BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22316_g2_i1 len=2090 path=[6487:0-443 6931:444-528 10039:529-623
7015:624-998 3007:999-1033 3042:1034-1628 3637:1629-1660
5911:1661-1978 6229:1979-2089]

Length=2090
                                                                      Score     E

emb|CDP09733.1|  unnamed protein product                                579   0.0      
ref|XP_009596031.1|  PREDICTED: transcription factor GAMYB-like i...    555   0.0      
ref|XP_009786742.1|  PREDICTED: transcription factor GAMYB-like i...    551   0.0      
ref|XP_009596093.1|  PREDICTED: transcription factor GAMYB-like i...    541   0.0      
ref|XP_009786743.1|  PREDICTED: transcription factor GAMYB-like i...    540   0.0      
ref|NP_001234362.1|  GAMYB-like2                                        535   4e-180   
ref|XP_010322306.1|  PREDICTED: GAMYB-like2 isoform X1                  534   9e-180   
ref|XP_006361138.1|  PREDICTED: transcription factor GAMYB-like i...    530   5e-178   
ref|XP_010322307.1|  PREDICTED: GAMYB-like2 isoform X2                  520   2e-174   
ref|XP_006361139.1|  PREDICTED: transcription factor GAMYB-like i...    516   6e-173   
ref|XP_011080497.1|  PREDICTED: transcription factor GAMYB-like i...    494   9e-164   
ref|XP_011080498.1|  PREDICTED: transcription factor GAMYB-like i...    494   1e-163   
ref|XP_011090254.1|  PREDICTED: transcription factor GAMYB-like         491   5e-163   
ref|XP_009771204.1|  PREDICTED: transcription factor GAMYB-like i...    475   2e-157   
ref|XP_009628010.1|  PREDICTED: transcription factor GAMYB-like i...    470   7e-156   
ref|XP_009628008.1|  PREDICTED: transcription factor GAMYB-like i...    470   1e-155   
ref|XP_009771205.1|  PREDICTED: transcription factor GAMYB-like i...    466   4e-154   
gb|AGN52102.1|  MYB-related transcription factor                        468   1e-153   
ref|XP_010319228.1|  PREDICTED: GAMyb-like1 isoform X1                  445   1e-144   
ref|NP_001234357.1|  GAMyb-like1                                        442   1e-143   
gb|KDP34526.1|  hypothetical protein JCGZ_11076                         430   3e-139   
ref|XP_009606602.1|  PREDICTED: transcription factor GAMYB-like         427   8e-139   
ref|XP_009762153.1|  PREDICTED: transcription factor GAMYB-like         427   1e-138   
ref|XP_010673830.1|  PREDICTED: transcription factor GAMYB-like         424   2e-136   
ref|XP_002313492.1|  hypothetical protein POPTR_0009s02380g             422   5e-136   Populus trichocarpa [western balsam poplar]
ref|XP_010251854.1|  PREDICTED: transcription factor GAMYB              422   2e-135   
ref|XP_011003856.1|  PREDICTED: transcription factor GAMYB-like         414   7e-133   
ref|XP_008231582.1|  PREDICTED: transcription factor GAMYB-like         413   6e-132   
ref|XP_007218962.1|  hypothetical protein PRUPE_ppa003628mg             410   8e-131   
emb|CAN63791.1|  hypothetical protein VITISV_037981                     407   8e-131   Vitis vinifera
emb|CBI24294.3|  unnamed protein product                                404   3e-129   
ref|XP_010651548.1|  PREDICTED: transcription factor GAMYB              404   6e-129   
ref|XP_010266746.1|  PREDICTED: transcription factor GAMYB-like i...    401   1e-128   
ref|XP_010266742.1|  PREDICTED: transcription factor GAMYB-like i...    403   4e-128   
ref|XP_011020506.1|  PREDICTED: transcription factor GAMYB              403   5e-128   
ref|XP_002304822.2|  hypothetical protein POPTR_0003s18900g             403   5e-128   Populus trichocarpa [western balsam poplar]
ref|XP_011007815.1|  PREDICTED: transcription factor GAMYB-like i...    399   4e-127   
ref|XP_011007813.1|  PREDICTED: transcription factor GAMYB-like i...    399   7e-127   
ref|XP_008375383.1|  PREDICTED: transcription factor GAMYB-like         399   1e-126   
ref|XP_011007812.1|  PREDICTED: transcription factor GAMYB-like i...    398   1e-126   
gb|KDP40595.1|  hypothetical protein JCGZ_24594                         399   1e-126   
gb|KDO47777.1|  hypothetical protein CISIN_1g011938mg                   394   1e-125   
ref|XP_007015386.1|  Myb domain protein 33, putative isoform 3          392   2e-125   
ref|XP_006471261.1|  PREDICTED: transcription factor GAMYB-like i...    394   1e-124   
ref|XP_007015384.1|  Myb domain protein 33, putative isoform 1          389   2e-123   
ref|XP_002525574.1|  r2r3-myb transcription factor, putative            389   7e-123   Ricinus communis
ref|XP_004306467.1|  PREDICTED: transcription factor GAMYB-like         389   1e-122   
ref|XP_002298147.2|  hypothetical protein POPTR_0001s23170g             389   2e-122   Populus trichocarpa [western balsam poplar]
ref|XP_002275846.1|  PREDICTED: transcription factor GAMYB              385   2e-121   Vitis vinifera
ref|XP_002523208.1|  myb81, putative                                    380   2e-120   Ricinus communis
ref|XP_008346342.1|  PREDICTED: transcription factor GAMYB-like         381   1e-119   
ref|XP_006368652.1|  hypothetical protein POPTR_0001s07330g             380   4e-119   
ref|XP_010067659.1|  PREDICTED: transcription factor GAMYB              379   5e-119   
ref|XP_006340345.1|  PREDICTED: transcription factor GAMYB-like         376   8e-119   
ref|XP_011034642.1|  PREDICTED: transcription factor GAMYB-like i...    379   1e-118   
ref|XP_011034640.1|  PREDICTED: transcription factor GAMYB-like i...    379   1e-118   
ref|XP_002297703.2|  hypothetical protein POPTR_0001s07330g             377   6e-118   Populus trichocarpa [western balsam poplar]
ref|XP_011034643.1|  PREDICTED: transcription factor GAMYB-like i...    376   8e-118   
ref|XP_009355091.1|  PREDICTED: transcription factor GAMYB-like         371   7e-116   
ref|XP_007010688.1|  Myb domain protein 65, putative isoform 3          370   9e-116   
ref|XP_007010686.1|  Myb domain protein 65, putative isoform 1          370   2e-115   
ref|XP_003543825.2|  PREDICTED: transcription factor GAMYB-like i...    367   2e-114   
ref|XP_006593626.1|  PREDICTED: transcription factor GAMYB-like i...    366   2e-114   
ref|XP_009398954.1|  PREDICTED: transcription factor GAMYB-like i...    367   3e-114   
ref|XP_009398961.1|  PREDICTED: transcription factor GAMYB-like i...    367   4e-114   
gb|KHG01258.1|  Transcription factor GAMYB                              365   9e-114   
gb|KHN30627.1|  Transcription factor GAMYB                              359   1e-111   
ref|XP_010045104.1|  PREDICTED: transcription factor GAMYB              358   2e-111   
ref|XP_007146191.1|  hypothetical protein PHAVU_006G020200g             358   3e-111   
ref|XP_006605628.1|  PREDICTED: transcription factor GAMYB-like i...    357   8e-111   
gb|KHG12129.1|  Transcription factor GAMYB                              355   2e-110   
gb|KHG02965.1|  Transcription factor GAMYB                              357   2e-110   
ref|XP_006605627.1|  PREDICTED: transcription factor GAMYB-like i...    357   3e-110   
gb|EYU35988.1|  hypothetical protein MIMGU_mgv1a022282mg                353   1e-109   
gb|KHG09015.1|  Transcription factor GAMYB                              351   3e-108   
ref|XP_010091315.1|  Transcription factor GAMYB                         349   2e-107   
ref|XP_010922970.1|  PREDICTED: transcription factor GAMYB-like i...    345   6e-106   
ref|XP_004251439.1|  PREDICTED: transcription factor GAMYB-like i...    342   1e-105   
ref|XP_010922971.1|  PREDICTED: transcription factor GAMYB-like i...    344   2e-105   
ref|XP_004140923.1|  PREDICTED: transcription factor GAMYB-like         342   6e-105   
ref|XP_008456638.1|  PREDICTED: transcription factor GAMYB              339   1e-103   
ref|XP_010904728.1|  PREDICTED: transcription factor GAMYB-like i...    338   2e-103   
ref|XP_008792434.1|  PREDICTED: transcription factor GAMYB-like i...    338   3e-103   
ref|XP_008792432.1|  PREDICTED: transcription factor GAMYB-like i...    338   5e-103   
ref|XP_010313492.1|  PREDICTED: transcription factor GAMYB-like i...    334   1e-102   
ref|XP_010904731.1|  PREDICTED: transcription factor GAMYB-like i...    335   1e-102   
ref|XP_008792433.1|  PREDICTED: transcription factor GAMYB-like i...    337   2e-102   
ref|XP_007133583.1|  hypothetical protein PHAVU_011G191300g             335   5e-102   
ref|XP_008786780.1|  PREDICTED: transcription factor GAMYB-like i...    334   1e-101   
ref|XP_008786776.1|  PREDICTED: transcription factor GAMYB-like i...    333   2e-101   
gb|AEH05966.1|  GAMYB2 protein                                          330   3e-100   
ref|XP_006598058.1|  PREDICTED: transcription factor GAMYB-like i...    329   4e-100   
ref|XP_006853124.1|  hypothetical protein AMTR_s00038p00150140          328   4e-99    
ref|XP_009387062.1|  PREDICTED: transcription factor GAMYB-like         325   2e-98    
gb|ACA29539.1|  GAMYB protein                                           322   2e-97    
gb|AHB19228.1|  GAMBY1-like family protein                              321   5e-97    
ref|XP_006594349.1|  PREDICTED: transcription factor GAMYB-like i...    320   2e-96    
gb|AHB19229.1|  GAMYB1-like family protein                              319   3e-96    
gb|AGN52104.1|  MYB-related transcription factor                        318   4e-96    
gb|KHN10328.1|  Transcription factor GAMYB                              318   6e-96    
gb|KEH32923.1|  myb transcription factor                                314   1e-94    
ref|XP_003526354.1|  PREDICTED: transcription factor GAMYB-like i...    308   1e-92    
ref|XP_006582387.1|  PREDICTED: transcription factor GAMYB-like i...    308   4e-92    
gb|AGZ16401.1|  MYB16                                                   296   7e-92    
gb|KHN26421.1|  Transcription factor GAMYB                              306   1e-91    
ref|XP_011086072.1|  PREDICTED: transcription factor GAMYB-like i...    305   4e-91    
ref|XP_009410451.1|  PREDICTED: transcription factor GAMYB-like i...    305   1e-90    
ref|XP_007148771.1|  hypothetical protein PHAVU_005G012900g             303   2e-90    
ref|XP_006578396.1|  PREDICTED: transcription factor GAMYB-like i...    301   8e-90    
ref|XP_009381364.1|  PREDICTED: transcription factor GAMYB-like         303   9e-90    
ref|XP_003523913.1|  PREDICTED: transcription factor GAMYB-like i...    301   1e-89    
ref|XP_009410453.1|  PREDICTED: transcription factor GAMYB-like i...    299   9e-89    
ref|XP_004514304.1|  PREDICTED: transcription factor GAMYB-like i...    294   1e-86    
ref|XP_011091869.1|  PREDICTED: transcription factor GAMYB-like i...    292   6e-86    
gb|KEH19184.1|  myb transcription factor                                292   8e-86    
dbj|BAD68205.1|  putative transcription factor GAMyb                    285   6e-84    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044592.1|  Os01g0812000                                       285   3e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644884.1|  PREDICTED: transcription factor GAMYB-like i...    285   4e-83    
emb|CAA67000.1|  transcription factor GAMyb                             285   4e-83    Oryza sativa Indica Group [Indian rice]
sp|A2WW87.1|GAM1_ORYSI  RecName: Full=Transcription factor GAMYB;...    285   5e-83    Oryza sativa Indica Group [Indian rice]
gb|EMS62608.1|  Transcription factor GAMYB                              283   4e-82    
ref|XP_004516524.1|  PREDICTED: transcription factor GAMYB-like i...    280   8e-82    
dbj|BAE92565.1|  transcription factor GAMYB                             280   2e-81    Triticum monococcum [einkorn wheat]
gb|AAT37169.1|  transcription factor Myb3                               278   4e-81    Triticum aestivum [Canadian hard winter wheat]
gb|EMT06573.1|  Transcription factor GAMYB                              279   5e-81    
ref|XP_010543777.1|  PREDICTED: transcription factor GAMYB-like         278   2e-80    
gb|AEV91157.1|  R2R3-MYB protein                                        277   4e-80    
ref|XP_011091874.1|  PREDICTED: transcription factor GAMYB-like i...    275   5e-80    
gb|ABO38439.1|  transcription factor                                    276   7e-80    Triticum dicoccon [cultivated emmer wheat]
gb|ABO38443.1|  transcription factor                                    276   7e-80    Triticum dicoccon [cultivated emmer wheat]
ref|XP_006287506.1|  hypothetical protein CARUB_v10000715mg             273   8e-80    
ref|XP_006287507.1|  hypothetical protein CARUB_v10000715mg             273   7e-79    
ref|XP_003564452.1|  PREDICTED: transcription factor GAMYB-like         272   2e-78    
gb|AAD31395.1|AF114162_1  gibberellin MYB transcription factor          271   4e-78    Lolium temulentum
gb|AAG22863.1|  transcription factor GAMyb                              269   3e-77    Hordeum vulgare [barley]
emb|CAA61021.1|  GAMyb protein                                          269   3e-77    Hordeum vulgare [barley]
ref|XP_002456516.1|  hypothetical protein SORBIDRAFT_03g037680          268   7e-77    Sorghum bicolor [broomcorn]
ref|XP_010423386.1|  PREDICTED: transcription factor GAMYB-like         267   8e-77    
ref|XP_006399071.1|  hypothetical protein EUTSA_v10013329mg             266   1e-76    
ref|XP_010544306.1|  PREDICTED: transcription factor MYB104-like ...    264   4e-76    
ref|XP_010544307.1|  PREDICTED: transcription factor MYB104-like ...    263   5e-76    
ref|XP_010544305.1|  PREDICTED: transcription factor MYB104-like ...    263   6e-76    
gb|EYU42075.1|  hypothetical protein MIMGU_mgv1a025316mg                260   1e-75    
ref|XP_010491156.1|  PREDICTED: transcription factor GAMYB-like         263   2e-75    
emb|CAB40189.1|  myb protein                                            264   2e-75    Avena sativa [cultivated oat]
ref|XP_002871198.1|  ATMYB33/MYB33                                      263   3e-75    
ref|NP_001130632.1|  MYBGA transcription factor                         263   4e-75    Zea mays [maize]
ref|XP_004970317.1|  PREDICTED: transcription factor GAMYB-like         263   7e-75    
ref|NP_196228.1|  myb domain protein 33                                 259   1e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297374.1|  hypothetical protein CARUB_v10013393mg             261   2e-74    
gb|EPS59038.1|  hypothetical protein M569_15771                         248   2e-74    
ref|XP_002882732.1|  hypothetical protein ARALYDRAFT_478481             261   3e-74    
emb|CDY56849.1|  BnaCnng31260D                                          259   5e-74    
ref|NP_850779.1|  myb domain protein 33                                 258   1e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452523.1|  PREDICTED: transcription factor GAMYB-like         258   2e-73    
ref|XP_006407447.1|  hypothetical protein EUTSA_v10020455mg             258   5e-73    
ref|XP_009146725.1|  PREDICTED: transcription factor GAMYB isofor...    256   5e-73    
ref|NP_187751.1|  myb domain protein 65                                 258   5e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146724.1|  PREDICTED: transcription factor GAMYB isofor...    256   6e-73    
gb|AFQ37424.1|  myb domain protein 33                                   258   2e-72    
ref|XP_010558042.1|  PREDICTED: transcription factor GAMYB-like i...    256   2e-72    
emb|CDY08526.1|  BnaA05g27620D                                          254   3e-72    
ref|XP_010558038.1|  PREDICTED: transcription factor GAMYB-like i...    256   3e-72    
gb|EYU42906.1|  hypothetical protein MIMGU_mgv1a007686mg                250   7e-72    
emb|CDY69320.1|  BnaAnng29990D                                          240   1e-70    
emb|CDY72198.1|  BnaAnng40310D                                          239   2e-70    
ref|XP_010495790.1|  PREDICTED: transcription factor GAMYB-like         249   4e-70    
dbj|BAA96421.1|  GAMyb protein                                          236   7e-70    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010464847.1|  PREDICTED: transcription factor GAMYB-like         249   9e-70    
ref|XP_009121138.1|  PREDICTED: transcription factor GAMYB-like i...    245   4e-69    
emb|CDY66041.1|  BnaCnng49390D                                          245   4e-69    
ref|XP_009121136.1|  PREDICTED: transcription factor GAMYB-like i...    245   4e-69    
gb|ADX60123.1|  MYB transcription factor                                235   8e-68    
ref|XP_006408602.1|  hypothetical protein EUTSA_v10002011mg             239   9e-68    
emb|CBI28806.3|  unnamed protein product                                239   2e-67    
ref|XP_006296237.1|  hypothetical protein CARUB_v10025403mg             236   1e-66    
ref|XP_002880852.1|  predicted protein                                  236   1e-66    
emb|CBI26650.3|  unnamed protein product                                236   2e-66    
ref|XP_010657205.1|  PREDICTED: transcription factor GAMYB isofor...    238   3e-66    
ref|XP_002268969.1|  PREDICTED: transcription factor GAMYB isofor...    238   5e-66    Vitis vinifera
ref|XP_009133920.1|  PREDICTED: transcription factor MYB104-like        235   6e-66    
ref|XP_002278003.1|  PREDICTED: protein ODORANT1-like                   236   7e-66    Vitis vinifera
ref|XP_002983020.1|  hypothetical protein SELMODRAFT_117411             223   2e-65    
gb|KFK24363.1|  hypothetical protein AALP_AAs49231U000100               229   4e-65    
ref|XP_006452391.1|  hypothetical protein CICLE_v10010620mg             233   4e-65    
emb|CDX83247.1|  BnaA03g22590D                                          233   4e-65    
gb|AGJ83731.1|  transcription factor GAMYB-like protein                 227   6e-65    
ref|NP_001241838.1|  uncharacterized protein LOC100857038               233   7e-65    
ref|XP_006475135.1|  PREDICTED: myb-like protein A-like                 236   7e-65    
ref|NP_001152014.1|  transcription factor GAMYB                         235   7e-65    Zea mays [maize]
gb|KDO62745.1|  hypothetical protein CISIN_1g046419mg                   234   8e-65    
gb|ACF83574.1|  unknown                                                 233   1e-64    Zea mays [maize]
gb|EPS59267.1|  hypothetical protein M569_15542                         221   1e-64    
ref|XP_010473083.1|  PREDICTED: transcription factor MYB104-like        231   2e-64    
ref|XP_002964589.1|  hypothetical protein SELMODRAFT_81112              221   2e-64    
ref|XP_002988806.1|  hypothetical protein SELMODRAFT_128781             221   2e-64    
emb|CDY38535.1|  BnaC03g26620D                                          230   4e-64    
ref|XP_001764220.1|  predicted protein                                  219   4e-64    
ref|XP_002965541.1|  hypothetical protein SELMODRAFT_84369              220   4e-64    
ref|XP_001778412.1|  predicted protein                                  219   7e-64    
emb|CDY66700.1|  BnaCnng51960D                                          228   3e-63    
ref|NP_180805.1|  myb domain protein 101                                229   3e-63    Arabidopsis thaliana [mouse-ear cress]
gb|AAL58845.1|AF411970_1  putative transcription factor MYB101          229   3e-63    Arabidopsis thaliana [mouse-ear cress]
emb|CDY68663.1|  BnaAnng27960D                                          228   4e-63    
ref|XP_007020787.1|  Transcription factor MYB811                        231   4e-63    
ref|XP_007015385.1|  Myb domain protein 33, putative isoform 2          226   4e-63    
ref|XP_007046374.1|  Myb domain protein 101, putative                   229   5e-63    
gb|KDO54678.1|  hypothetical protein CISIN_1g039708mg                   229   6e-63    
ref|XP_006447574.1|  hypothetical protein CICLE_v10014958mg             229   6e-63    
emb|CDY04471.1|  BnaA07g12970D                                          225   7e-63    
ref|XP_008342013.1|  PREDICTED: transcription factor MYB104-like        229   1e-62    
ref|XP_009592281.1|  PREDICTED: transcription factor RAX3               228   2e-62    
gb|KHG05273.1|  Transcription factor GAMYB                              228   3e-62    
ref|XP_008455547.1|  PREDICTED: transcription factor MYB86              227   4e-62    
ref|XP_010923867.1|  PREDICTED: transcription factor MYB44-like         226   4e-62    
ref|NP_001077993.1|  myb domain protein 101                             226   6e-62    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ61444.1|  R2R3-MYB transcription factor                          224   7e-62    
emb|CAA78388.1|  protein 3                                              226   9e-62    Petunia x hybrida [garden petunia]
ref|XP_010276128.1|  PREDICTED: myb-related protein B-like              225   1e-61    
dbj|BAG75111.1|  transcription factor MYB811                            227   1e-61    Fagus crenata
gb|KDP22719.1|  hypothetical protein JCGZ_01821                         226   1e-61    
ref|XP_006855906.1|  hypothetical protein AMTR_s00037p00177500          226   2e-61    
ref|XP_007149977.1|  hypothetical protein PHAVU_005G115500g             224   2e-61    
emb|CDY67258.1|  BnaAnng23930D                                          223   2e-61    
emb|CDX71481.1|  BnaC04g17160D                                          226   2e-61    
gb|KDO47779.1|  hypothetical protein CISIN_1g011938mg                   221   2e-61    
ref|XP_004144591.1|  PREDICTED: uncharacterized protein LOC101204619    224   2e-61    
ref|XP_003541947.1|  PREDICTED: transcription factor GAMYB-like         224   2e-61    
ref|XP_004243474.1|  PREDICTED: uncharacterized protein LOC101254917    224   4e-61    
gb|AAG28525.1|AF198498_1  anther-specific myb-related protein 2         223   4e-61    Nicotiana tabacum [American tobacco]
ref|XP_006366585.1|  PREDICTED: transcription factor RAX3-like          223   4e-61    
ref|XP_006432325.1|  hypothetical protein CICLE_v100007563mg            219   4e-61    
ref|XP_009132851.1|  PREDICTED: myb-related protein 306-like            223   4e-61    
ref|XP_008230038.1|  PREDICTED: transcription factor MYB108-like        224   4e-61    
ref|XP_007217274.1|  hypothetical protein PRUPE_ppa017451mg             224   5e-61    
ref|XP_009398956.1|  PREDICTED: myb-related protein P-like              222   5e-61    
emb|CDY19890.1|  BnaC09g31560D                                          221   6e-61    
ref|XP_006432326.1|  hypothetical protein CICLE_v100007563mg            219   6e-61    
ref|XP_006352041.1|  PREDICTED: myb-related protein Pp2-like            222   8e-61    
ref|XP_008808424.1|  PREDICTED: LOW QUALITY PROTEIN: tyrosine-pro...    223   9e-61    
ref|XP_010089493.1|  Transcription factor GAMYB                         223   9e-61    
ref|XP_004251522.1|  PREDICTED: transcription factor GAMYB-like         222   9e-61    
gb|KHN30812.1|  Transcription factor GAMYB                              220   1e-60    
ref|XP_009781770.1|  PREDICTED: transcription factor GAMYB-like         222   1e-60    
gb|KHN36528.1|  Transcription factor GAMYB                              222   1e-60    
ref|XP_009120026.1|  PREDICTED: transcription factor MYB104-like        224   1e-60    
ref|XP_008379641.1|  PREDICTED: transcription factor RAX1               223   1e-60    
ref|XP_010931683.1|  PREDICTED: transcription factor GAMYB-like         212   1e-60    
ref|XP_006296077.1|  hypothetical protein CARUB_v10025227mg             222   1e-60    
ref|XP_010510013.1|  PREDICTED: transcription factor GAMYB-like         223   1e-60    
dbj|BAJ61446.1|  R2R3-MYB transcription factor                          220   1e-60    
ref|XP_009103567.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    219   2e-60    
ref|XP_008226955.1|  PREDICTED: transcription factor MYB51-like         219   2e-60    
ref|XP_009601500.1|  PREDICTED: transcription factor GAMYB-like         221   2e-60    
ref|XP_002881227.1|  AtM1/AtMYB101/MYB101                               221   2e-60    
gb|AAG28526.1|AF198499_1  anther-specific myb-related protein 1         221   2e-60    Nicotiana tabacum [American tobacco]
ref|XP_010096901.1|  Transcription factor GAMYB                         220   2e-60    
gb|KDO47778.1|  hypothetical protein CISIN_1g011938mg                   221   3e-60    
emb|CDY12203.1|  BnaC04g12330D                                          221   3e-60    
ref|XP_009353373.1|  PREDICTED: myb-like protein A                      221   3e-60    
ref|XP_009408386.1|  PREDICTED: transcription factor GAMYB-like         223   4e-60    
gb|KHN44871.1|  Transcription factor GAMYB                              220   4e-60    
ref|XP_008357942.1|  PREDICTED: transcription factor RAX1-like          220   5e-60    
ref|XP_009773212.1|  PREDICTED: transcription factor MYB28-like         221   5e-60    
gb|KDP39145.1|  hypothetical protein JCGZ_00902                         223   5e-60    
gb|KFK31122.1|  hypothetical protein AALP_AA6G070700                    220   6e-60    
ref|XP_004289172.1|  PREDICTED: uncharacterized protein LOC101300860    221   8e-60    
ref|XP_010941521.1|  PREDICTED: myb-like protein A                      218   9e-60    
emb|CDY48264.1|  BnaA05g10900D                                          219   1e-59    
ref|XP_002529670.1|  r2r3-myb transcription factor, putative            221   1e-59    Ricinus communis
ref|XP_010278658.1|  PREDICTED: uncharacterized protein LOC104612781    219   1e-59    
ref|XP_009143995.1|  PREDICTED: myb-related protein 306-like            219   1e-59    
ref|XP_009388878.1|  PREDICTED: transcription factor MYB104-like        218   1e-59    
ref|XP_008463454.1|  PREDICTED: myb-related protein 330                 214   1e-59    
ref|XP_003539501.2|  PREDICTED: transcription factor GAMYB-like         219   1e-59    
emb|CDY15321.1|  BnaC04g43020D                                          218   1e-59    
ref|XP_002466889.1|  hypothetical protein SORBIDRAFT_01g015920          216   2e-59    Sorghum bicolor [broomcorn]
ref|XP_008775421.1|  PREDICTED: myb-related protein 330-like            214   2e-59    
gb|ABD27774.1|  MYB1                                                    216   2e-59    Phelipanche ramosa
emb|CDY19141.1|  BnaA04g18810D                                          218   2e-59    
emb|CDY20794.1|  BnaA02g09340D                                          216   3e-59    
ref|NP_180264.1|  myb domain protein 81                                 217   3e-59    
gb|EYU46142.1|  hypothetical protein MIMGU_mgv1a008698mg                215   3e-59    
gb|KHN26009.1|  Transcription factor GAMYB                              210   3e-59    
ref|XP_004173079.1|  PREDICTED: uncharacterized protein LOC101227024    218   4e-59    
ref|XP_004982528.1|  PREDICTED: myb-related protein P-like              218   4e-59    
ref|XP_006410379.1|  hypothetical protein EUTSA_v10016567mg             218   5e-59    
ref|XP_007212781.1|  hypothetical protein PRUPE_ppa019943mg             218   7e-59    
ref|XP_004295832.1|  PREDICTED: uncharacterized protein LOC101303499    219   8e-59    
ref|XP_009338730.1|  PREDICTED: transcription factor GAMYB-like         209   8e-59    
ref|XP_009408803.1|  PREDICTED: uncharacterized protein LOC103991170    215   1e-58    
ref|XP_009127041.1|  PREDICTED: transcription factor MYB104-like        218   1e-58    
gb|AGN52086.1|  MYB-related transcription factor                        215   1e-58    
ref|XP_008226954.1|  PREDICTED: transcription factor MYB76-like         218   1e-58    
gb|AGN52196.1|  MYB-related transcription factor                        215   1e-58    
gb|KHN02846.1|  Transcription factor GAMYB                              215   2e-58    
ref|XP_006279592.1|  hypothetical protein CARUB_v10026070mg             219   2e-58    
emb|CAN78897.1|  hypothetical protein VITISV_025421                     215   2e-58    
ref|XP_011006466.1|  PREDICTED: uncharacterized protein LOC105112461    216   3e-58    
ref|XP_007212976.1|  hypothetical protein PRUPE_ppa022465mg             214   3e-58    
ref|XP_010522346.1|  PREDICTED: transcription factor GAMYB-like i...    213   3e-58    
ref|XP_003559715.2|  PREDICTED: transcription factor GAMYB-like         211   3e-58    
ref|NP_568819.1|  myb domain protein 120                                216   3e-58    
ref|XP_006602199.1|  PREDICTED: transcription factor GAMYB-like i...    216   4e-58    
ref|XP_006650271.1|  PREDICTED: myb-related protein P-like              215   5e-58    
ref|XP_009132411.1|  PREDICTED: myb-like DNA-binding protein myb-1      215   5e-58    
gb|AEV91140.1|  R2R3-MYB protein                                        210   6e-58    
emb|CDY43016.1|  BnaA03g11630D                                          216   7e-58    
ref|XP_010666224.1|  PREDICTED: myb-like protein A                      213   7e-58    
ref|XP_010522345.1|  PREDICTED: anthocyanin regulatory C1 protein...    213   7e-58    
ref|XP_002301620.2|  hypothetical protein POPTR_0002s21300g             214   8e-58    
emb|CDY61426.1|  BnaC03g71630D                                          216   8e-58    
ref|XP_007146493.1|  hypothetical protein PHAVU_006G045300g             215   8e-58    
gb|EMS45362.1|  Transcription factor GAMYB                              213   9e-58    
ref|NP_001142050.1|  putative MYB DNA-binding domain superfamily ...    211   1e-57    
dbj|BAJ61445.1|  R2R3-MYB transcription factor                          214   1e-57    
dbj|BAB10576.1|  unnamed protein product                                216   1e-57    
ref|XP_004509036.1|  PREDICTED: transcription factor GAMYB-like         215   1e-57    
ref|XP_008385966.1|  PREDICTED: transcription factor MYB86-like         215   1e-57    
ref|NP_001050546.2|  Os03g0578900                                       214   2e-57    
gb|EMT27418.1|  Transcription factor GAMYB                              207   2e-57    
ref|NP_194423.1|  myb domain protein 97                                 211   2e-57    
ref|XP_003589262.1|  MYB family transcription factor-like protein       212   2e-57    
gb|ABK28651.1|  unknown                                                 210   2e-57    
gb|AAT76349.1|  putative Myb-like DNA-binding protein                   214   3e-57    
ref|XP_004149363.1|  PREDICTED: uncharacterized protein LOC101203510    213   3e-57    
gb|AGK45259.1|  transcription factor MYB120                             215   3e-57    
ref|XP_008385967.1|  PREDICTED: transcription factor MYB86-like         214   3e-57    
ref|XP_004493026.1|  PREDICTED: uncharacterized protein LOC101510675    216   3e-57    
gb|KGN56116.1|  hypothetical protein Csa_3G076520                       213   4e-57    
ref|XP_008681539.1|  PREDICTED: putative MYB DNA-binding domain s...    212   4e-57    
ref|XP_008665006.1|  PREDICTED: protein rough sheath 2-like             211   5e-57    
gb|KCW88778.1|  hypothetical protein EUGRSUZ_A01122                     209   5e-57    
ref|XP_010543010.1|  PREDICTED: myb-related protein Myb4-like           210   5e-57    
ref|XP_002869586.1|  hypothetical protein ARALYDRAFT_492106             209   6e-57    
ref|XP_009398879.1|  PREDICTED: uncharacterized protein LOC103983386    209   7e-57    
ref|XP_003600123.1|  Transcription factor GAMyb                         213   8e-57    
ref|XP_008804312.1|  PREDICTED: uncharacterized protein LOC103717629    212   1e-56    
ref|XP_006413125.1|  hypothetical protein EUTSA_v10025350mg             209   1e-56    
emb|CDP10791.1|  unnamed protein product                                211   1e-56    
gb|EYU34011.1|  hypothetical protein MIMGU_mgv1a025845mg                210   1e-56    
ref|XP_004487418.1|  PREDICTED: transcription factor MYB28-like         211   2e-56    
ref|XP_011100282.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    209   2e-56    
gb|EMT06644.1|  Transcription factor GAMYB                              208   2e-56    
ref|XP_003600125.1|  Transcription factor                               211   2e-56    
ref|XP_004500080.1|  PREDICTED: transcriptional activator Myb-like      211   2e-56    
dbj|BAK06247.1|  predicted protein                                      209   4e-56    
ref|XP_010539304.1|  PREDICTED: transcription factor MYB29-like         209   4e-56    
ref|XP_010068043.1|  PREDICTED: transcriptional activator Myb           209   4e-56    
ref|XP_002978627.1|  hypothetical protein SELMODRAFT_38120              197   5e-56    
ref|XP_004966214.1|  PREDICTED: transcription factor GAMYB-like i...    204   1e-55    
ref|XP_007141541.1|  hypothetical protein PHAVU_008G205000g             203   2e-55    
gb|EMS59753.1|  Transcription factor GAMYB                              206   2e-55    
ref|XP_004966213.1|  PREDICTED: transcription factor GAMYB-like i...    204   5e-55    
dbj|BAK04305.1|  predicted protein                                      202   3e-54    
ref|XP_006401500.1|  hypothetical protein EUTSA_v10013018mg             207   3e-54    
gb|EEE59400.1|  hypothetical protein OsJ_11534                          201   6e-54    
ref|XP_003596969.1|  Transcription factor                               201   2e-53    
gb|KFK29201.1|  hypothetical protein AALP_AA7G102300                    197   1e-52    
gb|EEC81180.1|  hypothetical protein OsI_24179                          196   2e-52    
gb|EMS45560.1|  Transcription factor GAMYB                              199   2e-52    
ref|XP_002438857.1|  hypothetical protein SORBIDRAFT_10g027280          197   3e-52    
ref|XP_010063022.1|  PREDICTED: uncharacterized protein LOC104450247    200   6e-52    
ref|NP_001058368.1|  Os06g0679400                                       196   1e-51    
ref|NP_001140392.1|  uncharacterized protein LOC100272446               192   1e-51    
ref|XP_008681373.1|  PREDICTED: uncharacterized protein LOC100272...    192   2e-51    
ref|XP_008681374.1|  PREDICTED: uncharacterized protein LOC100272...    192   2e-51    
ref|XP_008681372.1|  PREDICTED: uncharacterized protein LOC100272...    192   2e-51    
ref|NP_001055902.1|  Os05g0490600                                       194   3e-51    
dbj|BAA23341.1|  OSMYB5                                                 193   4e-51    
ref|XP_011037458.1|  PREDICTED: transcription factor GAMYB-like         190   4e-51    
ref|XP_008681371.1|  PREDICTED: uncharacterized protein LOC100272...    192   7e-51    
ref|XP_010229745.1|  PREDICTED: uncharacterized protein LOC104582109    192   1e-50    
ref|XP_006657115.1|  PREDICTED: transcription factor GAMYB-like         193   2e-50    
gb|EMS61102.1|  Transcription factor GAMYB                              189   3e-50    
gb|EMT30434.1|  Transcription factor GAMYB                              191   4e-50    
gb|EMT12896.1|  Transcription factor GAMYB                              192   2e-49    
ref|XP_004507522.1|  PREDICTED: uncharacterized protein LOC101502589    194   3e-49    
ref|XP_002438653.1|  hypothetical protein SORBIDRAFT_10g023665          184   3e-49    
ref|XP_006376488.1|  hypothetical protein POPTR_0013s13450g             193   4e-49    
gb|EEE64188.1|  hypothetical protein OsJ_19020                          192   7e-49    
dbj|BAE46986.1|  GAMYB-like1                                            191   3e-48    
gb|KGN46068.1|  hypothetical protein Csa_6G046460                       176   4e-48    
ref|XP_008648940.1|  PREDICTED: uncharacterized protein LOC103629636    186   7e-48    
gb|KCW87260.1|  hypothetical protein EUGRSUZ_B03766                     181   2e-47    
ref|XP_006432323.1|  hypothetical protein CICLE_v100007562mg            173   2e-47    
ref|XP_004965934.1|  PREDICTED: transcription factor GAMYB-like         185   3e-47    
gb|KCW87259.1|  hypothetical protein EUGRSUZ_B03766                     182   5e-47    
ref|XP_010474529.1|  PREDICTED: transcription factor GAMYB-like         172   6e-47    
ref|XP_006657252.1|  PREDICTED: myb-related protein Myb4-like           178   7e-47    
ref|XP_010038599.1|  PREDICTED: uncharacterized protein LOC104427155    183   1e-46    
ref|XP_006655435.1|  PREDICTED: transcription factor GAMYB-like         178   2e-46    
ref|XP_003563657.2|  PREDICTED: transcription factor GAMYB-like         182   2e-46    
gb|EEE65985.1|  hypothetical protein OsJ_21914                          181   9e-46    
ref|XP_010034253.1|  PREDICTED: transcription factor MYB29              174   7e-45    
gb|EEE66221.1|  hypothetical protein OsJ_22369                          175   7e-45    
ref|XP_008659753.1|  PREDICTED: myb-related protein B-like              175   9e-45    
ref|XP_008391711.1|  PREDICTED: transcription factor GAMYB-like         169   2e-44    
gb|ABD28344.1|  Homeodomain-related                                     174   2e-44    
ref|XP_008659750.1|  PREDICTED: transcription factor MYB29-like         173   3e-44    
gb|AFW87203.1|  putative MYB DNA-binding domain superfamily protein     173   2e-43    
gb|AFW75957.1|  putative MYB DNA-binding domain superfamily protein     170   2e-43    
ref|XP_003591179.1|  Transcription factor GAMYB                         173   5e-43    
gb|AAC83597.1|  putative transcription factor                           169   5e-43    
ref|NP_001141727.1|  uncharacterized protein LOC100273858               171   5e-43    
gb|AES61430.2|  myb transcription factor                                174   7e-43    
ref|XP_004491297.1|  PREDICTED: myb-related protein 315-like            166   2e-42    
dbj|BAO02546.1|  predicted Myb-related protein ortholog                 159   3e-42    
ref|XP_009764351.1|  PREDICTED: transcription factor MYB39-like         165   4e-42    
gb|KHG06127.1|  Transcription factor GAMYB                              157   1e-41    
gb|KHM99555.1|  Transcription factor GAMYB-like protein                 166   1e-41    
gb|KEH43718.1|  myb transcription factor MIXTA-like protein             163   2e-41    
ref|XP_010262320.1|  PREDICTED: myb-related protein Myb4                162   2e-41    
ref|XP_010672001.1|  PREDICTED: myb-related protein Myb4                163   2e-41    
gb|KFK32225.1|  hypothetical protein AALP_AA6G214100                    163   2e-41    
ref|XP_009419837.1|  PREDICTED: myb-related protein 305-like            159   2e-41    
ref|XP_009114510.1|  PREDICTED: myb-related protein 315                 163   2e-41    
dbj|BAC07544.1|  myb-related transcription factor VlMYBB1-2             161   2e-41    
ref|NP_001169723.1|  putative MYB DNA-binding domain superfamily ...    167   3e-41    
emb|CDP09077.1|  unnamed protein product                                150   4e-41    
ref|XP_008230200.1|  PREDICTED: myb-related protein 315                 164   4e-41    
ref|XP_002529907.1|  r2r3-myb transcription factor, putative            156   4e-41    
ref|XP_004293469.1|  PREDICTED: uncharacterized protein LOC101296263    164   5e-41    
gb|KFK28725.1|  hypothetical protein AALP_AA7G039100                    158   6e-41    
ref|XP_010422382.1|  PREDICTED: transcription factor MYB51-like         162   6e-41    
ref|XP_009350479.1|  PREDICTED: myb-related protein 308-like            163   6e-41    
ref|XP_011080041.1|  PREDICTED: myb-related protein Myb4-like           159   7e-41    
ref|XP_008353526.1|  PREDICTED: myb-related protein 308-like            163   7e-41    
ref|XP_002872736.1|  predicted protein                                  162   7e-41    
ref|XP_007216934.1|  hypothetical protein PRUPE_ppa016708mg             163   8e-41    
gb|ABD60296.2|  R2R3-MYB transcription factor MYB1                      156   8e-41    
gb|AAZ20434.1|  MYB18                                                   163   8e-41    
ref|XP_009382382.1|  PREDICTED: myb-related protein Myb4-like           161   1e-40    
ref|XP_009589203.1|  PREDICTED: protein ODORANT1-like                   161   1e-40    
ref|XP_009375123.1|  PREDICTED: myb-related protein 305-like            157   1e-40    
ref|XP_006341595.1|  PREDICTED: myb-related protein 305-like            160   1e-40    
emb|CDP13053.1|  unnamed protein product                                161   1e-40    
dbj|BAC75674.1|  transcription factor MYB101                            162   1e-40    
dbj|BAC75671.1|  transcription factor MYB101                            162   1e-40    
gb|ABH02890.1|  MYB transcription factor MYB77                          157   1e-40    
ref|XP_009116786.1|  PREDICTED: myb-related protein Zm38                160   1e-40    
ref|XP_009783632.1|  PREDICTED: transcription factor MYB39-like         159   1e-40    
ref|XP_009137191.1|  PREDICTED: transcription factor MYB39-like         161   2e-40    
gb|KHN46464.1|  Transcription factor MYB39                              161   2e-40    
ref|XP_011005145.1|  PREDICTED: myb-related protein 305 isoform X2      157   2e-40    
ref|XP_003532377.1|  PREDICTED: myb-related protein 330-like            157   2e-40    
ref|XP_006592013.1|  PREDICTED: transcription factor MYB39              161   2e-40    
gb|KHN01976.1|  Transcription factor MYB28                              160   2e-40    
ref|XP_003520087.1|  PREDICTED: transcription factor MYB32-like         160   2e-40    
ref|XP_009374421.1|  PREDICTED: transcription factor RAX2               161   2e-40    
ref|XP_010536668.1|  PREDICTED: transcription factor GAMYB-like         154   2e-40    
emb|CDO99644.1|  unnamed protein product                                161   2e-40    
ref|XP_006357153.1|  PREDICTED: myb-related protein 305-like            156   2e-40    
ref|XP_004233330.1|  PREDICTED: myb-related protein 305-like            156   2e-40    
gb|AAS10073.1|  MYB transcription factor                                160   2e-40    
ref|XP_004236420.2|  PREDICTED: transcription factor MYB108-like        159   2e-40    
ref|XP_006595453.1|  PREDICTED: protein ODORANT1-like                   160   2e-40    
ref|XP_008358698.1|  PREDICTED: LOW QUALITY PROTEIN: protein ODOR...    161   2e-40    
ref|NP_192419.1|  myb domain protein 74                                 160   2e-40    
ref|XP_006396633.1|  hypothetical protein EUTSA_v10029512mg             160   2e-40    
gb|AFD36431.1|  R2R3 MYB transcription factor                           161   2e-40    
gb|AIT13037.1|  myb-related transcription factor                        158   3e-40    
emb|CDY68230.1|  BnaCnng58140D                                          159   3e-40    
gb|EPS61722.1|  hypothetical protein M569_13071                         154   3e-40    
gb|KHG24385.1|  Transcription factor GAMYB                              154   3e-40    
gb|AGN52066.1|  MYB-related transcription factor                        160   3e-40    
gb|KDP20873.1|  hypothetical protein JCGZ_21344                         161   3e-40    
ref|XP_010273102.1|  PREDICTED: myb-related protein 308-like            160   3e-40    
ref|XP_009348003.1|  PREDICTED: protein ODORANT1-like                   161   3e-40    
ref|XP_009137762.1|  PREDICTED: transcription repressor MYB6-like...    159   3e-40    
ref|XP_006286241.1|  hypothetical protein CARUB_v10007810mg             159   3e-40    
ref|XP_004301783.1|  PREDICTED: transcription factor MYB39-like         160   3e-40    
gb|KHN07682.1|  Transcription factor MYB39                              160   3e-40    
ref|XP_003612858.1|  Myb-like transcription factor                      160   3e-40    
emb|CDY47094.1|  BnaC03g64160D                                          160   3e-40    
ref|XP_010528247.1|  PREDICTED: transcription factor MYB21              156   3e-40    
ref|XP_003529290.1|  PREDICTED: transcription factor MYB32-like         160   4e-40    
ref|XP_009137761.1|  PREDICTED: transcription repressor MYB6-like...    159   4e-40    
ref|NP_567626.1|  R2R3 family MYB transcription factor                  160   4e-40    
ref|NP_001281023.1|  protein ODORANT1-like                              160   4e-40    
ref|XP_004505589.1|  PREDICTED: transcription factor MYB39-like         160   4e-40    
ref|XP_010255443.1|  PREDICTED: transcription factor MYB3-like          159   4e-40    
gb|ABI84253.1|  transcription factor Myb1                               154   4e-40    
ref|XP_004487648.1|  PREDICTED: transcription factor MYB86-like         159   4e-40    
ref|XP_007025822.1|  MYB-like 102                                       161   4e-40    
ref|XP_002298534.1|  Myb26 family protein                               155   4e-40    
ref|XP_008243872.1|  PREDICTED: transcription factor MYB32-like         160   4e-40    
ref|XP_009418749.1|  PREDICTED: transcription repressor MYB6-like       159   4e-40    
ref|XP_008341440.1|  PREDICTED: myb-related protein 305-like            155   4e-40    
ref|XP_006342308.1|  PREDICTED: protein ODORANT1-like                   159   4e-40    
gb|AAM64808.1|  myb-related protein M4                                  160   4e-40    
gb|AEE37094.1|  MYB transcription factor                                155   4e-40    
gb|AFK38734.1|  unknown                                                 160   5e-40    
ref|XP_006413779.1|  hypothetical protein EUTSA_v10027571mg             160   5e-40    
ref|XP_003520086.2|  PREDICTED: myb-related protein Zm38-like           159   5e-40    
gb|KHG06894.1|  Transcription factor MYB39 -like protein                159   5e-40    
ref|XP_010686260.1|  PREDICTED: protein ODORANT1-like                   161   5e-40    
ref|XP_008670489.1|  PREDICTED: snRNA-activating protein complex ...    160   5e-40    
ref|XP_009596250.1|  PREDICTED: myb-related protein 315                 160   5e-40    
gb|KEH30212.1|  myb transcription factor                                159   5e-40    



