF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGF+VID IK++++ +C + VVSCADILAVAARDSVVALGGPTW V+
Sbjct  85    TGEKTAAPNNNSLRGFDVIDNIKAQIEGICPQ-VVSCADILAVAARDSVVALGGPTWVVQ  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS D ANN++P P +DL  L ++F N+GL+  D++ALSG HT+G A+C  FR
Sbjct  144   LGRRDSTTASLDAANNDIPAPTLDLGDLNKSFSNKGLSATDMIALSGAHTIGQARCVNFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY + +IDS  A   ++NCP   G+++++ LD  TP  FD  Y+KNL+KKKG+L SDQ
Sbjct  204   NRIYSETNIDSSLATSLKSNCPNTTGDNNISPLDASTPYVFDNFYYKNLLKKKGVLHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG  D     YS N   F  DF+ +M+KM +I PLTG++G+IR NCR+VN
Sbjct  264   QLFNGGSADSQTTTYSSNMATFFTDFSAAMVKMSNITPLTGSSGQIRKNCRKVN  317



>emb|CAD67479.1| peroxidase [Asparagus officinalis]
Length=320

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/296 (59%), Positives = 212/296 (72%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P+FY+  CP   PTI+ +V+ AI  E+RMG SLLRL FHDCFVNGCD S+LLD T + 
Sbjct  26    LTPNFYSSSCPTLFPTIKSVVQSAISSEKRMGASLLRLFFHDCFVNGCDGSLLLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA+ N  S RGF+VID+IK+ V++ C   VVSCADILAV ARDSVV LGGPTW VK
Sbjct  86    TGEKNAIPNKGSVRGFDVIDKIKTAVEQACPG-VVSCADILAVTARDSVVLLGGPTWNVK  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  ANNN+P P   LS L   F  QGL+ K++VAL G HT+G A+C  FR
Sbjct  145   LGRRDSRTASQSGANNNIPPPTSSLSNLISKFSAQGLSAKEMVALVGAHTIGQARCTNFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
               +Y D DID+ FA+ RQ+NCP     G+++LA LD  TP  FD  YFKNLV KKGLL S
Sbjct  205   AHVYNDTDIDATFAKTRQSNCPSTSGSGDNNLAPLDLQTPVAFDNNYFKNLVSKKGLLHS  264

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ +F+GG T+  V  YS +   +S+DF  +MIKMGDI PLTG +GEIR NCR+ N
Sbjct  265   DQQVFSGGSTNSQVSTYSTSPSTWSSDFVAAMIKMGDISPLTGKSGEIRKNCRKTN  320



>emb|CDP07980.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 213/295 (72%), Gaps = 3/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY+  CP AL TIR  +  AI +ERRM  SL+RLHFHDCFV GCD S+LLD TPTI
Sbjct  28    LSPTFYDTTCPNALTTIRTTIRSAISRERRMAASLIRLHFHDCFVQGCDGSVLLDETPTI  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              SEK +LAN  SARGF VI+  K+ V+++C   VVSCADILAVAARDS  A+GGP+W VK
Sbjct  88    QSEKTSLANRQSARGFNVIEDAKTAVEKIC-PGVVSCADILAVAARDSSAAVGGPSWTVK  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  A+++LP PF  LS L   F N+G   +++VALSG HT+G AQC TFR
Sbjct  147   LGRRDSTTASRSLADSDLPAPFHQLSTLISLFSNKGFTPREMVALSGAHTVGQAQCRTFR  206

Query  509   QRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSD  336
              RIY +  DID+ FA  RQ  CP  GG+S+LA LD  TP  FD  Y+KNLV+KKGLL+SD
Sbjct  207   GRIYSNGADIDTGFASTRQRQCPSTGGDSNLAPLDLVTPNQFDNNYYKNLVQKKGLLISD  266

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF G  TD  V  YS+N   FS+DF  +M+KMGD+ PLTG +G IR  C  +N
Sbjct  267   QTLFNGSSTDTFVTEYSQNPQTFSSDFGAAMVKMGDLSPLTGQDGIIRRVCSAIN  321



>ref|XP_010922691.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score =   355 bits (912),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 211/296 (71%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CPQ    ++ +V+ AI +E+RMG SLLRL FHDCFV GCD SILLD TPT 
Sbjct  26    LSTNFYASSCPQVFSAVKPVVQAAIAKEQRMGASLLRLFFHDCFVQGCDGSILLDDTPTF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A+ NNNS RGF+V+D IK+ V++VC   VVSCADILA+ +RDSVV LGGP W+VK
Sbjct  86    MGEKTAVPNNNSVRGFDVVDNIKAAVEKVC-PGVVSCADILAITSRDSVVILGGPNWDVK  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   ANNN+P P   LS L   F  QGL+ KD+VALSGGHT+G A+C  FR
Sbjct  145   LGRRDSTTASFSGANNNIPPPNSSLSNLISKFAAQGLSTKDMVALSGGHTIGQARCLNFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
               IY D DIDS FA+ RQ NCP     G+++LA LD  TP  FD  Y+KNL+ KKGLL S
Sbjct  205   AHIYNDTDIDSSFAKTRQMNCPSTSGSGDNNLAPLDLQTPTCFDNDYYKNLINKKGLLHS  264

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD  V  YS N   F++DF   MI MGDI PLTG++G+IR NCR+VN
Sbjct  265   DQELFNGGSTDSQVMTYSNNPSTFNSDFVTGMINMGDITPLTGSSGQIRKNCRKVN  320



>ref|XP_010041557.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   355 bits (911),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 214/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP AL TI+  V  A+K E RMG SLLRLHFHDCFVNGCDAS+LLD T   
Sbjct  27    LSSTFYSTSCPSALSTIKSAVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDTANF  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NS RGF+VID IKS+++  C   VVSCAD+L VAARDSVVALGGP+W V 
Sbjct  87    TGEKNATPNANSLRGFDVIDTIKSQLESAC-PGVVSCADLLTVAARDSVVALGGPSWTVP  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  AN+N+P P ++LS L   F N+G   K++VALSG HT+G A+C +FR
Sbjct  146   LGRRDSTTASQSAANSNIPAPTLNLSGLITAFSNKGFTTKEMVALSGSHTIGQARCTSFR  205

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQ  333
              R+Y + +I++ FA   +ANCP +GG+++L+ LD T P  FD  YFKNL  ++GLL SDQ
Sbjct  206   ARLYNENNINTTFATSLKANCPSSGGDNNLSPLDTTSPTSFDNAYFKNLQIQEGLLHSDQ  265

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  V  YS N   F  DFA +M+KMG++ PLTG++G+IR NCR VN
Sbjct  266   QLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKNCRNVN  319



>ref|XP_011070600.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=304

 Score =   355 bits (910),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 215/295 (73%), Gaps = 3/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSPSFYN  CP AL TIR  +  A+ +ERRM  SL+RLHFHDCFV GCDASILLD T TI
Sbjct  11    LSPSFYNSTCPNALSTIRTSIRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDDTSTI  70

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              SEK+A  N NSARGFEVI+  K EV+R+C   VVSCADIL +AARD+ VA+GGP+W V+
Sbjct  71    QSEKSAGPNANSARGFEVIEAAKREVERICP-GVVSCADILTLAARDASVAVGGPSWTVR  129

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTA++  AN++LP PF  L  L  +F N+GL  +++VALSG HTLG AQCF FR
Sbjct  130   LGRRDSTTANRAQANSDLPGPFSTLDGLISSFTNKGLIAREMVALSGAHTLGQAQCFLFR  189

Query  509   QRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSD  336
              RIY +  DID  FA  R+  CP  GG+S+LA LD  TP  FD  YFKNL ++KGLL SD
Sbjct  190   ARIYSNGTDIDPGFASTRRRQCPQTGGDSNLAPLDLVTPNSFDNNYFKNLQQRKGLLQSD  249

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF+GG TD +V  Y R+   F+ DFA +MIKMG+I+PLTG +G IR  C  +N
Sbjct  250   QVLFSGGSTDSIVSEYIRSPQTFARDFANAMIKMGEIQPLTGQSGIIRRVCNAIN  304



>gb|AHL39176.1| class III peroxidase [Populus trichocarpa]
Length=316

 Score =   355 bits (911),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 210/294 (71%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CP+AL TIR  V  A+ +E RMG SLLRLHFHDCFV GCDAS+LLD T + 
Sbjct  24    LSTTFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVQGCDASVLLDDTSSF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RG++VID IKS+++ +C   VVSCADILAVAARDSVVAL GP+W V+
Sbjct  84    TGEKTAGPNANSLRGYDVIDTIKSQLESIC-PGVVSCADILAVAARDSVVALSGPSWTVQ  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   AN++LP+P MDLS L  +F N+G   K++VALSG HT+G A+C  FR
Sbjct  143   LGRRDSTTASLGAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLLFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSDQ  333
              R+Y +  +DS  A   ++NCP  G + SL+SLD  TP  FD  YFKNL   KGLL SDQ
Sbjct  203   NRVYNETSLDSTLATSLKSNCPNTGSDDSLSSLDATTPVTFDNSYFKNLANNKGLLHSDQ  262

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  V+ YS N   F  DFA +M+KMG I PLTG++G+IR NC +VN
Sbjct  263   QLFSGGTTDSQVKTYSINSATFYADFASAMVKMGSISPLTGSDGQIRTNCAKVN  316



>ref|XP_008782618.1| PREDICTED: cationic peroxidase 1-like [Phoenix dactylifera]
Length=350

 Score =   356 bits (914),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 178/292 (61%), Positives = 212/292 (73%), Gaps = 3/292 (1%)
 Frame = -1

Query  1037  FYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEK  858
             FY+ VC QALPTI+ +VE AI  E RMG SL+RLHFHDCFVNGCD SILLD +PT   EK
Sbjct  57    FYDEVCSQALPTIKSVVEQAIASEPRMGASLVRLHFHDCFVNGCDGSILLDDSPTFTGEK  116

Query  857   NALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVKLGRR  678
              A  NNNS RGF+VID+IK  V+ VC   VVSCADILAVAARDSVVALGG +++V LGRR
Sbjct  117   TARPNNNSVRGFDVIDQIKDAVNDVCSENVVSCADILAVAARDSVVALGGSSYDVLLGRR  176

Query  677   DSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRIY  498
             DSTTASKD AN N+P+P  DL  L  NF++ GL ++DLV LSG HTLGFA+C +FR RIY
Sbjct  177   DSTTASKDAANTNIPSPLSDLPALVSNFESHGLALEDLVVLSGAHTLGFARCVSFRNRIY  236

Query  497   GDKD-IDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQALFA  321
              +   ID  FA   QA CP +G + +LA LD TP  FD  Y+++L+  KGLL SDQ LF 
Sbjct  237   NETSTIDGDFAASLQAVCPQSGDDDNLAQLDDTPESFDTAYYQDLMGSKGLLHSDQQLFM  296

Query  320   --GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
               G   D+ V+ YS +   FS DF  +MIKMG+I PLTG++GEIR NCR VN
Sbjct  297   GDGSAADEQVQSYSDDPDDFSADFGAAMIKMGNISPLTGSDGEIRENCRVVN  348



>ref|XP_010035872.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=317

 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 170/293 (58%), Positives = 209/293 (71%), Gaps = 1/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY   CP     +R     A+++E RMG S+LR+ FHDCFVNGCDAS+LLD T T 
Sbjct  26    LSPNFYTRTCPNVQGIVRNATTQAVRREPRMGASILRMFFHDCFVNGCDASVLLDDTATF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGFEVID IKS V+  C    VSCADILA+AARD VV LGGP+W V 
Sbjct  86    TGEKTARPNQNSLRGFEVIDTIKSRVEAACN-ATVSCADILALAARDGVVQLGGPSWAVP  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS   AN+ +P+PF  L+ L  +F  QGLN +D+ ALSGGH +G A+C TFR
Sbjct  145   LGRRDARTASLSGANSQIPSPFSSLATLISSFAAQGLNARDMTALSGGHAIGLARCTTFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + +ID+ FA  R+ NCP +GG+++LA LD TP  FD  Y++NLV ++GLL SDQ 
Sbjct  205   NRIYNETNIDASFATTRRTNCPASGGDANLAPLDRTPNRFDNNYYQNLVARRGLLHSDQE  264

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG  D LVR YS N+ AF++DFA +M+KMG+I PLTG NGEIR NCR VN
Sbjct  265   LFNGGSQDALVRTYSNNYRAFASDFAAAMVKMGNISPLTGRNGEIRRNCRVVN  317



>ref|XP_002450134.1| hypothetical protein SORBIDRAFT_05g001030 [Sorghum bicolor]
 gb|EES09122.1| hypothetical protein SORBIDRAFT_05g001030 [Sorghum bicolor]
Length=317

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 217/294 (74%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+ +FY+  CP AL TI+  V  A+ +E RMG SLLRLHFHDCFVNGCD S+LLD TPT 
Sbjct  25    LNANFYDKSCPNALYTIQTAVRSAVARENRMGASLLRLHFHDCFVNGCDGSVLLDDTPTF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A+ NNNS RGF+VID IK++++R+C + VVSCADI+AVAARDSVVALGGPTW V 
Sbjct  85    TGEKTAVPNNNSLRGFDVIDSIKAQLERICPQ-VVSCADIVAVAARDSVVALGGPTWAVN  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS D ANN++P P +DL+ LT++F N+GL+  D++ALSGGHT+G A+C  FR
Sbjct  144   LGRRDSLTASLDAANNDIPAPTLDLTDLTKSFSNKGLSASDMIALSGGHTIGQARCVNFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY + +ID+  A   + NCP   G+++++ LD  TP  FD  Y+KNL+ KKG+L SDQ
Sbjct  204   DRIYSEANIDTSLATSLKTNCPNKTGDNNISPLDASTPYVFDNFYYKNLLNKKGVLHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG  D     YS N   F  DF+ +M+KM +I PLTG++G+IR NCRRVN
Sbjct  264   QLFNGGSADSQTTTYSSNMAKFFTDFSTAMLKMSNISPLTGSSGQIRKNCRRVN  317



>ref|XP_010931328.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=316

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 215/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY   CP AL TI+  V  A+ +ERRMG SLLRLHFHDCFVNGCD SILLD TPT 
Sbjct  24    LSPTFYETSCPGALYTIQNAVRAAVFKERRMGASLLRLHFHDCFVNGCDGSILLDDTPTF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGF+VID IKS+V+ +C + VVSCADILAVAARDSVVALGGP+W V+
Sbjct  84    TGEKTAGPNNNSVRGFDVIDTIKSQVEAICTQ-VVSCADILAVAARDSVVALGGPSWAVQ  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+TTAS   AN+++P+P  DLS L   F  +GL+  D+VALSG HT+G A+C  FR
Sbjct  143   LGRRDATTASFSGANSDIPSPTSDLSALISAFSKKGLSTTDMVALSGAHTIGQARCTVFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSDQ  333
              R+Y + +ID+  A   ++NCP +GG+ +L+ LD  TP   D  Y+K+LV KKGLL SDQ
Sbjct  203   TRLYNETNIDASLATSLKSNCPSSGGDDNLSPLDAITPTIVDNFYYKDLVNKKGLLHSDQ  262

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              L+ GG TD  V  Y+ N   F +DFA +M+ MG+I PLTG +GEIR NCR++N
Sbjct  263   QLYNGGSTDSQVTTYANNFAKFYSDFAAAMVNMGNISPLTGTSGEIRTNCRKIN  316



>ref|XP_009594465.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=314

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 212/294 (72%), Gaps = 1/294 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +L+ +FY+  CP  L  I+  V  AI +E RMG SLLRLHFHDCFVNGCDAS+LLD T +
Sbjct  22    ELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDDTSS  81

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
                EK A  N+ S RGF+VID IK++V+  C   VVSCADILAVAARDSVV LGGP+W V
Sbjct  82    FTGEKTANPNSGSLRGFDVIDTIKTQVESTCA-GVVSCADILAVAARDSVVKLGGPSWNV  140

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
              LGRRDSTTAS   ANN++P P ++LS L  +F N+G N +++VALSG HT+G A+C TF
Sbjct  141   LLGRRDSTTASLSAANNDIPAPTLNLSSLISSFSNKGFNAREMVALSGSHTIGQARCTTF  200

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R R+Y + +I+S F    +ANCP NGG+++L+ LD +P  FD  Y+KNL  +KG+L SDQ
Sbjct  201   RDRLYNETNINSSFGTSIKANCPQNGGDNNLSPLDTSPTTFDNAYYKNLQSQKGILHSDQ  260

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD +V  YS N   F  DFA +M+KMG++ PLTG NG+IR NCR+ N
Sbjct  261   QLFNGGSTDSIVNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRKNCRKNN  314



>ref|XP_007048724.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOX92881.1| Peroxidase superfamily protein [Theobroma cacao]
Length=320

 Score =   355 bits (911),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 212/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP FY + CP     +R  +  A+ +E R+G S+LRL FHDCFVNGCDASILLD T T 
Sbjct  28    LSPKFYANSCPNLQTIVRNAMTQAVNRETRIGASILRLFFHDCFVNGCDASILLDDTATF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGFEVID IK+ V+  C    VSCADILA+AARD VV L GP+W+V 
Sbjct  88    TGEKNAAPNRNSARGFEVIDTIKTSVEAACS-ATVSCADILALAARDGVVLLKGPSWQVP  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANN LP+PF +LS LT +F  +GL+ +DL ALSGGHT+G A+C TFR
Sbjct  147   LGRRDARTASQSAANNQLPSPFSNLSALTSSFAAKGLSARDLTALSGGHTIGLARCTTFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY D +ID  FA  R+ANCP +GG+++LA LD  TP  FD  YF+NLV ++GLL SDQ
Sbjct  207   GRIYNDTNIDPNFAANRRANCPASGGDNNLAPLDIQTPTRFDNYYFRNLVAQRGLLHSDQ  266

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG  D LVR YS N   FS+DFA +M++MG+I PLTG  GEIR NCR VN
Sbjct  267   ELFNGGSQDALVRTYSTNPEVFSSDFAAAMVRMGNISPLTGTRGEIRRNCRVVN  320



>ref|XP_010931330.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=319

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 177/296 (60%), Positives = 214/296 (72%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P FY   CP+   T++ +V+ AI +E+RMG SLLRL FHDCFV GCDASILLD TPT 
Sbjct  25    LTPDFYAKSCPKLFSTVKPVVQAAIAKEKRMGASLLRLVFHDCFVQGCDASILLDDTPTF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGF+VID+IK+ V++VC   VVSCADIL + ARDSVV LGGP WEVK
Sbjct  85    RGEKTAAPNNNSVRGFDVIDKIKAAVEKVCPG-VVSCADILEITARDSVVILGGPFWEVK  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   AN N+P P   LS L   F  QGL+ KD+VALSG HT+G A+C  FR
Sbjct  144   LGRRDSTTASFSLANQNIPPPTSSLSNLINKFAAQGLSTKDMVALSGAHTIGKARCINFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNG--GNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + DI+S FA++RQANCP     G+++LA LD  TP YFD  Y++NL+ K+GLL S
Sbjct  204   NRIYNETDINSAFAKKRQANCPKTAGSGDNNLAPLDVQTPTYFDNDYYQNLIHKEGLLHS  263

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ L+ GG TD  V+ YS + G+F +DF   MI + DI PLTG+ GEIR NCRRVN
Sbjct  264   DQVLYNGGSTDFQVKTYSISPGSFYHDFVVGMINIADINPLTGSKGEIRKNCRRVN  319



>tpe|CAH69282.1| TPA: class III peroxidase 40 precursor [Oryza sativa Japonica 
Group]
Length=321

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 216/301 (72%), Gaps = 6/301 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L P FY+ +CP ALPTI+ IVE+A+  E RMG SLLRLHFHDCFVNGCD SILLD TP  
Sbjct  21    LDPHFYDGLCPAALPTIKRIVEEAVAAEPRMGASLLRLHFHDCFVNGCDGSILLDDTPFF  80

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NS RGF+VIDRIK  V+  C R VVSCADI+AVAARDS+V LGGP++ V 
Sbjct  81    TGEKNAAPNMNSVRGFDVIDRIKDAVNAACRRNVVSCADIVAVAARDSIVTLGGPSYHVP  140

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  AN+++P P ++L  L  +F  QGL+V+DLV LSG HTLGF++C  FR
Sbjct  141   LGRRDARTASQAAANSSIPAPTLNLDGLVSSFAAQGLSVQDLVLLSGAHTLGFSRCTNFR  200

Query  509   QRIYGDK-DIDSKFARQRQANCP--MNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVS  339
              R+Y +   +D+  A      CP     G+ +LA LDPTPA FDA Y+ +L++ +GLL S
Sbjct  201   DRLYNETATLDASLAASLGGTCPRTAGAGDDNLAPLDPTPARFDAAYYASLLRARGLLHS  260

Query  338   DQALFAG---GQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNY  168
             DQ LFAG   G TD LVR Y+ N  AF  DFA+SM++M  + PL G+ GE+RVNCR+VNY
Sbjct  261   DQQLFAGGGLGATDGLVRFYAANPDAFRRDFAESMVRMASLSPLVGSQGEVRVNCRKVNY  320

Query  167   Y  165
             Y
Sbjct  321   Y  321



>ref|XP_006470943.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=323

 Score =   355 bits (911),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 219/295 (74%), Gaps = 4/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY+  CP AL TIR  + +A+ +ERRM  SL+RLHFHDCFV GCDASILLD + +I
Sbjct  31    LSPTFYDATCPSALNTIRTGIRNAVSRERRMSASLIRLHFHDCFVQGCDASILLDDSSSI  90

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             DSEKNAL N  SARGFEVID +KS+++RVC   VVSCADI+AVAARD+  A+GGP+W VK
Sbjct  91    DSEKNALPNFKSARGFEVIDSVKSQLERVCP-GVVSCADIVAVAARDASFAVGGPSWTVK  149

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  A  NLP+    L +L   F  +GLN +DLVALSG HTLG AQC  FR
Sbjct  150   LGRRDSTTASRSLA-ENLPSFTDGLDKLISTFATKGLNARDLVALSGAHTLGQAQCAFFR  208

Query  509   QRIYGDK-DIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSD  336
              RIY ++ +ID+ FA  R+  CP NGG+S+L+ LD  TP  FD  YFKNL++KKGLL SD
Sbjct  209   DRIYSNQSNIDAGFASTRRRQCPANGGDSNLSPLDLVTPNSFDNNYFKNLIQKKGLLASD  268

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF+GG TD +V  YS+N   F +DFA +MIKM DI PLTG+ GEIR  C  VN
Sbjct  269   QVLFSGGSTDSIVDEYSKNPSKFKSDFAAAMIKMADISPLTGSAGEIRRVCNLVN  323



>ref|XP_007142069.1| hypothetical protein PHAVU_008G249900g [Phaseolus vulgaris]
 gb|ESW14063.1| hypothetical protein PHAVU_008G249900g [Phaseolus vulgaris]
Length=318

 Score =   355 bits (910),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 173/289 (60%), Positives = 212/289 (73%), Gaps = 2/289 (1%)
 Frame = -1

Query  1034  YNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEKN  855
             Y   CPQAL  IR  V  A+ +E RMG SLLRLHFHDCFVNGCDAS+LLD T +   EK+
Sbjct  31    YQSTCPQALSIIRSSVISAVAKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSSFTGEKS  90

Query  854   ALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVKLGRRD  675
             A AN NS RGFEVID IK++V+ VC   VVSCADI+AVAARDSVVALGGP+W V LGRRD
Sbjct  91    AGANVNSLRGFEVIDDIKTKVEAVC-PGVVSCADIVAVAARDSVVALGGPSWNVGLGRRD  149

Query  674   STTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRIYG  495
             STTASKD A  ++P+P MDLS L   F N+G N K++VALSG HT G A+C  FR R+Y 
Sbjct  150   STTASKDAATKDIPSPLMDLSALISAFANKGFNSKEMVALSGAHTTGLARCQLFRGRVYN  209

Query  494   DKDIDSKFARQRQANCPMNGGNSSLASLDPTPAY-FDAKYFKNLVKKKGLLVSDQALFAG  318
             +  I+S FA   ++NCP  GG+++L+ LD T +  FD  YFKNL+ +KGLL SDQ LF+G
Sbjct  210   ETSIESNFATSLKSNCPSTGGDTNLSPLDVTTSVQFDNAYFKNLINQKGLLHSDQQLFSG  269

Query  317   GQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             G TD  V  YS +  AF  DFA +M+KMG++ PLTG +G+IR +CR+VN
Sbjct  270   GSTDSQVTTYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRTDCRKVN  318



>ref|XP_004500339.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=318

 Score =   355 bits (910),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 210/294 (71%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY   CP+AL  I   V  A+ +E+RMG SLLRLHFHDCFVNGCDAS+LLD T + 
Sbjct  26    LSSDFYGTTCPKALSIINSAVCSAVSKEQRMGASLLRLHFHDCFVNGCDASVLLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK+A AN NS RGFEVID IK++++  C   +VSCADI+AVAARDSV ALGGP+W V 
Sbjct  86    TGEKSAGANVNSLRGFEVIDDIKTQLETAC-PGIVSCADIVAVAARDSVKALGGPSWSVG  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTASKD A N++P+P MDLS L   F N+G    ++V LSG HT G A+C  FR
Sbjct  145   LGRRDSTTASKDAATNDIPSPLMDLSDLISAFSNKGFTTNEMVVLSGAHTTGQARCQLFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTP-AYFDAKYFKNLVKKKGLLVSDQ  333
              RIY +  IDS FA   ++NCP  GG+S+L SLD T    FD  YFKNLV KKGLL SDQ
Sbjct  205   GRIYNETTIDSNFATSVKSNCPSTGGDSNLTSLDVTTNVLFDNAYFKNLVNKKGLLHSDQ  264

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  V  YS +   F+ DFA +M+KMG++ PLTGNNG+IR NC +VN
Sbjct  265   QLFSGGSTDSQVTTYSTSPSTFNADFASAMVKMGNLSPLTGNNGQIRTNCHKVN  318



>gb|ABF95843.1| Peroxidase 52 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59028.1| hypothetical protein OsJ_10775 [Oryza sativa Japonica Group]
Length=326

 Score =   355 bits (910),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 216/301 (72%), Gaps = 6/301 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L P FY+ +CP ALPTI+ IVE+A+  E RMG SLLRLHFHDCFVNGCD SILLD TP  
Sbjct  26    LDPHFYDGLCPAALPTIKRIVEEAVAAEPRMGASLLRLHFHDCFVNGCDGSILLDDTPFF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NS RGF+VIDRIK  V+  C R VVSCADI+AVAARDS+V LGGP++ V 
Sbjct  86    TGEKNAAPNMNSVRGFDVIDRIKDAVNAACRRNVVSCADIVAVAARDSIVTLGGPSYHVP  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  AN+++P P ++L  L  +F  QGL+V+DLV LSG HTLGF++C  FR
Sbjct  146   LGRRDARTASQAAANSSIPAPTLNLDGLVSSFAAQGLSVQDLVLLSGAHTLGFSRCTNFR  205

Query  509   QRIYGDK-DIDSKFARQRQANCP--MNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVS  339
              R+Y +   +D+  A      CP     G+ +LA LDPTPA FDA Y+ +L++ +GLL S
Sbjct  206   DRLYNETATLDASLAASLGGTCPRTAGAGDDNLAPLDPTPARFDAAYYASLLRARGLLHS  265

Query  338   DQALFAG---GQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNY  168
             DQ LFAG   G TD LVR Y+ N  AF  DFA+SM++M  + PL G+ GE+RVNCR+VNY
Sbjct  266   DQQLFAGGGLGATDGLVRFYAANPDAFRRDFAESMVRMASLSPLVGSQGEVRVNCRKVNY  325

Query  167   Y  165
             Y
Sbjct  326   Y  326



>ref|XP_003552299.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=322

 Score =   355 bits (910),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 216/293 (74%), Gaps = 1/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY+  CP AL TI+ +V+ A+  E RMG SLLRLHFHDCFV GCDAS+LL+ T + 
Sbjct  31    LSSDFYSTTCPNALSTIKSVVDSAVSNEARMGASLLRLHFHDCFVQGCDASVLLNDTTSF  90

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               E+ A  N NS RGF VID IKS+V+ +C   VVSCADILAVAARDSVVALGGP+W V+
Sbjct  91    TGEQTARGNVNSIRGFGVIDNIKSQVESLC-PGVVSCADILAVAARDSVVALGGPSWTVQ  149