>emb|CDP09733.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/459 (68%), Positives = 368/459 (80%), Gaps = 9/459 (2%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAG-GVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             MS+TSESED M  KG + SPS+EE +GG N G   PLKKGPWTSAEDAIL+EYVT+HGEG
Sbjct  1     MSMTSESEDRMVPKGAIGSPSIEETSGGGNFGVNGPLKKGPWTSAEDAILVEYVTKHGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKH+GLARCGKSCRLRWANHL+PDLKKGAFTPEEE RIIELHAKMGNKWARMAAE
Sbjct  61    NWNAVQKHSGLARCGKSCRLRWANHLRPDLKKGAFTPEEERRIIELHAKMGNKWARMAAE  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPD+ LQA+ ES Q+E++S+FS+ +TQH +LL
Sbjct  121   LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDICLQALSESKQSENLSSFSSVETQHPDLL  180

Query  1436  QVNYFEIPAVEFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTM  1281
              +N FEIPAVEFKNLELN QL+P        +  LDIPASSLLAQGL+SSYG +   S +
Sbjct  181   PINSFEIPAVEFKNLELNHQLYPSPLLDVPGRGLLDIPASSLLAQGLHSSYGGKTLLSAV  240

Query  1280  NPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS  1101
             +P+KRLR  +SLF GL+++ +  FT    Y ND   Q  QS G +S Y QNL  D+ S S
Sbjct  241   HPTKRLRQSESLFPGLATSFTGAFTNCSKYHNDGSAQSLQSFGITSAYDQNLTSDNHSTS  300

Query  1100  CVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPPTE  921
             CV+PGSHA LN N SS EP+WA K ELPSLQ+QI SW SPSSPLPSLESV+TLIQSPPTE
Sbjct  301   CVLPGSHALLNGNPSSSEPSWAMKLELPSLQTQIGSWGSPSSPLPSLESVDTLIQSPPTE  360

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
              ++SG++SPRNSGLL+AVLYESQ+LK+ K++  Q  S  S+   +++DN+  D HE EWE
Sbjct  361   HTQSGSLSPRNSGLLDAVLYESQSLKNFKSSSCQHMSSVSMAQGEVMDNSLQDLHEAEWE  420

Query  740   GYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
              Y DPISP GHSAASV +EYTPIS SS++E QS+E   G
Sbjct  421   AYGDPISPRGHSAASVLSEYTPISRSSMDELQSLENTPG  459



>ref|XP_009596031.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Nicotiana 
tomentosiformis]
Length=505

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/462 (69%), Positives = 370/462 (80%), Gaps = 22/462 (5%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEG  1797
             MS+TSES+D MT    V+SPSVEEA GG N GG +PLKKGPWTSAEDAIL++YVT+HGEG
Sbjct  1     MSMTSESDDRMTSNVGVDSPSVEEACGGGNTGGGLPLKKGPWTSAEDAILVDYVTKHGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKH+GLARCGKSCRLRWANHL+PDLKKGAFTPEEE RIIELHAKMGNKWARMAA+
Sbjct  61    NWNAVQKHSGLARCGKSCRLRWANHLRPDLKKGAFTPEEERRIIELHAKMGNKWARMAAD  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YPPD+  QAI E+ QNE++  FS+ D Q+ + L
Sbjct  121   LPGRTDNEIKNYWNTRIKRRQRAGLPVYPPDICFQAISENKQNEELGAFSSTDAQYPDFL  180

Query  1436  QVNYFEIPAVEFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTM  1281
              +N +EIPAVEFKNLE NQQL P         S LDIPA SLLAQGLNS+Y  R FFST+
Sbjct  181   PMNNYEIPAVEFKNLEFNQQLCPPPLLDIPSGSLLDIPARSLLAQGLNSAYYSRSFFSTV  240

Query  1280  NPSKRLRGPDSLFTGLSSNDS-----DIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPD  1116
             +P+KR+RG +S F+GL+ + S     D F ++  YQND  + ++QS GFSS YY+NL  D
Sbjct  241   HPTKRMRGSESEFSGLNDDSSPLKNDDSFPSYHQYQNDGFL-LAQSLGFSSSYYRNLTSD  299

Query  1115  -HPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLI  939
              HP+   VIPGSHA LN NSSS EP+ AKK ELPSLQSQ+ SW   SSPLPSLESV+TLI
Sbjct  300   HHPTSLGVIPGSHAHLNGNSSSSEPSRAKKLELPSLQSQMASWGLSSSPLPSLESVDTLI  359

Query  938   QSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDF  759
             QSPPT+++ES N+SPRNSGLL+AVLYE+QT++ SKN L Q++SG      D+VDN+ PD 
Sbjct  360   QSPPTDQTESCNLSPRNSGLLDAVLYEAQTMRASKNNLHQESSG------DVVDNSCPDL  413

Query  758   HETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEM  633
             HET WE Y DPISPLGHSAASVF+EYTP S SS EE Q V M
Sbjct  414   HETGWETYGDPISPLGHSAASVFSEYTPTSGSSSEEPQLVTM  455



>ref|XP_009786742.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Nicotiana 
sylvestris]
Length=505

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/462 (68%), Positives = 368/462 (80%), Gaps = 22/462 (5%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEG  1797
             M +TSES+D MT    V+SPSVEEA GG N GG +PLKKGPWTSAEDAIL++YVT+HGEG
Sbjct  1     MIMTSESDDRMTSNVGVDSPSVEEACGGGNTGGGLPLKKGPWTSAEDAILVDYVTKHGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKH+GLARCGKSCRLRWANHL+PDLKKGAFTPEEE RIIELHAKMGNKWARMAA+
Sbjct  61    NWNAVQKHSGLARCGKSCRLRWANHLRPDLKKGAFTPEEERRIIELHAKMGNKWARMAAD  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YPPD+  QAI E+ QNE++  FS+ D Q+ + L
Sbjct  121   LPGRTDNEIKNYWNTRIKRRQRAGLPVYPPDICFQAISENKQNEELGAFSSTDAQYPDFL  180

Query  1436  QVNYFEIPAVEFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTM  1281
              +N +EIPAVEFKNLE NQQL P         S LDIPA SLLAQGLNS+Y  R F ST+
Sbjct  181   PMNNYEIPAVEFKNLEFNQQLCPPPLLDIPSGSLLDIPARSLLAQGLNSAYYSRSFLSTV  240

Query  1280  NPSKRLRGPDSLFTGLSSNDS-----DIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPD  1116
             +P+KR+RG +S+F+GL+ + S     D F +   YQND  + ++QS GFSS YY+NL  D
Sbjct  241   HPTKRMRGSESVFSGLNDDSSPLKNDDSFPSCHQYQNDGSL-LAQSLGFSSSYYRNLTSD  299

Query  1115  -HPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLI  939
              HP+   VIPGSHA LN NSSS EP+ AKK ELPSLQSQ+ SW   SSPLPSLESV+TLI
Sbjct  300   HHPASLGVIPGSHAHLNGNSSSSEPSRAKKLELPSLQSQMASWGLSSSPLPSLESVDTLI  359

Query  938   QSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDF  759
             QSPPT+++ES N+SPRNSGLL+AVLYE+QT++ SKN L Q++SG      D+VDN+ PD 
Sbjct  360   QSPPTDQTESCNLSPRNSGLLDAVLYEAQTMRASKNNLQQESSG------DVVDNSCPDL  413

Query  758   HETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEM  633
             HET WE Y DPISPLGHSAASVF+EYTP S SS EE Q V M
Sbjct  414   HETGWETYGDPISPLGHSAASVFSEYTPTSGSSSEEPQLVTM  455



>ref|XP_009596093.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Nicotiana 
tomentosiformis]
Length=495

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/452 (69%), Positives = 361/452 (80%), Gaps = 22/452 (5%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTG  1767
             MT    V+SPSVEEA GG N GG +PLKKGPWTSAEDAIL++YVT+HGEGNWNAVQKH+G
Sbjct  1     MTSNVGVDSPSVEEACGGGNTGGGLPLKKGPWTSAEDAILVDYVTKHGEGNWNAVQKHSG  60

Query  1766  LARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIK  1587
             LARCGKSCRLRWANHL+PDLKKGAFTPEEE RIIELHAKMGNKWARMAA+LPGRTDNEIK
Sbjct  61    LARCGKSCRLRWANHLRPDLKKGAFTPEEERRIIELHAKMGNKWARMAADLPGRTDNEIK  120

Query  1586  NYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAV  1407
             NYWNTRIKRRQRAGLP+YPPD+  QAI E+ QNE++  FS+ D Q+ + L +N +EIPAV
Sbjct  121   NYWNTRIKRRQRAGLPVYPPDICFQAISENKQNEELGAFSSTDAQYPDFLPMNNYEIPAV  180

Query  1406  EFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPD  1251
             EFKNLE NQQL P         S LDIPA SLLAQGLNS+Y  R FFST++P+KR+RG +
Sbjct  181   EFKNLEFNQQLCPPPLLDIPSGSLLDIPARSLLAQGLNSAYYSRSFFSTVHPTKRMRGSE  240

Query  1250  SLFTGLSSNDS-----DIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPD-HPSLSCVIP  1089
             S F+GL+ + S     D F ++  YQND  + ++QS GFSS YY+NL  D HP+   VIP
Sbjct  241   SEFSGLNDDSSPLKNDDSFPSYHQYQNDGFL-LAQSLGFSSSYYRNLTSDHHPTSLGVIP  299

Query  1088  GSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPPTERSES  909
             GSHA LN NSSS EP+ AKK ELPSLQSQ+ SW   SSPLPSLESV+TLIQSPPT+++ES
Sbjct  300   GSHAHLNGNSSSSEPSRAKKLELPSLQSQMASWGLSSSPLPSLESVDTLIQSPPTDQTES  359

Query  908   GNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSD  729
              N+SPRNSGLL+AVLYE+QT++ SKN L Q++SG      D+VDN+ PD HET WE Y D
Sbjct  360   CNLSPRNSGLLDAVLYEAQTMRASKNNLHQESSG------DVVDNSCPDLHETGWETYGD  413

Query  728   PISPLGHSAASVFNEYTPISASSLEEHQSVEM  633
             PISPLGHSAASVF+EYTP S SS EE Q V M
Sbjct  414   PISPLGHSAASVFSEYTPTSGSSSEEPQLVTM  445



>ref|XP_009786743.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Nicotiana 
sylvestris]
Length=495

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/452 (69%), Positives = 360/452 (80%), Gaps = 22/452 (5%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTG  1767
             MT    V+SPSVEEA GG N GG +PLKKGPWTSAEDAIL++YVT+HGEGNWNAVQKH+G
Sbjct  1     MTSNVGVDSPSVEEACGGGNTGGGLPLKKGPWTSAEDAILVDYVTKHGEGNWNAVQKHSG  60

Query  1766  LARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIK  1587
             LARCGKSCRLRWANHL+PDLKKGAFTPEEE RIIELHAKMGNKWARMAA+LPGRTDNEIK
Sbjct  61    LARCGKSCRLRWANHLRPDLKKGAFTPEEERRIIELHAKMGNKWARMAADLPGRTDNEIK  120

Query  1586  NYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAV  1407
             NYWNTRIKRRQRAGLP+YPPD+  QAI E+ QNE++  FS+ D Q+ + L +N +EIPAV
Sbjct  121   NYWNTRIKRRQRAGLPVYPPDICFQAISENKQNEELGAFSSTDAQYPDFLPMNNYEIPAV  180

Query  1406  EFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPD  1251
             EFKNLE NQQL P         S LDIPA SLLAQGLNS+Y  R F ST++P+KR+RG +
Sbjct  181   EFKNLEFNQQLCPPPLLDIPSGSLLDIPARSLLAQGLNSAYYSRSFLSTVHPTKRMRGSE  240

Query  1250  SLFTGLSSNDS-----DIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPD-HPSLSCVIP  1089
             S+F+GL+ + S     D F +   YQND  + ++QS GFSS YY+NL  D HP+   VIP
Sbjct  241   SVFSGLNDDSSPLKNDDSFPSCHQYQNDGSL-LAQSLGFSSSYYRNLTSDHHPASLGVIP  299

Query  1088  GSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPPTERSES  909
             GSHA LN NSSS EP+ AKK ELPSLQSQ+ SW   SSPLPSLESV+TLIQSPPT+++ES
Sbjct  300   GSHAHLNGNSSSSEPSRAKKLELPSLQSQMASWGLSSSPLPSLESVDTLIQSPPTDQTES  359

Query  908   GNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSD  729
              N+SPRNSGLL+AVLYE+QT++ SKN L Q++SG      D+VDN+ PD HET WE Y D
Sbjct  360   CNLSPRNSGLLDAVLYEAQTMRASKNNLQQESSG------DVVDNSCPDLHETGWETYGD  413

Query  728   PISPLGHSAASVFNEYTPISASSLEEHQSVEM  633
             PISPLGHSAASVF+EYTP S SS EE Q V M
Sbjct  414   PISPLGHSAASVFSEYTPTSGSSSEEPQLVTM  445



>ref|NP_001234362.1| GAMYB-like2 [Solanum lycopersicum]
 gb|ABM53274.1| GAMYB-like2 [Solanum lycopersicum]
Length=504