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS  +AN++LP   + L QL++NF+N+GL   ++VALSGGHT+G AQC TFR
Sbjct  150   LGRRDSTTASLSSANSDLPRFDLSLQQLSDNFQNKGLTTAEMVALSGGHTIGQAQCSTFR  209

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + +IDS FA   QANCP  GG+S+LA LD +   FD  YFK+L  +KGLL +DQ 
Sbjct  210   TRIYNETNIDSSFATSLQANCPSVGGDSNLAPLDSSQNTFDNAYFKDLQSQKGLLHTDQV  269

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             LF GG TD  V  Y+ +  +F+ DFA +MIKMG+I PLTG++GEIR NC + N
Sbjct  270   LFNGGSTDSQVNGYASDPSSFNTDFANAMIKMGNISPLTGSSGEIRTNCWKTN  322



>ref|XP_008776455.1| PREDICTED: peroxidase 70-like [Phoenix dactylifera]
 ref|XP_008776456.1| PREDICTED: peroxidase 70-like [Phoenix dactylifera]
Length=318

 Score =   354 bits (909),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 175/293 (60%), Positives = 212/293 (72%), Gaps = 2/293 (1%)
 Frame = -1

Query  1043  PSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTIDS  864
             P FY+HVCP+ALP I+ +VE A+ +E RMG SLLRLHFHDCFVNGCD SILLD  P    
Sbjct  26    PDFYDHVCPEALPAIKAVVERAVAREPRMGASLLRLHFHDCFVNGCDGSILLDDAPGFTG  85

Query  863   EKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVKLG  684
             EK A  N NS RGF+V+D IK+ V+  C   VVSCADILA+AARDSV ALGGP + V LG
Sbjct  86    EKTAKPNLNSVRGFDVVDEIKNAVNEACHGNVVSCADILAIAARDSVAALGGPPYMVLLG  145

Query  683   RRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFRQR  504
             RRDS TAS + ANN++P P  + SQL  NF++ GL++KDLV LSGGHT+G A+C +FR R
Sbjct  146   RRDSRTASLNDANNDIPPPVFNFSQLLSNFRSHGLDLKDLVVLSGGHTIGLARCTSFRDR  205

Query  503   IYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQALF  324
             +Y + +ID  FA   +  CP +GG+ +LASLD TPA FD  YF  L+  +GLL SDQ LF
Sbjct  206   LYNETNIDRGFASILRNYCPTSGGDDNLASLDATPARFDTAYFNGLLHGRGLLHSDQQLF  265

Query  323   AGGQ--TDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
               GQ  +D LV  YS N  AF  DFA SM+KMG+I PLTGN GEIR+NCR+ N
Sbjct  266   KRGQGVSDGLVSFYSANPYAFWADFAVSMLKMGNISPLTGNRGEIRMNCRKAN  318



>ref|XP_008384726.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=320

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 211/295 (72%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FYN VCPQALP IR +V+ AI +E R+G SLLRLHFHDCFVNGCD SILLD T + 
Sbjct  26    LSAGFYNRVCPQALPAIRRVVKQAIFREPRIGASLLRLHFHDCFVNGCDGSILLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGF+VID IK+ VD+ C R VVSCADILAVAARDSV  LGGP ++V 
Sbjct  86    TGEKTAFPNVNSVRGFDVIDDIKNAVDKACKRSVVSCADILAVAARDSVFLLGGPLYQVP  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TA  + AN NLP P  +  QL  NF+  GL++ DLV LS  HT+G A+C TFR
Sbjct  146   LGRRDARTAXLNDANRNLPPPXFNFPQLLSNFQAHGLDLTDLVVLSAAHTIGLARCTTFR  205

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +ID  FA   Q NCP +GGN +   LD T   FD  YF +L+K+KGLL SDQ 
Sbjct  206   ARIYNDTNIDPSFAASAQQNCPSSGGNDNTLPLDATTRRFDTVYFNSLLKQKGLLHSDQE  265

Query  329   LFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L+   G  +D LV  YSRN  AF+ DF+ SMIKMG+IKPLTGN+GE+R+NCR++N
Sbjct  266   LYKNNGTDSDKLVFKYSRNPFAFARDFSASMIKMGNIKPLTGNDGELRLNCRKIN  320



>ref|XP_003519281.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=330

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/303 (59%), Positives = 221/303 (73%), Gaps = 9/303 (3%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P++Y+ VCP+ALP I+ IV+ AI +E+R+G SLLRLHFHDCFVNGCD S+LLD TP+ 
Sbjct  28    LTPNYYDKVCPKALPIIKSIVKQAIIREKRIGASLLRLHFHDCFVNGCDGSVLLDDTPSF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--WE  696
               EK AL N NS RGFEV+D IK  VD+ C RPVVSCADILAVAARDSV  LGG    ++
Sbjct  88    LGEKTALPNLNSIRGFEVVDEIKVAVDKACNRPVVSCADILAVAARDSVAILGGAQYWYQ  147

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRD+  ASKD AN NLP PF +  QL  +F++ GL++KDLV LSGGHT+G A+C T
Sbjct  148   VLLGRRDAIYASKDAANANLPPPFFNFPQLLASFQSHGLDLKDLVVLSGGHTIGLAKCIT  207

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNG--GNSSLASLDP-TPAYFDAKYFKNLVKKKGLL  345
             FR RI+ D  ID  FA   + +CP     G+++L  LD  +P+ FD  Y+K L+ KKGLL
Sbjct  208   FRDRIFNDTHIDPNFAATLRDSCPRRSGDGDTNLTPLDASSPSQFDNTYYKALLHKKGLL  267

Query  344   VSDQALFA----GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRR  177
              SDQ LF     GG++D LV+LYS +  AF+ DF  SMIKMG++KPLTG  GEIR NCR+
Sbjct  268   HSDQELFKGGDDGGESDRLVQLYSYDPYAFARDFGVSMIKMGNLKPLTGYEGEIRYNCRK  327

Query  176   VNY  168
             VNY
Sbjct  328   VNY  330



>ref|XP_010041648.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 213/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CP AL TI+  V  A+  E RMG SLLRLHFHDCFVNGCDASILLD T   
Sbjct  27    LSSTFYFTSCPSALHTIKSGVNSAVSSEARMGASLLRLHFHDCFVNGCDASILLDDTTNF  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A AN+NS RG+EVID IKS+++  C   VVSCADILAVAARDS+VALGGP+W V 
Sbjct  87    TGEKTAGANDNSIRGYEVIDTIKSQLESSC-PGVVSCADILAVAARDSIVALGGPSWRVL  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   AN+++P P + LS L   F N+G   K++VALSG HT+G A+C TF+
Sbjct  146   LGRRDSTTASLSAANSDIPAPTLSLSDLITAFSNKGFTAKEMVALSGSHTIGQARCTTFQ  205

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQ  333
              R+Y + DI+S FA   + NCP +GG+++L+ LD T P YFD  YFKNL  +KGLL SDQ
Sbjct  206   TRLYNESDINSTFATSLKENCPSSGGDNNLSPLDTTSPTYFDNAYFKNLQTQKGLLHSDQ  265

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  V  YS N   F  DFA +M+KMG++ PLTG++G+IR NCR++N
Sbjct  266   QLFSGGSTDAQVNTYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKNCRKLN  319



>dbj|BAM05634.1| peroxidase 2 [Eucalyptus pilularis]
 dbj|BAM05636.1| peroxidase 2 [Eucalyptus pyrocarpa]
Length=333

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 215/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSPS Y   CP+AL  ++  V  AIK E R+G SLLRLHFHDCFVNGCDASILLD TP+ 
Sbjct  41    LSPSHYQSTCPKALSIVQAGVAKAIKNETRIGASLLRLHFHDCFVNGCDASILLDDTPSF  100

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             + EK A  NNNS RGFEVIDRIK+ +++ C   VVSCADI+A+AARDSVV LGGP+W V 
Sbjct  101   EGEKTAAPNNNSVRGFEVIDRIKASLEKEC-HGVVSCADIVALAARDSVVYLGGPSWTVS  159

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  AN ++P P  +LS L  +F  QGL+VK++VALSG HT+G A+C  FR
Sbjct  160   LGRRDSITASRSLANTSIPPPTSNLSALITSFAAQGLSVKNMVALSGSHTIGLARCTIFR  219

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY D +ID+ FA + Q  CP  G +S L  LD  TP +FD  Y++NL++KKGLL SDQ
Sbjct  220   GRIYNDSNIDASFANKLQKICPKIGNDSVLQRLDIQTPTFFDNLYYRNLLQKKGLLHSDQ  279

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF G   D LV+ Y+ + G F  DFAK+MIKM  IKPLTG++G+IR NCR+VN
Sbjct  280   ELFNGSSVDSLVKKYACDTGKFFRDFAKAMIKMSKIKPLTGSSGQIRKNCRKVN  333



>emb|CAH10839.1| peroxidase [Picea abies]
Length=317

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 211/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+ +FYN +CP AL  ++  V  A+  E+RMG SLLRLHFHDCFVNGCD SILLD   T 
Sbjct  25    LTSTFYNKLCPTALSIVKAAVNKAVNNEKRMGASLLRLHFHDCFVNGCDGSILLDDNSTF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK AL N NS RGF+VID IK++V+  C   VVSCADILA+ ARDSVV LGGPTW V 
Sbjct  85    TGEKTALPNANSVRGFDVIDTIKTQVEAAC-SGVVSCADILAIVARDSVVQLGGPTWTVL  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   ANNN+P+P  +LS L  +F   GL+ KDLVALSGGHT+G A+C TFR
Sbjct  144   LGRRDSTTASLSAANNNIPSPASNLSALISSFTAHGLSTKDLVALSGGHTIGQARCTTFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY + +ID+ FA   +++CP  GG+++L+ LD  TP  FD KY+ +L  +KGLL SDQ
Sbjct  204   ARIYNESNIDTSFATSVKSSCPSAGGDNTLSPLDLATPTTFDNKYYTDLGNRKGLLHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG T+  V  YS N   F  DFA +M+KMG+I PLTG +G+IR NCR+ N
Sbjct  264   QLFSGGSTNSQVTTYSANQNTFFTDFAAAMVKMGNISPLTGTSGQIRKNCRKAN  317



>ref|XP_010035984.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/290 (60%), Positives = 213/290 (73%), Gaps = 2/290 (1%)
 Frame = -1

Query  1037  FYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEK  858
             +Y   CP+AL TI+  V+ A+ +E RMG SLLRLHFHDCFVNGCDASILLD T     EK
Sbjct  32    YYATRCPKALDTIKSAVKSAVAKEARMGASLLRLHFHDCFVNGCDASILLDDTANFTGEK  91

Query  857   NALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVKLGRR  678
              A  N NSARGF VID IKS+V+++C   VVSCADILAV ARDSVV LGG +W+V+LGRR
Sbjct  92    TAFPNVNSARGFNVIDTIKSKVEKLC-PGVVSCADILAVVARDSVVELGGRSWQVQLGRR  150

Query  677   DSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRIY  498
             DSTTAS + AN NLP P ++LS L  +F N+G   K++VALSG HT+G A+C TFR R+Y
Sbjct  151   DSTTASLNAANTNLPAPTLNLSALITSFSNKGFTAKEMVALSGSHTIGQARCVTFRNRLY  210

Query  497   GDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQALFA  321
              + DI S FA   +A CP +GG++ L+ LD T P  FD+ YF NLV +KGLL SDQ LF+
Sbjct  211   NENDISSSFATSLKAQCPSSGGDNKLSPLDITSPTSFDSAYFSNLVSQKGLLHSDQQLFS  270

Query  320   GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             GG T+  V  YS+N   F NDFAK+M+KMG + PLTG+ G+IR NC+RVN
Sbjct  271   GGSTNAQVTTYSKNLDLFKNDFAKAMVKMGGLSPLTGSAGQIRTNCKRVN  320



>gb|KHN29529.1| Cationic peroxidase 1 [Glycine soja]
Length=314

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 211/294 (72%), Gaps = 4/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CP AL TI+  V  A+  ERRMG SLLRLHFHDCF  GCDAS+LLD T + 
Sbjct  24    LSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCF--GCDASVLLDDTSSF  81

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N  S RGF+VID IKS+V+ +C   VVSCADILAVAARDSVVALGG TW V+
Sbjct  82    TGEKTAGPNAGSIRGFDVIDTIKSKVESLC-PGVVSCADILAVAARDSVVALGGTTWTVQ  140

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS  +AN++LP P   LS L  +F N+G + K+LVALSG HT+G AQC +FR
Sbjct  141   LGRRDSTTASLSSANSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFR  200

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY D +IDS FA+  Q NCP  GG+S+LA LD T P  FD  YFKNL  KKGLL SDQ
Sbjct  201   TRIYNDTNIDSSFAKSLQGNCPSTGGDSNLAPLDTTSPNTFDNAYFKNLQSKKGLLHSDQ  260

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD  V  YS N  +F  DFA +MIKMG++ PLTG++G+IR NCR+ N
Sbjct  261   ELFNGGSTDSQVNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  314



>dbj|BAM05635.1| peroxidase 2 [Eucalyptus pilularis]
Length=333

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 215/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSPS Y   CP+AL  ++  V  AIK E R+G SLLRLHFHDCFVNGCDASILLD TP+ 
Sbjct  41    LSPSHYQSTCPKALSIVQAGVAKAIKNETRIGASLLRLHFHDCFVNGCDASILLDDTPSF  100

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             + EK A  NNNS RGFEVIDRIK+ +++ C   VVSCADI+A+AARDSVV LGGP+W V 
Sbjct  101   EGEKTAAPNNNSVRGFEVIDRIKASLEKEC-HGVVSCADIVALAARDSVVYLGGPSWTVS  159

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  AN ++P P  +LS L  +F  QGL+VK++VALSG HT+G A+C  FR
Sbjct  160   LGRRDSITASRSLANTSIPPPTSNLSALITSFAAQGLSVKNMVALSGSHTIGLARCTIFR  219

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
             +RIY D +ID+ FA + Q  CP  G +S L  LD   P +FD  Y++NL++KKGLL SDQ
Sbjct  220   ERIYNDSNIDASFANKLQKICPKIGNDSVLQRLDIQMPTFFDNLYYRNLLQKKGLLHSDQ  279

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF G   D LV+ Y+ + G F  DFAK+MIKM  IKPLTG++G+IR NCR+VN
Sbjct  280   ELFNGSSVDSLVKKYACDTGKFFRDFAKAMIKMSKIKPLTGSSGQIRKNCRKVN  333



>ref|XP_006378807.1| hypothetical protein POPTR_0010s24330g [Populus trichocarpa]
 gb|ERP56604.1| hypothetical protein POPTR_0010s24330g [Populus trichocarpa]
Length=316

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 212/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP A   IR  +  AI +ERRM  SL+RLHFHDCFV GCDASILLD T +I
Sbjct  24    LSSTFYHKSCPNAESAIRTAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLDETSSI  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              SEK A AN NSARG+EVID+ K+EV+++C   VVSCADI+AVAARD+   +GGP+W VK
Sbjct  84    KSEKTAGANKNSARGYEVIDKAKAEVEKICP-GVVSCADIIAVAARDASAYVGGPSWAVK  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   A   LP    DL +L   F+ +GL  +D+VALSG H+LG AQCFTFR
Sbjct  143   LGRRDSTTASPTLAITELPAFSDDLGRLISRFQQKGLTARDMVALSGSHSLGQAQCFTFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RI+ D +ID+ FA  R+  CP+ G +S+LA LD  TP  FD  YFKNL++KKGLL SDQ
Sbjct  203   DRIHSDNNIDAGFASTRKRRCPLVGSDSTLAPLDLVTPNSFDNNYFKNLMQKKGLLQSDQ  262

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD +V  YSRN   FS+DFA +MIKMGDI PLTG  G+IR  C  VN
Sbjct  263   ELFSGGSTDSIVSEYSRNPAKFSSDFASAMIKMGDISPLTGTAGQIRRICSAVN  316



>ref|XP_009420366.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=317

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/295 (59%), Positives = 213/295 (72%), Gaps = 3/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP A+ TIR  V  A+ +E RMG SLLRLHFHDCFVNGCD S+LLD T   
Sbjct  24    LSSTFYSTSCPLAIQTIRLAVRAAVAKEARMGASLLRLHFHDCFVNGCDGSVLLDDTSGF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A+ NNNS RGF+VID IKS+V+ VC + VVSCADILAVAAR+SV ALGGP W V+
Sbjct  84    TGEKTAVPNNNSLRGFDVIDNIKSQVEAVC-KQVVSCADILAVAARESVAALGGPLWTVQ  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+TTAS D AN  +P+P  DL  L   +  +GL   D+VALSG HT+G A+C +FR
Sbjct  143   LGRRDATTASLDAANTEIPSPKSDLDDLISAYSKKGLGTTDMVALSGAHTIGQARCISFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNG-GNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSD  336
              RIY +  IDS  A  RQ+NCP +G G+ +L+ LD  T   FD  YF+NLVKKKGLL SD
Sbjct  203   DRIYNETSIDSSLATSRQSNCPSSGDGDDNLSPLDAVTCTLFDNFYFRNLVKKKGLLHSD  262

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF+GG TD LV  YS N   F +DFA +M+KMG+I PLTG +GE+R+NCR+ N
Sbjct  263   QQLFSGGSTDSLVTTYSTNTARFFSDFAAAMVKMGNISPLTGTDGEVRLNCRKTN  317



>ref|XP_008460239.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis melo]
Length=316

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 214/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS SFY+  CP AL TIR ++  AI QERRM  SL+RLHFHDCFV GCDASILLD TP++
Sbjct  24    LSSSFYDQTCPTALTTIRTVIRQAISQERRMAASLIRLHFHDCFVQGCDASILLDDTPSM  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               E+NA  N NSARG+ VI + K+EV+++C   VVSCADILAVAARD+  A+GGP+W VK
Sbjct  84    IGEQNAAPNRNSARGYGVIHKAKTEVEKICPG-VVSCADILAVAARDASFAVGGPSWTVK  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTASK  A N LP+    L +L   F N+GL+ +D+VALSG HT+G AQCF FR
Sbjct  143   LGRRDSTTASKTLAENELPHFQAGLDRLISIFSNKGLSTRDMVALSGSHTIGQAQCFLFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY   +ID+ FA  R+ NCP + GN +LA LD  TP  FD  YFKNLV++KGLL +DQ
Sbjct  203   NRIYNQTNIDAGFASTRRRNCPTSSGNGNLAPLDLVTPNSFDNNYFKNLVQRKGLLETDQ  262

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD +V  YSR+   F +DFA +MIKMG+I+PLTG  GEIR  C  VN
Sbjct  263   VLFNGGSTDSIVTEYSRDPTMFKSDFAAAMIKMGNIQPLTGLEGEIRNICGIVN  316



>gb|KHN44723.1| Peroxidase 4 [Glycine soja]
Length=314

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 174/295 (59%), Positives = 214/295 (73%), Gaps = 2/295 (1%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +L   FY+  CP  LP ++  V  AI++E RMG SLLRLHFHDCFVNGCDASILLD T  
Sbjct  21    ELCADFYSCTCPNLLPIVKKGVAKAIQKEPRMGASLLRLHFHDCFVNGCDASILLDDTSN  80

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
                E+ A ANN SARGF VI+ IK+ V++ C R VVSCADILA++ARDSVV LGGP+WEV
Sbjct  81    FIGEQTAAANNQSARGFNVINDIKASVEKECPR-VVSCADILALSARDSVVYLGGPSWEV  139

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
              LGRRDSTTAS+  ANN++P PF+ L+ L  NF NQGL+V DLVALSG HT+G A+C  F
Sbjct  140   GLGRRDSTTASRSDANNSIPGPFLSLTALINNFANQGLSVTDLVALSGAHTIGLAECKNF  199

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSD  336
             R  IY D ++D  + +  Q+ CP +G + +L  LD  TP +FD  YF+NLV KK LL SD
Sbjct  200   RAHIYNDSNVDPSYRKFLQSKCPRSGNDKTLEPLDHQTPIHFDNLYFQNLVSKKALLHSD  259

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF G  TD+LVR Y+ N  AF  DFAK M+KM +IKPLTG+ G+IR+NC +VN
Sbjct  260   QELFNGSSTDNLVRKYATNAAAFFEDFAKGMLKMSNIKPLTGSQGQIRINCGKVN  314



>gb|AHL39166.1| class III peroxidase [Populus trichocarpa]
Length=316

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 213/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP A   IR  +  AI +ERRM  SL+RLHFHDCFV GCDASILLD T +I
Sbjct  24    LSSTFYHKSCPNAESAIRTAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLDETSSI  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              SEK A AN NSARG+EVID+ K+EV+++C   VVSCADI+AVAARD+   +GGP+W VK
Sbjct  84    KSEKTAGANKNSARGYEVIDKAKAEVEKICP-GVVSCADIIAVAARDASAYVGGPSWAVK  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   A   LP    DL +L   F+ +GL  +D+VALSG H+LG AQCFTFR
Sbjct  143   LGRRDSTTASPTLAITELPAFSDDLGRLISRFQQKGLTARDMVALSGSHSLGQAQCFTFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RI+ D +ID+ FA  R+  CP+ G +S+LA LD  TP  FD  YFKNL++KKGLL SDQ
Sbjct  203   DRIHSDNNIDAGFASTRKRRCPLVGSDSTLAPLDLVTPNSFDNNYFKNLMQKKGLLQSDQ  262

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD +V  YSRN   FS+DFA +MIKMGDI PLTG+ G+IR  C  VN
Sbjct  263   ELFSGGSTDSIVSEYSRNPAKFSSDFASAMIKMGDISPLTGSAGQIRRICSAVN  316



>ref|XP_003545648.1| PREDICTED: peroxidase 4 [Glycine max]
Length=325

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 174/295 (59%), Positives = 214/295 (73%), Gaps = 2/295 (1%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +L   FY+  CP  LP ++  V  AI++E RMG SLLRLHFHDCFVNGCDASILLD T  
Sbjct  32    ELCADFYSCTCPNLLPIVKKGVAKAIQKEPRMGASLLRLHFHDCFVNGCDASILLDDTSN  91

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
                E+ A ANN SARGF VI+ IK+ V++ C R VVSCADILA++ARDSVV LGGP+WEV
Sbjct  92    FIGEQTAAANNQSARGFNVINDIKASVEKECPR-VVSCADILALSARDSVVYLGGPSWEV  150

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
              LGRRDSTTAS+  ANN++P PF+ L+ L  NF NQGL+V DLVALSG HT+G A+C  F
Sbjct  151   GLGRRDSTTASRSDANNSIPGPFLSLTALINNFANQGLSVTDLVALSGAHTIGLAECKNF  210

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSD  336
             R  IY D ++D  + +  Q+ CP +G + +L  LD  TP +FD  YF+NLV KK LL SD
Sbjct  211   RAHIYNDSNVDPSYRKFLQSKCPRSGNDKTLEPLDHQTPIHFDNLYFQNLVSKKALLHSD  270

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF G  TD+LVR Y+ N  AF  DFAK M+KM +IKPLTG+ G+IR+NC +VN
Sbjct  271   QELFNGSSTDNLVRKYATNAAAFFEDFAKGMLKMSNIKPLTGSQGQIRINCGKVN  325



>ref|XP_010035985.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 170/290 (59%), Positives = 214/290 (74%), Gaps = 2/290 (1%)
 Frame = -1

Query  1037  FYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEK  858
             +Y   CP+AL TI   V+ A+  E RMG SLLRLHFHDCFVNGCD SILLD T     EK
Sbjct  32    YYEKGCPKALQTIGSAVKSAVANESRMGASLLRLHFHDCFVNGCDGSILLDDTANFTGEK  91

Query  857   NALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVKLGRR  678
              A  N NS RGF+V+D IKSEV+++C   VVSCADILA+ ARDSVV LGG +W+V+LGRR
Sbjct  92    TAFPNLNSLRGFDVVDTIKSEVEKLC-PGVVSCADILAIVARDSVVELGGQSWQVQLGRR  150

Query  677   DSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRIY  498
             DSTTAS +TAN +LP P ++LS L  +F N+G   +++V LSG HT+G ++C TFR R+Y
Sbjct  151   DSTTASLNTANTDLPAPTLNLSALITSFSNKGFTAEEMVTLSGSHTIGQSRCVTFRARLY  210

Query  497   GDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQALFA  321
              + +IDS FA   +ANCP +GG+++L+ LD T P  FD  YF NLV +KGLL SDQ LF+
Sbjct  211   NESNIDSSFATTLKANCPSSGGDNNLSPLDVTSPTSFDNAYFTNLVCQKGLLHSDQQLFS  270

Query  320   GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             GG T+  V  YS+N G+F NDFAK+M+KMG + PLTG+ G+IR NCRRVN
Sbjct  271   GGSTNAQVTAYSKNFGSFQNDFAKAMVKMGGLSPLTGSTGQIRTNCRRVN  320



>ref|XP_010552918.1| PREDICTED: peroxidase P7-like [Tarenaya hassleriana]
Length=319

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/296 (59%), Positives = 217/296 (73%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+ +FY   CP+ +PT+R +++ A+K+E R+G S+LRL FHDCFVNGCD SILLD T + 
Sbjct  25    LTTNFYASSCPKLIPTVRSVMQSAVKREARIGASILRLFFHDCFVNGCDGSILLDDTSSF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NS RGF+VID IK+  ++ C   +VSCADILA+AARD VV LGGP+WEVK
Sbjct  85    TGEKNAGPNRNSVRGFDVIDNIKTAAEKAC-PGIVSCADILAIAARDGVVLLGGPSWEVK  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  AN ++P P  +LS+L  +F N GL+ +D+VALSGGHT+G A+C TFR
Sbjct  144   LGRRDSRTASQSAANRDIPAPTFNLSRLVSSFSNVGLSARDMVALSGGHTIGQARCTTFR  203

Query  509   QRIYGDKDIDSKFARQRQANCP-MNG-GNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY +K+I+S FA  RQ NCP  NG G+ +LA LD  TP  FD  YFKNL+ +KGLL S
Sbjct  204   ARIYNEKNINSAFAATRQRNCPRTNGSGDGNLAPLDIQTPTKFDNNYFKNLMVQKGLLHS  263

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +VR Y      FS+DF  +MI+MGDI PLTG  GEIR NCRRVN
Sbjct  264   DQELFNGGSTDSIVRTYGTKPATFSSDFTAAMIRMGDISPLTGKKGEIRRNCRRVN  319



>ref|XP_007206242.1| hypothetical protein PRUPE_ppa015551mg [Prunus persica]
 gb|EMJ07441.1| hypothetical protein PRUPE_ppa015551mg [Prunus persica]
Length=320

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 212/295 (72%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS SFYN VCPQALP IR +V+ AI +E R+G SLLRLHFHDCFVNGCD SILLD T + 
Sbjct  26    LSASFYNRVCPQALPAIRRVVKQAIFREPRIGASLLRLHFHDCFVNGCDGSILLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGF+VID IK+ VD+ C   VVSCADILAVAARDSV  L GP ++V+
Sbjct  86    TGEKTAFPNANSVRGFDVIDDIKNAVDKACKGSVVSCADILAVAARDSVFLLAGPLYQVQ  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS + AN NLP P    SQL  NF+  GL++ DLV LS  HT+G A+C TFR
Sbjct  146   LGRRDARTASLNDANRNLPPPVFSFSQLLSNFQAHGLDLTDLVVLSAAHTIGLARCGTFR  205

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +ID  FA   + NCP +GG+ +   LD T   FD  YFK+L+++KGLL SDQ 
Sbjct  206   ARIYNDTNIDPNFAVSARQNCPSSGGDDNTEPLDATTRRFDTVYFKSLLQQKGLLHSDQE  265

Query  329   LFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L+   G  +D LV  YSRN  AF+ DF+ SMIKMG IKPLTGN+GE+R+NCR++N
Sbjct  266   LYKNNGTDSDKLVLKYSRNPFAFARDFSASMIKMGSIKPLTGNDGEVRLNCRKIN  320



>ref|NP_001289531.1| lignin-forming anionic peroxidase precursor [Nicotiana sylvestris]
 sp|Q02200.1|PERX_NICSY RecName: Full=Lignin-forming anionic peroxidase; Flags: Precursor 
[Nicotiana sylvestris]
 gb|AAA34050.1| anionic peroxidase [Nicotiana sylvestris]
Length=322