 Score =   535 bits (1378),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 310/464 (67%), Positives = 362/464 (78%), Gaps = 23/464 (5%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEG  1797
             MS+TSES+D MT +  V+SPS EEA GG N GG +PLKKGPWTSAEDAIL+EYVT+HGEG
Sbjct  1     MSVTSESDDRMTSQDGVDSPSAEEACGGGNTGGGLPLKKGPWTSAEDAILVEYVTKHGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKH+GLARCGKSCRLRWANHL+PDLKKGAFTPEEE  IIELHAKMGNKWARMAAE
Sbjct  61    NWNAVQKHSGLARCGKSCRLRWANHLRPDLKKGAFTPEEERHIIELHAKMGNKWARMAAE  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLPIYP D+  Q+I E+ QNE++ TFS+ D+Q+ +  
Sbjct  121   LPGRTDNEIKNYWNTRIKRRQRAGLPIYPSDICFQSITENKQNEELGTFSSADSQYPDFF  180

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQS--------PLDIPASSLLAQGLNSSYGPRPFFSTM  1281
              +NY EIPAVEFK LE NQ L P +         LDIP  SLLAQGLNS+Y  R F ST 
Sbjct  181   PMNY-EIPAVEFKRLEFNQHLCPPALLDIPTGGILDIPGRSLLAQGLNSAYYSRSFLSTT  239

Query  1280  NPSKRLRGPDSLFTGLSSNDS----DI-FTAFGPYQNDTCMQVsqssgfssgyyQNLDPD  1116
              P+KR+RG +SLF+GL+ + S    D+ F+    +Q+D  + ++QS GFSS + QNL  D
Sbjct  240   PPAKRIRGSESLFSGLNGDCSPSKNDVSFSTCHQHQDDGSL-LAQSMGFSSSFNQNLTSD  298

Query  1115  -HPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLI  939
              HPS   VIPGSHA LN ++SS EP+WAKK ELPSLQS I SW   +SPLPSL+SV+TLI
Sbjct  299   YHPSSLGVIPGSHALLNGHTSSSEPSWAKKLELPSLQSTIASWGLVTSPLPSLDSVDTLI  358

Query  938   QSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDF  759
             QSPPTE +ES N+SPRNSGLL+AVL+ESQT+K SK+ L Q+NSG      D+VDN+ PD 
Sbjct  359   QSPPTEHTESCNLSPRNSGLLDAVLHESQTMKASKSILHQENSG------DVVDNSCPDL  412

Query  758   HETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLA  627
             H TEW  + DPISPLGHSAASVF+EYTP S SS EE Q V M A
Sbjct  413   HMTEWGQHGDPISPLGHSAASVFSEYTPTSGSSSEEPQLVTMPA  456



>ref|XP_010322306.1| PREDICTED: GAMYB-like2 isoform X1 [Solanum lycopersicum]
Length=504

 Score =   534 bits (1376),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 310/464 (67%), Positives = 362/464 (78%), Gaps = 23/464 (5%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEG  1797
             MS+TSES+D MT +  V+SPS EEA GG N GG +PLKKGPWTSAEDAIL+EYVT+HGEG
Sbjct  1     MSMTSESDDRMTSQDGVDSPSAEEACGGGNTGGGLPLKKGPWTSAEDAILVEYVTKHGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKH+GLARCGKSCRLRWANHL+PDLKKGAFTPEEE  IIELHAKMGNKWARMAAE
Sbjct  61    NWNAVQKHSGLARCGKSCRLRWANHLRPDLKKGAFTPEEERHIIELHAKMGNKWARMAAE  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLPIYP D+  Q+I E+ QNE++ TFS+ D+Q+ +  
Sbjct  121   LPGRTDNEIKNYWNTRIKRRQRAGLPIYPSDICFQSITENKQNEELGTFSSADSQYPDFF  180

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQS--------PLDIPASSLLAQGLNSSYGPRPFFSTM  1281
              +NY EIPAVEFK LE NQ L P +         LDIP  SLLAQGLNS+Y  R F ST 
Sbjct  181   PMNY-EIPAVEFKRLEFNQHLCPPALLDIPTGGILDIPGRSLLAQGLNSAYYSRSFLSTT  239

Query  1280  NPSKRLRGPDSLFTGLSSNDS----DI-FTAFGPYQNDTCMQVsqssgfssgyyQNLDPD  1116
              P+KR+RG +SLF+GL+ + S    D+ F+    +Q+D  + ++QS GFSS + QNL  D
Sbjct  240   PPAKRIRGSESLFSGLNGDCSPSKNDVSFSTCHQHQDDGSL-LAQSMGFSSSFNQNLTSD  298

Query  1115  -HPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLI  939
              HPS   VIPGSHA LN ++SS EP+WAKK ELPSLQS I SW   +SPLPSL+SV+TLI
Sbjct  299   YHPSSLGVIPGSHALLNGHTSSSEPSWAKKLELPSLQSTIASWGLVTSPLPSLDSVDTLI  358

Query  938   QSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDF  759
             QSPPTE +ES N+SPRNSGLL+AVL+ESQT+K SK+ L Q+NSG      D+VDN+ PD 
Sbjct  359   QSPPTEHTESCNLSPRNSGLLDAVLHESQTMKASKSILHQENSG------DVVDNSCPDL  412

Query  758   HETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLA  627
             H TEW  + DPISPLGHSAASVF+EYTP S SS EE Q V M A
Sbjct  413   HMTEWGQHGDPISPLGHSAASVFSEYTPTSGSSSEEPQLVTMPA  456



>ref|XP_006361138.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Solanum 
tuberosum]
Length=504

 Score =   530 bits (1364),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 312/470 (66%), Positives = 359/470 (76%), Gaps = 35/470 (7%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEG  1797
             MS+TSES+D MT    V+SPSVEEA GG N GG +PLKKGPWTSAEDAIL+EYVT+HGEG
Sbjct  1     MSMTSESDDRMTSLDGVDSPSVEEACGGGNTGGGLPLKKGPWTSAEDAILVEYVTKHGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKH+GLARCGKSCRLRWANHL+PDLKKGAFTPEEE  IIELHAKMGNKWARMAAE
Sbjct  61    NWNAVQKHSGLARCGKSCRLRWANHLRPDLKKGAFTPEEERHIIELHAKMGNKWARMAAE  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLPIYP D+  Q+I E+ QNE++ TFS+ D+Q+ + L
Sbjct  121   LPGRTDNEIKNYWNTRIKRRQRAGLPIYPSDICFQSITENKQNEELGTFSSADSQYPDFL  180

Query  1436  QVNYFEIPAVEFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTM  1281
              +NY EIPAVEFK LE NQ L P           LDIP  SLLAQGLNS+Y  R F ST 
Sbjct  181   PMNY-EIPAVEFKRLEFNQHLCPPVLLDIPTGGILDIPGRSLLAQGLNSAYYSRSFLSTT  239

Query  1280  NPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQND----TCMQ-------Vsqssgfssgyy  1134
              P+KR+RG +SLF+GL+ + S       P +ND    TC Q       ++QS GFSS + 
Sbjct  240   PPAKRIRGSESLFSGLNGDCS-------PSKNDGSFPTCHQHQDDGSLLAQSMGFSSSFN  292

Query  1133  QNLDPD-HPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsle  957
             QNL  D HPS   VIPGSHA LN ++SS EP+WAKK ELPSLQS I SW   +SPLPSL+
Sbjct  293   QNLTSDYHPSSLGVIPGSHALLNGHTSSSEPSWAKKLELPSLQSPIASWGLLTSPLPSLD  352

Query  956   SVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVD  777
             SV+TLIQSPPTE +E  N+SPRNSGLL+AVL+ESQT++ SK+ L Q+NSG      D+VD
Sbjct  353   SVDTLIQSPPTEHTEPCNLSPRNSGLLDAVLHESQTMRASKSILHQENSG------DVVD  406

Query  776   NTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLA  627
             N+ PD H TEW  + DPISPLGHSAASVF+EYTP S SS EE Q V M A
Sbjct  407   NSCPDLHMTEWGQHGDPISPLGHSAASVFSEYTPTSGSSSEEPQLVTMPA  456



>ref|XP_010322307.1| PREDICTED: GAMYB-like2 isoform X2 [Solanum lycopersicum]
Length=494

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 303/454 (67%), Positives = 353/454 (78%), Gaps = 23/454 (5%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTG  1767
             MT +  V+SPS EEA GG N GG +PLKKGPWTSAEDAIL+EYVT+HGEGNWNAVQKH+G
Sbjct  1     MTSQDGVDSPSAEEACGGGNTGGGLPLKKGPWTSAEDAILVEYVTKHGEGNWNAVQKHSG  60

Query  1766  LARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIK  1587
             LARCGKSCRLRWANHL+PDLKKGAFTPEEE  IIELHAKMGNKWARMAAELPGRTDNEIK
Sbjct  61    LARCGKSCRLRWANHLRPDLKKGAFTPEEERHIIELHAKMGNKWARMAAELPGRTDNEIK  120

Query  1586  NYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAV  1407
             NYWNTRIKRRQRAGLPIYP D+  Q+I E+ QNE++ TFS+ D+Q+ +   +NY EIPAV
Sbjct  121   NYWNTRIKRRQRAGLPIYPSDICFQSITENKQNEELGTFSSADSQYPDFFPMNY-EIPAV  179

Query  1406  EFKNLELNQQLHPQS--------PLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPD  1251
             EFK LE NQ L P +         LDIP  SLLAQGLNS+Y  R F ST  P+KR+RG +
Sbjct  180   EFKRLEFNQHLCPPALLDIPTGGILDIPGRSLLAQGLNSAYYSRSFLSTTPPAKRIRGSE  239

Query  1250  SLFTGLSSNDS----DI-FTAFGPYQNDTCMQVsqssgfssgyyQNLDPD-HPSLSCVIP  1089
             SLF+GL+ + S    D+ F+    +Q+D  + ++QS GFSS + QNL  D HPS   VIP
Sbjct  240   SLFSGLNGDCSPSKNDVSFSTCHQHQDDGSL-LAQSMGFSSSFNQNLTSDYHPSSLGVIP  298

Query  1088  GSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPPTERSES  909
             GSHA LN ++SS EP+WAKK ELPSLQS I SW   +SPLPSL+SV+TLIQSPPTE +ES
Sbjct  299   GSHALLNGHTSSSEPSWAKKLELPSLQSTIASWGLVTSPLPSLDSVDTLIQSPPTEHTES  358

Query  908   GNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSD  729
              N+SPRNSGLL+AVL+ESQT+K SK+ L Q+NSG      D+VDN+ PD H TEW  + D
Sbjct  359   CNLSPRNSGLLDAVLHESQTMKASKSILHQENSG------DVVDNSCPDLHMTEWGQHGD  412

Query  728   PISPLGHSAASVFNEYTPISASSLEEHQSVEMLA  627
             PISPLGHSAASVF+EYTP S SS EE Q V M A
Sbjct  413   PISPLGHSAASVFSEYTPTSGSSSEEPQLVTMPA  446



>ref|XP_006361139.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Solanum 
tuberosum]
Length=494

 Score =   516 bits (1329),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 305/460 (66%), Positives = 350/460 (76%), Gaps = 35/460 (8%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTG  1767
             MT    V+SPSVEEA GG N GG +PLKKGPWTSAEDAIL+EYVT+HGEGNWNAVQKH+G
Sbjct  1     MTSLDGVDSPSVEEACGGGNTGGGLPLKKGPWTSAEDAILVEYVTKHGEGNWNAVQKHSG  60

Query  1766  LARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIK  1587
             LARCGKSCRLRWANHL+PDLKKGAFTPEEE  IIELHAKMGNKWARMAAELPGRTDNEIK
Sbjct  61    LARCGKSCRLRWANHLRPDLKKGAFTPEEERHIIELHAKMGNKWARMAAELPGRTDNEIK  120

Query  1586  NYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAV  1407
             NYWNTRIKRRQRAGLPIYP D+  Q+I E+ QNE++ TFS+ D+Q+ + L +NY EIPAV
Sbjct  121   NYWNTRIKRRQRAGLPIYPSDICFQSITENKQNEELGTFSSADSQYPDFLPMNY-EIPAV  179

Query  1406  EFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPD  1251
             EFK LE NQ L P           LDIP  SLLAQGLNS+Y  R F ST  P+KR+RG +
Sbjct  180   EFKRLEFNQHLCPPVLLDIPTGGILDIPGRSLLAQGLNSAYYSRSFLSTTPPAKRIRGSE  239

Query  1250  SLFTGLSSNDSDIFTAFGPYQND----TCMQ-------VsqssgfssgyyQNLDPD-HPS  1107
             SLF+GL+ + S       P +ND    TC Q       ++QS GFSS + QNL  D HPS
Sbjct  240   SLFSGLNGDCS-------PSKNDGSFPTCHQHQDDGSLLAQSMGFSSSFNQNLTSDYHPS  292

Query  1106  LSCVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPP  927
                VIPGSHA LN ++SS EP+WAKK ELPSLQS I SW   +SPLPSL+SV+TLIQSPP
Sbjct  293   SLGVIPGSHALLNGHTSSSEPSWAKKLELPSLQSPIASWGLLTSPLPSLDSVDTLIQSPP  352

Query  926   TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETE  747
             TE +E  N+SPRNSGLL+AVL+ESQT++ SK+ L Q+NSG      D+VDN+ PD H TE
Sbjct  353   TEHTEPCNLSPRNSGLLDAVLHESQTMRASKSILHQENSG------DVVDNSCPDLHMTE  406

Query  746   WEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLA  627
             W  + DPISPLGHSAASVF+EYTP S SS EE Q V M A
Sbjct  407   WGQHGDPISPLGHSAASVFSEYTPTSGSSSEEPQLVTMPA  446



>ref|XP_011080497.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Sesamum 
indicum]
Length=547

 Score =   494 bits (1273),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 285/466 (61%), Positives = 345/466 (74%), Gaps = 20/466 (4%)
 Frame = -1

Query  1994  VPKYYSDMSITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEY  1818
             V K    MS+TSES +    K  V+SP+ ++A  G   GG  PLKKGPWTSAEDAIL+EY
Sbjct  4     VYKKVKAMSMTSESNERSMPKNGVDSPAADDANSGGYVGGHGPLKKGPWTSAEDAILVEY  63

Query  1817  VTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNK  1638
             VT+HGEGNWNAVQKH+GLARCGKSCRLRWANHL+PDLKKGAF+PEEE  IIELHAKMGNK
Sbjct  64    VTKHGEGNWNAVQKHSGLARCGKSCRLRWANHLRPDLKKGAFSPEEERLIIELHAKMGNK  123

Query  1637  WARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGD  1458
             WARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPD+ L+   E+ Q++D+S+FS+GD
Sbjct  124   WARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDISLRPSKENQQSDDISSFSSGD  183

Query  1457  TQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPLDI--------PASSLLAQGLNSSYGP  1302
             + + + + VN FEIPAVEFKNLELNQQL+P + LDI        PASSLLAQGL  SY  
Sbjct  184   SHYPDFMPVNNFEIPAVEFKNLELNQQLYPPALLDIPATGLLDVPASSLLAQGLPPSYPN  243

Query  1301  RPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLD  1122
             +   ST++PSKRLRG + LF GL +   +       YQND  MQ++QS   SS Y     
Sbjct  244   KSLLSTIHPSKRLRGSEPLFPGLCATMGNSIPGRSQYQNDGPMQIAQSFINSSAY-----  298

Query  1121  PDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETL  942
              DH S S V+ GSHA LN N SS EP WA K ELPSLQ+Q+  W SPSSPLP+LESV+TL
Sbjct  299   -DHTSFSSVLSGSHAILNGNPSSSEPDWAMKLELPSLQTQVGGWGSPSSPLPNLESVDTL  357

Query  941   IQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPD  762
             IQ+PPTE + S +  PRNSGLL+AVLYESQT+K      P+ +S  + +  DI+D +   
Sbjct  358   IQTPPTEHTLSYDHPPRNSGLLDAVLYESQTMKQ-----PKYSSHLADMLVDIMDTSSQY  412

Query  761   FHETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
             FHET+WE Y +  +PLGHS++S+F+E TP + +S +E QSVE + G
Sbjct  413   FHETDWEAYGESTTPLGHSSSSIFSESTPTNGNSFDEPQSVETIPG  458



>ref|XP_011080498.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Sesamum 
indicum]
 ref|XP_011080499.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Sesamum 
indicum]
Length=537

 Score =   494 bits (1271),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 283/459 (62%), Positives = 343/459 (75%), Gaps = 20/459 (4%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEG  1797
             MS+TSES +    K  V+SP+ ++A  G   GG  PLKKGPWTSAEDAIL+EYVT+HGEG
Sbjct  1     MSMTSESNERSMPKNGVDSPAADDANSGGYVGGHGPLKKGPWTSAEDAILVEYVTKHGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKH+GLARCGKSCRLRWANHL+PDLKKGAF+PEEE  IIELHAKMGNKWARMAAE
Sbjct  61    NWNAVQKHSGLARCGKSCRLRWANHLRPDLKKGAFSPEEERLIIELHAKMGNKWARMAAE  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPD+ L+   E+ Q++D+S+FS+GD+ + + +
Sbjct  121   LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDISLRPSKENQQSDDISSFSSGDSHYPDFM  180

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSPLDI--------PASSLLAQGLNSSYGPRPFFSTM  1281
              VN FEIPAVEFKNLELNQQL+P + LDI        PASSLLAQGL  SY  +   ST+
Sbjct  181   PVNNFEIPAVEFKNLELNQQLYPPALLDIPATGLLDVPASSLLAQGLPPSYPNKSLLSTI  240

Query  1280  NPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS  1101
             +PSKRLRG + LF GL +   +       YQND  MQ++QS   SS Y      DH S S
Sbjct  241   HPSKRLRGSEPLFPGLCATMGNSIPGRSQYQNDGPMQIAQSFINSSAY------DHTSFS  294

Query  1100  CVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPPTE  921
              V+ GSHA LN N SS EP WA K ELPSLQ+Q+  W SPSSPLP+LESV+TLIQ+PPTE
Sbjct  295   SVLSGSHAILNGNPSSSEPDWAMKLELPSLQTQVGGWGSPSSPLPNLESVDTLIQTPPTE  354

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
              + S +  PRNSGLL+AVLYESQT+K      P+ +S  + +  DI+D +   FHET+WE
Sbjct  355   HTLSYDHPPRNSGLLDAVLYESQTMKQ-----PKYSSHLADMLVDIMDTSSQYFHETDWE  409

Query  740   GYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
              Y +  +PLGHS++S+F+E TP + +S +E QSVE + G
Sbjct  410   AYGESTTPLGHSSSSIFSESTPTNGNSFDEPQSVETIPG  448



>ref|XP_011090254.1| PREDICTED: transcription factor GAMYB-like [Sesamum indicum]
Length=509

 Score =   491 bits (1265),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 270/433 (62%), Positives = 330/433 (76%), Gaps = 12/433 (3%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGGV-PLKKGPWTSAEDAILMEYVTRHGEG  1797
             MS+TSES++ M     V+SPSV++A  G N GG  PLKKGPWTSAEDAIL+EYVT+HGEG
Sbjct  1     MSMTSESDERMMPNNGVDSPSVDDANSGGNVGGNGPLKKGPWTSAEDAILVEYVTKHGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKH+GLARCGKSCRLRWANHL+PDLKKGAFTPEEE RIIELHAKMGNKWARMAAE
Sbjct  61    NWNAVQKHSGLARCGKSCRLRWANHLRPDLKKGAFTPEEERRIIELHAKMGNKWARMAAE  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPD+ +QA+ E   +++M+TFS+ +  H + +
Sbjct  121   LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDICMQAMTEKQPSDNMNTFSSAEVHHPDFM  180

Query  1436  QVNYFEIPAVEFKNLELNQQLH--------PQSPLDIPASSLLAQGLNSSYGPRPFFSTM  1281
              VN FEIPAVEFKNLELNQQL+          S LDIPASSLLAQGL+SSY  +   ST+
Sbjct  181   PVNNFEIPAVEFKNLELNQQLYSPALLDIPAGSLLDIPASSLLAQGLHSSYPNKSLLSTV  240

Query  1280  NPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS  1101
             +PSKRLRG +S F  L++   +  T    YQ+D  +Q++QS  +SS Y  +   DH + S
Sbjct  241   HPSKRLRGSESFFPSLNTAIGNALTGGSQYQSDGSLQIAQSFVYSSPYDHSSTSDHATSS  300

Query  1100  CVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsl--eSVETLIQSPP  927
              +IPGSHA + + + S EPAWA K ELPSLQ+Q+ SW SPS   P    ESV+ LIQ+PP
Sbjct  301   SLIPGSHA-VLNGTPSSEPAWAMKLELPSLQTQMGSWGSPSPSSPLPCFESVDILIQTPP  359

Query  926   TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETE  747
             TE ++S N+SP+NSGLL+AVLYES+T+K+SK    Q  S AS + + ++ N+  D HETE
Sbjct  360   TEHTQSCNLSPQNSGLLDAVLYESETMKNSKIDDCQHTSRASTVEAAMMANSTHDLHETE  419

Query  746   WEGYSDPISPLGH  708
             WE Y + +SPLGH
Sbjct  420   WEAYDEQLSPLGH  432



>ref|XP_009771204.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Nicotiana 
sylvestris]
Length=446

 Score =   475 bits (1222),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 268/442 (61%), Positives = 321/442 (73%), Gaps = 21/442 (5%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANA-GGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             M +TSE  D MT K  V SPSVEEA+GG N  GGVPLKKGPWT  EDA+LM+Y+ +HGEG
Sbjct  1     MCMTSECVDRMTSKVGVGSPSVEEASGGGNTRGGVPLKKGPWTKEEDAVLMDYIRKHGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NW+AVQKH+GLARCGKSCRLRWANHL+PDLKKGA TPEE  RI ELHAKMGNKWA++AA+
Sbjct  61    NWSAVQKHSGLARCGKSCRLRWANHLRPDLKKGALTPEEVRRINELHAKMGNKWAQIAAK  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIK+R+R GL IYPPD+  QA  E+ QN ++  FS+ ++ H + L
Sbjct  121   LPGRTDNEIKNYWNTRIKKRRRVGLQIYPPDICFQAFSENKQNNELGIFSSANS-HPDFL  179

Query  1436  QVNYFEIPAVEFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTM  1281
              +N FEIP VEFK LE +QQL+P         S  DIPA+SLLAQ L+SS       STM
Sbjct  180   PINDFEIPTVEFKKLEPSQQLYPWALVNIAASSFFDIPATSLLAQALSSS-NTCSGLSTM  238

Query  1280  NPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS  1101
             +PSKR+RG +S F G++ N   +F A   YQN+  +        SS  +     +HPS S
Sbjct  239   HPSKRIRGSESWFFGMTDN---LFQACHQYQNNGSLFAQSLGFSSSYTHNLTSDNHPSFS  295

Query  1100  CVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPPTE  921
               IPGSHA LN NSSS EP WAKK ELPSLQ Q+ +W    SPLPSLES +TLIQ PP E
Sbjct  296   GEIPGSHAPLNGNSSSSEPKWAKKLELPSLQIQMANWG-SPSPLPSLESFDTLIQYPPNE  354

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
              ++SG++SPRNSGLL+AVLYESQT K SK+   Q+ S       D+VD++ PD  ET+W 
Sbjct  355   HADSGSLSPRNSGLLDAVLYESQTSKASKHNSHQETS------CDVVDDSCPDLQETQWG  408

Query  740   GYSDPISPLGHSAASVFNEYTP  675
              YS+PISPLGHSAASV +EYTP
Sbjct  409   TYSNPISPLGHSAASVLSEYTP  430



>ref|XP_009628010.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Nicotiana 
tomentosiformis]
Length=435

 Score =   470 bits (1210),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 276/434 (64%), Positives = 328/434 (76%), Gaps = 24/434 (6%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEEATGGANA-GGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTG  1767
             MT K  V+SPSVEEA+GG +  GGVPLKKGPWT  EDAILM+Y+ +HGEGNW+AVQKH+G
Sbjct  1     MTSKVGVDSPSVEEASGGGSTRGGVPLKKGPWTKEEDAILMDYIRKHGEGNWSAVQKHSG  60

Query  1766  LARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIK  1587
             LARCGKSCRLRWANHL+PDLKKGA TPEE   I ELHAKMGNKWA++AA+LPGRTDNEIK
Sbjct  61    LARCGKSCRLRWANHLRPDLKKGALTPEEVRHINELHAKMGNKWAQIAAKLPGRTDNEIK  120

Query  1586  NYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAV  1407
             NYWNTRIK+RQRAGL IYPPD+  QA  E+ QN+++  FS+ ++ H + L +N F IP V
Sbjct  121   NYWNTRIKKRQRAGLQIYPPDISFQAFSENKQNKELGIFSSANS-HPDFLPINGFTIPTV  179

Query  1406  EFKNLELNQQLHPQSPL--------DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPD  1251
             EFK LE +Q L+P++ L        DIPA+SLLAQGL+SS       STM+PSKR+RG +
Sbjct  180   EFKKLEPSQLLYPRALLNIAASSFFDIPATSLLAQGLSSS-NTCSGLSTMHPSKRIRGSE  238

Query  1250  SLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPD-HPSLSCVIPGSHAs  1074
             S F GL  ND D+F A   YQND  + ++QS GFSS Y  NL  D HPS S  IPGSHA 
Sbjct  239   SWFFGL--ND-DLFQACHQYQNDGSL-LAQSLGFSSSYTHNLTSDHHPSFSVEIPGSHAP  294

Query  1073  lnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPPTERSESGNVSP  894
             LN NSSS EP WAKK ELPSLQ Q+ +W    SPLPSLES +TLIQSPP E ++SG++SP
Sbjct  295   LNGNSSSSEPKWAKKLELPSLQIQMENWG-SPSPLPSLESFDTLIQSPPNEHADSGSLSP  353

Query  893   RNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPL  714
             RNSGLL+AVLYESQT K SKN   Q+ S         VD+++PD  ET+W  YSDPISPL
Sbjct  354   RNSGLLDAVLYESQTSKASKNNSHQETSCD-------VDDSYPDLQETQWGRYSDPISPL  406

Query  713   GHSAASVFNEYTPI  672
             GHSAASV ++YTP+
Sbjct  407   GHSAASVLSKYTPM  420



>ref|XP_009628008.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628009.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Nicotiana 
tomentosiformis]
Length=441

 Score =   470 bits (1209),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 276/434 (64%), Positives = 328/434 (76%), Gaps = 24/434 (6%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEEATGGANA-GGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTG  1767
             MT K  V+SPSVEEA+GG +  GGVPLKKGPWT  EDAILM+Y+ +HGEGNW+AVQKH+G
Sbjct  1     MTSKVGVDSPSVEEASGGGSTRGGVPLKKGPWTKEEDAILMDYIRKHGEGNWSAVQKHSG  60

Query  1766  LARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIK  1587
             LARCGKSCRLRWANHL+PDLKKGA TPEE   I ELHAKMGNKWA++AA+LPGRTDNEIK
Sbjct  61    LARCGKSCRLRWANHLRPDLKKGALTPEEVRHINELHAKMGNKWAQIAAKLPGRTDNEIK  120

Query  1586  NYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAV  1407
             NYWNTRIK+RQRAGL IYPPD+  QA  E+ QN+++  FS+ ++ H + L +N F IP V
Sbjct  121   NYWNTRIKKRQRAGLQIYPPDISFQAFSENKQNKELGIFSSANS-HPDFLPINGFTIPTV  179

Query  1406  EFKNLELNQQLHPQSPL--------DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPD  1251
             EFK LE +Q L+P++ L        DIPA+SLLAQGL+SS       STM+PSKR+RG +
Sbjct  180   EFKKLEPSQLLYPRALLNIAASSFFDIPATSLLAQGLSSS-NTCSGLSTMHPSKRIRGSE  238

Query  1250  SLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPD-HPSLSCVIPGSHAs  1074
             S F GL  ND D+F A   YQND  + ++QS GFSS Y  NL  D HPS S  IPGSHA 
Sbjct  239   SWFFGL--ND-DLFQACHQYQNDGSL-LAQSLGFSSSYTHNLTSDHHPSFSVEIPGSHAP  294

Query  1073  lnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPPTERSESGNVSP  894
             LN NSSS EP WAKK ELPSLQ Q+ +W    SPLPSLES +TLIQSPP E ++SG++SP
Sbjct  295   LNGNSSSSEPKWAKKLELPSLQIQMENWG-SPSPLPSLESFDTLIQSPPNEHADSGSLSP  353

Query  893   RNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPL  714
             RNSGLL+AVLYESQT K SKN   Q+ S         VD+++PD  ET+W  YSDPISPL
Sbjct  354   RNSGLLDAVLYESQTSKASKNNSHQETSCD-------VDDSYPDLQETQWGRYSDPISPL  406

Query  713   GHSAASVFNEYTPI  672
             GHSAASV ++YTP+
Sbjct  407   GHSAASVLSKYTPM  420



>ref|XP_009771205.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Nicotiana 
sylvestris]
Length=436

 Score =   466 bits (1198),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 263/432 (61%), Positives = 315/432 (73%), Gaps = 21/432 (5%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEEATGGANA-GGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTG  1767
             MT K  V SPSVEEA+GG N  GGVPLKKGPWT  EDA+LM+Y+ +HGEGNW+AVQKH+G
Sbjct  1     MTSKVGVGSPSVEEASGGGNTRGGVPLKKGPWTKEEDAVLMDYIRKHGEGNWSAVQKHSG  60

Query  1766  LARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIK  1587
             LARCGKSCRLRWANHL+PDLKKGA TPEE  RI ELHAKMGNKWA++AA+LPGRTDNEIK
Sbjct  61    LARCGKSCRLRWANHLRPDLKKGALTPEEVRRINELHAKMGNKWAQIAAKLPGRTDNEIK  120

Query  1586  NYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAV  1407
             NYWNTRIK+R+R GL IYPPD+  QA  E+ QN ++  FS+ ++ H + L +N FEIP V
Sbjct  121   NYWNTRIKKRRRVGLQIYPPDICFQAFSENKQNNELGIFSSANS-HPDFLPINDFEIPTV  179

Query  1406  EFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPD  1251
             EFK LE +QQL+P         S  DIPA+SLLAQ L+SS       STM+PSKR+RG +
Sbjct  180   EFKKLEPSQQLYPWALVNIAASSFFDIPATSLLAQALSSS-NTCSGLSTMHPSKRIRGSE  238

Query  1250  SLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAsl  1071
             S F G++ N   +F A   YQN+  +        SS  +     +HPS S  IPGSHA L
Sbjct  239   SWFFGMTDN---LFQACHQYQNNGSLFAQSLGFSSSYTHNLTSDNHPSFSGEIPGSHAPL  295

Query  1070  nsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPR  891
             N NSSS EP WAKK ELPSLQ Q+ +W    SPLPSLES +TLIQ PP E ++SG++SPR
Sbjct  296   NGNSSSSEPKWAKKLELPSLQIQMANWG-SPSPLPSLESFDTLIQYPPNEHADSGSLSPR  354

Query  890   NSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLG  711
             NSGLL+AVLYESQT K SK+   Q+ S       D+VD++ PD  ET+W  YS+PISPLG
Sbjct  355   NSGLLDAVLYESQTSKASKHNSHQETS------CDVVDDSCPDLQETQWGTYSNPISPLG  408

Query  710   HSAASVFNEYTP  675
             HSAASV +EYTP
Sbjct  409   HSAASVLSEYTP  420



>gb|AGN52102.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52212.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=550

 Score =   468 bits (1205),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 264/452 (58%), Positives = 332/452 (73%), Gaps = 13/452 (3%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             M ++SES++       V+SPSV++   G   G  PLKKGPWTSAEDAIL+EYVT+HGEGN
Sbjct  1     MRMSSESDERTKPNSGVDSPSVDDGIEGNVGGNGPLKKGPWTSAEDAILVEYVTKHGEGN  60

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKH+GLARCGKSCRLRWANHL+PDLKKGAFTPEEE RIIELHAKMGNKWARMAAEL
Sbjct  61    WNAVQKHSGLARCGKSCRLRWANHLRPDLKKGAFTPEEERRIIELHAKMGNKWARMAAEL  120

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKRRQRAGLPIYP D+ LQ+++++ Q++DMS  S+G+  H  L+ 
Sbjct  121   PGRTDNEIKNYWNTRIKRRQRAGLPIYPADICLQSLNDNLQSDDMSNLSSGNVHHPELMP  180

Query  1433  VNYFEIPAVEFKNLELNQQLH-------PQSP-LDIPASSLLAQGLNSSYGPRPFFSTMN  1278
             +N F+IPAVEFKN+ELN  ++       P S  LDIPASSLL Q LNSSY  +    T++
Sbjct  181   INNFDIPAVEFKNMELNHHIYTPALLDFPASNLLDIPASSLLTQSLNSSYHNKSLLPTVH  240

Query  1277  PSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSC  1098
             PSKRLRG + +F GL++   ++F     Y  D+ MQ+   S   S Y QN   DH   S 
Sbjct  241   PSKRLRGSEPMFPGLNAPICNVFPGGNQYHIDSSMQI-GKSSVFSAYDQNPAADHARTSS  299

Query  1097  VIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsl--eSVETLIQSPPT  924
             +  GSHA +++ +SS EP+WA K ELPSLQ+Q+ +W SPS   P    ESV+ LIQ+PP 
Sbjct  300   LPNGSHA-ISNGNSSSEPSWAMKLELPSLQTQMGTWGSPSPSSPLPFFESVDILIQTPPN  358

Query  923   ERSESGNVSPRNSGLLEAVLYESQTLKHSK-NTLPQQNSGASIIPSDIVDNTFPDFHETE  747
             E   S N+SP+NSGLL+AVLYES+T+++SK N   QQ   AS +  + +D++    HETE
Sbjct  359   EHMNSCNLSPQNSGLLDAVLYESETMRNSKSNGGVQQTPHASTVAVNTMDDSAQALHETE  418

Query  746   WEGYSDPISPLGHSAASVFNEYTPISASSLEE  651
             W  Y + +SPLGHS++SVF+E TPIS +SL+E
Sbjct  419   WRAYEEQLSPLGHSSSSVFSESTPISGNSLDE  450



>ref|XP_010319228.1| PREDICTED: GAMyb-like1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322046.1| PREDICTED: GAMyb-like1 isoform X1 [Solanum lycopersicum]
 ref|XP_010324959.1| PREDICTED: GAMyb-like1 isoform X1 [Solanum lycopersicum]
Length=537

 Score =   445 bits (1145),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 255/461 (55%), Positives = 320/461 (69%), Gaps = 25/461 (5%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             MSI SE+E+ MT K +++SP  +EA+GG     VPLKKGPWTSAED IL++YV  HGEGN
Sbjct  1     MSIKSETEERMTSKVDMDSP--DEASGGDLGESVPLKKGPWTSAEDVILVDYVMTHGEGN  58

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQ+H+GLARCGKSCRLRWANHL+PDLKKGAFTPEEE RI+ELHAKMGNKWARMA EL
Sbjct  59    WNAVQRHSGLARCGKSCRLRWANHLRPDLKKGAFTPEEEQRIVELHAKMGNKWARMAVEL  118

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKRRQRAGLPIYP D+   A  ++ QNE++  FS+ D Q+ ++L 
Sbjct  119   PGRTDNEIKNYWNTRIKRRQRAGLPIYPADISFMA-SQNKQNEELGAFSSADAQNPDVLG  177

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSPLDIPASSL--------LAQGLNSSYGPRPFFSTMN  1278
             +N FEIPAVEFK LEL   L+P    DIPA SL        L+QG  + Y    F ST  
Sbjct  178   INNFEIPAVEFKKLELTHLLYPPQLADIPARSLLNDPVSNFLSQGHRAPYSSTYFLSTTY  237

Query  1277  PSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCM--QVsqssgfssgyyQNLD-PDHPS  1107
             P+KR+RG +S+F+G   ++ D+  +   YQND  +  Q        S Y  NL   D  +
Sbjct  238   PAKRIRGSESVFSG---SNGDLLNSL-QYQNDGSLLAQAQAQPLDFSSYNHNLTYDDQRA  293

Query  1106  LSCVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPP  927
             +S ++PG HA   + +SS EP WA K ELPSLQ+Q  +W SP S LPSL+SV+ LIQSPP
Sbjct  294   ISNIVPGGHA-YLNGNSSSEPTWAMKLELPSLQNQTENWGSPHSALPSLDSVDILIQSPP  352

Query  926   TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETE  747
                SESG++SP NSGLL+AVL+ESQT+K S +   Q N  +     + V+N+ PD    +
Sbjct  353   AGHSESGSLSPSNSGLLDAVLHESQTMKASNDNSYQGNETS----GNAVNNSCPDLKGCD  408

Query  746   WEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
               G+  P+SPL   +ASVF++Y PI+ SSL E  S+  + G
Sbjct  409   IYGH--PVSPLSQFSASVFSDYAPINESSLHEFPSMATMPG  447



>ref|NP_001234357.1| GAMyb-like1 [Solanum lycopersicum]
 gb|ABM53273.1| GAMyb-like1 [Solanum lycopersicum]
Length=537

 Score =   442 bits (1138),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 254/461 (55%), Positives = 319/461 (69%), Gaps = 25/461 (5%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             MSI SE+E+ MT K +++SP  +EA+GG     VPLKKGPWTSAE  IL++YV  HGEGN
Sbjct  1     MSIKSETEERMTSKVDMDSP--DEASGGDLGESVPLKKGPWTSAEGVILVDYVMTHGEGN  58

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQ+H+GLARCGKSCRLRWANHL+PDLKKGAFTPEEE RI+ELHAKMGNKWARMA EL
Sbjct  59    WNAVQRHSGLARCGKSCRLRWANHLRPDLKKGAFTPEEEQRIVELHAKMGNKWARMAVEL  118

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKRRQRAGLPIYP D+   A  ++ QNE++  FS+ D Q+ ++L 
Sbjct  119   PGRTDNEIKNYWNTRIKRRQRAGLPIYPADISFMA-SQNKQNEELGAFSSADAQNPDVLG  177

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSPLDIPASSL--------LAQGLNSSYGPRPFFSTMN  1278
             +N FEIPAVEFK LEL   L+P    DIPA SL        L+QG  + Y    F ST  
Sbjct  178   INNFEIPAVEFKKLELTHLLYPPQLADIPARSLLNDPVSNFLSQGHRAPYSSTYFLSTTY  237

Query  1277  PSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCM--QVsqssgfssgyyQNLD-PDHPS  1107
             P+KR+RG +S+F+G   ++ D+  +   YQND  +  Q        S Y  NL   D  +
Sbjct  238   PAKRIRGSESVFSG---SNGDLLNSL-QYQNDGSLLAQAQAQPLDFSSYNHNLTYDDQRA  293

Query  1106  LSCVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPP  927
             +S ++PG HA   + +SS EP WA K ELPSLQ+Q  +W SP S LPSL+SV+ LIQSPP
Sbjct  294   ISNIVPGGHA-YLNGNSSSEPTWAMKLELPSLQNQTENWGSPHSALPSLDSVDILIQSPP  352

Query  926   TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETE  747
                SESG++SP NSGLL+AVL+ESQT+K S +   Q N  +     + V+N+ PD    +
Sbjct  353   AGHSESGSLSPSNSGLLDAVLHESQTMKASNDNSYQGNETS----GNAVNNSCPDLKGCD  408

Query  746   WEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
               G+  P+SPL   +ASVF++Y PI+ SSL E  S+  + G
Sbjct  409   IYGH--PVSPLSQFSASVFSDYAPINESSLHEFPSMATMPG  447



>gb|KDP34526.1| hypothetical protein JCGZ_11076 [Jatropha curcas]
 gb|AIT52227.1| MYB family protein [Jatropha curcas]
Length=506

 Score =   430 bits (1106),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 261/446 (59%), Positives = 319/446 (72%), Gaps = 17/446 (4%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             +T+  ED+   K    SP++EEA+ G      PLKKGPWT+AEDAIL++YVT+HGEGNWN
Sbjct  1     MTNGVEDNKRSKVRRESPALEEASNG------PLKKGPWTAAEDAILVDYVTKHGEGNWN  54

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL+RCGKSCRLRWANHL+PDLKKGAFTPEEE RIIELHAKMGNKWARMAAELPG
Sbjct  55    AVQKHSGLSRCGKSCRLRWANHLRPDLKKGAFTPEEERRIIELHAKMGNKWARMAAELPG  114

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKR QRAGLPIYPP+V LQ ++ S +++DM T  + DT  SNL+Q +
Sbjct  115   RTDNEIKNYWNTRIKRLQRAGLPIYPPEVCLQVLNGSQESQDMGTLQSTDTHGSNLIQND  174

Query  1427  YFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGP  1254
             +FEIP VEFKNLELN+ L   SP  LDI  SS+L QG++ S+     F  M+P+KRLR  
Sbjct  175   HFEIPEVEFKNLELNRGLLSYSPTVLDISQSSMLKQGVSPSHSNNFMFPAMHPAKRLRES  234

Query  1253  DSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDP-DHPSLSCVIPGSHA  1077
             +++F  L  + S     F    +    +++ S G SS    + +    PSL  V+ G HA
Sbjct  235   ETIFPTLDCSVSSGLPVFIQSTDHFSEKIADSFGVSSRCVPHTNTYGQPSLG-VLSGIHA  293

Query  1076  slnsnsssLEPAWA-KKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERSES  909
              LN NSSS EP     K ELPSLQ   +Q  SW  P+SPLPSLESV+TLIQSPPTE+++ 
Sbjct  294   LLNDNSSSSEPFCGLMKLELPSLQYSETQQDSWGMPASPLPSLESVDTLIQSPPTEQTDC  353

Query  908   GNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSD  729
               +SPR+SGLLEAVLYES TLK S+N    Q S  SI+P D+ D +  +  ETEW+ + D
Sbjct  354   --LSPRSSGLLEAVLYESHTLKSSRNYSGHQTSDNSIVPGDVEDCSL-NPCETEWDIHGD  410

Query  728   PISPLGHSAASVFNEYTPISASSLEE  651
             P SPLGHS ASVF+  TPIS  S +E
Sbjct  411   PNSPLGHSVASVFSACTPISGGSSDE  436



>ref|XP_009606602.1| PREDICTED: transcription factor GAMYB-like [Nicotiana tomentosiformis]
Length=450

 Score =   427 bits (1097),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 266/464 (57%), Positives = 311/464 (67%), Gaps = 57/464 (12%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGGV-PLKKGPWTSAEDAILMEYVTRHGEG  1797
             M+IT E+ D MT K +V+SP  +EAT G NAGG  PLKKGPWTSAEDAILM+YV +HGEG
Sbjct  1     MNITIETNDMMTSKVDVDSP--DEATVGGNAGGSEPLKKGPWTSAEDAILMDYVMKHGEG  58

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQK +GLARCGKSCRLRWANHL+PDLKKGAFTPEEE RI+ELHAKMGNKWARMAAE
Sbjct  59    NWNAVQKQSGLARCGKSCRLRWANHLRPDLKKGAFTPEEERRIVELHAKMGNKWARMAAE  118

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKR QRAGLP+YPPD+   A  ++ QNE++  FS+ D Q+ N+ 
Sbjct  119   LPGRTDNEIKNYWNTRIKRHQRAGLPVYPPDICFLA-SQNKQNEELGAFSSADAQNPNVS  177

Query  1436  QVNYFEIPAVEFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTM  1281
               N F+IPAVEFKNLELN+ L+P         S LDI  SS LAQG +  YG   F STM
Sbjct  178   GTNTFDIPAVEFKNLELNRLLYPPPLVEIPSNSLLDITLSSFLAQGHSPPYGSTSFLSTM  237

Query  1280  NPSKRLRGPDSLFTGLSSNDSDIF---TAFGPYQNDTCMQVsqssgfssgyyQNLDPDHP  1110
             +PSKR+RG +S+F G  SN   +      F  Y N                      DH 
Sbjct  238   HPSKRIRGSESIFFG--SNGGSLLGQPLGFSSYNNHNVTY----------------DDHE  279

Query  1109  SLSC-VIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQS  933
             S SC VIPGS A LN NS       +   ELPSLQ+Q  +W  PSSPLPSLES++TLIQS
Sbjct  280   SFSCTVIPGSQAPLNGNS-------SSSEELPSLQNQTANWGPPSSPLPSLESIDTLIQS  332

Query  932   PPTERSESG-NVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFH  756
             P    SESG ++SPRNSGLL+A+LY SQT+K S +   Q+ S       D VDN+     
Sbjct  333   PAAGHSESGSDLSPRNSGLLDAMLYGSQTMKASTDNSHQEKSSF----GDAVDNS-----  383

Query  755   ETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
                   Y+D ISPL H  ASVF+EY PI  SSL E  S+  + G
Sbjct  384   ------YADLISPLSHFTASVFSEYAPIDGSSLHEFPSLATMPG  421



>ref|XP_009762153.1| PREDICTED: transcription factor GAMYB-like [Nicotiana sylvestris]
 ref|XP_009762156.1| PREDICTED: transcription factor GAMYB-like [Nicotiana sylvestris]
 ref|XP_009762161.1| PREDICTED: transcription factor GAMYB-like [Nicotiana sylvestris]
 ref|XP_009762167.1| PREDICTED: transcription factor GAMYB-like [Nicotiana sylvestris]
Length=449

 Score =   427 bits (1097),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 264/463 (57%), Positives = 311/463 (67%), Gaps = 56/463 (12%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGGV-PLKKGPWTSAEDAILMEYVTRHGEG  1797
             MSIT E++D MT K +V+SP  +EATGG NAGG  PLKKGPWTSAEDAILM+YV +HGEG
Sbjct  1     MSITVETDDMMTSKVDVDSP--DEATGGVNAGGSEPLKKGPWTSAEDAILMDYVMKHGEG  58

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQK +GLARCGKSCRLRWANHL+PDLKKGAFTPEEE RI+ELHAKMGNKWARMAAE
Sbjct  59    NWNAVQKQSGLARCGKSCRLRWANHLRPDLKKGAFTPEEERRIVELHAKMGNKWARMAAE  118

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKR QRAGLP+YPPD+   A  ++ QNE++S FS+ D Q+ ++ 
Sbjct  119   LPGRTDNEIKNYWNTRIKRHQRAGLPVYPPDICFLA-SQNKQNEELSAFSSADAQNPDVS  177

Query  1436  QVNYFEIPAVEFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTM  1281
               N F+IPAVEFKNLELN+ L+P         S LDI  SS LAQG +  Y    F STM
Sbjct  178   GTNDFDIPAVEFKNLELNRPLYPPPLFEIPSNSLLDITVSSFLAQGHSPPYNSTSFLSTM  237

Query  1280  NPSKRLRGPDSLFTGLSSNDSDIF---TAFGPYQNDTCMQVsqssgfssgyyQNLDPDHP  1110
             +PSKR+RG +S+F    SN   +      F  Y N                    D   P
Sbjct  238   HPSKRIRGSESMF---GSNGGSLLGQPLGFSSYNNHNV---------------TYDDHLP  279

Query  1109  SLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSP  930
               S VIPGSHA LN NS       +   ELPSLQ+Q  +W  PSSPLPSLES++TLI SP
Sbjct  280   FSSIVIPGSHAPLNGNS-------SSSEELPSLQNQTANWGPPSSPLPSLESIDTLIHSP  332

Query  929   PTERSESG-NVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHE  753
             P   SESG ++SPRNSGLL+A+LY S T+K S +   Q+         D VDN+      
Sbjct  333   PAGHSESGSDLSPRNSGLLDAMLYGSHTMKASTDNSHQEKETF----GDAVDNS------  382

Query  752   TEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
                  Y+DPISPL H +ASVF+EY PI  SSL E  S+  + G
Sbjct  383   -----YADPISPLSHFSASVFSEYAPIDGSSLHEFPSLATMPG  420



>ref|XP_010673830.1| PREDICTED: transcription factor GAMYB-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010673831.1| PREDICTED: transcription factor GAMYB-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010673832.1| PREDICTED: transcription factor GAMYB-like [Beta vulgaris subsp. 
vulgaris]
Length=559

 Score =   424 bits (1091),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 262/455 (58%), Positives = 323/455 (71%), Gaps = 9/455 (2%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGGV-PLKKGPWTSAEDAILMEYVTRHGEG  1797
             + +TS+S+     K   NSPS EE + G N+ G  PLKKGPWTSAEDAIL+EYVT+HGEG
Sbjct  2     IEMTSDSDKRRAAKCRKNSPSAEEVSSGGNSSGGSPLKKGPWTSAEDAILVEYVTKHGEG  61

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKH+GL+RCGKSCRLRWANHL+PDLKKGAFTPEEE+RIIELHAKMGNKWARMAAE
Sbjct  62    NWNAVQKHSGLSRCGKSCRLRWANHLRPDLKKGAFTPEEENRIIELHAKMGNKWARMAAE  121

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKR QRAGLPIYPP V L A+ ES Q+EDM T   GD   S   
Sbjct  122   LPGRTDNEIKNYWNTRIKRLQRAGLPIYPPSVRLHAMSESQQSEDMMTCQNGDLHGSEAS  181

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRL  1263
             + + F+IP VEFKNL LNQ     SP  LD+P +SLL +G++SS      FS +NP KRL
Sbjct  182   ESSGFDIPDVEFKNLGLNQGYLNCSPALLDMPPTSLLQKGVSSSSSYGFMFSALNPHKRL  241

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCV-IPG  1086
             R  +S F    ++ S+ F++F  +++D   +++      S    + D +    S + + G
Sbjct  242   REVESQFHSSVASTSNAFSSFDQHEDDLFGRLTSVQPLWSPPSYDPDFNIDQTSPIDVLG  301

Query  1085  SHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTER  918
             SHA +N NSSS EP   A K ELPSLQ   SQ+ SW +PSSPLPSLESV+TLIQSP +E 
Sbjct  302   SHAPINGNSSSSEPIHEAMKLELPSLQYSASQVGSWATPSSPLPSLESVDTLIQSPLSEH  361

Query  917   SESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEG  738
             ++S   SPR+SGLLEA++YES++LK S     QQ S  S++  D V+++  +  ET W+ 
Sbjct  362   TQSNCPSPRSSGLLEAIVYESRSLKCSNYNAHQQISEPSVMAGDGVESSSRNVCETRWDV  421

Query  737   YSDPISPLGHSAASVFNEYTPIS-ASSLEEHQSVE  636
               DP+SPL  SAASVF EYTP+S  SS +E QS E
Sbjct  422   CGDPMSPLSQSAASVFVEYTPVSGGSSSDEPQSAE  456



>ref|XP_002313492.1| hypothetical protein POPTR_0009s02380g [Populus trichocarpa]
 gb|EEE87447.1| hypothetical protein POPTR_0009s02380g [Populus trichocarpa]
Length=516

 Score =   422 bits (1085),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 259/447 (58%), Positives = 310/447 (69%), Gaps = 13/447 (3%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             S+ + SEDS   K   +SP+ +EA GG   GG +PLKKGPWTSAEDAIL++YV +HGEGN
Sbjct  3     SMMNGSEDSKRSKDCRDSPAADEANGGEMMGGMIPLKKGPWTSAEDAILIDYVKKHGEGN  62

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKH+GL RCGKSCRLRWANHL+PDLKKGAFTPEEE+RIIELHA MGNKWARMAAEL
Sbjct  63    WNAVQKHSGLFRCGKSCRLRWANHLRPDLKKGAFTPEEENRIIELHATMGNKWARMAAEL  122

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKR QR GLPIYPPDV LQ        ++M T  TGDT   +L+Q
Sbjct  123   PGRTDNEIKNYWNTRIKRLQRTGLPIYPPDVCLQLYKTIQDGQNMGTLQTGDTCDPDLMQ  182

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
              ++F+IP VEFKNLEL+Q +   S +  D   SS+L QG+ SSYG    F T++P+KRLR
Sbjct  183   TDHFKIPEVEFKNLELSQDVLSYSSVLFDTSPSSMLKQGVGSSYGNALVFPTIHPAKRLR  242

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDP-DHPSLSCVIPGS  1083
                ++FTGL          F    +  C ++ + SG SS Y  +L   D PS   V+PGS
Sbjct  243   ESQTIFTGLDGCVGRGMPVFDQLTDYPCGKIIEHSGLSSPYDPDLSTYDQPSWD-VLPGS  301

Query  1082  HAslnsnsssLEP--AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTER  918
             HA LN NSSS         K ELPSLQ   SQ  SW +P+SPLPSLESV+TLIQSPPT+ 
Sbjct  302   HAILNDNSSSSNVPICGTMKLELPSLQYSESQQDSWGTPTSPLPSLESVDTLIQSPPTKE  361

Query  917   SESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFP-DFHETEWE  741
               S   SPR+SGLLEAVLYE +TLK+SK       S  S++   +  N  P +   TEWE
Sbjct  362   MRSDGQSPRSSGLLEAVLYEYRTLKNSKKCSGHPTSDVSVVFGGV--NVSPLNTSATEWE  419

Query  740   GYSDPISPLGHSAASVFNEYTPISASS  660
              Y+D  SP GHSA+S+F+E TP+S SS
Sbjct  420   VYADLNSPSGHSASSLFSECTPVSGSS  446



>ref|XP_010251854.1| PREDICTED: transcription factor GAMYB [Nelumbo nucifera]
 ref|XP_010251855.1| PREDICTED: transcription factor GAMYB [Nelumbo nucifera]
 ref|XP_010251856.1| PREDICTED: transcription factor GAMYB [Nelumbo nucifera]
Length=558

 Score =   422 bits (1084),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 250/460 (54%), Positives = 322/460 (70%), Gaps = 21/460 (5%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEAT-GGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             T+ESE+SM LK   +SPS++E + GG+  GGV LKKGPWTSAEDAIL++YV +HGEGNWN
Sbjct  5     TNESEESMVLKVQTDSPSIDEGSCGGSMNGGVVLKKGPWTSAEDAILVDYVKKHGEGNWN  64

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL RCGKSCRLRWANHL+P+LKKGAF+ EEE  IIELHAKMGNKWARMAA LPG
Sbjct  65    AVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFSQEEEKLIIELHAKMGNKWARMAAHLPG  124

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKRRQRAGLP+YPP++ LQA++ES Q+++    ++G+ +H +LLQ N
Sbjct  125   RTDNEIKNYWNTRIKRRQRAGLPLYPPELCLQALNESQQSQNSGEVNSGEKRHHDLLQGN  184

Query  1427  YFEIPAVEFKNLELNQQL--HPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPS----KR  1266
              +EIP V F N + NQ     P +  DI  SS+L QG  SS    P +S M P     KR
Sbjct  185   SYEIPDVIFDNFKANQGALSFPSALPDISMSSMLTQGPGSS----PNYSFMPPMMHRPKR  240

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             LR  ++LF   + + ++ F  F  +Q D C ++ +  G S       DPD  S +    G
Sbjct  241   LRESEALFPSYNGSITNGFPEFEQFQGDNCQKIHRPCGMSFP----YDPDPSSKNPQHFG  296

Query  1085  SHAslnsnsssLEPA-WAKKPELPSLQSQ---IVSWDspssplpsleSVETLIQS-PPTE  921
              H+ LN N S+ +P   + K ELPSLQ Q   +  W + +   PSLESV+T IQS PPT 
Sbjct  297   GHSLLNGNFSASKPTPGSMKLELPSLQYQETDLGGWGTSTLLPPSLESVDTFIQSPPPTG  356

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASII-PSDIVDNTFPDFHETEW  744
               +S  +SPRNSGLLEA+L+E+Q L   KN   +++S +S++ PSD+VD++  +  +TEW
Sbjct  357   TVQSDCLSPRNSGLLEALLHEAQNLSSGKNHSFEKSSNSSVVTPSDVVDSSSLNLCDTEW  416

Query  743   EGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
             E YSDPISPLG SAASVF+E TPIS SSL+E    +++ G
Sbjct  417   EEYSDPISPLGRSAASVFSECTPISGSSLDETTPSDIIPG  456



>ref|XP_011003856.1| PREDICTED: transcription factor GAMYB-like [Populus euphratica]
Length=516

 Score =   414 bits (1064),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 253/447 (57%), Positives = 307/447 (69%), Gaps = 13/447 (3%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             S+ + S+DS   K   +SP+ +EA GG   GG +PLKKGPWT AEDAIL++YV +HGEGN
Sbjct  3     SMMNGSKDSKRSKDCRDSPAADEANGGEMMGGMIPLKKGPWTPAEDAILIDYVKKHGEGN  62

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKH+GL RCGKSCRLRWANHL+PDLKKGAFTPEEE+RIIELHA MGNKWARMAAEL
Sbjct  63    WNAVQKHSGLFRCGKSCRLRWANHLRPDLKKGAFTPEEENRIIELHATMGNKWARMAAEL  122

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKR QR GLPIYPPDV LQ        ++M T  TGDT   +L+Q
Sbjct  123   PGRTDNEIKNYWNTRIKRLQRTGLPIYPPDVCLQLFKTIQDGQNMGTSQTGDTYDPDLMQ  182

Query  1433  VNYFEIPAVEFKNLELNQQL--HPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
              ++F+IP VEFKNLEL++ +  +     D  +SS+L QG+ SSYG    F T++P+KRLR
Sbjct  183   TDHFKIPEVEFKNLELSRDVLSYSSGLFDTSSSSMLKQGVGSSYGNAVVFPTIHPAKRLR  242

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDP-DHPSLSCVIPGS  1083
                ++FTGL          F    +  C ++ + SG S  Y  +L   D P    V PGS
Sbjct  243   ESQTIFTGLDGCVGRGMPMFDQLTDYPCGKIIEHSGLSPPYDPDLSTYDQPPWD-VFPGS  301

Query  1082  HAslnsnsssLEP--AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTER  918
             HA LN N+SS       A K ELPSLQ   SQ  SW +P+SPLPSLESV+TLIQSPPT+ 
Sbjct  302   HAILNDNTSSSNGPICGAMKLELPSLQYSESQQDSWGTPTSPLPSLESVDTLIQSPPTKE  361

Query  917   SESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFP-DFHETEWE  741
               S   SPR+SGLLEAVLYES+TLK+SK       S  S+    +  N  P +   TEWE
Sbjct  362   MRSDGQSPRSSGLLEAVLYESRTLKNSKKCSGHPTSDVSVAFGGV--NVSPLNTSATEWE  419

Query  740   GYSDPISPLGHSAASVFNEYTPISASS  660
              Y+D  SP G+SA+S+F+E TP+S SS
Sbjct  420   VYADLNSPSGYSASSLFSECTPVSGSS  446



>ref|XP_008231582.1| PREDICTED: transcription factor GAMYB-like [Prunus mume]
Length=560

 Score =   413 bits (1061),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 251/461 (54%), Positives = 315/461 (68%), Gaps = 19/461 (4%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNA  1785
             T+ESED +  K  + SP ++E+ GG   GG+ LKKGPWTSAEDAIL+EYV +HGEGNWNA
Sbjct  5     TNESEDGVLSKDQIESPMMDESNGGTGNGGIVLKKGPWTSAEDAILVEYVKKHGEGNWNA  64

Query  1784  VQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGR  1605
             VQKH+GL RCGKSCRLRWANHL+P+LKKGAFTPEEEH I+ELHAKMGNKWARMAA LPGR
Sbjct  65    VQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTPEEEHLIVELHAKMGNKWARMAAHLPGR  124

Query  1604  TDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNY  1425
             TDNEIKNYWNTRIKRRQRAGLP+YPP+V LQA+ ES Q +     +  D  H + LQ N 
Sbjct  125   TDNEIKNYWNTRIKRRQRAGLPLYPPEVCLQALQESQQGQSSGGINGADRAHHDSLQTNS  184

Query  1424  FEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPS----KRL  1263
             +EIP V F++L+ N  + P  P   D+ AS +L +GL+SS    P+   M P+    KRL
Sbjct  185   YEIPDVVFESLKGNNCVLPYVPEIPDLSASGVLMKGLSSS----PYCGFMPPTMHRQKRL  240

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             R   SLF+    +  + F  F  +Q+DTC +V QS G S  +  +     P    VI GS
Sbjct  241   RESTSLFSTSDGSFKNGFPQFDHFQDDTCDKVGQSFGLSFPHDPDPTTKSPLSFGVIQGS  300