 Score =   353 bits (905),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 215/295 (73%), Gaps = 3/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY++ CP AL TIR  V  AI  ERRM  SL+RLHFHDCFV GCDASILLD TP+I
Sbjct  29    LSATFYDNTCPNALNTIRTSVRQAISSERRMAASLIRLHFHDCFVQGCDASILLDETPSI  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             +SEK AL N  SARGF +I+  K EV+++C   VVSCADIL VAARD+  A+GGP+W VK
Sbjct  89    ESEKTALPNLGSARGFGIIEDAKREVEKIC-PGVVSCADILTVAARDASAAVGGPSWTVK  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTASK  A  +LP PF  L++L  +F ++GL+ +D+VALSG HT+G AQCF FR
Sbjct  148   LGRRDSTTASKTLAETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHTIGQAQCFLFR  207

Query  509   QRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSD  336
              RIY +  DID+ FA  R+  CP  G N +LA LD  TP  FD  YFKNL++KKGLL SD
Sbjct  208   DRIYSNGTDIDAGFASTRRRQCPQEGENGNLAPLDLVTPNQFDNNYFKNLIQKKGLLQSD  267

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF GG TD++V  YS +  AFS+DFA +MIKMGDI PL+G NG IR  C  VN
Sbjct  268   QVLFNGGSTDNIVSEYSNSARAFSSDFAAAMIKMGDISPLSGQNGIIRKVCGSVN  322



>ref|XP_006378808.1| hypothetical protein POPTR_0010s24340g [Populus trichocarpa]
 ref|XP_006387937.1| Peroxidase 5 precursor family protein [Populus trichocarpa]
 gb|ERP46851.1| Peroxidase 5 precursor family protein [Populus trichocarpa]
 gb|ERP56605.1| hypothetical protein POPTR_0010s24340g [Populus trichocarpa]
 gb|AHL39167.1| class III peroxidase [Populus trichocarpa]
Length=317

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 211/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP+A   IR  +  AI +ERRM  SL+RLHFHDCFV GCDASILLD T +I
Sbjct  25    LSSAFYHKSCPKAESAIRTAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLDETSSI  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              SEK A  NNNS RG+EVID+ KS+V+++C   VVSCADI+AVAARD+   +GGP+W VK
Sbjct  85    QSEKTAGGNNNSVRGYEVIDKAKSKVEKICP-GVVSCADIIAVAARDASAYVGGPSWAVK  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   A   LP  F DL +L   F+ +GL  +D+VALSG HTLG AQCFTFR
Sbjct  144   LGRRDSTTASPALAITELPAFFDDLGRLISRFQQKGLTARDMVALSGSHTLGQAQCFTFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY   +ID+ FA  R+  CP  GG ++LA LD  TP  FD  YFKNL++ KGLL SDQ
Sbjct  204   DRIYNASNIDAGFASTRKRRCPRAGGQANLAPLDLVTPNSFDNNYFKNLMRNKGLLQSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD +V  YSRN   FS+DFA +MIKMGDI+PLTG+ G+IR  C  VN
Sbjct  264   VLFNGGSTDSIVSEYSRNPAKFSSDFASAMIKMGDIRPLTGSAGQIRRICSAVN  317



>gb|KHN46099.1| Cationic peroxidase 1 [Glycine soja]
Length=310

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 177/303 (58%), Positives = 221/303 (73%), Gaps = 9/303 (3%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P++Y+ VCP+ALP I+ IV+ AI +E+R+G SLLRLHFHDCFVNGCD S+LLD TP+ 
Sbjct  8     LTPNYYDKVCPKALPIIKSIVKQAIIREKRIGASLLRLHFHDCFVNGCDGSVLLDDTPSF  67

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPT--WE  696
               EK AL N NS RGFEV+D IK  VD+ C RPVVSCADILAVAARDSV  LGG    ++
Sbjct  68    LGEKTALPNLNSIRGFEVVDEIKVAVDKACNRPVVSCADILAVAARDSVAILGGAQYWYQ  127

Query  695   VKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             V LGRRD+  ASKD AN NLP PF +  QL  +F++ GL++KDLV LSGGHT+G A+C T
Sbjct  128   VLLGRRDAIYASKDAANANLPPPFFNFPQLLASFQSHGLDLKDLVVLSGGHTIGLAKCIT  187

Query  515   FRQRIYGDKDIDSKFARQRQANCPMNG--GNSSLASLDP-TPAYFDAKYFKNLVKKKGLL  345
             FR RI+ +  ID  FA   + +CP     G+++L  LD  +P+ FD  Y+K L+ KKGLL
Sbjct  188   FRDRIFNETHIDPNFAATLRDSCPRRSGDGDTNLTPLDASSPSQFDNTYYKALLHKKGLL  247

Query  344   VSDQALFA----GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRR  177
              SDQ LF     GG++D LV+LYS +  AF+ DF  SMIKMG++KPLTG  GEIR NCR+
Sbjct  248   HSDQELFKGGDDGGESDRLVQLYSYDPYAFARDFGVSMIKMGNLKPLTGYEGEIRYNCRK  307

Query  176   VNY  168
             VNY
Sbjct  308   VNY  310



>ref|XP_010664359.1| PREDICTED: cationic peroxidase 1 isoform X3 [Vitis vinifera]
Length=316

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 210/293 (72%), Gaps = 1/293 (0%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CP+AL TIR  V +A+ +ERRMG SLLRLHFHDCFV GCDASILLD T   
Sbjct  24    LSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTANF  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RG++VID IKS+++ +C   VVSCADI+AVAARDSVVALGGPTW V+
Sbjct  84    TGEKTAGPNNNSVRGYDVIDTIKSQMESLC-PGVVSCADIVAVAARDSVVALGGPTWTVQ  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS  TAN++LP P  DL  L   F N+G   +++V LSG HT+G AQC  FR
Sbjct  143   LGRRDSTTASFSTANSDLPAPTSDLDALISLFSNKGFTTQEMVVLSGTHTIGKAQCSKFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY + +ID+ FA  +QA CP +GG+ +L+ LD T   FD  YF NL++KKGLL SDQ 
Sbjct  203   DRIYNETNIDATFATSKQAICPSSGGDENLSDLDETTTVFDNVYFTNLIEKKGLLHSDQQ  262

Query  329   LFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L+ G  TD +V  YS +   F  D A +M+KMG++ PLTG +GEIR NCR +N
Sbjct  263   LYNGNSTDSMVETYSNDSTTFFTDVASAMVKMGNLSPLTGTDGEIRTNCRAIN  315



>ref|XP_006387938.1| hypothetical protein POPTR_0466s00210g [Populus trichocarpa]
 gb|ERP46852.1| hypothetical protein POPTR_0466s00210g [Populus trichocarpa]
Length=316

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 211/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP+A   IR  +  AI +ERRM  SL+RLHFHDCFV GCDASILLD T +I
Sbjct  24    LSSAFYDKSCPKAESAIRTAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLDETSSI  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              SEK A  NNNS RG+EVID+ KS+V+++C   VVSCADI+AVAARD+   +GGP+W VK
Sbjct  84    QSEKTAGGNNNSVRGYEVIDKAKSKVEKICP-GVVSCADIIAVAARDASAYVGGPSWAVK  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
              GRRDSTTAS+  AN  LP  F  L +L   F+ +GL  +D+VALSG HTLG AQCFTFR
Sbjct  143   FGRRDSTTASRTLANAELPAFFDRLDRLISRFQKKGLTARDMVALSGSHTLGQAQCFTFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY   +ID+ FA  R+  CP  GG ++LA LD  TP  FD  YFKNL++ KGLL SDQ
Sbjct  203   DRIYNASNIDAGFASTRKRRCPRAGGQANLAPLDLVTPNSFDNNYFKNLMRNKGLLQSDQ  262

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD +V  YSRN   FS+DFA +MIKMGDI+PLTG+ G+IR  C  VN
Sbjct  263   VLFNGGSTDSIVSEYSRNPAKFSSDFASAMIKMGDIRPLTGSAGQIRRICSAVN  316



>ref|XP_008244539.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=320

 Score =   352 bits (904),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 212/295 (72%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS SFYN VCPQALP IR +V+ AI +E R+G SLLRLHFHDCFVNGCD SILLD T + 
Sbjct  26    LSASFYNSVCPQALPAIRRVVKQAIFREPRIGASLLRLHFHDCFVNGCDGSILLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGF+VID IK+ VD+ C   VVSCADILAVAARDSV  L GP ++V+
Sbjct  86    TGEKTAFPNANSVRGFDVIDDIKNAVDKACKGSVVSCADILAVAARDSVFLLEGPLYQVQ  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS + AN NLP P    SQL  NF+  GL++ DLV LS  HT+G A+C TFR
Sbjct  146   LGRRDARTASLNDANRNLPPPVFSFSQLLSNFQAHGLDLTDLVVLSAAHTIGLARCGTFR  205

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +ID  FA   + NCP +GG+ +   LD T   FD  YFK+L+++KGLL SDQ 
Sbjct  206   ARIYNDTNIDPNFAASARQNCPSSGGDDNTEPLDATTRRFDTIYFKSLLQQKGLLHSDQE  265

Query  329   LFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L+   G  +D LV  YSRN  AF+ DF+ SMIKMG IKPLTGN+GE+R+NCR++N
Sbjct  266   LYKNNGTDSDKLVLKYSRNPFAFARDFSASMIKMGSIKPLTGNDGEVRLNCRKIN  320



>ref|XP_010261059.1| PREDICTED: cationic peroxidase 1-like isoform X1 [Nelumbo nucifera]
Length=318

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 217/294 (74%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY   CP ALP I   V  A+ QERRMG SLLRLHFHDCFVNGCDASILLD TPT 
Sbjct  26    LSPTFYATTCPLALPVISTAVNLAVAQERRMGASLLRLHFHDCFVNGCDASILLDDTPTF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK AL N NS RG+EVID IK++++ +C   V+SCADILAVAARD+VVALGG TW V+
Sbjct  86    TGEKTALPNANSVRGYEVIDSIKAQLELLC-PGVISCADILAVAARDAVVALGGITWTVQ  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS D AN ++P+PF++L  L   F N+G  V +LVALSG HT+G A+C  FR
Sbjct  145   LGRRDSTTASLDVANTDIPSPFLNLDDLITAFANKGFTVNELVALSGSHTIGQARCLLFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY + +ID++FA   ++NCP  GG+++LA+ D  TP  FD  YF NL+  KGLL SDQ
Sbjct  205   DRIYKETNIDTQFAIALRSNCPTAGGDNNLANFDTTTPTVFDNAYFTNLLANKGLLHSDQ  264

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD  VR YS N  AF  DF  +MIKMG++ PLTG+NG+IR NCRRVN
Sbjct  265   QLFTGGSTDAQVRTYSINSAAFFTDFGNAMIKMGNLSPLTGSNGQIRANCRRVN  318



>ref|XP_003616748.1| Peroxidase [Medicago truncatula]
 gb|AES99706.1| class III peroxidase [Medicago truncatula]
Length=325

 Score =   352 bits (904),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 179/297 (60%), Positives = 210/297 (71%), Gaps = 4/297 (1%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
             +LS  +Y   CP+   T++C V+ AI +E RMG SLLRL FHDCFVNGCD SILLD T +
Sbjct  30    NLSKDYYYSSCPKLFETVKCEVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSS  89

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
                EK A  N NSARGFEVID+IKS V++VC    VSCADIL + ARDSV  LGGPTW+V
Sbjct  90    FTGEKTANPNKNSARGFEVIDKIKSAVEKVC-PGAVSCADILTITARDSVEILGGPTWDV  148

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             KLGRRD+ TASK  ANN++P P   L+QL   F   GL+ KDLVALSGGHT+G A+C TF
Sbjct  149   KLGRRDARTASKSAANNDIPAPTSSLNQLISRFNALGLSTKDLVALSGGHTIGQARCTTF  208

Query  512   RQRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLV  342
             R  IY D +ID+ FAR RQ+ CP     G+++LA LD  TP  FD  YFKNLV  KGLL 
Sbjct  209   RAHIYNDSNIDTSFARTRQSGCPKTSGSGDNNLAPLDLATPTSFDNHYFKNLVDSKGLLH  268

Query  341   SDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             SDQ LF GG TD +V  YS    +FS+DF  +MIKMGDI PLTG+NGEIR  CR VN
Sbjct  269   SDQQLFNGGSTDSIVHEYSLYPSSFSSDFVTAMIKMGDISPLTGSNGEIRKQCRSVN  325



>emb|CDP13933.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   352 bits (904),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 178/297 (60%), Positives = 215/297 (72%), Gaps = 5/297 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY H CP    T++  V+ AI +E RMG SLLRL FHDCFVNGCD S+LLD T + 
Sbjct  26    LSTNFYYHSCPNLFSTVKSTVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NSARGFEV+D IKS V+R C   VVSCAD+LA+AARDSV  LGGP W+VK
Sbjct  86    RGEKRAAPNFNSARGFEVVDNIKSAVERACP-GVVSCADVLAIAARDSVEILGGPRWDVK  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANN++P P  +L+ L   F   GL+ +DLVALSG HT+G A+C  FR
Sbjct  145   LGRRDARTASQAAANNSIPPPTTNLNALISRFSAVGLSARDLVALSGSHTIGLARCTNFR  204

Query  509   QRIYGD-KDIDSKFARQRQANCP--MNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLV  342
              RIY +  ++DS  AR RQ+NCP     G+++LA LD  TP  FD  YFKNLV ++GLL 
Sbjct  205   ARIYNETNNLDSSLARTRQSNCPSVSGSGDNNLAPLDLQTPTNFDNNYFKNLVNRRGLLH  264

Query  341   SDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             SDQ LF GG TD  VR YS N G+F++DFA +MIKMGDIKPLTG+NGEIR NCRR+N
Sbjct  265   SDQQLFNGGSTDSAVRAYSNNPGSFASDFAAAMIKMGDIKPLTGSNGEIRKNCRRIN  321



>ref|XP_004138400.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
 ref|XP_004160737.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
Length=322