Query  1082  HAslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERS  915
             H+  N NSS+ +P + A K ELPSLQ   + + SW S S P P LES++  IQSPP   +
Sbjct  301   HSLSNGNSSASKPTSGAVKLELPSLQYPETDLGSW-STSPPPPLLESIDAFIQSPPPVGA  359

Query  914   -ESGNVSPRNSGLLEAVLYESQTLKHSKNTL-PQQNSGASIIPSDIVDNTFPDFHETEWE  741
              ES   SPRNSGLL+A+L+E++TL  +KN    + ++ +S+ P DI D++  +  ETEWE
Sbjct  360   FESDCASPRNSGLLDALLHEAKTLSSAKNLYSDKSSNSSSVTPGDIADSSTLNICETEWE  419

Query  740   GYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
              Y DPISPLGHSA S+F+E TPISA  SSL+E    E   G
Sbjct  420   DYRDPISPLGHSATSLFSECTPISASGSSLDEPPPAETFTG  460



>ref|XP_007218962.1| hypothetical protein PRUPE_ppa003628mg [Prunus persica]
 gb|EMJ20161.1| hypothetical protein PRUPE_ppa003628mg [Prunus persica]
Length=560

 Score =   410 bits (1054),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 250/461 (54%), Positives = 314/461 (68%), Gaps = 19/461 (4%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNA  1785
             T+ESED +  K  + SP ++E+ GG   GG+ LKKGPWTSAEDAIL+EYV +HGEGNWNA
Sbjct  5     TNESEDGVLSKDQIESPLMDESNGGTGNGGIVLKKGPWTSAEDAILVEYVKKHGEGNWNA  64

Query  1784  VQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGR  1605
             VQKH+GL RCGKSCRLRWANHL+P+LKKGAFTPEEEH I+ELHAKMGNKWARMAA LPGR
Sbjct  65    VQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTPEEEHLIVELHAKMGNKWARMAAHLPGR  124

Query  1604  TDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNY  1425
             TDNEIKNYWNTRIKRRQRAGLP+YPP+V LQA+ ES Q +     +  D  H + LQ N 
Sbjct  125   TDNEIKNYWNTRIKRRQRAGLPLYPPEVCLQALQESQQGQSSGGINGADRAHHDSLQTNS  184

Query  1424  FEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPS----KRL  1263
             +EIP V F++L+ N  + P  P   D+ AS +L + L+SS    P+   M P+    KRL
Sbjct  185   YEIPDVVFESLKGNNCVLPYVPEIPDLSASGVLMKDLSSS----PYCGFMPPTMHRQKRL  240

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             R   SLF+    +  + F  F  +Q+DTC +V QS G S  +  +     P    VI GS
Sbjct  241   RESTSLFSTSDGSFKNGFPQFDHFQDDTCDKVGQSFGLSFPHDPDPTSKSPLSFGVIQGS  300

Query  1082  HAslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERS  915
             H+  N NSS+ +P + A K ELPSLQ   + + SW S S P P LES++  IQSPP   +
Sbjct  301   HSLSNGNSSASKPTSGAVKLELPSLQYPETDLGSW-STSPPPPLLESIDAFIQSPPPVGA  359

Query  914   -ESGNVSPRNSGLLEAVLYESQTLKHSKNTL-PQQNSGASIIPSDIVDNTFPDFHETEWE  741
              ES   SPRNSGLL+A+L+E++TL  +KN    + ++ +S+ P DI D++  +  ETEWE
Sbjct  360   FESDCASPRNSGLLDALLHEAKTLSSAKNLCSDKSSNSSSVTPGDIADSSTLNICETEWE  419

Query  740   GYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
              Y DPISPLGHSA S+F+E TPISA  SSL+E    E   G
Sbjct  420   DYRDPISPLGHSATSLFSECTPISASGSSLDEPPPAETFTG  460



>emb|CAN63791.1| hypothetical protein VITISV_037981 [Vitis vinifera]
Length=460

 Score =   407 bits (1045),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 240/427 (56%), Positives = 298/427 (70%), Gaps = 20/427 (5%)
 Frame = -1

Query  1853  WTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEH  1674
             WTSAEDA+L++YVT+HGEGNWNAV KH+GL+RCGKSCRLRWANHL+PDLKKGAFTPEEEH
Sbjct  34    WTSAEDAVLIDYVTKHGEGNWNAVMKHSGLSRCGKSCRLRWANHLRPDLKKGAFTPEEEH  93

Query  1673  RIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESN  1494
             RIIELHA+MGNKWARMAAELPGRTDNEIKNYWNTRIKR QRAGLPIYPPDV ++A++ S 
Sbjct  94    RIIELHARMGNKWARMAAELPGRTDNEIKNYWNTRIKRLQRAGLPIYPPDVSMKALNGSQ  153

Query  1493  QNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGL  1320
             Q++ M + +TG+   S+LLQ N FEIPAV+FKNL+ N  ++P  P   DI  S  L Q L
Sbjct  154   QSQSMGSLTTGEASPSDLLQGNSFEIPAVQFKNLQ-NPGIYPYPPTYFDILPSGSLTQNL  212

Query  1319  NSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQ-----------NDTCM  1173
              SS G    F  M+P KR R  ++ F+GL+ + S+ F A   Y            +DTC 
Sbjct  213   GSSDGQNFMFPAMHPPKRFRESETFFSGLNDDFSNAFPALDLYDDTCDNNPYYLYDDTCE  272

Query  1172  QVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQ---SQ  1002
             +  Q   +SS Y  +L  +  SL   +PGSHA  N N SS   + A K ELPSLQ   +Q
Sbjct  273   KNPQPFEWSSSYDPDLSTNLTSLGG-LPGSHALSNGNFSSEPISGAMKVELPSLQYSEAQ  331

Query  1001  IVSWDspssplpsleSVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLP  822
             + +W     P+PS+ESV+TLIQSP TE+ +   +SP  SGLLEAV+YES+ LK   ++  
Sbjct  332   VGNW-GSLFPMPSIESVDTLIQSPQTEQIQVDCLSPSKSGLLEAVVYESRNLKRKYDSC-  389

Query  821   QQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQS  642
              Q S  +I  +D+V N   + +E EW  Y DP SPLG+SAASVFN +TPIS SS +E QS
Sbjct  390   HQASNTAIECNDVVGNLPLNPYEAEWNVYVDPTSPLGNSAASVFNVHTPISGSSPDEPQS  449

Query  641   VEMLAGE  621
             +E L GE
Sbjct  450   IETLLGE  456



>emb|CBI24294.3| unnamed protein product [Vitis vinifera]
Length=487

 Score =   404 bits (1037),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 230/415 (55%), Positives = 285/415 (69%), Gaps = 35/415 (8%)
 Frame = -1

Query  1853  WTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEH  1674
             WTSAEDA+L++YVT+HGEGNWNAV KH+GL+RCGKSCRLRWANHL+PDLKKGAFTPEEEH
Sbjct  34    WTSAEDAVLIDYVTKHGEGNWNAVMKHSGLSRCGKSCRLRWANHLRPDLKKGAFTPEEEH  93

Query  1673  RIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESN  1494
             RIIELHA+MGNKWARMAAELPGRTDNEIKNYWNTRIKR QRAGLPIYPPDV ++A++ S 
Sbjct  94    RIIELHARMGNKWARMAAELPGRTDNEIKNYWNTRIKRLQRAGLPIYPPDVSMKALNGSQ  153

Query  1493  QNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGL  1320
             Q++ M + +TG+   S+LLQ N FEIPAV+FKNL+ N  ++P  P   DI  S  L Q L
Sbjct  154   QSQSMGSLTTGEASPSDLLQGNSFEIPAVQFKNLQ-NPGIYPYPPTYFDILPSGSLTQNL  212

Query  1319  NSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssg  1140
              SS G    F  M+P KR R  ++ F+GL+ + S+ F A   Y +               
Sbjct  213   GSSDGQNFMFPAMHPPKRFRESETFFSGLNDDFSNAFPALDLYDD---------------  257

Query  1139  yyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQ---SQIVSWDspsspl  969
                         +C +PGSHA  N N SS   + A K ELPSLQ   +Q+ +W     P+
Sbjct  258   ------------TCGLPGSHALSNGNFSSEPISGAMKVELPSLQYSEAQVGNW-GSLFPM  304

Query  968   psleSVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPS  789
             PS+ESV+TLIQSP TE+ +   +SP  SGLLEAV+YES+ LK   ++   Q S  +I  +
Sbjct  305   PSIESVDTLIQSPQTEQIQVDCLSPSKSGLLEAVVYESRNLKRKYDSC-HQASNTAIECN  363

Query  788   DIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
             D+V N   + +E EW  Y DP SPLG+SAASVFN +TPIS SS +E QS+E L G
Sbjct  364   DVVGNLPLNPYEAEWNVYVDPTSPLGNSAASVFNVHTPISGSSPDEPQSIETLLG  418



>ref|XP_010651548.1| PREDICTED: transcription factor GAMYB [Vitis vinifera]
 ref|XP_010651549.1| PREDICTED: transcription factor GAMYB [Vitis vinifera]
Length=524

 Score =   404 bits (1038),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 239/426 (56%), Positives = 297/426 (70%), Gaps = 20/426 (5%)
 Frame = -1

Query  1853  WTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEH  1674
             WTSAEDA+L++YVT+HGEGNWNAV KH+GL+RCGKSCRLRWANHL+PDLKKGAFTPEEEH
Sbjct  34    WTSAEDAVLIDYVTKHGEGNWNAVMKHSGLSRCGKSCRLRWANHLRPDLKKGAFTPEEEH  93

Query  1673  RIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESN  1494
             RIIELHA+MGNKWARMAAELPGRTDNEIKNYWNTRIKR QRAGLPIYPPDV ++A++ S 
Sbjct  94    RIIELHARMGNKWARMAAELPGRTDNEIKNYWNTRIKRLQRAGLPIYPPDVSMKALNGSQ  153

Query  1493  QNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGL  1320
             Q++ M + +TG+   S+LLQ N FEIPAV+FKNL+ N  ++P  P   DI  S  L Q L
Sbjct  154   QSQSMGSLTTGEASPSDLLQGNSFEIPAVQFKNLQ-NPGIYPYPPTYFDILPSGSLTQNL  212

Query  1319  NSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQ-----------NDTCM  1173
              SS G    F  M+P KR R  ++ F+GL+ + S+ F A   Y            +DTC 
Sbjct  213   GSSDGQNFMFPAMHPPKRFRESETFFSGLNDDFSNAFPALDLYDDTCDNNPYYLYDDTCE  272

Query  1172  QVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQ---SQ  1002
             +  Q   +SS Y  +L  +  SL   +PGSHA  N N SS   + A K ELPSLQ   +Q
Sbjct  273   KNPQPFEWSSSYDPDLSTNLTSLGG-LPGSHALSNGNFSSEPISGAMKVELPSLQYSEAQ  331

Query  1001  IVSWDspssplpsleSVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLP  822
             + +W     P+PS+ESV+TLIQSP TE+ +   +SP  SGLLEAV+YES+ LK   ++  
Sbjct  332   VGNW-GSLFPMPSIESVDTLIQSPQTEQIQVDCLSPSKSGLLEAVVYESRNLKRKYDSC-  389

Query  821   QQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQS  642
              Q S  +I  +D+V N   + +E EW  Y DP SPLG+SAASVFN +TPIS SS +E QS
Sbjct  390   HQASNTAIECNDVVGNLPLNPYEAEWNVYVDPTSPLGNSAASVFNVHTPISGSSPDEPQS  449

Query  641   VEMLAG  624
             +E L G
Sbjct  450   IETLLG  455



>ref|XP_010266746.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Nelumbo 
nucifera]
Length=463

 Score =   401 bits (1031),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 237/454 (52%), Positives = 312/454 (69%), Gaps = 13/454 (3%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGAN-AGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             T++SE+SM  K  ++SPS+++++ G    GGV LKKGPWTSAEDAIL++YV +HGEGNWN
Sbjct  5     TNDSEESMLSKDQIDSPSIDDSSCGRTMGGGVVLKKGPWTSAEDAILVDYVKKHGEGNWN  64

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL RCGKSCRLRWANHL+P+LKKGAF+ EEE  IIELHAKMGNKWARMAA LPG
Sbjct  65    AVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFSQEEERMIIELHAKMGNKWARMAAHLPG  124

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKRRQRAGLP+YPP+V LQA++ES Q ++    ++ D +H +LLQ N
Sbjct  125   RTDNEIKNYWNTRIKRRQRAGLPLYPPEVCLQALNESRQTQNSVEINSVDKRHHDLLQGN  184

Query  1427  YFEIPAVEFKNLELNQQL--HPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGP  1254
              +EIP V F N +  Q    +P +  +I  S++L Q L SS         M+ +K+LR  
Sbjct  185   SYEIPDVIFDNFKATQGALSYPSALPNISTSNILTQNLVSSQNYSFMPPIMHHTKQLRES  244

Query  1253  DSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAs  1074
             + LF GL+ N +     F  +Q D C ++ +  G S       DPD  +      GSHA 
Sbjct  245   EGLFPGLNGNVTSALPPFDQFQGDNCEKIHRPFGLSFP----YDPDPNAKDPPHFGSHAL  300

Query  1073  lnsnsssLEPA-WAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQS-PPTERSES  909
             +N N S+ +P   A K ELPSLQ   + + SW +      SLESV+T IQS PPT   +S
Sbjct  301   INGNFSASKPIPGAVKLELPSLQYPETDLGSWGTSLPMPVSLESVDTFIQSPPPTGSVQS  360

Query  908   GNVSPRNSGLLEAVLYESQTLKHSKN-TLPQQNSGASIIPSDIVDNTFPDFHETEWEGYS  732
               + PRNSGLLEA+L+E+Q +  +KN +  + +S + + P+++VD++  +  ETEW+ YS
Sbjct  361   DCLLPRNSGLLEALLHEAQNISSAKNQSADKSSSSSVVTPNEVVDSSNLNLCETEWDEYS  420

Query  731   DPISPLGHSAASVFNEYTPISASSLEEHQSVEML  630
             DPISPLG SAASVF+E TPIS SS +E  S ++L
Sbjct  421   DPISPLGRSAASVFSECTPISGSSFDEPPSNDIL  454



>ref|XP_010266742.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010266743.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010266744.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010266745.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Nelumbo 
nucifera]
Length=557

 Score =   403 bits (1035),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 238/458 (52%), Positives = 314/458 (69%), Gaps = 13/458 (3%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGAN-AGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             T++SE+SM  K  ++SPS+++++ G    GGV LKKGPWTSAEDAIL++YV +HGEGNWN
Sbjct  5     TNDSEESMLSKDQIDSPSIDDSSCGRTMGGGVVLKKGPWTSAEDAILVDYVKKHGEGNWN  64

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL RCGKSCRLRWANHL+P+LKKGAF+ EEE  IIELHAKMGNKWARMAA LPG
Sbjct  65    AVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFSQEEERMIIELHAKMGNKWARMAAHLPG  124

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKRRQRAGLP+YPP+V LQA++ES Q ++    ++ D +H +LLQ N
Sbjct  125   RTDNEIKNYWNTRIKRRQRAGLPLYPPEVCLQALNESRQTQNSVEINSVDKRHHDLLQGN  184

Query  1427  YFEIPAVEFKNLELNQQL--HPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGP  1254
              +EIP V F N +  Q    +P +  +I  S++L Q L SS         M+ +K+LR  
Sbjct  185   SYEIPDVIFDNFKATQGALSYPSALPNISTSNILTQNLVSSQNYSFMPPIMHHTKQLRES  244

Query  1253  DSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAs  1074
             + LF GL+ N +     F  +Q D C ++ +  G S       DPD  +      GSHA 
Sbjct  245   EGLFPGLNGNVTSALPPFDQFQGDNCEKIHRPFGLSFP----YDPDPNAKDPPHFGSHAL  300

Query  1073  lnsnsssLEPA-WAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQS-PPTERSES  909
             +N N S+ +P   A K ELPSLQ   + + SW +      SLESV+T IQS PPT   +S
Sbjct  301   INGNFSASKPIPGAVKLELPSLQYPETDLGSWGTSLPMPVSLESVDTFIQSPPPTGSVQS  360

Query  908   GNVSPRNSGLLEAVLYESQTLKHSKN-TLPQQNSGASIIPSDIVDNTFPDFHETEWEGYS  732
               + PRNSGLLEA+L+E+Q +  +KN +  + +S + + P+++VD++  +  ETEW+ YS
Sbjct  361   DCLLPRNSGLLEALLHEAQNISSAKNQSADKSSSSSVVTPNEVVDSSNLNLCETEWDEYS  420

Query  731   DPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAGED  618
             DPISPLG SAASVF+E TPIS SS +E  S ++L G +
Sbjct  421   DPISPLGRSAASVFSECTPISGSSFDEPPSNDILPGSN  458



>ref|XP_011020506.1| PREDICTED: transcription factor GAMYB [Populus euphratica]
 ref|XP_011020507.1| PREDICTED: transcription factor GAMYB [Populus euphratica]
 ref|XP_011020508.1| PREDICTED: transcription factor GAMYB [Populus euphratica]
Length=558

 Score =   403 bits (1035),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 246/463 (53%), Positives = 299/463 (65%), Gaps = 25/463 (5%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNA  1785
             TSESED M  K    SP  EE   G    GV LKKGPWTSAEDAIL+EYV +HGEGNWN+
Sbjct  5     TSESEDGMISKDQTESPLGEEGNYGGGTNGVVLKKGPWTSAEDAILIEYVKKHGEGNWNS  64

Query  1784  VQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGR  1605
             VQKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LPGR
Sbjct  65    VQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHAKMGNKWARMAAHLPGR  124

Query  1604  TDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNY  1425
             TDNEIKNYWNTRIKRRQRAGLP+YPP+V LQ +  S Q  D++   +G+    ++LQ + 
Sbjct  125   TDNEIKNYWNTRIKRRQRAGLPLYPPEVSLQTLQGSQQCLDINGMGSGNKGQHDILQTHN  184

Query  1424  FEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSS-YGPRPFFS-TMNPSKRLRG  1257
             + IP V F NL+ NQ + P  P   DI ASS+L +GL SS YG   F S TM+  KRLR 
Sbjct  185   YGIPVVVFDNLKTNQSILPYVPELPDISASSILMKGLCSSQYG--SFMSPTMHRQKRLRE  242

Query  1256  PDSLFTGLSSNDSDIFTAFGPYQN-DTCMQVsqssgfssgyyQNLDPD----HPSLSCVI  1092
               +L T  S    + F  F  +Q+ D   Q    S          +PD    +P +    
Sbjct  243   ATTLLTSFSGGMKNDFHLFDQFQDGDKAAQYFGLSFP-------FNPDSATENPEIFGEN  295

Query  1091  PGSHAslnsnsssLEP-AWAKKPELPSLQSQIV---SWDspssplpsleSVETLIQSPPT  924
              GSH   N + S+ +P + A K ELPSLQ   +    W +  SP P +ESV+T IQSPPT
Sbjct  296   QGSHTLANGDFSASKPTSEAVKLELPSLQYAEIDLGGWGASCSPSPLIESVDTFIQSPPT  355

Query  923   ERSESGNVSPRNSGLLEAVLYESQTLKHSKN-TLPQQNSGASIIPSDIVDNTFPDFHETE  747
                ES   SPRNSGLL+A+LYE++TL  +KN +  + ++ ++I P D  D +  +  ETE
Sbjct  356   GTVESNFPSPRNSGLLDALLYEARTLSSAKNQSSDKSSNSSTITPGDNADCSALNISETE  415

Query  746   WEGYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
             WE Y DPISPLGH   S+F+E TPISA  SSL+E    E L G
Sbjct  416   WEDYGDPISPLGHPVTSLFSECTPISASGSSLDESPPTETLTG  458



>ref|XP_002304822.2| hypothetical protein POPTR_0003s18900g [Populus trichocarpa]
 ref|XP_006385964.1| hypothetical protein POPTR_0003s18900g [Populus trichocarpa]
 gb|EEE79801.2| hypothetical protein POPTR_0003s18900g [Populus trichocarpa]
 gb|ERP63761.1| hypothetical protein POPTR_0003s18900g [Populus trichocarpa]
Length=568

 Score =   403 bits (1035),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 246/463 (53%), Positives = 303/463 (65%), Gaps = 25/463 (5%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNA  1785
             TSESED M  K     P  EE + G +  GV LKKGPWTSAEDAIL+EYV +HGEGNWN+
Sbjct  5     TSESEDGMISKDQTGLPLGEEGSYGGSTNGVGLKKGPWTSAEDAILIEYVKKHGEGNWNS  64

Query  1784  VQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGR  1605
             VQKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LPGR
Sbjct  65    VQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTHEEEQLIIELHAKMGNKWARMAAHLPGR  124

Query  1604  TDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNY  1425
             TDNEIKNYWNTRIKRRQRAGLP+YPP+V LQ +  S Q  D++   +G+    ++LQ + 
Sbjct  125   TDNEIKNYWNTRIKRRQRAGLPLYPPEVSLQTLQGSQQCLDINGMDSGNKGQHDILQTHN  184

Query  1424  FEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSS-YGPRPFFS-TMNPSKRLRG  1257
             + IP V F NL+ N+ + P  P   DI ASS+L +GL SS YG   F S TM+  KRLR 
Sbjct  185   YGIPDVMFDNLKTNRSILPYVPELPDISASSILMKGLCSSQYG--SFMSPTMHRQKRLRE  242

Query  1256  PDSLFTGLSSNDSDIFTAFGPYQN-DTCMQVsqssgfssgyyQNLDPD----HPSLSCVI  1092
               +L +  S    + F  F  +Q+ D   Q    S          DPD    +P +    
Sbjct  243   ATTLLSSFSGGMKNDFHLFDQFQDGDKAAQYFGLSFP-------FDPDSATKNPEIFGEN  295

Query  1091  PGSHAslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPT  924
              GSH   N + S+ +P + A K ELPSLQ   + +  W +  SP P +ESV+T IQSPPT
Sbjct  296   QGSHTLANGDFSASKPTSEAVKFELPSLQYAETDLGGWGASCSPSPLIESVDTFIQSPPT  355

Query  923   ERSESGNVSPRNSGLLEAVLYESQTLKHSKN-TLPQQNSGASIIPSDIVDNTFPDFHETE  747
                ES   SPRNSGLL+A+LYE++TL  +KN +  + ++ ++I P D  D +  +  ETE
Sbjct  356   GTVESNFPSPRNSGLLDALLYEARTLSSAKNQSSDKSSNSSTITPGDNADCSALNISETE  415

Query  746   WEGYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
             WE Y DPISPLGH AAS+F+E TPISA  SSL+E    E L G
Sbjct  416   WEDYGDPISPLGHPAASLFSECTPISASGSSLDESPPTETLTG  458



>ref|XP_011007815.1| PREDICTED: transcription factor GAMYB-like isoform X3 [Populus 
euphratica]
Length=517

 Score =   399 bits (1025),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 247/451 (55%), Positives = 307/451 (68%), Gaps = 11/451 (2%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGGV-PLKKGPWTSAEDAILMEYVTRHGEGN  1794
             S+ + +ED+   KG  +SP+ +E  GG   GG+ PLKKGPWTSAEDAIL++YV +HGEGN
Sbjct  3     SMMNGTEDNKRSKGRQDSPAADEGNGGGMVGGITPLKKGPWTSAEDAILIDYVKKHGEGN  62

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKH+GL RCGKSCRLRWANHL+PDLKKG+FTP EE+RIIELHA MGNKWARMAAEL
Sbjct  63    WNAVQKHSGLFRCGKSCRLRWANHLRPDLKKGSFTPVEENRIIELHANMGNKWARMAAEL  122

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTR KR QRAGLP+YPP+V L+A   +   ++M    TGD    +++ 
Sbjct  123   PGRTDNEIKNYWNTRTKRLQRAGLPLYPPEVCLRAYKMNKDGQNMGKLQTGDAHDPDMML  182

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
              ++F+IP VEFK L LN  + P S    D  ASS+L QG+ SSYG    F T+ P+KR R
Sbjct  183   TDHFKIPEVEFKTLALNPGVLPYSTGLFDASASSMLKQGVGSSYGRGLVFPTIQPAKRFR  242

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSH  1080
                ++FTGL  + S     F    +    +++ + G SS Y  +L     S   V+PGSH
Sbjct  243   ESQTIFTGLDGSVSGGIPEFDQLTDYHRGKITGNFGLSSPYGCDLGNYDQSSCGVLPGSH  302

Query  1079  A---slnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTE  921
             A     +S+SSS EP + A K ELPSLQ   +Q  SW +P+SPL SLESV+T IQSPPTE
Sbjct  303   AILNGNSSSSSSSEPIYRATKLELPSLQYSETQQDSWGTPASPLLSLESVDTFIQSPPTE  362

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
                 G  SPR+SGLLEAVLYESQTLKHSK     Q S A +     V ++  +    EWE
Sbjct  363   TKSDGQ-SPRSSGLLEAVLYESQTLKHSKKCPDHQTSDAFVPIGCGVHSSPLNARAAEWE  421

Query  740   GYSDPISPLGHSAASVFNEYTPISASSLEEH  648
              ++D  SP GHSA+S+F+E TPIS SS +E 
Sbjct  422   LHADLNSPSGHSASSLFSECTPISGSSSDEQ  452



>ref|XP_011007813.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Populus 
euphratica]
Length=521

 Score =   399 bits (1024),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 246/452 (54%), Positives = 307/452 (68%), Gaps = 11/452 (2%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGGV-PLKKGPWTSAEDAILMEYVTRHGEG  1797
             + + + +ED+   KG  +SP+ +E  GG   GG+ PLKKGPWTSAEDAIL++YV +HGEG
Sbjct  6     LCMMNGTEDNKRSKGRQDSPAADEGNGGGMVGGITPLKKGPWTSAEDAILIDYVKKHGEG  65

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKH+GL RCGKSCRLRWANHL+PDLKKG+FTP EE+RIIELHA MGNKWARMAAE
Sbjct  66    NWNAVQKHSGLFRCGKSCRLRWANHLRPDLKKGSFTPVEENRIIELHANMGNKWARMAAE  125

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTR KR QRAGLP+YPP+V L+A   +   ++M    TGD    +++
Sbjct  126   LPGRTDNEIKNYWNTRTKRLQRAGLPLYPPEVCLRAYKMNKDGQNMGKLQTGDAHDPDMM  185

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRL  1263
               ++F+IP VEFK L LN  + P S    D  ASS+L QG+ SSYG    F T+ P+KR 
Sbjct  186   LTDHFKIPEVEFKTLALNPGVLPYSTGLFDASASSMLKQGVGSSYGRGLVFPTIQPAKRF  245

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             R   ++FTGL  + S     F    +    +++ + G SS Y  +L     S   V+PGS
Sbjct  246   RESQTIFTGLDGSVSGGIPEFDQLTDYHRGKITGNFGLSSPYGCDLGNYDQSSCGVLPGS  305

Query  1082  HA---slnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPT  924
             HA     +S+SSS EP + A K ELPSLQ   +Q  SW +P+SPL SLESV+T IQSPPT
Sbjct  306   HAILNGNSSSSSSSEPIYRATKLELPSLQYSETQQDSWGTPASPLLSLESVDTFIQSPPT  365

Query  923   ERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEW  744
             E    G  SPR+SGLLEAVLYESQTLKHSK     Q S A +     V ++  +    EW
Sbjct  366   ETKSDGQ-SPRSSGLLEAVLYESQTLKHSKKCPDHQTSDAFVPIGCGVHSSPLNARAAEW  424

Query  743   EGYSDPISPLGHSAASVFNEYTPISASSLEEH  648
             E ++D  SP GHSA+S+F+E TPIS SS +E 
Sbjct  425   ELHADLNSPSGHSASSLFSECTPISGSSSDEQ  456



>ref|XP_008375383.1| PREDICTED: transcription factor GAMYB-like [Malus domestica]
 ref|XP_008375384.1| PREDICTED: transcription factor GAMYB-like [Malus domestica]
Length=551

 Score =   399 bits (1026),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 245/461 (53%), Positives = 312/461 (68%), Gaps = 21/461 (5%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNA  1785
             T+ESED M  K  ++SP ++E+ GG+  GG+ LKKGPWTSAED IL+EYV RHGEGNWNA
Sbjct  5     TNESEDGMLYKDQIDSPLMDESNGGSGNGGIVLKKGPWTSAEDTILVEYVNRHGEGNWNA  64

Query  1784  VQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGR  1605
             VQKH+GL RCGKSCRLRWANHL+P+LKKGAFTP+EE  I+ELHAKMGNKWARMAA LPGR
Sbjct  65    VQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTPDEERLIVELHAKMGNKWARMAAHLPGR  124

Query  1604  TDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNY  1425
             TDNEIKNYWNTRIKRRQRAGLP+YPP+V LQA+ ES Q +     +  D  H++ +Q N 
Sbjct  125   TDNEIKNYWNTRIKRRQRAGLPLYPPEVCLQALQESQQGQSSGGINGADGAHNDSMQANS  184

Query  1424  FEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPS----KRL  1263
             FEIP V F +L+ N  + P  P   DI    +L +GL SS    P+   M+P+    KRL
Sbjct  185   FEIPDVVFDSLKGNNCVLPYVPELPDISPGGMLMKGLGSS----PYCGFMSPTMHRQKRL  240

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             R   +LF+    +  + F  F  +QNDTC ++  +      +  + DP  P    VI GS
Sbjct  241   RESTALFSTSGGSFKNGFPQFDQFQNDTCDKI--ARTVGFPFPHDPDPTIPLSFGVIQGS  298

Query  1082  HAslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERS  915
             H+  N NSS+ +P   A KPELPSLQ   + + SW S S P P LESV+  IQSPP   +
Sbjct  299   HSLSNGNSSASKPTTGAVKPELPSLQYPETDLGSW-STSPPPPLLESVDAFIQSPPXVGT  357

Query  914   -ESGNVSPRNSGLLEAVLYESQTLKHS-KNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
              ES   SPRNSGLL+A+L+E++TL  +  ++  + ++ +S+ P D+ +++  +  ETEWE
Sbjct  358   FESDCTSPRNSGLLDALLHEAKTLSSANNHSSEKSSNSSSVTPGDVAESSNLNICETEWE  417

Query  740   GYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
              Y DPISPLGHSA S+FNE TPISA  SSL+E    E   G
Sbjct  418   EYRDPISPLGHSATSLFNECTPISASGSSLDEPPPAETFTG  458



>ref|XP_011007812.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Populus 
euphratica]
Length=528

 Score =   398 bits (1023),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 247/451 (55%), Positives = 307/451 (68%), Gaps = 11/451 (2%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGGV-PLKKGPWTSAEDAILMEYVTRHGEGN  1794
             S+ + +ED+   KG  +SP+ +E  GG   GG+ PLKKGPWTSAEDAIL++YV +HGEGN
Sbjct  14    SMMNGTEDNKRSKGRQDSPAADEGNGGGMVGGITPLKKGPWTSAEDAILIDYVKKHGEGN  73

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKH+GL RCGKSCRLRWANHL+PDLKKG+FTP EE+RIIELHA MGNKWARMAAEL
Sbjct  74    WNAVQKHSGLFRCGKSCRLRWANHLRPDLKKGSFTPVEENRIIELHANMGNKWARMAAEL  133

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTR KR QRAGLP+YPP+V L+A   +   ++M    TGD    +++ 
Sbjct  134   PGRTDNEIKNYWNTRTKRLQRAGLPLYPPEVCLRAYKMNKDGQNMGKLQTGDAHDPDMML  193

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
              ++F+IP VEFK L LN  + P S    D  ASS+L QG+ SSYG    F T+ P+KR R
Sbjct  194   TDHFKIPEVEFKTLALNPGVLPYSTGLFDASASSMLKQGVGSSYGRGLVFPTIQPAKRFR  253

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSH  1080
                ++FTGL  + S     F    +    +++ + G SS Y  +L     S   V+PGSH
Sbjct  254   ESQTIFTGLDGSVSGGIPEFDQLTDYHRGKITGNFGLSSPYGCDLGNYDQSSCGVLPGSH  313

Query  1079  A---slnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTE  921
             A     +S+SSS EP + A K ELPSLQ   +Q  SW +P+SPL SLESV+T IQSPPTE
Sbjct  314   AILNGNSSSSSSSEPIYRATKLELPSLQYSETQQDSWGTPASPLLSLESVDTFIQSPPTE  373

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
                 G  SPR+SGLLEAVLYESQTLKHSK     Q S A +     V ++  +    EWE
Sbjct  374   TKSDGQ-SPRSSGLLEAVLYESQTLKHSKKCPDHQTSDAFVPIGCGVHSSPLNARAAEWE  432

Query  740   GYSDPISPLGHSAASVFNEYTPISASSLEEH  648
              ++D  SP GHSA+S+F+E TPIS SS +E 
Sbjct  433   LHADLNSPSGHSASSLFSECTPISGSSSDEQ  463



>gb|KDP40595.1| hypothetical protein JCGZ_24594 [Jatropha curcas]
 gb|AIT52228.1| MYB family protein [Jatropha curcas]
Length=557

 Score =   399 bits (1025),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 245/466 (53%), Positives = 315/466 (68%), Gaps = 33/466 (7%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEAT-GGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             TSES+D +  K   +SP  EE + GG+  GG+ LKKGPWTSAEDAIL+EYV +HGEGNWN
Sbjct  5     TSESDDGVLSKDRADSPLAEEGSCGGSANGGIVLKKGPWTSAEDAILIEYVKKHGEGNWN  64

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL+RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LPG
Sbjct  65    AVQKHSGLSRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHAKMGNKWARMAAHLPG  124

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKRRQRAGLP+YPP+V LQA+ ES +  ++   STGD  H +L++ N
Sbjct  125   RTDNEIKNYWNTRIKRRQRAGLPLYPPEVSLQALQESQRGLNVGGISTGDKGHQDLMRTN  184

Query  1427  YFEIPAVEFKNLELNQQLHPQ-SPL-DIPASSLLAQGLNSS-YGPRPFFSTMNPS----K  1269
              +EIP V F +L+ NQ + P  S L DI ASS+L +GL SS YG     S M+PS    K
Sbjct  185   SYEIPDVIFDSLKANQGISPYVSELPDISASSILVKGLGSSQYG-----SFMSPSVHRQK  239

Query  1268  RLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPD----HPSLS  1101
             R R   +L  G S      F  F  +Q+++C +V+QS G S       DPD    +P   
Sbjct  240   RFRESTTLIPGYSGGVKTEFPLFDQFQDNSCDKVAQSFGLSFP----FDPDPTNKNPQSF  295

Query  1100  CVIPGSHAslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQS  933
             C   G H   N + S+ +P +   K ELPSLQ   + + SW   +SP   LE+V+T IQS
Sbjct  296   CDNQGGHTLANGDFSASKPNSGPLKMELPSLQYPENDLGSW--GTSPPHLLETVDTFIQS  353

Query  932   PPTERSESGNVSPRNSGLLEAVLYESQTLKHSKN-TLPQQNSGASIIPSDIVDNTFPDFH  756
             PPT   ES   SPRNSGLL+A+L+E++TL  +KN +  + ++ +++ P ++ +++  +  
Sbjct  354   PPTGAVES---SPRNSGLLDALLHEAKTLSSAKNHSSDKSSNSSTVTPGELAESSALNIC  410

Query  755   ETEWEGYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
               EWE Y DP+SPLGH+A S+F++ TPISA  SSL+E    E   G
Sbjct  411   GAEWEDYGDPLSPLGHTATSLFSDCTPISASGSSLDEPPPTETFTG  456



>gb|KDO47777.1| hypothetical protein CISIN_1g011938mg [Citrus sinensis]
Length=474

 Score =   394 bits (1011),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 245/460 (53%), Positives = 310/460 (67%), Gaps = 20/460 (4%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGN-VNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             MS +S   D M L  +  +SP ++E  GG  A GV LKKGPWTSAEDAIL++YV +HGEG
Sbjct  1     MSCSSNGSDDMMLSNDQTDSPLMDEG-GGGTARGVILKKGPWTSAEDAILIDYVKKHGEG  59

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQK++GL RCGKSCRLRWANHL+P+LKKGAFT EEE  I+ELHAKMGNKWARMAA 
Sbjct  60    NWNAVQKNSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQMIVELHAKMGNKWARMAAH  119

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP+V  QA+ ES Q ++++  ++GD  H +LL
Sbjct  120   LPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEVSFQALQES-QCQNINGINSGDKGHHDLL  178

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFF-STMNPSKR  1266
             Q N +EIP V F +L+ NQ + P  P   DI AS++L +GL S Y    F    M+  KR
Sbjct  179   QANGYEIPDVVFDSLKANQGVLPYVPDIPDITASTMLMKGLGSQYC--SFVPPVMHRPKR  236

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             LR    LF+    +  + F+ F  + NDT  ++++S G S     +  P  P    ++ G
Sbjct  237   LRESVPLFSAYGGSVKNEFS-FDQFHNDTSDKIARSFGLSFPLDPDTTPKAPESFGMLQG  295

Query  1085  SHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQS-PPTE  921
             SH   N N S+ +P   A K ELPSLQ   + + SW   SSP P LE+V+  IQS PPT 
Sbjct  296   SHTLSNGNFSASKPNLGAVKLELPSLQYTETDLGSW-GTSSPQPLLETVDAFIQSPPPTG  354

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
               +SG  SPRNSGLL+A+++ES TL   KN    ++S +S +  D+ D+   +F ETEWE
Sbjct  355   TLDSGCPSPRNSGLLDALIHESNTL---KNHSSDKSSNSSSVTPDVADSCTRNFCETEWE  411

Query  740   GYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLA  627
              YSDP+SPLGHSA S+FNE TP+SA  SSL+E   VE   
Sbjct  412   DYSDPLSPLGHSATSLFNECTPLSASGSSLDEQAPVETFG  451



>ref|XP_007015386.1| Myb domain protein 33, putative isoform 3 [Theobroma cacao]
 gb|EOY33005.1| Myb domain protein 33, putative isoform 3 [Theobroma cacao]
Length=446

 Score =   392 bits (1007),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 242/446 (54%), Positives = 303/446 (68%), Gaps = 19/446 (4%)
 Frame = -1

Query  1934  KGNVNSPSVEEATG-GANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLAR  1758
             KG+ +  SVEE +  G+      LKKGPWTSAEDAIL++YV +HGEGNWNAVQK++GL+R
Sbjct  3     KGHSDLSSVEEGSRRGSMRESCHLKKGPWTSAEDAILVDYVKKHGEGNWNAVQKNSGLSR  62

Query  1757  CGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYW  1578
             CGKSCRLRWANHL+PDLKKG FTPEEE RIIELHAK+GNKWARMAAELPGRTDNEIKNYW
Sbjct  63    CGKSCRLRWANHLRPDLKKGVFTPEEERRIIELHAKLGNKWARMAAELPGRTDNEIKNYW  122

Query  1577  NTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFK  1398
             NTRIKR QRAGLPIYPPDV LQ      ++ + ++   GD+  SNLLQ + FEIP VEF+
Sbjct  123   NTRIKRLQRAGLPIYPPDVCLQVNRSQEESHNAASLPNGDSYASNLLQSDAFEIPRVEFE  182

Query  1397  NLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSN  1224
             NLELNQ     SP+  DIPA+++L + + SSYG    F   +P+KRLR   S +  + + 
Sbjct  183   NLELNQGCLSYSPMLHDIPANTMLKR-VGSSYGYGLMFPIAHPTKRLRESVSNYFSMPNQ  241

Query  1223  DSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEP  1044
              +         +N    +       SS Y  NL  +  +   + PGS A LNSN S  EP
Sbjct  242   LT---------ENAYKKRFDGPLMISSPYDSNLSTNDQASFGIPPGSDAPLNSNFSPSEP  292

Query  1043  AWAK-KPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPRNSGLL  876
                  K ELPS Q   +Q  SW +P+ PLP +ESV+ LIQSP  E+++S   +P+NSGLL
Sbjct  293   MSGPIKLELPSYQYSDTQEDSWVNPAYPLPLVESVDNLIQSPSIEQAKSDYFTPQNSGLL  352

Query  875   EAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAAS  696
             EAVL+ESQ LK SK+   QQ+S  S++  D V N   +  E E+E + DP SPL HSAAS
Sbjct  353   EAVLHESQKLKSSKDDSCQQSSSTSVL--DDVANFSLNHCEIEFEAHCDPNSPLAHSAAS  410

Query  695   VFNEYTPISASSLEEHQSVEMLAGED  618
             VF+E+TP+S SS +E Q +E + GED
Sbjct  411   VFSEFTPVSGSSSDEPQFIESILGED  436



>ref|XP_006471261.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471262.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471263.1| PREDICTED: transcription factor GAMYB-like isoform X3 [Citrus 
sinensis]
Length=551

 Score =   394 bits (1011),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 245/460 (53%), Positives = 310/460 (67%), Gaps = 20/460 (4%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGN-VNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             MS +S   D M L  +  +SP ++E  GG  A GV LKKGPWTSAEDAIL++YV +HGEG
Sbjct  1     MSCSSNGSDDMMLSNDQTDSPLMDEG-GGGTARGVILKKGPWTSAEDAILIDYVKKHGEG  59

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQK++GL RCGKSCRLRWANHL+P+LKKGAFT EEE  I+ELHAKMGNKWARMAA 
Sbjct  60    NWNAVQKNSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQMIVELHAKMGNKWARMAAH  119

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP+V  QA+ ES Q ++++  ++GD  H +LL
Sbjct  120   LPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEVSFQALQES-QCQNINGINSGDKGHHDLL  178

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFF-STMNPSKR  1266
             Q N +EIP V F +L+ NQ + P  P   DI AS++L +GL S Y    F    M+  KR
Sbjct  179   QANGYEIPDVVFDSLKANQGVLPYVPDIPDITASTMLMKGLGSQYC--SFVPPVMHRPKR  236

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             LR    LF+G   +  + F+ F  + NDT  ++++S G S     +  P  P    ++ G
Sbjct  237   LRESVPLFSGYGGSVKNEFS-FDQFHNDTSDKIARSFGLSFPLDPDTTPKAPESFGMLQG  295

Query  1085  SHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQS-PPTE  921
             SH   N N S+ +P   A K ELPSLQ   + + SW   SSP P LE+V+  IQS PPT 
Sbjct  296   SHTLSNGNFSASKPNLGAVKLELPSLQYTETDLGSW-GTSSPQPLLETVDAFIQSPPPTG  354

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
               +SG  SPRNSGLL+A+++ES  L   KN    ++S +S +  D+ D+   +F ETEWE
Sbjct  355   TLDSGCPSPRNSGLLDALIHESNIL---KNHSSDKSSNSSSVTPDVADSCTRNFCETEWE  411

Query  740   GYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLA  627
              YSDP+SPLGHSA S+FNE TP+SA  SSL+E   VE   
Sbjct  412   DYSDPLSPLGHSATSLFNECTPLSASGSSLDEQAPVETFG  451



>ref|XP_007015384.1| Myb domain protein 33, putative isoform 1 [Theobroma cacao]
 gb|EOY33003.1| Myb domain protein 33, putative isoform 1 [Theobroma cacao]
Length=488

 Score =   389 bits (998),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 240/444 (54%), Positives = 301/444 (68%), Gaps = 19/444 (4%)
 Frame = -1

Query  1934  KGNVNSPSVEEATG-GANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLAR  1758
             KG+ +  SVEE +  G+      LKKGPWTSAEDAIL++YV +HGEGNWNAVQK++GL+R
Sbjct  3     KGHSDLSSVEEGSRRGSMRESCHLKKGPWTSAEDAILVDYVKKHGEGNWNAVQKNSGLSR  62

Query  1757  CGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYW  1578
             CGKSCRLRWANHL+PDLKKG FTPEEE RIIELHAK+GNKWARMAAELPGRTDNEIKNYW
Sbjct  63    CGKSCRLRWANHLRPDLKKGVFTPEEERRIIELHAKLGNKWARMAAELPGRTDNEIKNYW  122

Query  1577  NTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFK  1398
             NTRIKR QRAGLPIYPPDV LQ      ++ + ++   GD+  SNLLQ + FEIP VEF+
Sbjct  123   NTRIKRLQRAGLPIYPPDVCLQVNRSQEESHNAASLPNGDSYASNLLQSDAFEIPRVEFE  182

Query  1397  NLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSN  1224
             NLELNQ     SP+  DIPA+++L + + SSYG    F   +P+KRLR   S +  + + 
Sbjct  183   NLELNQGCLSYSPMLHDIPANTMLKR-VGSSYGYGLMFPIAHPTKRLRESVSNYFSMPNQ  241

Query  1223  DSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEP  1044
              +         +N    +       SS Y  NL  +  +   + PGS A LNSN S  EP
Sbjct  242   LT---------ENAYKKRFDGPLMISSPYDSNLSTNDQASFGIPPGSDAPLNSNFSPSEP  292

Query  1043  AWAK-KPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPRNSGLL  876
                  K ELPS Q   +Q  SW +P+ PLP +ESV+ LIQSP  E+++S   +P+NSGLL
Sbjct  293   MSGPIKLELPSYQYSDTQEDSWVNPAYPLPLVESVDNLIQSPSIEQAKSDYFTPQNSGLL  352

Query  875   EAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAAS  696
             EAVL+ESQ LK SK+   QQ+S  S++  D V N   +  E E+E + DP SPL HSAAS
Sbjct  353   EAVLHESQKLKSSKDDSCQQSSSTSVL--DDVANFSLNHCEIEFEAHCDPNSPLAHSAAS  410

Query  695   VFNEYTPISASSLEEHQSVEMLAG  624
             VF+E+TP+S SS +E Q +E + G
Sbjct  411   VFSEFTPVSGSSSDEPQFIESILG  434



>ref|XP_002525574.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF36833.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=556

 Score =   389 bits (1000),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 241/465 (52%), Positives = 311/465 (67%), Gaps = 32/465 (7%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEA-TGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             T+ES+D +  K  ++SP  E    GG+  GG  LKKGPWTSAEDAIL+EYV +HGEGNWN
Sbjct  5     TNESDDGLFSKDRIDSPLAEGGNCGGSANGGAMLKKGPWTSAEDAILIEYVKKHGEGNWN  64

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL+RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LPG
Sbjct  65    AVQKHSGLSRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHAKMGNKWARMAAHLPG  124

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKRRQRAGLP+YPP+V  QA+ ES+Q   +   +TGD  H +LL+ N
Sbjct  125   RTDNEIKNYWNTRIKRRQRAGLPLYPPEVSFQALQESHQGLTIGGINTGDKVHGDLLRNN  184

Query  1427  YFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSS-YGPRPFFSTMNPS----K  1269
              +EIP V F +L+ +Q + P  P   DI  SS+L +GL+SS YG     S M+PS    K
Sbjct  185   GYEIPDVIFDSLKASQGISPYVPELADITTSSMLIKGLSSSQYG-----SFMSPSAHRQK  239

Query  1268  RLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPD---HPSLSC  1098
             RLR   +   G S N    F  F  +Q+++C +V+QS G S       DPD   +P    
Sbjct  240   RLRESTTFIPGYSGNIKSEFPLFDQFQDESCDKVAQSFGLSFP----FDPDPTKNPQSFG  295

Query  1097  VIPGSHAslnsnsssLE-PAWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSP  930
                GSH   N + S+ +  +   K ELPSLQ   + + SW   +SP P LE+++  IQSP
Sbjct  296   ENQGSHTLANGDFSTSKLTSGPVKLELPSLQYPETDLGSW--GTSPPPLLETLDNFIQSP  353

Query  929   PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN-TLPQQNSGASIIPSDIVDNTFPDFHE  753
             PT   ES   SPRNSGLL+A+LYE++ L  +KN +  + ++ +++ P ++ + +  +  E
Sbjct  354   PTAIIES---SPRNSGLLDALLYEAKALSSAKNHSSEKSSNSSTVTPGELAECSAINICE  410

Query  752   TEWEGYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
             TEWE Y DP+SPLGH+A S+F+E TPISA  SSL+E    +   G
Sbjct  411   TEWEDYGDPLSPLGHTATSLFSECTPISASGSSLDEPPPTDTFTG  455



>ref|XP_004306467.1| PREDICTED: transcription factor GAMYB-like [Fragaria vesca subsp. 
vesca]
Length=562

 Score =   389 bits (999),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 245/463 (53%), Positives = 302/463 (65%), Gaps = 19/463 (4%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNA  1785
             TS+SED M  K  + SP ++E  GG   GG+ LKKGPWT+AEDAIL+EYV +HGEGNWNA
Sbjct  5     TSDSEDGMFSKDQIESPLMDENNGGIGNGGIILKKGPWTTAEDAILVEYVKKHGEGNWNA  64

Query  1784  VQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGR  1605
             VQKH+GL RCGKSCRLRWANHL+P+LKKGAFTPEEE  I+ELHAKMGNKWARMAA LPGR
Sbjct  65    VQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIVELHAKMGNKWARMAAHLPGR  124

Query  1604  TDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNY  1425
             TDNEIKNYWNTRIKRRQRAGLP+YPP++ LQA  ES Q       +  D  H + LQ N 
Sbjct  125   TDNEIKNYWNTRIKRRQRAGLPLYPPELSLQASQESQQGHSGGALNGTDRAHHDSLQSNS  184

Query  1424  FEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPS----KRL  1263
             +EIP V F +L+ N  + P  P   DI AS +L +GL SS    P+   M P+    KR 
Sbjct  185   YEIPDVVFDSLKGNNCVLPYVPELPDISASGMLMKGLGSS----PYCGFMPPTMHRQKRP  240

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             R   +LF    S+  D F  F  Y+ND C +V++  G       +     P    VI G 
Sbjct  241   RESTALFPTSGSSFRDGFPQFDQYENDACDKVARPFGLPFLPDPDPTTKSPLSFGVIQGC  300

Query  1082  HAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERS  915
             H+  N NSS+  P +   K ELPSLQ   + + SW S S P P LES +  IQSPP   +
Sbjct  301   HSLSNGNSSACRPTYGPVKLELPSLQYPETDLGSW-STSPPPPLLESFDNFIQSPPPVGA  359

Query  914   -ESGNVSPRNSGLLEAVLYESQTLKHSKN-TLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
              ES   SPRNSGLL+A+LYES+TL  +KN +  + +  +S+ P ++ D++  +  ETEWE
Sbjct  360   FESDCASPRNSGLLDALLYESKTLSSTKNHSTDKSSISSSVTPGEVADSSTLNVCETEWE  419

Query  740   GYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAGED  618
              Y DPISPLGHSA  +F+E TPISA  SSLEE    E + G +
Sbjct  420   EYGDPISPLGHSATLLFSECTPISASGSSLEEAPPAETITGSN  462



>ref|XP_002298147.2| hypothetical protein POPTR_0001s23170g [Populus trichocarpa]
 gb|EEE82952.2| hypothetical protein POPTR_0001s23170g [Populus trichocarpa]
Length=583

 Score =   389 bits (999),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 242/486 (50%), Positives = 312/486 (64%), Gaps = 45/486 (9%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGGV-PLKKGPWTSAEDAILMEYVTRHGEGN  1794
             S+ + +ED+   KG  +SP+ +E   G   GG+ PLKKGPWTSAEDAIL++YV +HGEGN
Sbjct  3     SMMNGTEDNKRSKGRQDSPAADEVNDGGMVGGITPLKKGPWTSAEDAILIDYVKKHGEGN  62

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE-  1617
             WN+VQKH+GL RCGKSCRLRWANHL+PDLKKG+FTPEEE+RIIELHA MGNKWARMAAE 
Sbjct  63    WNSVQKHSGLFRCGKSCRLRWANHLRPDLKKGSFTPEEENRIIELHANMGNKWARMAAEV  122

Query  1616  ----------------------------------LPGRTDNEIKNYWNTRIKRRQRAGLP  1539
                                               LPGRTDNEIKNYWNTR KR QRAGLP
Sbjct  123   GNLIPDLKCVRIHNVVWEEEIGRRGEIGSSGEKKLPGRTDNEIKNYWNTRTKRLQRAGLP  182

Query  1538  IYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQL--HPQ  1365
             +YPP+V L+A   +   ++M    TGD    +++  ++F+IP VEFK L LN  +  +  
Sbjct  183   LYPPEVCLRAYKMNKDGQNMGKLQTGDAHDPDMMLTDHFKIPEVEFKTLALNPGVLSYST  242

Query  1364  SPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQN  1185
                D  ASS+L QG+ SSYG    F T++P+KR R   ++FTGL  + S     F  + +
Sbjct  243   GLFDASASSMLKQGVGSSYGQGLVFPTIHPAKRFRESQTIFTGLDGSVSGGIPEFDQFTD  302

Query  1184  DTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHA---slnsnsssLEPAW-AKKPELP  1017
                 +++ + G SS Y  +L     S   V+PGSHA     +S+SSS EP + A K ELP
Sbjct  303   YHRGKITGNFGLSSPYGCDLSNYDQSSCGVLPGSHAILNGNSSSSSSSEPIYRATKLELP  362

Query  1016  SLQ---SQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTL  846
             SLQ   +Q  SW +P+SPLPSLESV+T IQSPPT+ ++S  +SPR+SGLLEAVLYES+TL
Sbjct  363   SLQYSETQQDSWGTPASPLPSLESVDTFIQSPPTKETKSDGLSPRSSGLLEAVLYESRTL  422

Query  845   KHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISA  666
             K+SK     Q S A +     V ++  +    EWE ++D  SP GHSA+S+F+E TPIS 
Sbjct  423   KYSKKCPGHQTSDAFVPIGCGVHSSPLNACAAEWELHADLNSPSGHSASSLFSECTPISG  482

Query  665   SSLEEH  648
             SS +E 
Sbjct  483   SSSDEQ  488



>ref|XP_002275846.1| PREDICTED: transcription factor GAMYB [Vitis vinifera]
 ref|XP_010645528.1| PREDICTED: transcription factor GAMYB [Vitis vinifera]
 ref|XP_010645529.1| PREDICTED: transcription factor GAMYB [Vitis vinifera]
 ref|XP_010645530.1| PREDICTED: transcription factor GAMYB [Vitis vinifera]
 ref|XP_010645531.1| PREDICTED: transcription factor GAMYB [Vitis vinifera]
 emb|CBI40642.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   385 bits (990),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 242/463 (52%), Positives = 302/463 (65%), Gaps = 23/463 (5%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEGNW  1791
             +T+ESED M  K    SP ++E     +AGG + LKKGPWTS+EDAIL+EYV +HGEGNW
Sbjct  4     LTNESEDGMLSKDQTGSPLIDEGNSSGSAGGGIVLKKGPWTSSEDAILVEYVKKHGEGNW  63

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LP
Sbjct  64    NAVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTAEEERLIIELHAKMGNKWARMAAHLP  123

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQV  1431
             GRTDNEIKNYWNTRIKRRQRAGLP+YPP+V  QA+ ES Q ++    + GD  H +LLQ 
Sbjct  124   GRTDNEIKNYWNTRIKRRQRAGLPLYPPEVCFQALQESQQIQNTGGINGGDKVHHDLLQT  183

Query  1430  NYFEIPAVEFKNLELNQQLHPQSPLDIP---ASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
             N +EIP V     + NQ   P  P D P    SS+L +G  SS        TM+  KR+R
Sbjct  184   NSYEIPDVILDGFKANQDAFPYVP-DFPNLSTSSMLMKGFGSSQYCGFMAPTMHRQKRVR  242

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPD----HPSLSCVI  1092
                +LF G   N+ +    F   Q+DT  +++QS G         DPD     P     +
Sbjct  243   ESPALFPGY--NERNGIPLFDQIQDDTGDKIAQSFGLPYP----FDPDPTNKDPLPFAGM  296

Query  1091  PGSHAslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPT  924
              GSHA LN N S+ +P +   K ELPSLQ   + +  W + SSP P LESV+  IQSPP+
Sbjct  297   QGSHALLNGNFSASKPISGPVKLELPSLQYLETDLGGWGTSSSPPPLLESVDAFIQSPPS  356

Query  923   ERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGAS-IIPSDIVDNTFPDFHETE  747
                +   +SPRNSGLL+A+L+E++T+   KN L  +++ +S + P D+ D+   +  ETE
Sbjct  357   GTVQLECLSPRNSGLLDALLHEAKTISSGKNHLSDKSANSSTVTPGDLADSCL-NMCETE  415

Query  746   WEGYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
             WE Y DPISPLGHS  S+F+E TPISA  SSL+EH   E   G
Sbjct  416   WEDYGDPISPLGHSTTSIFSECTPISASGSSLDEHPPSETFPG  458



>ref|XP_002523208.1| myb81, putative [Ricinus communis]
 gb|EEF39129.1| myb81, putative [Ricinus communis]
Length=478

 Score =   380 bits (977),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 239/425 (56%), Positives = 296/425 (70%), Gaps = 24/425 (6%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             +T+  ED    K   +S ++EEA         PLKKGPWTSAEDAIL++YVT+HGEGNWN
Sbjct  4     MTNGGEDHKRSKCRQDSQTIEEAINS------PLKKGPWTSAEDAILVDYVTKHGEGNWN  57

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL+RCGKSCRLRWANHL+PDLKKGAFT +EE RIIELHAKMGNKWARMAAELPG
Sbjct  58    AVQKHSGLSRCGKSCRLRWANHLRPDLKKGAFTAQEERRIIELHAKMGNKWARMAAELPG  117

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKR QRAGLPIYPP+V LQ  + S++++++ T  T DT  S+L+Q  
Sbjct  118   RTDNEIKNYWNTRIKRLQRAGLPIYPPEVCLQLFNGSHESQNLGTPQTTDTHSSDLIQTG  177

Query  1427  YFEIPAVEFKNLELNQQL--HPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGP  1254
             ++EIP V+F+N E ++ L  +P + L+IP +S+  QG++ S      F T+ P+KRLR  
Sbjct  178   HYEIPEVQFQNFEFSRGLLSYPPNILEIPMTSMPKQGVHPSDSDGFVFPTLTPAKRLRES  237

Query  1253  DSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAs  1074
             DS F  L    SD   A+          + +  G SS Y  + +     L  V PGSHA 
Sbjct  238   DSEFPVLDGG-SDGLPAY----------IQEPFGLSSSYDSHTNYYGQQLLAVPPGSHAL  286

Query  1073  lnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERSESG  906
             LN NSSS EP   A K ELPSLQ   +Q  SW+ P+SPLPSLESV+TLIQSPPTE ++S 
Sbjct  287   LNDNSSSSEPLCGAMKLELPSLQYSETQQDSWERPTSPLPSLESVDTLIQSPPTELTQSH  346

Query  905   NVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDP  726
               SPR++G LEA+LY SQ+LK+SK TL  Q S +S+ PSDI D    +  ETE E + DP
Sbjct  347   CFSPRDNGTLEALLYGSQSLKNSKKTLDHQFSVSSVAPSDIGDCP-SNTGETEKEAHGDP  405

Query  725   ISPLG  711
              SPLG
Sbjct  406   NSPLG  410



>ref|XP_008346342.1| PREDICTED: transcription factor GAMYB-like [Malus domestica]
Length=553

 Score =   381 bits (978),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 237/457 (52%), Positives = 301/457 (66%), Gaps = 11/457 (2%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNA  1785
             T+ESED +  K  ++SP ++E+ GG+  GG+ LKKGPWTSAEDAIL+EYV +HGEGNWNA
Sbjct  5     TNESEDGVLSKDQIDSPLMDESNGGSGNGGMVLKKGPWTSAEDAILVEYVKKHGEGNWNA  64

Query  1784  VQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGR  1605
             VQKH+GL RCGKSCRLRWANHL+P+LKKGAFTPEEE  I+ELHAKMGNKWARMAA LPGR
Sbjct  65    VQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIVELHAKMGNKWARMAAHLPGR  124

Query  1604  TDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNY  1425
             TDNEIKNYWNTRIKRRQRAGLP+YPP+V LQA  ES Q +     +  D    + +Q N 
Sbjct  125   TDNEIKNYWNTRIKRRQRAGLPLYPPEVCLQAFQESQQGQSSGGINXVDRVQHDSMQANS  184