 Score =   352 bits (904),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 214/296 (72%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY+  CP  L T++  V  A+  E RMG S+LRL FHDCFVNGCD SILLD T + 
Sbjct  28    LSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLFFHDCFVNGCDGSILLDDTSSF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGF+VID IK+ V++ C   VVSCADILA+AARDSVV LGGP+W VK
Sbjct  88    TGEKNANPNRNSARGFDVIDNIKTAVEKAC-PGVVSCADILAIAARDSVVLLGGPSWNVK  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  ANN++P P   LSQL+  F   GL+  DLVALSGGHT+G A+C TFR
Sbjct  147   LGRRDSTTASQSQANNDIPGPTSSLSQLSSRFSALGLSSTDLVALSGGHTIGQARCTTFR  206

Query  509   QRIYGD-KDIDSKFARQRQANCPMNG--GNSSLASLDPTPAYFDAKYFKNLVKKKGLLVS  339
              RIY +  +I+S FAR RQ+NCP     G+++LA LD TP  FD  Y+KNLV+ KGLL S
Sbjct  207   SRIYSNSSNIESSFARTRQSNCPNTSGTGDNNLAPLDFTPTSFDNNYYKNLVQNKGLLQS  266

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +V+ Y+     F +DFA +M+KMGDI PLTG+NG+IR NCR VN
Sbjct  267   DQVLFNGGSTDSVVQNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRKNCRMVN  322



>ref|XP_003557955.1| PREDICTED: peroxidase P7-like [Brachypodium distachyon]
Length=326

 Score =   352 bits (904),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 211/298 (71%), Gaps = 3/298 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L   FY+ VCP ALP I+ +VE A+  E RMG SLLRLHFHDCFVNGCD SILLD TP+ 
Sbjct  29    LDACFYDKVCPAALPAIKTVVEQAVAVEPRMGASLLRLHFHDCFVNGCDGSILLDDTPSF  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NS RGF+VIDRIK  VD  C   VVSCADILA AARDS+VALGGP++ V 
Sbjct  89    TGEKNAAPNANSVRGFDVIDRIKDAVDAACRGNVVSCADILAAAARDSIVALGGPSYAVP  148

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  ANN++P P +DL  L  NF + GL+V+DLV LSGGHTLGF++C  FR
Sbjct  149   LGRRDSRTASQAAANNSIPAPTLDLGGLVSNFASHGLSVQDLVVLSGGHTLGFSRCTNFR  208

Query  509   QRIYGD-KDIDSKFARQRQANCPMNGGNS--SLASLDPTPAYFDAKYFKNLVKKKGLLVS  339
              R+Y +   +D+  A   +A CP   G+   +LA LDPTPA FD  Y+ +L++ K LL S
Sbjct  209   DRLYNETATLDASLAASLRAVCPRPAGDGDDNLAPLDPTPARFDGAYYGSLLRSKALLHS  268

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNYY  165
             DQ L A G T+ LVR Y  N  AF  DFA++M++M  + PLTG++GEIR NCR+VN Y
Sbjct  269   DQQLLAAGATEGLVRFYGANPEAFRRDFAEAMVRMSSLAPLTGSSGEIRANCRKVNGY  326



>ref|XP_006468150.1| PREDICTED: peroxidase 52-like [Citrus sinensis]
 ref|XP_006468154.1| PREDICTED: peroxidase 52-like [Citrus sinensis]
Length=287

 Score =   351 bits (900),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 174/287 (61%), Positives = 211/287 (74%), Gaps = 2/287 (1%)
 Frame = -1

Query  1025  VCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTIDSEKNALA  846
             +CPQALPTIR +V +AI  E RMG SLLRLHFHDCFVNGCD S+LLD T     EK A+ 
Sbjct  1     MCPQALPTIRTVVRNAITNETRMGASLLRLHFHDCFVNGCDGSLLLDDTANFVGEKTAIP  60

Query  845   NNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVKLGRRDSTT  666
             NNNS RGF+VID IK  V+  C   VVSCADI+AVAARDSV  LGGP + V+LGRRD+ T
Sbjct  61    NNNSVRGFDVIDEIKQAVNTACKGNVVSCADIVAVAARDSVNLLGGPCYPVQLGRRDART  120

Query  665   ASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFRQRIYGDKD  486
             AS + AN NLP+PF + S L  NF++QGLN++DLVALSGGH++G A+C +FR RIY D D
Sbjct  121   ASFNDANANLPSPFSNFSVLLSNFQSQGLNLQDLVALSGGHSIGLARCPSFRNRIYNDSD  180

Query  485   IDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQALFAGGQTD  306
             ID  FA  +Q NCP+ GG  +   LD T   FD +YFK+L+  +GLL SDQ LF    +D
Sbjct  181   IDPVFAASKQKNCPVTGGTFNTEPLDATTTLFDNQYFKDLIASRGLLHSDQQLFKNDSSD  240

Query  305   D--LVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
                LVR YS N  +F++DF+ SMIKMG++  LTGNNGEIR+NCRRVN
Sbjct  241   SDRLVRKYSTNPISFASDFSASMIKMGNLNVLTGNNGEIRMNCRRVN  287



>ref|XP_011070599.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=321

 Score =   352 bits (903),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 215/295 (73%), Gaps = 4/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY+  CP A   IR  +  AI +ERRM  SL+RLHFHDCFV GCDASILLD TPTI
Sbjct  29    LSPTFYDTTCPNATAIIRTSIRRAISRERRMAASLIRLHFHDCFVQGCDASILLDETPTI  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
              SEK A  N NSARG+EVI+  K EV+RVC   VVSCAD+L +AARD+ VA+GGP+W VK
Sbjct  89    QSEKTAFPNINSARGYEVIEAAKREVERVCP-GVVSCADVLTLAARDASVAVGGPSWNVK  147

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS+  AN +LP+PF  L  L   F N+GL+ +D+VALSG HT+G AQCF FR
Sbjct  148   LGRRDSTTASRSQANTDLPSPFAGLDTLISAFANKGLSARDMVALSGAHTIGQAQCFLFR  207

Query  509   QRIYGD-KDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSD  336
              RIY +  DID+ FA  R+  CP NGG+ +LA+LD  TP  FD  YFKNL+++KGLL SD
Sbjct  208   GRIYSNGTDIDAGFASTRRRQCPQNGGDGNLAALDLVTPNSFDNNYFKNLMQRKGLLQSD  267

Query  335   QALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF+GG TD +V  YSRN   F++DFA +MIKMG+I P +  NG IR  C  +N
Sbjct  268   QVLFSGGSTDSIVSEYSRNPRIFASDFANAMIKMGEIPP-SQQNGIIRRVCSAIN  321



>ref|XP_010264466.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=320

 Score =   352 bits (903),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 213/296 (72%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP    T++  V  AI +ERRMG SLLRL FHDCFVNGCD SIL+D T   
Sbjct  26    LSTNFYSKSCPNVFTTVKSAVGSAISKERRMGASLLRLFFHDCFVNGCDGSILVDDTSNF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NS RGF V+D IKS+V++VC   VVSCADILA+AARDSVV LGGP+W+VK
Sbjct  86    TGEKNAAPNRNSVRGFNVVDDIKSKVEKVC-PGVVSCADILAIAARDSVVILGGPSWKVK  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  AN ++P P   LS L  +F+++GL+ KD+VALSG HT+G A+C +FR
Sbjct  145   LGRRDARTASQAAANTSIPPPTSSLSNLISSFQSKGLSTKDMVALSGSHTIGQARCTSFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMN--GGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +ID  FA+ RQ  CP     G+++LA LD  TP  FD  YFKNL+  KGLL S
Sbjct  205   TRIYNESNIDGSFAKARQRKCPATSGSGDNNLAPLDLQTPTAFDNNYFKNLINNKGLLHS  264

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD LVR YS     F +DF+ +MIKMGDI PLTG+NGEIR NCRRVN
Sbjct  265   DQQLFNGGSTDSLVRSYSSKPSTFISDFSAAMIKMGDITPLTGSNGEIRNNCRRVN  320



>gb|AFR44628.1| class III secretory peroxidase [Ginkgo biloba]
 gb|AGN03453.1| class III peroxidase [Ginkgo biloba]
Length=316

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 210/294 (71%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY   CP  L T++  V+ A+ +E RMG SLLRLHFHDCFVNGCD SILLD + T+
Sbjct  24    LSPTFYAKSCPNVLSTVKSAVKQAVAKEARMGASLLRLHFHDCFVNGCDGSILLDDSSTL  83

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A+ N NSARGF+VID IKS+V+ VC   VVSCADIL +AARDSVV LGGP+W V 
Sbjct  84    TGEKTAVPNANSARGFDVIDNIKSQVEAVCSG-VVSCADILTIAARDSVVELGGPSWAVP  142

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS   ANNN+P P   L+ L   F+ QGL+ KD+VAL+GGHT+G A+C +FR
Sbjct  143   LGRRDSRTASLSGANNNIPPPTSSLANLMSKFQAQGLSTKDMVALAGGHTIGQARCTSFR  202

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
               IY D +ID+ +A   +A CP  G +++++ LD  TP  FD  YFKNL  KKGLL SDQ
Sbjct  203   AHIYNDTNIDTTYANSLKAKCPRTGSDNNISPLDVVTPTSFDNNYFKNLRAKKGLLHSDQ  262

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD  V  Y  +   F NDFA SM+KMG+IKPLTG NGEIR NCR+ N
Sbjct  263   ELFNGGSTDSQVTSYVTSPITFRNDFATSMVKMGNIKPLTGTNGEIRKNCRKPN  316



>ref|XP_009622973.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=320

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/294 (56%), Positives = 215/294 (73%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  +Y   CP+A+ TI+  V +A+ +E RMG SLLRLHFHDCFVNGCD S+LLD T   
Sbjct  28    LSSDYYEKSCPKAIYTIKDAVTNAVAKEHRMGASLLRLHFHDCFVNGCDGSVLLDDTSDF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N+NS RGF++ID IKS+V+++C   +VSCADI+A+AARDSV  LGGP+W V+
Sbjct  88    TGEKTAKPNSNSLRGFDLIDTIKSQVEKLC-PGIVSCADIIAIAARDSVAILGGPSWTVQ  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS  +AN+++P+P MDL+ L  NF N+G   K++VAL+G HT+G AQC TFR
Sbjct  147   LGRRDSTTASLSSANSDIPSPLMDLTDLITNFANKGFTAKEMVALAGAHTIGQAQCTTFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
             +R+Y +  IDS  A   ++NCP  GG+ SL++LD  TPA FD  YF NL K KG+L SDQ
Sbjct  207   ERVYNETTIDSSLATSLKSNCPSTGGDDSLSALDAATPAIFDNHYFNNLKKNKGILHSDQ  266

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  V  Y      F+ DFAK+++KMG++ PLTG NG+IR NCR++N
Sbjct  267   QLFSGGSTDSQVTTYGTRPITFAADFAKAIVKMGNLSPLTGTNGQIRTNCRKIN  320



>ref|XP_008354764.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=327

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 177/297 (60%), Positives = 217/297 (73%), Gaps = 5/297 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CPQ    ++ +V+ A+ +E+RMG SLLRLHFHDCFVNGCD S+LLD T + 
Sbjct  32    LSTNFYSKSCPQVFDAVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDTSSF  91

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK AL NNNS RGFEV+D+IKS+V++ C   VVSCADILA+A+RDSV  LGGP+WEVK
Sbjct  92    TGEKTALPNNNSXRGFEVVDKIKSQVEKAC-PGVVSCADILAIASRDSVQILGGPSWEVK  150

Query  689   LGRRDSTTASKDTANNN-LPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             LGRRDS TAS   AN+  LP P   L++LT  F+  GL+ +DLVALSG HT+G A+C TF
Sbjct  151   LGRRDSKTASLSAANSGVLPPPTATLNELTTRFRAVGLSQRDLVALSGAHTIGQARCTTF  210

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNS--SLASLD-PTPAYFDAKYFKNLVKKKGLLV  342
             R RIY + +ID+ FAR RQ  CP   G+   +LA  D  TP  FD  YFKNLV +KGLL 
Sbjct  211   RARIYNETNIDASFARTRQNTCPRTAGSGDDNLAPFDITTPNTFDTAYFKNLVNQKGLLH  270

Query  341   SDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             SDQ LF GG TD LV+ YS +   F+ DFAK+MIKMGD KPLTG+ GEIR+NCR+ N
Sbjct  271   SDQILFNGGPTDSLVKSYSGSANTFNADFAKAMIKMGDNKPLTGSKGEIRLNCRKPN  327



>ref|XP_007011229.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY20039.1| Peroxidase superfamily protein [Theobroma cacao]
Length=321

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 174/296 (59%), Positives = 215/296 (73%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS ++Y+  CP+  PT++  V  AI +E RMG SLLRL FHDCFVNGCD S+LLD T + 
Sbjct  27    LSTNYYSKTCPKLFPTVKSTVHSAIMKEARMGASLLRLFFHDCFVNGCDGSLLLDDTSSF  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA  N NSARGF+V+D IKS V+ VC   VVSCADIL +AARDSV  LGGP W+VK
Sbjct  87    TGEKNAAPNRNSARGFDVVDNIKSAVEDVCP-GVVSCADILTIAARDSVAILGGPNWDVK  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANN++P P  +L++L   F   GL+ +D+VALSG HT+G A+C +FR
Sbjct  146   LGRRDARTASQAAANNSIPPPTSNLNRLISRFNALGLSTRDMVALSGSHTIGLARCTSFR  205

Query  509   QRIYGDKDIDSKFARQRQANCP--MNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +IDS FA+ RQ NCP     G+++LA LD  TP +FD  YFKNL+ ++GLL S
Sbjct  206   PRIYNESNIDSSFAQTRQRNCPRTTGSGDNNLAPLDIQTPTFFDNNYFKNLINRRGLLHS  265

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +VR YS N  +FS+DF   MIKMGDI PLTG+ GEIR NCRRVN
Sbjct  266   DQQLFNGGSTDSIVRGYSNNPSSFSSDFVTGMIKMGDISPLTGSRGEIRKNCRRVN  321



>ref|XP_010653358.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=325

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 209/294 (71%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+ +FY   CP AL  I+  V  A+K E RMG SLLRLHFHDCFVNGCDASILLD T   
Sbjct  33    LTTNFYAKTCPNALSIIKSAVNSAVKSEARMGASLLRLHFHDCFVNGCDASILLDDTSNF  92

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RG+EV+D IKS+++  C   VVSCADILAVAARDSVVAL GP+W V+
Sbjct  93    TGEKTAGPNANSVRGYEVVDTIKSQLEASC-PGVVSCADILAVAARDSVVALRGPSWMVR  151