Query  1424  FEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPD  1251
             FEIP V F +L+ N  + P  P   DI    +L +GL S+        TM+  KRLR   
Sbjct  185   FEIPDVVFDSLKGNGCVLPYVPDLPDISPGGMLMKGLGSAPYCGFMXPTMHRQKRLREST  244

Query  1250  SLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAsl  1071
             +LF+    +    F  F  +QNDTC +V+++ G    +  +     P    VI GSH+  
Sbjct  245   ALFSTSGGSFKXGFPQFDQFQNDTCDKVARTFGLPFPHDPDPTTRSPLSFGVIQGSHSLS  304

Query  1070  nsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERS-ESG  906
             N NSS+ +P + A K ELPSLQ   + + SW S S P P LE ++  IQSPP   + E  
Sbjct  305   NGNSSASKPTSGAVKLELPSLQYPETDLGSW-STSPPPPLLEXIDAFIQSPPQVGTFEPD  363

Query  905   NVSPRNSGLLEAVLYESQTLKHSKNTLPQQNS-GASIIPSDIVDNTFPDFHETEWEGYSD  729
               SPRNSGLL+A+L+E++ L  +KN   +++S  +S+ P D+   +  +  E EWE   D
Sbjct  364   CTSPRNSGLLDALLHEAKALSSAKNHPXEKSSNSSSVTPGDVAKGSNLNICEAEWEENRD  423

Query  728   PISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
             PISPLGHSA S+F+E TPISA  SSL+E    E   G
Sbjct  424   PISPLGHSATSLFSECTPISASGSSLDEPPPAETFTG  460



>ref|XP_006368652.1| hypothetical protein POPTR_0001s07330g [Populus trichocarpa]
 gb|ERP65221.1| hypothetical protein POPTR_0001s07330g [Populus trichocarpa]
Length=568

 Score =   380 bits (976),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 234/459 (51%), Positives = 290/459 (63%), Gaps = 15/459 (3%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             +TSESED +     + SP  EE     +A G  LKKGPWTSAEDAIL+EYV +HGEGNWN
Sbjct  4     MTSESEDGIVSNNQIESPLGEEGNYCGSANGGVLKKGPWTSAEDAILIEYVKKHGEGNWN  63

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LPG
Sbjct  64    AVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHAKMGNKWARMAAHLPG  123

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKR QRAGLP+YPP+  LQA+ ES +  ++      +    + LQ N
Sbjct  124   RTDNEIKNYWNTRIKRHQRAGLPLYPPEASLQALQESQRCLNIDRIEIRNKSQHDTLQSN  183

Query  1427  YFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFS-TMNPSKRLRG  1257
              + IP V F NL  +Q + P  P   DI ASS+L +GL SS+    F S  M+  KRLR 
Sbjct  184   SYGIPNVMFDNLTPHQSILPYVPELPDITASSMLMKGL-SSFQYGSFMSPIMHRQKRLRE  242

Query  1256  PDSLFTGLSSNDSDIFTAFGPYQN-DTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSH  1080
               +L +       + F  F  +Q+ D   Q               +P+    +    GSH
Sbjct  243   ATTLLSSFGGGMKNEFHLFDQFQDVDKASQSFGLPFPFDYDSTTKNPEFFGEN---QGSH  299

Query  1079  AslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERSE  912
                N N S+ +P + A K ELPSLQ   + +  W    SP P +ESV+T IQSPPT   E
Sbjct  300   TLANGNFSASKPTSEAVKLELPSLQYSETDLGGWGPSCSPSPLIESVDTFIQSPPTGTVE  359

Query  911   SGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGAS-IIPSDIVDNTFPDFHETEWEGY  735
             S   SPRNSGLL+A+L+E++TL  +KN L  ++S +S + P D  D++  +  ETE E Y
Sbjct  360   SDCPSPRNSGLLDALLHEAKTLSSAKNQLSDKSSNSSTVTPGDDADSSALNICETEREDY  419

Query  734   SDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
               PISPLGH+A S+F+E TPISA  SSL+E  S E   G
Sbjct  420   GHPISPLGHTATSLFSECTPISANESSLDESPSSETFTG  458



>ref|XP_010067659.1| PREDICTED: transcription factor GAMYB [Eucalyptus grandis]
 ref|XP_010067660.1| PREDICTED: transcription factor GAMYB [Eucalyptus grandis]
 gb|KCW65837.1| hypothetical protein EUGRSUZ_G03183 [Eucalyptus grandis]
Length=559

 Score =   379 bits (974),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 224/451 (50%), Positives = 301/451 (67%), Gaps = 15/451 (3%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEA-TGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             T E +D +  +  + SP +++  +GG+  GG+ LKKGPWTSAEDAIL++YV +HGEGNWN
Sbjct  5     TFECDDGVVSQDQIGSPLMDKGKSGGSEDGGLVLKKGPWTSAEDAILVDYVKKHGEGNWN  64

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQK +GL+RCGKSCRLRWANHL+P+LKKGAF+ EEE  I+ELHAKMGNKWARMAA LPG
Sbjct  65    AVQKFSGLSRCGKSCRLRWANHLRPNLKKGAFSAEEERLIVELHAKMGNKWARMAAHLPG  124

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKRRQRAGLP+YP ++ +QA+ +  Q +     + G+  H  +LQ +
Sbjct  125   RTDNEIKNYWNTRIKRRQRAGLPLYPAELCMQALQDGQQGQTFCRMTNGNKGHHEILQGS  184

Query  1427  YFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGP  1254
              +EIP + F + + N  + P +P   DI A+ LL +GL SS        TM   KRLR  
Sbjct  185   GYEIPDIVFDSFKANHSVLPYTPEISDISATGLLMKGLASSQCGGLVQPTMPRHKRLRQS  244

Query  1253  DSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPD-HPSLSCVIPGSHA  1077
              S + G      D F +   +++D+  +   S      +  + DPD +P    V+ GSH+
Sbjct  245   ASFYPGYGGIFKDAFPSMHQFEDDS--REKLSRAIVHPFPIDHDPDKNPLPFGVVQGSHS  302

Query  1076  slnsnsssLEPAW-AKKPELPSLQS---QIVSWDspssplpsleSVETLIQSPP-TERSE  912
               N NSS+ EP++ A K ELPSLQ     + SWD+ SSP   LESV+  I SP  T ++E
Sbjct  303   FSNGNSSTSEPSYEALKLELPSLQYSEPDMGSWDTSSSPPTLLESVDNFILSPARTGKAE  362

Query  911   SGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGAS-IIPSDIVDNTFPDFHETEWEGY  735
             S  +SPRNSGLL+A+++ES+T+  +KN  P++++ +S + P DI  +T  D  ++EWE Y
Sbjct  363   SECLSPRNSGLLDALVHESKTMSSAKNNSPEKSTNSSALTPGDISSSTL-DICKSEWEEY  421

Query  734   SDPISPLGHSAASVFNEYTPI--SASSLEEH  648
              DPISP GHSA SVFN  TP+  S SSL+E 
Sbjct  422   GDPISPRGHSATSVFNGCTPLSTSGSSLDEQ  452



>ref|XP_006340345.1| PREDICTED: transcription factor GAMYB-like [Solanum tuberosum]
Length=485

 Score =   376 bits (966),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 224/459 (49%), Positives = 286/459 (62%), Gaps = 26/459 (6%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAG-GVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             M +T+E  D MT +  ++S SV+EA  G N   G PLKKGPW  AEDAILM+YV ++GEG
Sbjct  1     MCMTTECVDRMTSEVGIDSTSVKEANAGRNIREGSPLKKGPWIKAEDAILMDYVAKYGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NW++V + TGLARCGKSCRLRWANHLKPDLKKGAFT EEE  IIE+HAK+GNKWARMAAE
Sbjct  61    NWSSVHRRTGLARCGKSCRLRWANHLKPDLKKGAFTQEEEELIIEMHAKIGNKWARMAAE  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
              PGRTDN+IKN+WNTR+KR++RA   + P  V  Q   E  QN++++T S+ ++   +LL
Sbjct  121   FPGRTDNDIKNFWNTRLKRQRRAEKHMLPLGVFFQEFSEDKQNKELATSSSANSD-PHLL  179

Query  1436  QVNYFEIPAVEFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTM  1281
              +N  EIP  E +N E +QQL+P         S LD PA+SL  QGLNSS+      ST+
Sbjct  180   PINNVEIPTAENRNFEPSQQLYPPGLLNIGFSSFLDTPATSLRDQGLNSSWNTHSVRSTV  239

Query  1280  NPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS  1101
             + SKR+RG ++ F   S  + D+  A   YQND  +        S          HPS +
Sbjct  240   HSSKRIRGSEAWF---SDQNVDLSQAHHQYQNDGSLFTQSLGFSSLYTRNLTSNYHPSSA  296

Query  1100  CVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPPTE  921
               IPG HA      SS EP    K ELPS Q+ + SWDSPSS      S  T IQSPP E
Sbjct  297   GDIPGIHA------SSSEPKLKGKLELPSFQTPMTSWDSPSSVPSIESS-NTFIQSPPNE  349

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
              ++S ++SP++S LL A+LY SQT   S+N   Q+ S       D   ++ P   E +W 
Sbjct  350   YTDSYSLSPQSSDLLHAILYGSQTPNASRNNSHQETS------RDAGPDSCPVLQEIQWG  403

Query  740   GYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
                D I+P GH+  SVF+EYTP S  SLE+HQS+  L G
Sbjct  404   TNPDAITPSGHTITSVFSEYTPSSGGSLEDHQSIAPLMG  442



>ref|XP_011034642.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Populus 
euphratica]
Length=566

 Score =   379 bits (973),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 234/460 (51%), Positives = 286/460 (62%), Gaps = 16/460 (3%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEA--TGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             +TSESE+ +     +  P  EE    G AN GGV LKKGPWTSAEDAIL+EYV +HGEGN
Sbjct  1     MTSESENGIVSNNQIELPLGEEGNYCGSAN-GGVVLKKGPWTSAEDAILIEYVKKHGEGN  59

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWA MAA L
Sbjct  60    WNAVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHAKMGNKWALMAAHL  119

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKRRQRAGLP+YPP+  LQA+ ES +  ++      +    + LQ
Sbjct  120   PGRTDNEIKNYWNTRIKRRQRAGLPLYPPEASLQALQESQRCLNIDRIEIRNKSQHDTLQ  179

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
              N + IP V F NL  NQ + P  P   DI ASS+L +GL+S          M+  KRLR
Sbjct  180   SNSYGIPNVIFDNLTPNQSIIPYVPELPDITASSMLMKGLSSFQYGSIMSPIMHRQKRLR  239

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQN-DTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
                +L +       + F  F  +Q  D   Q               +P+    +    GS
Sbjct  240   EATTLLSSFGGGMKNEFHLFDQFQEVDIAAQSFGLPFPFDYDSTTKNPEFFGEN---QGS  296

Query  1082  HAslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERS  915
             H   N N S+ +P + A K ELPSLQ   S +  W    SP P +ESV+  IQSPPT   
Sbjct  297   HTLANGNFSASKPTSEAVKLELPSLQYSESDLGGWGPSCSPSPLIESVDAFIQSPPTGTV  356

Query  914   ESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGAS-IIPSDIVDNTFPDFHETEWEG  738
             ES   SPRNSGLL+A+L+E++TL  +KN L  ++S +S + P D  D+   +  ETEWE 
Sbjct  357   ESECPSPRNSGLLDALLHEAKTLSSAKNQLSDKSSNSSTVTPGDNADSPGLNISETEWED  416

Query  737   YSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
             Y  P SPLGH+A S+F+E TPISA  SSL+E  S E   G
Sbjct  417   YGHPFSPLGHTATSLFSECTPISANESSLDESPSCETFTG  456



>ref|XP_011034640.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Populus 
euphratica]
 ref|XP_011034641.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Populus 
euphratica]
Length=569

 Score =   379 bits (972),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 234/460 (51%), Positives = 286/460 (62%), Gaps = 16/460 (3%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEA--TGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             +TSESE+ +     +  P  EE    G AN GGV LKKGPWTSAEDAIL+EYV +HGEGN
Sbjct  4     MTSESENGIVSNNQIELPLGEEGNYCGSAN-GGVVLKKGPWTSAEDAILIEYVKKHGEGN  62

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWA MAA L
Sbjct  63    WNAVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHAKMGNKWALMAAHL  122

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKRRQRAGLP+YPP+  LQA+ ES +  ++      +    + LQ
Sbjct  123   PGRTDNEIKNYWNTRIKRRQRAGLPLYPPEASLQALQESQRCLNIDRIEIRNKSQHDTLQ  182

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
              N + IP V F NL  NQ + P  P   DI ASS+L +GL+S          M+  KRLR
Sbjct  183   SNSYGIPNVIFDNLTPNQSIIPYVPELPDITASSMLMKGLSSFQYGSIMSPIMHRQKRLR  242

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQN-DTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
                +L +       + F  F  +Q  D   Q               +P+    +    GS
Sbjct  243   EATTLLSSFGGGMKNEFHLFDQFQEVDIAAQSFGLPFPFDYDSTTKNPEFFGEN---QGS  299

Query  1082  HAslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERS  915
             H   N N S+ +P + A K ELPSLQ   S +  W    SP P +ESV+  IQSPPT   
Sbjct  300   HTLANGNFSASKPTSEAVKLELPSLQYSESDLGGWGPSCSPSPLIESVDAFIQSPPTGTV  359

Query  914   ESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGAS-IIPSDIVDNTFPDFHETEWEG  738
             ES   SPRNSGLL+A+L+E++TL  +KN L  ++S +S + P D  D+   +  ETEWE 
Sbjct  360   ESECPSPRNSGLLDALLHEAKTLSSAKNQLSDKSSNSSTVTPGDNADSPGLNISETEWED  419

Query  737   YSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
             Y  P SPLGH+A S+F+E TPISA  SSL+E  S E   G
Sbjct  420   YGHPFSPLGHTATSLFSECTPISANESSLDESPSCETFTG  459



>ref|XP_002297703.2| hypothetical protein POPTR_0001s07330g [Populus trichocarpa]
 gb|EEE82508.2| hypothetical protein POPTR_0001s07330g [Populus trichocarpa]
Length=558

 Score =   377 bits (967),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 233/457 (51%), Positives = 289/457 (63%), Gaps = 15/457 (3%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             +TSESED +     + SP  EE     +A G  LKKGPWTSAEDAIL+EYV +HGEGNWN
Sbjct  4     MTSESEDGIVSNNQIESPLGEEGNYCGSANGGVLKKGPWTSAEDAILIEYVKKHGEGNWN  63

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LPG
Sbjct  64    AVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHAKMGNKWARMAAHLPG  123

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKR QRAGLP+YPP+  LQA+ ES +  ++      +    + LQ N
Sbjct  124   RTDNEIKNYWNTRIKRHQRAGLPLYPPEASLQALQESQRCLNIDRIEIRNKSQHDTLQSN  183

Query  1427  YFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFS-TMNPSKRLRG  1257
              + IP V F NL  +Q + P  P   DI ASS+L +GL SS+    F S  M+  KRLR 
Sbjct  184   SYGIPNVMFDNLTPHQSILPYVPELPDITASSMLMKGL-SSFQYGSFMSPIMHRQKRLRE  242

Query  1256  PDSLFTGLSSNDSDIFTAFGPYQN-DTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSH  1080
               +L +       + F  F  +Q+ D   Q               +P+    +    GSH
Sbjct  243   ATTLLSSFGGGMKNEFHLFDQFQDVDKASQSFGLPFPFDYDSTTKNPEFFGEN---QGSH  299

Query  1079  AslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERSE  912
                N N S+ +P + A K ELPSLQ   + +  W    SP P +ESV+T IQSPPT   E
Sbjct  300   TLANGNFSASKPTSEAVKLELPSLQYSETDLGGWGPSCSPSPLIESVDTFIQSPPTGTVE  359

Query  911   SGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGAS-IIPSDIVDNTFPDFHETEWEGY  735
             S   SPRNSGLL+A+L+E++TL  +KN L  ++S +S + P D  D++  +  ETE E Y
Sbjct  360   SDCPSPRNSGLLDALLHEAKTLSSAKNQLSDKSSNSSTVTPGDDADSSALNICETEREDY  419

Query  734   SDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEML  630
               PISPLGH+A S+F+E TPISA  SSL+E  S E  
Sbjct  420   GHPISPLGHTATSLFSECTPISANESSLDESPSSETF  456



>ref|XP_011034643.1| PREDICTED: transcription factor GAMYB-like isoform X3 [Populus 
euphratica]
Length=559

 Score =   376 bits (966),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 233/458 (51%), Positives = 285/458 (62%), Gaps = 16/458 (3%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEA--TGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             +TSESE+ +     +  P  EE    G AN GGV LKKGPWTSAEDAIL+EYV +HGEGN
Sbjct  4     MTSESENGIVSNNQIELPLGEEGNYCGSAN-GGVVLKKGPWTSAEDAILIEYVKKHGEGN  62

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWA MAA L
Sbjct  63    WNAVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHAKMGNKWALMAAHL  122

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKRRQRAGLP+YPP+  LQA+ ES +  ++      +    + LQ
Sbjct  123   PGRTDNEIKNYWNTRIKRRQRAGLPLYPPEASLQALQESQRCLNIDRIEIRNKSQHDTLQ  182

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
              N + IP V F NL  NQ + P  P   DI ASS+L +GL+S          M+  KRLR
Sbjct  183   SNSYGIPNVIFDNLTPNQSIIPYVPELPDITASSMLMKGLSSFQYGSIMSPIMHRQKRLR  242

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQN-DTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
                +L +       + F  F  +Q  D   Q               +P+    +    GS
Sbjct  243   EATTLLSSFGGGMKNEFHLFDQFQEVDIAAQSFGLPFPFDYDSTTKNPEFFGEN---QGS  299

Query  1082  HAslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERS  915
             H   N N S+ +P + A K ELPSLQ   S +  W    SP P +ESV+  IQSPPT   
Sbjct  300   HTLANGNFSASKPTSEAVKLELPSLQYSESDLGGWGPSCSPSPLIESVDAFIQSPPTGTV  359

Query  914   ESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGAS-IIPSDIVDNTFPDFHETEWEG  738
             ES   SPRNSGLL+A+L+E++TL  +KN L  ++S +S + P D  D+   +  ETEWE 
Sbjct  360   ESECPSPRNSGLLDALLHEAKTLSSAKNQLSDKSSNSSTVTPGDNADSPGLNISETEWED  419

Query  737   YSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEML  630
             Y  P SPLGH+A S+F+E TPISA  SSL+E  S E  
Sbjct  420   YGHPFSPLGHTATSLFSECTPISANESSLDESPSCETF  457



>ref|XP_009355091.1| PREDICTED: transcription factor GAMYB-like [Pyrus x bretschneideri]
 ref|XP_009355092.1| PREDICTED: transcription factor GAMYB-like [Pyrus x bretschneideri]
Length=548

 Score =   371 bits (952),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 239/461 (52%), Positives = 305/461 (66%), Gaps = 24/461 (5%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNA  1785
             T+ESED +  K  ++SP ++E+ GG+  GG+ LKKGPWTSAEDAIL+EYV +HGEGNWNA
Sbjct  5     TNESEDGVLSKDQIDSPLMDESNGGSGNGGMVLKKGPWTSAEDAILVEYVKKHGEGNWNA  64

Query  1784  VQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGR  1605
             VQKH+GL RCGKSCRLRWANHL+P+LKKGAFTPEEE  I+ELHAKMGNKWARMAA LPGR
Sbjct  65    VQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIVELHAKMGNKWARMAAHLPGR  124

Query  1604  TDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNY  1425
             TDNEIKNYWNTRIKRRQRAGLP+YPP+V LQA  ES Q +     +  D +  + +Q N 
Sbjct  125   TDNEIKNYWNTRIKRRQRAGLPLYPPEVCLQAFQESQQGQSSGGNNGADREQHDSMQANS  184

Query  1424  FEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPS----KRL  1263
             FEIP V F +L+ N  + P  P   DI    +L +GL S+    P+   M P+    KRL
Sbjct  185   FEIPDVVFDSLKGNGCVLPYVPDLPDISPGGMLMKGLGSA----PYCGFMPPTMHRQKRL  240

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             R   +LF    S     F  F  +Q+DTC +V+++ G    +  +     P    VI GS
Sbjct  241   RESTALF----STSGGSFNQFDQFQSDTCDEVARTFGLPFPHDPDPTTRSPLSFGVIQGS  296

Query  1082  HAslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERS  915
             H+  N NSS+ +P + A K ELPSLQ   + + SW S S P P LES++  IQSPP   +
Sbjct  297   HSLSNGNSSASKPTSGAVKLELPSLQYPETDLGSW-STSPPPPLLESIDAFIQSPPQVGT  355

Query  914   -ESGNVSPRNSGLLEAVLYESQTLKHSKN-TLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
              E    SPRNSGLL+A+L+E++ L  +KN +  + ++ +S+ P D+   +  +  ETEWE
Sbjct  356   FEPDCTSPRNSGLLDALLHEAKALSSAKNHSSEKSSNSSSVTPGDVAIGSNLNICETEWE  415

Query  740   GYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
                DPISPLGHSA S+F+E TPISA  SSL+E    E   G
Sbjct  416   -ERDPISPLGHSATSMFSECTPISASGSSLDEPPPAETFTG  455



>ref|XP_007010688.1| Myb domain protein 65, putative isoform 3 [Theobroma cacao]
 gb|EOY19498.1| Myb domain protein 65, putative isoform 3 [Theobroma cacao]
Length=540

 Score =   370 bits (950),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 231/457 (51%), Positives = 293/457 (64%), Gaps = 25/457 (5%)
 Frame = -1

Query  1958  ESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQ  1779
             E ED M  +    SP  ++   G   GGV +KKGPWTSAEDAIL+EYV +HGEGNWNAVQ
Sbjct  7     EREDGMLSEDQAESPLADDGNCGGAGGGVVMKKGPWTSAEDAILIEYVKKHGEGNWNAVQ  66

Query  1778  KHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTD  1599
             KH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LPGRTD
Sbjct  67    KHSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHAKMGNKWARMAAHLPGRTD  126

Query  1598  NEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFE  1419
             NEIKNYWNTRIKRRQRAGLP+YPP+V LQA+ ES+     S  + GD    +++Q N ++
Sbjct  127   NEIKNYWNTRIKRRQRAGLPLYPPEVCLQALQESHST---SAVNGGDKGPQDIMQNNSYQ  183

Query  1418  IPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSL  1245
             IP V F +L+ NQ + P  P   DI  SS+L +GL SS        T++  KRLR   + 
Sbjct  184   IPDVIFDSLKANQSVLPYVPELPDISTSSMLMKGLGSSQYCSFMPPTIHRQKRLRESTAF  243

Query  1244  F---TGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSC----VIPG  1086
             F   TG   N+  +F  F    +D   Q       S G    ++PD  + +     V PG
Sbjct  244   FPGYTGAVKNECPLFDQFQDDMSDKAAQ-------SFGVSFQIEPDPTAKNSESFGVFPG  296

Query  1085  SHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQS-PPTE  921
             SHA  N N S+ E +  A K ELPSLQ   +++ +W + S P P LESV+  IQS PPT 
Sbjct  297   SHALTNGNFSASESSLEAVKLELPSLQYPETELGNWGTISCPPPLLESVDAFIQSPPPTS  356

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
               ES ++SP NSGLL+A+L+E++TL  +KN    ++S +S  P DI +++  +  ETEWE
Sbjct  357   GVESDSLSPHNSGLLDALLHEAKTLSSAKNHASDKSSNSS-TPGDIAESSNFNICETEWE  415

Query  740   GYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEML  630
                 P+SP+GHSA S+F+E    S SSL+E    E  
Sbjct  416   NCGQPLSPMGHSATSLFSECISASGSSLDEQPPAETF  452



>ref|XP_007010686.1| Myb domain protein 65, putative isoform 1 [Theobroma cacao]
 ref|XP_007010687.1| Myb domain protein 65, putative isoform 1 [Theobroma cacao]
 gb|EOY19496.1| Myb domain protein 65, putative isoform 1 [Theobroma cacao]
 gb|EOY19497.1| Myb domain protein 65, putative isoform 1 [Theobroma cacao]
Length=555

 Score =   370 bits (950),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 231/457 (51%), Positives = 293/457 (64%), Gaps = 25/457 (5%)
 Frame = -1

Query  1958  ESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQ  1779
             E ED M  +    SP  ++   G   GGV +KKGPWTSAEDAIL+EYV +HGEGNWNAVQ
Sbjct  7     EREDGMLSEDQAESPLADDGNCGGAGGGVVMKKGPWTSAEDAILIEYVKKHGEGNWNAVQ  66

Query  1778  KHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTD  1599
             KH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LPGRTD
Sbjct  67    KHSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHAKMGNKWARMAAHLPGRTD  126

Query  1598  NEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFE  1419
             NEIKNYWNTRIKRRQRAGLP+YPP+V LQA+ ES+     S  + GD    +++Q N ++
Sbjct  127   NEIKNYWNTRIKRRQRAGLPLYPPEVCLQALQESHST---SAVNGGDKGPQDIMQNNSYQ  183

Query  1418  IPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSL  1245
             IP V F +L+ NQ + P  P   DI  SS+L +GL SS        T++  KRLR   + 
Sbjct  184   IPDVIFDSLKANQSVLPYVPELPDISTSSMLMKGLGSSQYCSFMPPTIHRQKRLRESTAF  243

Query  1244  F---TGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSC----VIPG  1086
             F   TG   N+  +F  F    +D   Q       S G    ++PD  + +     V PG
Sbjct  244   FPGYTGAVKNECPLFDQFQDDMSDKAAQ-------SFGVSFQIEPDPTAKNSESFGVFPG  296

Query  1085  SHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQS-PPTE  921
             SHA  N N S+ E +  A K ELPSLQ   +++ +W + S P P LESV+  IQS PPT 
Sbjct  297   SHALTNGNFSASESSLEAVKLELPSLQYPETELGNWGTISCPPPLLESVDAFIQSPPPTS  356

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
               ES ++SP NSGLL+A+L+E++TL  +KN    ++S +S  P DI +++  +  ETEWE
Sbjct  357   GVESDSLSPHNSGLLDALLHEAKTLSSAKNHASDKSSNSS-TPGDIAESSNFNICETEWE  415

Query  740   GYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEML  630
                 P+SP+GHSA S+F+E    S SSL+E    E  
Sbjct  416   NCGQPLSPMGHSATSLFSECISASGSSLDEQPPAETF  452



>ref|XP_003543825.2| PREDICTED: transcription factor GAMYB-like isoform X1 [Glycine 
max]
Length=534

 Score =   367 bits (941),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 224/435 (51%), Positives = 284/435 (65%), Gaps = 42/435 (10%)
 Frame = -1

Query  1871  PLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAF  1692
             PLKKGPWT+AEDAIL+EYV +HG+GNWNAVQKH+GLARCGKSCRLRWANHL+PDLKKGAF
Sbjct  47    PLKKGPWTAAEDAILVEYVKKHGQGNWNAVQKHSGLARCGKSCRLRWANHLRPDLKKGAF  106

Query  1691  TPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQ  1512
             T EEE+RI+ELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKR QRAGLPIYP ++  +
Sbjct  107   TAEEENRILELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRMQRAGLPIYPEELCQR  166

Query  1511  AIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQL-HPQSPLDIPASSL  1335
              ++ + +++++ T +     H +L Q N F+IP VEFKN +    L H  S  D+P SSL
Sbjct  167   ILNGNQESQNVGTMTNEACHHDDLSQTNNFDIPDVEFKNFKFRHGLPHVPSIFDMPESSL  226

Query  1334  LAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqss  1155
               Q  +SS+     F TM P+KR R  + L+    S   +    F  Y N T  ++S   
Sbjct  227   FDQSSDSSHSYNFLFPTMRPTKRPRESEMLYDSFGSCSINAAPLFDQYGNYTFEKIS---  283

Query  1154  gfssgyyQNLDPDHPSLS--CV-------------IPGSHAslnsnsssLEPAW-AKKPE  1023
                         DHP LS  C              + GSHA+LN N+S+  P + A K E
Sbjct  284   ------------DHPGLSLPCDPVLNTTDQFHGDNLTGSHAALNGNASASVPIFGAMKLE  331

Query  1022  LPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQ  852
             LPSLQ   +Q  SW  P SPLPSLESV+TLIQSP  E   S  +SP++SGLLEA++Y S+
Sbjct  332   LPSLQYPETQHGSWGPPMSPLPSLESVDTLIQSPTLEPILSDPISPQSSGLLEAIVYNSK  391

Query  851   TLKHSKNTLPQQNSGAS---IIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEY  681
             +LK S N L  Q + A+   +     ++++F    +TEW+   DP SPLG SAASV  +Y
Sbjct  392   SLKGSNNDLLLQETIATANEVANISTLNHSF----QTEWDELGDPNSPLGQSAASVLTDY  447

Query  680   TPISASSLEEHQSVE  636
             TP+   S++ +QS E
Sbjct  448   TPVRMCSVDGYQSTE  462



>ref|XP_006593626.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Glycine 
max]
 ref|XP_006593627.1| PREDICTED: transcription factor GAMYB-like isoform X3 [Glycine 
max]
Length=524

 Score =   366 bits (940),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 223/435 (51%), Positives = 283/435 (65%), Gaps = 42/435 (10%)
 Frame = -1

Query  1871  PLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAF  1692
             PLKKGPWT+AEDAIL+EYV +HG+GNWNAVQKH+GLARCGKSCRLRWANHL+PDLKKGAF
Sbjct  37    PLKKGPWTAAEDAILVEYVKKHGQGNWNAVQKHSGLARCGKSCRLRWANHLRPDLKKGAF  96

Query  1691  TPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQ  1512
             T EEE+RI+ELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKR QRAGLPIYP ++  +
Sbjct  97    TAEEENRILELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRMQRAGLPIYPEELCQR  156

Query  1511  AIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQL-HPQSPLDIPASSL  1335
              ++ + +++++ T +     H +L Q N F+IP VEFKN +    L H  S  D+P SSL
Sbjct  157   ILNGNQESQNVGTMTNEACHHDDLSQTNNFDIPDVEFKNFKFRHGLPHVPSIFDMPESSL  216