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   AN+N+P P ++LS L   F N+G N +++VALSG HT+G A+C TFR
Sbjct  152   LGRRDSTTASLSAANSNIPAPTLNLSGLISAFTNKGFNAREMVALSGSHTIGQARCTTFR  211

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDP-TPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY + +ID+ F    QANCP +GG+++L+ LD  TP  FD  Y+ NLV KKGLL SDQ
Sbjct  212   TRIYNEANIDASFKTSLQANCPSSGGDNTLSPLDTQTPTTFDNAYYTNLVNKKGLLHSDQ  271

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG TD +V  YS     F  DFA +M+KMG++ PLTG +G+IR NCR+ N
Sbjct  272   QLFNGGSTDAVVNTYSTRSTTFFTDFANAMVKMGNLSPLTGTSGQIRTNCRKTN  325



>ref|XP_008358939.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=320

 Score =   351 bits (901),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 210/295 (71%), Gaps = 2/295 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FYN VCPQALP IR +V+ AI +E R+G SLLRLHFHDCFVNGCD SILLD T + 
Sbjct  26    LSAGFYNRVCPQALPAIRRVVKQAIFREPRIGASLLRLHFHDCFVNGCDGSILLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGF+VID IK+ VD+ C R VVSCADILAVAARDSV  LGGP ++V 
Sbjct  86    TGEKTAFPNVNSVRGFDVIDDIKNAVDKACKRSVVSCADILAVAARDSVFLLGGPLYQVP  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TA  + AN NLP P  +  QL  NF+  GL++ DLV LS  HT+G A+C TFR
Sbjct  146   LGRRDARTAXLNDANRNLPPPXFNFPQLLSNFQAHGLDLTDLVVLSAAHTIGLARCTTFR  205

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQA  330
              RIY D +ID  FA   Q NCP +GGN +   LD T   FD  YF +L+K+KGLL SDQ 
Sbjct  206   ARIYNDTNIDPSFAASAQQNCPSSGGNDNTLPLDATTRRFDTVYFNSLLKQKGLLHSDQE  265

Query  329   LFA--GGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             L    G  +D LV  YSRN  AF+ DF+ SMIKMG++KPLTGN+GE+R+NCR++N
Sbjct  266   LXKNNGTDSDKLVFKYSRNPFAFARDFSASMIKMGNLKPLTGNDGEVRLNCRKIN  320



>ref|XP_008245160.1| PREDICTED: cationic peroxidase 1-like [Prunus mume]
Length=324

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 217/294 (74%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY+  CP AL TI+  V+ A+ +E RMG SLLRLHFHDCFVNGCDAS+LLD T ++
Sbjct  32    LSPTFYSTSCPNALSTIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTASL  91

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N NS RGFEVID IK++++ +C + VVSCADIL VAARDS+VALGGPT+ V 
Sbjct  92    TGEKTAGPNANSLRGFEVIDTIKTQLESLCPK-VVSCADILTVAARDSIVALGGPTYTVP  150

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+TTAS   AN+N+P P ++L+ L   F N+G   +++VALSG HT+G A+C TFR
Sbjct  151   LGRRDATTASLSAANSNIPGPQLNLAALISAFSNKGFTAREMVALSGSHTIGQARCTTFR  210

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQ  333
              R+Y + +I++ FA   +  CP +GG+++L+ LD T P  FD  YF+NLV +KGLL SDQ
Sbjct  211   NRLYNEANINASFATSVKTQCPSSGGDNTLSPLDVTSPTSFDNAYFRNLVSQKGLLHSDQ  270

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              L++GG T+ +V  Y  N G F  DFA +M KMG++ PLTG NG+IR NCR+VN
Sbjct  271   QLYSGGSTNTIVDAYISNTGTFRADFANAMKKMGNLSPLTGTNGQIRTNCRKVN  324



>ref|XP_008810563.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=319

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 206/296 (70%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS ++Y   CP+    ++ +V+ AI +E+RMG SLLRL FHDCFV GCD SILLD T + 
Sbjct  25    LSTNYYASSCPKVFSAVKPVVQSAIAKEKRMGASLLRLFFHDCFVQGCDGSILLDDTSSF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGF+V+D IK+ V++VC   VVSCADILA+ ARDSVV LGGP W VK
Sbjct  85    QGEKTATPNNNSVRGFDVVDSIKAAVEKVC-PGVVSCADILAITARDSVVILGGPNWNVK  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   ANNN+P P   LS L   F  QGL+ KD+VALSGGHT+G A+C  FR
Sbjct  144   LGRRDSTTASFSGANNNIPPPNSSLSNLISKFSAQGLSTKDMVALSGGHTIGQARCTNFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNG--GNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
               +Y D DIDS FA+ RQ NCP     G+++LA LD  TP  FD  Y+KNL+ KKGLL S
Sbjct  204   AHVYNDTDIDSSFAKTRQMNCPSTAGSGDNNLAPLDLQTPTCFDNNYYKNLINKKGLLHS  263

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD  V  YS N   F++DF   MI MGDI PLTG  GEIR NCRRVN
Sbjct  264   DQELFNGGSTDSQVTTYSNNPSTFNSDFVTGMINMGDINPLTGTRGEIRKNCRRVN  319



>ref|XP_002281755.1| PREDICTED: peroxidase P7 [Vitis vinifera]
Length=317

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 208/294 (71%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSP+FY   CP     +R  +  A+ +E RMG S+LRL FHDCFVNGCDASILLD T T 
Sbjct  25    LSPNFYASTCPNVQKIVRVEMVQAVIREPRMGASILRLFFHDCFVNGCDASILLDDTATF  84

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNAL N NS RGFEVID IK+ V+  C +  VSCADILA+AARD VV LGGP+W V 
Sbjct  85    TGEKNALPNQNSVRGFEVIDTIKTRVEAAC-KATVSCADILALAARDGVVLLGGPSWTVP  143

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TA++  ANN+LP PF +LS L   F  +GLN  D+ ALSG HT+G AQCFTFR
Sbjct  144   LGRRDARTANQSAANNDLPAPFANLSALISGFAAKGLNADDMTALSGSHTIGQAQCFTFR  203

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
              RIY D +ID  FA  R++ CP++GGNS+LA LD  T   FD  Y++NL+ ++GLL SDQ
Sbjct  204   SRIYNDTNIDPNFAATRRSTCPVSGGNSNLAPLDIQTMNKFDNNYYQNLMTQRGLLHSDQ  263

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF GG  D LVR YS N+  F  DFA +M+KM +I PLTG NGEIR NCR VN
Sbjct  264   ELFNGGSQDALVRTYSANNALFFGDFAAAMVKMSNISPLTGTNGEIRSNCRVVN  317



>ref|XP_009416317.1| PREDICTED: cationic peroxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=320

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/298 (60%), Positives = 212/298 (71%), Gaps = 5/298 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             L+P FY+ VCP ALPTIR +VE A+  + R+G  L+RLHFHDCFVNGCD S+LLD + T 
Sbjct  22    LAPDFYDAVCPHALPTIRAVVEAAVALQPRLGAYLVRLHFHDCFVNGCDGSVLLDDSATF  81

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGFEVID IK+ V+  C   VVSCADILAVAARDS+VALGG ++EV 
Sbjct  82    VGEKTAGPNNNSLRGFEVIDDIKAVVNAACFGNVVSCADILAVAARDSIVALGGSSYEVL  141

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+TTASKD AN ++P PF  L  L   F++ GL V+DLVALSG HTLGFA+C  FR
Sbjct  142   LGRRDATTASKDDANADIPTPFSGLPDLLAKFQSHGLAVEDLVALSGAHTLGFARCALFR  201

Query  509   QRIYGDKD-IDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSD  336
              R+Y +   IDS FA   QA CP  GG+  L+ LD T PA FDA Y++ L++ KGLL SD
Sbjct  202   DRLYNETSTIDSDFATALQARCPRTGGDDELSPLDETSPAVFDAGYYRGLLQNKGLLHSD  261

Query  335   QALFAG---GQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             Q LF G   G TD LV+ YS N G F  DF  +MIKMG I PLTG++GEIR NCR  N
Sbjct  262   QQLFGGDGSGDTDALVQHYSENPGEFMADFGVAMIKMGSISPLTGSDGEIRENCRVAN  319



>gb|ABV24960.2| putative secretory peroxidase [Catharanthus roseus]
Length=330

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/296 (59%), Positives = 217/296 (73%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY+  CPQ   T+R  VE A+ +E+RMG SLLRLHFHDCFV GCD SILLD T ++
Sbjct  36    LSSEFYSKTCPQVYNTVRKGVESAVSKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSL  95

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  N  S RGF+V+D IKS+V++VC   VVSCADILA+AARDSVVALGGP+W+VK
Sbjct  96    RGEKTAGPNVGSVRGFDVVDNIKSDVEKVC-PGVVSCADILAIAARDSVVALGGPSWKVK  154

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             +GRRDS TAS   AN+ +P P  +L  L  +F+  GL+ KD+V LSG HT+G A+C  FR
Sbjct  155   VGRRDSKTASLSGANSRIPPPTSNLRNLISSFQAVGLSAKDMVVLSGSHTIGQARCTVFR  214

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGN--SSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +I++ FAR RQ NCP+  GN  +SLA LD  +P  FD  Y+KNL+ KKGLL S
Sbjct  215   ARIYNESNIETSFARTRQGNCPLPTGNGDNSLAPLDLQSPNGFDINYYKNLINKKGLLHS  274

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ L+ GG T+ LV  YS++  AF +DFA +MIKMGDI PLTG+NGE+R NCRRVN
Sbjct  275   DQELYNGGSTNSLVEAYSKDTKAFYSDFAAAMIKMGDISPLTGSNGEVRKNCRRVN  330



>gb|KHN40655.1| Cationic peroxidase 1 [Glycine soja]
Length=334

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/312 (58%), Positives = 212/312 (68%), Gaps = 20/312 (6%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFV---------------  915
             LS +FY   CP AL TI+  V  A+  ERRMG SLLRLHFHDCFV               
Sbjct  24    LSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQASQLSLCPFFHYDL  83

Query  914   ---NGCDASILLDSTPTIDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILA  744
                +GCDAS+LLD T +   EK A  N  S RGF VID IKS+V+ +C   VVSCADILA
Sbjct  84    FSLSGCDASVLLDDTSSFKGEKTAGPNAGSIRGFNVIDTIKSKVESLC-PGVVSCADILA  142

Query  743   VAARDSVVALGGPTWEVKLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDL  564
             VAARDSVVALGGPTW V+LGRRDSTTAS  +AN++LP P   LS L  +F N+G + K+L
Sbjct  143   VAARDSVVALGGPTWTVQLGRRDSTTASLSSANSDLPAPTSSLSALISSFSNKGFSSKEL  202

Query  563   VALSGGHTLGFAQCFTFRQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFD  387
             VALSG HT+G AQC +FR RIY D +IDS FA+  Q NCP  GG S+LA LD T P  FD
Sbjct  203   VALSGSHTIGQAQCSSFRTRIYNDTNIDSSFAKSLQGNCPSTGGGSTLAPLDTTSPNTFD  262

Query  386   AKYFKNLVKKKGLLVSDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGN  207
               YFKNL  KKGLL SDQ LF GG TD  V  YS N  +F  DFA +MIKMG++ PLTG+
Sbjct  263   NAYFKNLQSKKGLLHSDQELFNGGSTDSQVNSYSSNPASFKTDFANAMIKMGNLSPLTGS  322

Query  206   NGEIRVNCRRVN  171
             +G+IR NCR+ N
Sbjct  323   SGQIRTNCRKTN  334



>ref|XP_008370240.1| PREDICTED: cationic peroxidase 1-like [Malus domestica]
Length=324

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 212/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY   CP AL TI+  V+ A+ +E RMG SLLRLHFHDCFVNGCDAS+LLD T   
Sbjct  32    LSSTFYGTSCPNALSTIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTANF  91

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A AN NS RGF+VID IKS+++ +C + VVSCADIL VAARDS+VALGG T+ V 
Sbjct  92    TGEKTAGANANSLRGFDVIDTIKSQLESLCPK-VVSCADILTVAARDSIVALGGLTYTVP  150

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTAS   AN+N+P P ++LS L   F N+G   K+LVALSG HT+G A+C TFR
Sbjct  151   LGRRDSTTASLSAANSNIPAPTLNLSALITAFSNKGFTAKELVALSGSHTIGQARCTTFR  210

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPT-PAYFDAKYFKNLVKKKGLLVSDQ  333
              R+Y + +I++ FA   +++CP +GG+++L+ LD T P  FD  YF NLV + GLL SDQ
Sbjct  211   TRLYNEANINASFATSLKSSCPTSGGBNNLSPLDVTSPTSFDNAYFSNLVSQXGLLHSDQ  270

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG TD  V  Y  N   F  DFA +MIKMG++ PLTG NG+IR NCR+VN
Sbjct  271   QLFSGGSTDSQVNAYVSNPATFRTDFANAMIKMGNLSPLTGTNGQIRTNCRKVN  324



>ref|XP_007205544.1| hypothetical protein PRUPE_ppa008590mg [Prunus persica]
 gb|EMJ06743.1| hypothetical protein PRUPE_ppa008590mg [Prunus persica]
Length=326

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 220/299 (74%), Gaps = 7/299 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY+  CP+    ++ +V+ A+ +E+RMG SLLRLHFHDCFV+GCD S+LLD T + 
Sbjct  29    LSTKFYSKSCPKVFNAVKSVVQSAVHKEKRMGASLLRLHFHDCFVHGCDGSLLLDDTSSF  88

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGF+V+D+IKS+V++ C   VVSCADILA+AARDSV  LGGP+W VK
Sbjct  89    TGEKTASPNNNSLRGFKVVDKIKSQVEKTC-PGVVSCADILAIAARDSVKILGGPSWHVK  147

Query  689   LGRRDSTTASKDTANNN--LPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFT  516
             LGRRDS TAS   AN +  LP+P   LSQL   F+  GLN +DLVALSG HT+G AQC +
Sbjct  148   LGRRDSKTASFFAANRSGVLPSPTSTLSQLKTRFQAVGLNERDLVALSGAHTIGKAQCSS  207

Query  515   FRQRIYGDKDIDSKFARQRQANCP--MNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLL  345
             FR RIY D +ID+ FA+ RQ  CP  +  G++ LA LD  TP  FD  YFKNL+ +KGLL
Sbjct  208   FRDRIYNDTNIDASFAKARQRKCPSTVGSGDNHLAPLDVQTPNTFDTAYFKNLINQKGLL  267

Query  344   VSDQALF-AGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              SDQ L+  GG TD LV+ YS +  AF++DFAK+MIKMGDIKPLTG+NGEIR+NCRR N
Sbjct  268   HSDQVLYNNGGSTDSLVKTYSGSANAFNSDFAKAMIKMGDIKPLTGSNGEIRLNCRRPN  326



>gb|KDP21681.1| hypothetical protein JCGZ_03352 [Jatropha curcas]
Length=325

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 214/296 (72%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS SFY+  CP    TI+ +V+ AI +E+RMG SL+RL FHDCFVNGCD S+LLD T + 
Sbjct  31    LSTSFYSKSCPNLFSTIKPVVQSAINKEKRMGASLVRLFFHDCFVNGCDGSVLLDDTSSF  90

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK AL N NSARGFEVID IKS V++ C   VVSCADILAVAARDS V LGGPTW VK
Sbjct  91    TGEKTALPNRNSARGFEVIDSIKSAVEKAC-PGVVSCADILAVAARDSTVILGGPTWNVK  149

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS   ANN +P P  +L+QL   F   GL+ +DLVAL+G HT+G A+C +FR
Sbjct  150   LGRRDARTASLSAANNGIPPPTSNLNQLISRFNALGLSTRDLVALTGSHTIGQARCTSFR  209

Query  509   QRIYGDKDIDSKFARQRQANCP-MNG-GNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVS  339
              RIY + +ID+ FA+ R++NCP  NG G+++LA LD  TP  FD  YFKNL+ +KGLL S
Sbjct  210   ARIYNETNIDNSFAQTRRSNCPRTNGTGDNNLAPLDLQTPTSFDNNYFKNLLNQKGLLHS  269

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD +VR YS     F +DF   MIKMGDI PLTG+ GEIR NCRR+N
Sbjct  270   DQQLFNGGSTDSIVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRKNCRRMN  325



>ref|XP_004305595.1| PREDICTED: lignin-forming anionic peroxidase-like [Fragaria vesca 
subsp. vesca]
Length=326

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/298 (60%), Positives = 216/298 (72%), Gaps = 5/298 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FYN  CP AL TIR  +  A+  ERRM  SL+RLHFHDCFV GCDASILLD T TI
Sbjct  30    LSSTFYNKACPNALATIRKSIRTAVSAERRMAASLVRLHFHDCFVQGCDASILLDDTATI  89

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNAL N NS RG+EVID  K+ V+++C   VVSCADI+AVAARD+ VA+GGP+W VK
Sbjct  90    IGEKNALPNLNSVRGYEVIDDAKAAVEKLCP-GVVSCADIVAVAARDASVAVGGPSWAVK  148

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTASK  A ++LP+   +L  LT  F   GLNV+DLVALSG H++G AQCFTFR
Sbjct  149   LGRRDSTTASKTLAESSLPSFLDNLESLTNRFAGLGLNVRDLVALSGAHSIGQAQCFTFR  208

Query  509   QRIYGD-KDIDSKFARQRQANCP--MNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLV  342
              RIY    DID+ FA  R+++CP   N GN++LA+LD  TP   D  Y+KNL++KKGLL 
Sbjct  209   DRIYNKTSDIDANFASTRKSSCPAEANVGNANLAALDLVTPNQLDNNYYKNLIQKKGLLA  268

Query  341   SDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVNY  168
             SDQ L++GG TD +V  YS     F  DFA +MIKMG+I PLTG+NG+IR  C  +NY
Sbjct  269   SDQVLYSGGSTDSIVSEYSSKPAKFIADFATAMIKMGNINPLTGSNGQIRRICSALNY  326



>ref|XP_010067586.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=322

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 217/296 (73%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY   CP+  PT++ IV  AI  E RMG SLLRL FHDCFVNGCD S LLD TPT 
Sbjct  28    LSTDFYAKTCPKLFPTVKKIVRAAIANETRMGASLLRLFFHDCFVNGCDGSNLLDDTPTF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EKNA+ N NS RGF+V+DRIKS V++VC   +VSCAD+LA+ ARDSV  LGGP W+VK
Sbjct  88    TGEKNAMPNQNSLRGFDVVDRIKSAVEKVC-PSIVSCADLLAIIARDSVGILGGPMWDVK  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRD+ TAS+  ANN++P P  +LS L  +F+NQGL++KDLVAL GGHT+G A+C  FR
Sbjct  147   LGRRDARTASQAAANNSIPPPTNNLSALISSFQNQGLSLKDLVALYGGHTIGQARCTNFR  206

Query  509   QRIYGDKDIDSKFARQRQANCP-MNG-GNSSLASLDPTPAY-FDAKYFKNLVKKKGLLVS  339
              RIY + ++DS FAR  ++NCP + G G+++LA LD   A  FD  Y+ NL+KK+GLL S
Sbjct  207   ARIYNESNLDSSFARVAKSNCPRVTGVGDNNLAGLDFQSATSFDNSYYINLIKKRGLLHS  266

Query  338   DQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             DQ LF GG TD  +R Y+++   F  DF  S+IKMGDIKPLTG+NGEIR  CRRVN
Sbjct  267   DQQLFNGGSTDSFIRTYAKSQSTFFKDFVASIIKMGDIKPLTGSNGEIRKKCRRVN  322



>ref|XP_009803848.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   350 bits (899),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 211/294 (72%), Gaps = 1/294 (0%)
 Frame = -1

Query  1052  DLSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPT  873
              LS +FY+  CP  L  I+  V+ A+ +E RMG SLLRLHFHDCFVNGCDAS+LLD T  
Sbjct  22    SLSANFYSSSCPNVLSVIKTAVDSAVTKEARMGASLLRLHFHDCFVNGCDASVLLDDTSN  81

Query  872   IDSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEV  693
                EK A  N+ S RGF+VID IK++V+  C   VVSCADILAVAARDSVV LGGP+W V
Sbjct  82    FTGEKTANPNSGSLRGFDVIDTIKTKVEASCA-GVVSCADILAVAARDSVVKLGGPSWTV  140

Query  692   KLGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
              LGRRDSTTAS   ANNN+P P ++LS L  +F  +GL  +++VALSGGHT+G A+C TF
Sbjct  141   LLGRRDSTTASLSAANNNIPAPTLNLSGLISSFSTKGLTAREMVALSGGHTIGQARCTTF  200

Query  512   RQRIYGDKDIDSKFARQRQANCPMNGGNSSLASLDPTPAYFDAKYFKNLVKKKGLLVSDQ  333
             R R+Y + +I++ FA   +ANCP +GGN++L+ LD +P  FD  YFKNL  +KGLL SDQ
Sbjct  201   RNRLYNEANINASFATSVKANCPQSGGNNNLSPLDTSPTSFDNVYFKNLQIQKGLLHSDQ  260

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF+GG T  +V  YS N   F  DF  +M+KMG++ PLTG +G+IR NCR+ N
Sbjct  261   QLFSGGSTHSIVNTYSSNSATFFTDFKNAMVKMGNLSPLTGTSGQIRKNCRKTN  314



>ref|XP_010067580.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=320

 Score =   350 bits (899),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 213/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LSPS Y   CP+AL  +R  V  AIK E R G SLLRLHFHDCFVNGCDASILLD TP+ 
Sbjct  28    LSPSHYQSTCPKALSIVRAGVAKAIKNETRTGASLLRLHFHDCFVNGCDASILLDDTPSF  87

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGFEVIDRIK+ +++ C   VVSCADI+A+AARDSVV LGGP+W V 
Sbjct  88    VGEKTAAPNNNSVRGFEVIDRIKASLEKECP-GVVSCADIVALAARDSVVHLGGPSWTVS  146

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGR+DS TAS+  AN ++P P  +LS L  +F  QGL+VK++VALSG HT+G A+C +FR
Sbjct  147   LGRKDSITASRSLANTSIPPPTSNLSALITSFAAQGLSVKNMVALSGSHTIGLARCTSFR  206

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
             +RIY D +ID+ FA + Q  CP  G +S L  LD  TP +FD  Y+ NL++KKGLL SDQ
Sbjct  207   RRIYNDSNIDTSFAHKLQKICPKIGNDSVLQRLDIQTPTFFDNLYYHNLLQKKGLLHSDQ  266

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF G   D LV+ Y+ + G F  DFAK+MIKM +IKP  G+NG+IR NCR+VN
Sbjct  267   ELFNGSSVDSLVKKYACDTGKFFRDFAKAMIKMSEIKPPKGSNGQIRKNCRKVN  320



>ref|XP_003556178.1| PREDICTED: lignin-forming anionic peroxidase-like [Glycine max]
Length=323

 Score =   350 bits (899),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 176/298 (59%), Positives = 215/298 (72%), Gaps = 6/298 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP AL TIR ++  A+  ERRM  SL+RLHFHDCFV GCDASILLD + TI
Sbjct  27    LSSTFYDSACPNALSTIRSVIRSAVSAERRMAASLIRLHFHDCFVQGCDASILLDDSSTI  86

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
             +SEK+AL N NS RG+ +ID+ KSEV++VC   VVSCADI+AVAARD+  A+GGP+W VK
Sbjct  87    ESEKSALQNANSIRGYNIIDQAKSEVEKVCP-GVVSCADIVAVAARDASFAVGGPSWTVK  145

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDSTTASK +A ++LP    DL  L   F N+GL  +D+V LSG HT+G AQCFTFR
Sbjct  146   LGRRDSTTASKSSATSDLPRFTDDLDTLISKFNNKGLTARDMVTLSGAHTIGQAQCFTFR  205

Query  509   QRIYGD-KDIDSKFARQRQANCPM---NGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLL  345
              RIY +  DID+ FA  RQ  CP    +  +  LA+LD  TP  FD  YFKNL++KKGLL
Sbjct  206   GRIYNNASDIDAGFASTRQRGCPSVSNDDNDKKLAALDLVTPNSFDNNYFKNLIQKKGLL  265

Query  344   VSDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              SDQ LF+GG TD +V  YS+N   F +DFA +MIKMGDI+PLTG+ G IR  C  VN
Sbjct  266   QSDQVLFSGGSTDSIVSEYSKNPTTFKSDFAAAMIKMGDIEPLTGSAGMIRKICSSVN  323



>ref|XP_008384729.1| PREDICTED: peroxidase 4-like isoform X1 [Malus domestica]
Length=327

 Score =   350 bits (899),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/297 (59%), Positives = 219/297 (74%), Gaps = 5/297 (2%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS +FY+  CP+   T++ +V+ A+ +E+RMG SLLRLHFHDCFVNGCD S+LLD T + 
Sbjct  32    LSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDTSSF  91

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A  NNNS RGFEV+D+IKS+V++ C   VVSCADILA+A+RDSV  LGGP+WEVK
Sbjct  92    TGEKTAGPNNNSVRGFEVVDKIKSQVEKAC-PGVVSCADILAIASRDSVQILGGPSWEVK  150

Query  689   LGRRDSTTASKDTANNN-LPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTF  513
             LGRRDS TAS   AN+  +P P   L++L   F+  GL+ +DLVALSG HT+G A+C TF
Sbjct  151   LGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQARCTTF  210

Query  512   RQRIYGDKDIDSKFARQRQANCP--MNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLV  342
             R R+Y + +ID+ FAR RQ  CP  +  G+++LA LD  TP  FD  YFKNLV +KGLL 
Sbjct  211   RARVYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKNLVNRKGLLH  270

Query  341   SDQALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
             SDQ LF GG TD LV+ YS N   F+ DFAK+MIKMGD KPLTG+ GEIR+NCR+ N
Sbjct  271   SDQILFNGGATDSLVKSYSGNAETFNADFAKAMIKMGDNKPLTGSKGEIRLNCRKPN  327



>ref|XP_003601028.1| Peroxidase [Medicago truncatula]
 gb|AES71279.1| peroxidase family protein [Medicago truncatula]
Length=318

 Score =   350 bits (898),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 211/294 (72%), Gaps = 2/294 (1%)
 Frame = -1

Query  1049  LSPSFYNHVCPQALPTIRCIVEDAIKQERRMGGSLLRLHFHDCFVNGCDASILLDSTPTI  870
             LS  FY   CP+ L  +   V +AIK+E R+G SLLRLHFHDCFVNGCDASILLD T + 
Sbjct  26    LSKDFYCSSCPELLSIVNQGVINAIKKETRIGASLLRLHFHDCFVNGCDASILLDDTSSF  85

Query  869   DSEKNALANNNSARGFEVIDRIKSEVDRVCGRPVVSCADILAVAARDSVVALGGPTWEVK  690
               EK A ANNNSARGF VID IK+ V++ C   VVSCADIL +AARDSVV LGGP+W V 
Sbjct  86    IGEKTAAANNNSARGFNVIDDIKANVEKACP-GVVSCADILTLAARDSVVHLGGPSWNVG  144

Query  689   LGRRDSTTASKDTANNNLPNPFMDLSQLTENFKNQGLNVKDLVALSGGHTLGFAQCFTFR  510
             LGRRDS TAS+  ANN++P PF++LS L  NF NQGL+ KDLVALSG HT+G A+C  FR
Sbjct  145   LGRRDSITASRSDANNSIPAPFLNLSALKTNFANQGLSAKDLVALSGAHTIGLARCVQFR  204

Query  509   QRIYGDKDIDSKFARQRQANCPMNGGNSSLASLD-PTPAYFDAKYFKNLVKKKGLLVSDQ  333
               IY D ++DS F +  Q  CP +G ++ L  LD  TP +FD  YFKNL+ KK LL SDQ
Sbjct  205   AHIYNDSNVDSLFRKSLQNKCPRSGNDNVLEPLDHQTPTHFDNLYFKNLLAKKALLHSDQ  264

Query  332   ALFAGGQTDDLVRLYSRNHGAFSNDFAKSMIKMGDIKPLTGNNGEIRVNCRRVN  171
              LF G  TD+LVR Y+ ++  F   FAK M+KM  IKPLTG+NG+IR NCR++N
Sbjct  265   ELFNGSSTDNLVRKYATDNAKFFKAFAKGMVKMSSIKPLTGSNGQIRTNCRKIN  318



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2887448412435