Query  1334  LAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqss  1155
               Q  +SS+     F TM P+KR R  + L+    S   +    F  Y N T  ++S   
Sbjct  217   FDQSSDSSHSYNFLFPTMRPTKRPRESEMLYDSFGSCSINAAPLFDQYGNYTFEKIS---  273

Query  1154  gfssgyyQNLDPDHPSLSCV---------------IPGSHAslnsnsssLEPAW-AKKPE  1023
                         DHP LS                 + GSHA+LN N+S+  P + A K E
Sbjct  274   ------------DHPGLSLPCDPVLNTTDQFHGDNLTGSHAALNGNASASVPIFGAMKLE  321

Query  1022  LPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQ  852
             LPSLQ   +Q  SW  P SPLPSLESV+TLIQSP  E   S  +SP++SGLLEA++Y S+
Sbjct  322   LPSLQYPETQHGSWGPPMSPLPSLESVDTLIQSPTLEPILSDPISPQSSGLLEAIVYNSK  381

Query  851   TLKHSKNTLPQQNSGAS---IIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEY  681
             +LK S N L  Q + A+   +     ++++F    +TEW+   DP SPLG SAASV  +Y
Sbjct  382   SLKGSNNDLLLQETIATANEVANISTLNHSF----QTEWDELGDPNSPLGQSAASVLTDY  437

Query  680   TPISASSLEEHQSVE  636
             TP+   S++ +QS E
Sbjct  438   TPVRMCSVDGYQSTE  452



>ref|XP_009398954.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=556

 Score =   367 bits (942),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 227/452 (50%), Positives = 299/452 (66%), Gaps = 20/452 (4%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGA--NAGGVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             + +ES+  M  K  ++S S+EE + G   N G   LKKGPWTSAEDAIL++YV +HGEGN
Sbjct  4     VPNESDRRMVPKDEIDSTSIEEDSSGGSLNGGNQVLKKGPWTSAEDAILIDYVKKHGEGN  63

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKHTGL+RCGKSCRLRWANHL+P+LKKGAFTPEEE  IIELHAKMGNKWARMAA L
Sbjct  64    WNAVQKHTGLSRCGKSCRLRWANHLRPNLKKGAFTPEEEQLIIELHAKMGNKWARMAAHL  123

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKRRQRAGLP+YPP+++ Q   E+ Q+++++ +S  D Q + L+Q
Sbjct  124   PGRTDNEIKNYWNTRIKRRQRAGLPLYPPNINFQVSDENQQSKNVNEYSYSDKQPNELMQ  183

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
              + F+IP + F+N   N      +P   DI AS++L Q + S +   PF + M+  K LR
Sbjct  184   GSNFDIPDITFENFNANYGSLSYAPPFPDIAASNMLNQRIGSLH--YPFTNPMSCVKHLR  241

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS---CVIP  1089
               ++L   L   DSD  + +  +      ++     F  GY  + DP+  SL+     +P
Sbjct  242   DSENLIPDLHGTDSDGLSTYEHFLFKPSGKI--KQTFGLGYPYDPDPNGESLTPLESAVP  299

Query  1088  GSHAslnsnsssLEPA-WAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTE  921
             GSHA LN   S+  P     K ELPSLQ   +   SW   +     LE+ +T I+SPPT 
Sbjct  300   GSHALLNGTFSASSPIDGTVKLELPSLQYTETDGNSW--LACSSTPLEAADTYIESPPTT  357

Query  920   RS-ESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEW  744
              S +S  +SPRNSGLLEA+L+E+QTL  +K     ++S ++I P ++ + +     E + 
Sbjct  358   VSLQSECISPRNSGLLEALLHEAQTLGSAKKKPSDKSSSSTITPGNVAECSGVSISE-KL  416

Query  743   EGYSDPISPLGHSAASVFNEYT-PISASSLEE  651
             E Y+DPISPLG SA+SVFNEYT PIS SSL+E
Sbjct  417   EEYNDPISPLGRSASSVFNEYTPPISGSSLDE  448



>ref|XP_009398961.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=553

 Score =   367 bits (941),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 227/452 (50%), Positives = 299/452 (66%), Gaps = 20/452 (4%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGA--NAGGVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             + +ES+  M  K  ++S S+EE + G   N G   LKKGPWTSAEDAIL++YV +HGEGN
Sbjct  4     VPNESDRRMVPKDEIDSTSIEEDSSGGSLNGGNQVLKKGPWTSAEDAILIDYVKKHGEGN  63

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKHTGL+RCGKSCRLRWANHL+P+LKKGAFTPEEE  IIELHAKMGNKWARMAA L
Sbjct  64    WNAVQKHTGLSRCGKSCRLRWANHLRPNLKKGAFTPEEEQLIIELHAKMGNKWARMAAHL  123

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKRRQRAGLP+YPP+++ Q   E+ Q+++++ +S  D Q + L+Q
Sbjct  124   PGRTDNEIKNYWNTRIKRRQRAGLPLYPPNINFQVSDENQQSKNVNEYSYSDKQPNELMQ  183

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
              + F+IP + F+N   N      +P   DI AS++L Q + S +   PF + M+  K LR
Sbjct  184   GSNFDIPDITFENFNANYGSLSYAPPFPDIAASNMLNQRIGSLH--YPFTNPMSCVKHLR  241

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS---CVIP  1089
               ++L   L   DSD  + +  +      ++     F  GY  + DP+  SL+     +P
Sbjct  242   DSENLIPDLHGTDSDGLSTYEHFLFKPSGKI--KQTFGLGYPYDPDPNGESLTPLESAVP  299

Query  1088  GSHAslnsnsssLEPA-WAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTE  921
             GSHA LN   S+  P     K ELPSLQ   +   SW   +     LE+ +T I+SPPT 
Sbjct  300   GSHALLNGTFSASSPIDGTVKLELPSLQYTETDGNSW--LACSSTPLEAADTYIESPPTT  357

Query  920   RS-ESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEW  744
              S +S  +SPRNSGLLEA+L+E+QTL  +K     ++S ++I P ++ + +     E + 
Sbjct  358   VSLQSECISPRNSGLLEALLHEAQTLGSAKKKPSDKSSSSTITPGNVAECSGVSISE-KL  416

Query  743   EGYSDPISPLGHSAASVFNEYT-PISASSLEE  651
             E Y+DPISPLG SA+SVFNEYT PIS SSL+E
Sbjct  417   EEYNDPISPLGRSASSVFNEYTPPISGSSLDE  448



>gb|KHG01258.1| Transcription factor GAMYB [Gossypium arboreum]
Length=556

 Score =   365 bits (938),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 230/456 (50%), Positives = 299/456 (66%), Gaps = 22/456 (5%)
 Frame = -1

Query  1958  ESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEGNWNAV  1782
             E ED M  K    SP +E+ + G    G V LKKGPWTSAEDAIL++YV +HGEGNWNAV
Sbjct  7     EREDGMLSKDQTESPYIEDGSCGGGGAGGVVLKKGPWTSAEDAILIDYVKKHGEGNWNAV  66

Query  1781  QKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRT  1602
             QKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LPGRT
Sbjct  67    QKHSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHAKMGNKWARMAAHLPGRT  126

Query  1601  DNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYF  1422
             DNEIKNYWNTRIKRRQRAGLP+YPP+V LQA+ ES+    ++    G    +++LQ N +
Sbjct  127   DNEIKNYWNTRIKRRQRAGLPLYPPEVCLQALQESHSTSVVNGLDKGP---NDILQNNSY  183

Query  1421  EIPAVEFKNLELNQQLHPQSPLDIP---ASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPD  1251
             EIP V F +L+ NQ + P  P ++P   ASS+L +GL SS        T++  KRLR   
Sbjct  184   EIPDVIFDSLKANQNVLPYVP-ELPVLSASSMLMKGLGSSQYCGFMQPTIHRQKRLRESP  242

Query  1250  SLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSC----VIPGS  1083
             + F G +    +    F  +Q+D    +S  +  S G    ++PD  + +     V PGS
Sbjct  243   AFFPGYTGAVKNECPLFMQFQDD----ISDKAAGSFGLSFPIEPDPATKNSQPFGVFPGS  298

Query  1082  HAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQS-PPTER  918
             HA  N N S+ EP   A K ELPSLQ   +++ +W + + P P LESV+  IQS PPT  
Sbjct  299   HALSNGNFSASEPPLEAVKLELPSLQYPETELGNWGTLTCPPPLLESVDAFIQSPPPTSG  358

Query  917   SESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEG  738
              ES ++SPRNSGLL+A+L+E++TL  +KN    ++S +S  P DI + +  +  ETEWE 
Sbjct  359   LESDSLSPRNSGLLDALLHEAKTLSSAKNHASDKSSNSS-TPGDIAEGSNFNICETEWEK  417

Query  737   YSDPISPLGHSAASVFNEYTPISASSLEEHQSVEML  630
               +P+SP+G+SA S+F+E    S SSL+E    E +
Sbjct  418   CGEPLSPMGNSATSLFSECISASGSSLDEQPPAETV  453



>gb|KHN30627.1| Transcription factor GAMYB [Glycine soja]
Length=521

 Score =   359 bits (921),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 232/475 (49%), Positives = 300/475 (63%), Gaps = 45/475 (9%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             S+TS  ++    KG  +S   EEA  G N  G  PLKKGPWT+AEDAIL+EYV +HG+GN
Sbjct  3     SVTSGGDNRKISKGRRSSSLEEEAGVGGNIRGESPLKKGPWTAAEDAILVEYVKKHGQGN  62

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAV K++GLARCGKSCRLRWANHL+PDLKKG FT EEE+RI+ELHAKMGNKWARMAAEL
Sbjct  63    WNAVHKYSGLARCGKSCRLRWANHLRPDLKKGEFTAEEENRILELHAKMGNKWARMAAEL  122

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKR QRAGLPIYP ++  + ++ + +++++S  S   +QH +L Q
Sbjct  123   PGRTDNEIKNYWNTRIKRMQRAGLPIYPEELCQRILNCNQESQNISILSNEASQHGDLSQ  182

Query  1433  VNYFEIPAVEFKNLELNQQL-HPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRG  1257
              + F+IP VEFK  +    L H QS  D+P SSL  Q  +SS+     F TM P+KR R 
Sbjct  183   TD-FDIPDVEFKIFKFRHGLSHGQSIFDMPESSLFDQSSDSSHSYN-LFPTMRPTKRPRE  240

Query  1256  PDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSC-------  1098
              + L+    S   +    F  Y N T  ++S               DHP LS        
Sbjct  241   SEMLYDSFESCTINAAPLFDQYDNYTSEKIS---------------DHPRLSLPRDPVLN  285

Query  1097  --------VIPGSHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleS  954
                      + GSHA+LN N+SS  P + A K ELPSLQ   +Q  SW +P+SPLPSLES
Sbjct  286   TNDQFNGDNLTGSHAALNGNASSSVPMFRAMKLELPSLQYPETQHGSWGTPTSPLPSLES  345

Query  953   VETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGAS---IIPSDI  783
             V+TLIQSP  E      +SP++SGLLEA+++ S++LK S N L  Q +  +   +  S  
Sbjct  346   VDTLIQSPVVEPILLDPISPQSSGLLEAIVHNSKSLKGSNNDLLLQETIGTTNEVAKSST  405

Query  782   VDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAGED  618
             ++++F    +T+W    +P SP G SAASV  EYTP+S  S++  QS+E     D
Sbjct  406   LNHSF----QTKWYELGEPNSPFGQSAASVLIEYTPVSMCSVDGPQSIETTQDHD  456



>ref|XP_010045104.1| PREDICTED: transcription factor GAMYB [Eucalyptus grandis]
Length=512

 Score =   358 bits (919),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 230/459 (50%), Positives = 289/459 (63%), Gaps = 20/459 (4%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNW  1791
             S T    D    K   + PS EEA+ G   GG+PLKKGPWT+AEDAIL++YVT+HGEGNW
Sbjct  3     STTDGGRDKKVRKIRRHPPSGEEASDG---GGIPLKKGPWTAAEDAILVDYVTKHGEGNW  59

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQKH+GLARCGKSCRLRWANHL+PDLKKGAF+PEEE  IIELHAKMGNKWARMAAELP
Sbjct  60    NAVQKHSGLARCGKSCRLRWANHLRPDLKKGAFSPEEERLIIELHAKMGNKWARMAAELP  119

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQV  1431
             GRTDNEIKNYWNTRIKR QR G+PIYP +V LQ   E+ +  +M    T    + +L Q 
Sbjct  120   GRTDNEIKNYWNTRIKRLQRTGMPIYPTEVCLQVSSENQETHNMGNLHTAGEDNCDLSQA  179

Query  1430  NYFEIPAVEFKNLELNQQLHP--QSPLDIPASSL--LAQGLNSSYGPRPFFSTMNPSKRL  1263
             +  EIP V+F+ LEL+        + LD+P       A  L+ +Y   PF S+ +P KRL
Sbjct  180   DPLEIPEVDFRKLELHLGFSSFWSTLLDVPPCGFGREAMCLSDAYC-LPFPSSRSP-KRL  237

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             RG ++ F  L +  +D F++FG Y + +     +S   SS Y  N D  + SL   +PGS
Sbjct  238   RGSETPFPVLDAGSNDSFSSFGQYADYSSEITPESFVLSSPYDVNPDSTNQSLLGDLPGS  297

Query  1082  HAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERS  915
             HA LN N  S  P   A K ELPSLQ   +Q  S  +P+SP PSLE ++ LIQSPP E  
Sbjct  298   HAFLNGNYPSSVPHLEAMKSELPSLQYTETQQSSCGTPASPRPSLEFIDPLIQSPPCEHY  357

Query  914   ESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGY  735
             +S   SPR  GLLEAV+YE+ + + S        +  +++  +   N+ P    T+ E Y
Sbjct  358   QSDCHSPRGCGLLEAVIYEAFSKQKS-------CAQTTVVSGNEACNSSPVQLRTKQEVY  410

Query  734   SDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAGED  618
             + P SPLG +A SV N  +P S  S EE QS   + G D
Sbjct  411   AAPDSPLGDNAISVLNHCSPASRKSFEEPQSANTMPGFD  449



>ref|XP_007146191.1| hypothetical protein PHAVU_006G020200g [Phaseolus vulgaris]
 gb|ESW18185.1| hypothetical protein PHAVU_006G020200g [Phaseolus vulgaris]
Length=525

 Score =   358 bits (919),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 228/466 (49%), Positives = 300/466 (64%), Gaps = 32/466 (7%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             S+TS  ++    +G  +S   EE   G N GG VPLKKGPWT+AEDAIL+EYV +HG+GN
Sbjct  3     SVTSGGDNRKIYRGCRSSSLDEEGEVGGNMGGEVPLKKGPWTAAEDAILLEYVNKHGQGN  62

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQK++GLARCGKSCRLRWANHL+PDLKKGAFT EEE+RI+ELHAKMGNKWARMAAEL
Sbjct  63    WNAVQKYSGLARCGKSCRLRWANHLRPDLKKGAFTEEEENRILELHAKMGNKWARMAAEL  122

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKR QRAGLPIYPP++  + ++ + +++++   +   +QH NLLQ
Sbjct  123   PGRTDNEIKNYWNTRIKRMQRAGLPIYPPELCERILNANQESQNICPLTVEASQHDNLLQ  182

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
              + F+I  ++FK ++ +     Q P  LDIP  +L  Q  +SS+     F T+ PSKRLR
Sbjct  183   TDQFDIQDMDFKTVKFHHG-PSQVPGILDIP-ENLFEQCSDSSH----LFPTLYPSKRLR  236

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSH  1080
               + L+    S  ++    F  Y N    ++     F   +   L+  +      I GSH
Sbjct  237   ESEILYNSFGSCTANALQLFDQYGNYIGEKIYDHPRFYPPFESVLNTSNQFHGDNINGSH  296

Query  1079  AslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERSE  912
             A LN N SS  P + A+K ELPSLQ   +Q  SW +  SPLPSLESV+TLIQSPP E   
Sbjct  297   AMLNGNVSSSVPLFGARKLELPSLQYTETQHGSWVTHGSPLPSLESVDTLIQSPPVESIP  356

Query  911   SGNVSPRNSGLLEAVLYESQTLKHSKNTL--------PQQNSGASIIPSDIVDNTFPDFH  756
             S  +SP++SGLLEA++Y S+++K S   L          + +G+S         T    +
Sbjct  357   SDLISPQSSGLLEAIVYNSKSMKDSNTDLFFPVITGASNEAAGSS---------TLNHPY  407

Query  755   ETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAGED  618
             +TEW+   +  SPLG SAASV  +YTPI  SS++  QS+E +   D
Sbjct  408   KTEWDEQGESNSPLGQSAASVMTDYTPI--SSVDGPQSIETIQDHD  451



>ref|XP_006605628.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Glycine 
max]
Length=521

 Score =   357 bits (915),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 231/475 (49%), Positives = 299/475 (63%), Gaps = 45/475 (9%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             S+TS  ++    KG  +S   EEA  G N  G  PLKKGPWT+AEDAIL+EY  +HG+GN
Sbjct  3     SVTSGGDNRKISKGRRSSSLEEEAGVGGNIRGESPLKKGPWTAAEDAILVEYAKKHGQGN  62

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAV K++GLARCGKSCRLRWANHL+PDLKKG FT EEE+RI+ELHAKMGNKWARMAAEL
Sbjct  63    WNAVHKYSGLARCGKSCRLRWANHLRPDLKKGEFTAEEENRILELHAKMGNKWARMAAEL  122

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKR QRAGLPIYP ++  + ++ + +++++S  S   +QH +L Q
Sbjct  123   PGRTDNEIKNYWNTRIKRMQRAGLPIYPEELCQRILNCNQESQNISILSNEASQHGDLSQ  182

Query  1433  VNYFEIPAVEFKNLELNQQL-HPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRG  1257
              + F+IP VEFK  +    L H QS  D+P SSL  Q  +SS+     F TM P+KR R 
Sbjct  183   TD-FDIPDVEFKIFKFRHGLSHGQSIFDMPESSLFDQSSDSSHSYN-LFPTMRPTKRPRE  240

Query  1256  PDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSC-------  1098
              + L+    S   +    F  Y N T  ++S               DHP LS        
Sbjct  241   SEMLYDSFESCTINAAPLFDQYDNYTSEKIS---------------DHPRLSLPRDPVLN  285

Query  1097  --------VIPGSHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleS  954
                      + GSHA+LN N+SS  P + A K ELPSLQ   +Q  SW +P+SPLPSLES
Sbjct  286   TNDQFNGDNLTGSHAALNGNASSSVPMFRAMKLELPSLQYPETQHGSWGTPTSPLPSLES  345

Query  953   VETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGAS---IIPSDI  783
             V+TLIQSP  E      +SP++SGLLEA+++ S++LK S N L  Q +  +   +  S  
Sbjct  346   VDTLIQSPVVEPILLDPISPQSSGLLEAIVHNSKSLKGSNNDLLLQETIGTTNEVAKSST  405

Query  782   VDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAGED  618
             ++++F    +T+W    +P SP G SAASV  EYTP+S  S++  QS+E     D
Sbjct  406   LNHSF----QTKWYELGEPNSPFGQSAASVLIEYTPVSMCSVDGPQSIETTQDHD  456



>gb|KHG12129.1| Transcription factor GAMYB [Gossypium arboreum]
Length=484

 Score =   355 bits (910),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 225/431 (52%), Positives = 280/431 (65%), Gaps = 42/431 (10%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWTSAEDAIL++YV +HGEGNWNAVQKH+GL+RCGKSCRLRWANHL+PDLKKG FT
Sbjct  26    LKKGPWTSAEDAILVDYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHLRPDLKKGMFT  85

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             PEEE RI+ELHAK+GNKWARMAAELPGRTDNEIKN+WNTRIKR QRAGLPIYPPDV LQ 
Sbjct  86    PEEERRIVELHAKLGNKWARMAAELPGRTDNEIKNFWNTRIKRLQRAGLPIYPPDVCLQV  145

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSL  1335
                  ++ ++ +    D+  SNL+Q + FEIP VEF+NLELNQQ    SP  L+IP  ++
Sbjct  146   NLSQEESHNVVSTPNQDSFGSNLVQSDAFEIPHVEFENLELNQQFLSYSPELLNIPPKTI  205

Query  1334  LAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDI---------FTAFGPYQND  1182
                GL++ YG    F    P K L+   S +  L +  +D          + +  PY +D
Sbjct  206   ---GLSNGYG--HVFPMAFPPKHLQESVSNYMSLPNQMTDFACKENFDEPYKSSSPYDSD  260

Query  1181  TCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEP-AWAKKPELPSLQ-  1008
                                  D  S   + PGS A LNSN S  EP +     ELPS Q 
Sbjct  261   FSTN-----------------DQSSFG-IPPGSDALLNSNFSPSEPLSGPMNLELPSYQY  302

Query  1007  --SQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSK  834
               +Q  SW + S PLP +ESV+TLIQSPP +R++S   + +NSGLLEAVLYES+ L  SK
Sbjct  303   SDNQQDSWVNSSVPLPLVESVDTLIQSPPMKRAKSECFALQNSGLLEAVLYESKKLNSSK  362

Query  833   NTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSL-  657
             +   QQ+S  +++  D+ D    D  E E+E + DP SP   SAASV +E+TP+S SSL 
Sbjct  363   DDSRQQSS--NLMLDDVADFHLKDC-ELEFEAHCDPNSPSALSAASVLSEHTPVSGSSLD  419

Query  656   EEHQSVEMLAG  624
             +E Q VE + G
Sbjct  420   DESQFVESILG  430



>gb|KHG02965.1| Transcription factor GAMYB [Gossypium arboreum]
Length=555

 Score =   357 bits (915),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 218/427 (51%), Positives = 283/427 (66%), Gaps = 22/427 (5%)
 Frame = -1

Query  1874  VPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGA  1695
             V LKKGPWTSAEDAIL++YV +HGEGNWNAVQKH+GL RCGKSCRLRWANHL+P+LKKGA
Sbjct  36    VVLKKGPWTSAEDAILIDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHLRPNLKKGA  95

Query  1694  FTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHL  1515
             FT EEE  IIELHAKMGNKWARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP+V L
Sbjct  96    FTQEEEQLIIELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEVCL  155

Query  1514  QAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPAS  1341
             QA+ +S+     S  + GD    ++LQ N +EIP V F +L+ +Q + P  P   DI  S
Sbjct  156   QALQDSH---GTSAVNGGDKGPHDILQNNSYEIPDVIFDSLKTSQNVLPYVPELPDISTS  212

Query  1340  SLLAQGLNSSYGPRPFF-STMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVs  1164
             S+L +GL S Y    F   T++  KRLR   + F G +    +    F  +Q+D    +S
Sbjct  213   SMLMKGLGSQYC--SFMPPTIHRQKRLREATAFFPGYTGAVKNECPLFEQFQDD----IS  266

Query  1163  qssgfssgyyQNLDPDHPSLSC----VIPGSHAslnsnsssLEPAW-AKKPELPSLQ---  1008
               +  S G    ++PD  + +     V PGSH   N N S+ EP   A K ELPSLQ   
Sbjct  267   DKAAQSFGLSFPIEPDPATKNSLQFGVFPGSHNLSNGNFSASEPPLEAVKLELPSLQYPE  326

Query  1007  SQIVSWDspssplpsleSVETLIQSPPTER-SESGNVSPRNSGLLEAVLYESQTLKHSKN  831
             +++ +W + S P P LESV+  IQSPP    +ES ++SPRNSGLL+A+L+E++TL  +KN
Sbjct  327   TELGNWGTFSCPPPLLESVDAFIQSPPPPSIAESDSLSPRNSGLLDALLHEAKTLSSAKN  386

Query  830   TLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSLEE  651
                +++S  S  P D+ +++  +  ETEWE   +P+SP+GHSA S+ +E    S S+L+E
Sbjct  387   HASEKSSN-SATPGDVAESSTFNICETEWENCGEPLSPMGHSATSLLSECISASGSTLDE  445

Query  650   HQSVEML  630
                 E  
Sbjct  446   QPPAETF  452



>ref|XP_006605627.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Glycine 
max]
Length=575

 Score =   357 bits (916),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 231/475 (49%), Positives = 299/475 (63%), Gaps = 45/475 (9%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGG-VPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             S+TS  ++    KG  +S   EEA  G N  G  PLKKGPWT+AEDAIL+EY  +HG+GN
Sbjct  57    SVTSGGDNRKISKGRRSSSLEEEAGVGGNIRGESPLKKGPWTAAEDAILVEYAKKHGQGN  116

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAV K++GLARCGKSCRLRWANHL+PDLKKG FT EEE+RI+ELHAKMGNKWARMAAEL
Sbjct  117   WNAVHKYSGLARCGKSCRLRWANHLRPDLKKGEFTAEEENRILELHAKMGNKWARMAAEL  176

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKR QRAGLPIYP ++  + ++ + +++++S  S   +QH +L Q
Sbjct  177   PGRTDNEIKNYWNTRIKRMQRAGLPIYPEELCQRILNCNQESQNISILSNEASQHGDLSQ  236

Query  1433  VNYFEIPAVEFKNLELNQQL-HPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRG  1257
              + F+IP VEFK  +    L H QS  D+P SSL  Q  +SS+     F TM P+KR R 
Sbjct  237   TD-FDIPDVEFKIFKFRHGLSHGQSIFDMPESSLFDQSSDSSHSYN-LFPTMRPTKRPRE  294

Query  1256  PDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSC-------  1098
              + L+    S   +    F  Y N T  ++S               DHP LS        
Sbjct  295   SEMLYDSFESCTINAAPLFDQYDNYTSEKIS---------------DHPRLSLPRDPVLN  339

Query  1097  --------VIPGSHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleS  954
                      + GSHA+LN N+SS  P + A K ELPSLQ   +Q  SW +P+SPLPSLES
Sbjct  340   TNDQFNGDNLTGSHAALNGNASSSVPMFRAMKLELPSLQYPETQHGSWGTPTSPLPSLES  399

Query  953   VETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGAS---IIPSDI  783
             V+TLIQSP  E      +SP++SGLLEA+++ S++LK S N L  Q +  +   +  S  
Sbjct  400   VDTLIQSPVVEPILLDPISPQSSGLLEAIVHNSKSLKGSNNDLLLQETIGTTNEVAKSST  459

Query  782   VDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAGED  618
             ++++F    +T+W    +P SP G SAASV  EYTP+S  S++  QS+E     D
Sbjct  460   LNHSF----QTKWYELGEPNSPFGQSAASVLIEYTPVSMCSVDGPQSIETTQDHD  510



>gb|EYU35988.1| hypothetical protein MIMGU_mgv1a022282mg [Erythranthe guttata]
Length=508

 Score =   353 bits (906),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 223/447 (50%), Positives = 276/447 (62%), Gaps = 70/447 (16%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAG-GVPLKKGPWTSAEDAILMEYVTRHGEGNW  1791
             +TSES++ M      +SPS ++A  G + G   PLKKGPWTSAEDAIL++YV ++GEGNW
Sbjct  1     MTSESDERMIPINGADSPSTDDANSGGDGGLNGPLKKGPWTSAEDAILVQYVNKNGEGNW  60

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQKH+GLARCGKSCRLRWANHL+PDLKKGAFT EEE RIIELHAKMGNKWARMAAELP
Sbjct  61    NAVQKHSGLARCGKSCRLRWANHLRPDLKKGAFTAEEERRIIELHAKMGNKWARMAAELP  120

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHE-SNQNED-MSTFSTGDTQHSNLL  1437
             GRTDNEIKNYWNTRIKRRQRAGLPIYPPD+ LQA++E S QNED ++TFS  D    + +
Sbjct  121   GRTDNEIKNYWNTRIKRRQRAGLPIYPPDICLQALNEGSQQNEDTINTFSPNDVHRPDFI  180

Query  1436  QVNYFEIPAVEFKNLELNQQLHP-----QSPLDIPASSLLAQGL-NSSYGPRPFFSTMNP  1275
             Q++  ++P++EFK LE+NQ L+P      + LDI  ++LL+QGL    +     F    P
Sbjct  181   QISTLDVPSLEFKGLEINQPLYPLDIPSNTLLDISTNTLLSQGLHPHPHPHNHPFYLHPP  240

Query  1274  SKRLR--GPDSLFTGLSSNDSDIFTAFGPYQ---NDTCMQVsqssgfssgyyQNLDPDHP  1110
             SKRLR   P+S+F  +     +I    G  Q   ND  +                     
Sbjct  241   SKRLRSGAPESMFPCI-----NIVPPIGMSQYQSNDGLL---------------------  274

Query  1109  SLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQSQI------VSWDspssplpsleSVE  948
              LSC  P S  S          AWA K ELPSLQ+Q+       +W  P     +    E
Sbjct  275   -LSC--PSSDPS----------AWAMKMELPSLQTQMRNTTANTNWGGPPPSPANNPFFE  321

Query  947   ---TLIQS-PPTERSESGNVSPRNSGLLEAVLYESQTLKHSKN--TLPQQNSGASIIPSD  786
                 L+QS PP E ++  N+SP+NSGLL  VLYES  L +SK   + PQ +S   I  S+
Sbjct  322   PADVLMQSPPPNEGAQLCNLSPQNSGLLNEVLYESGALNNSKTSYSFPQPDSYIDIDSSN  381

Query  785   IVDNTFPDFHETEWEGYSDPISPLGHS  705
                N   D    EWE Y + +SPL HS
Sbjct  382   A--NVLCD---AEWEPYGERLSPLVHS  403



>gb|KHG09015.1| Transcription factor GAMYB [Gossypium arboreum]
 gb|KHG27014.1| Transcription factor GAMYB [Gossypium arboreum]
Length=555

 Score =   351 bits (901),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 222/458 (48%), Positives = 280/458 (61%), Gaps = 27/458 (6%)
 Frame = -1

Query  1958  ESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQ  1779
             E ED M  K     P +++   G   GG  LKKGPWTSAEDAIL++YV +HGEGNWNAVQ
Sbjct  7     EREDGMLSKNRKELPLIDDGNYGDADGGALLKKGPWTSAEDAILIDYVKKHGEGNWNAVQ  66

Query  1778  KHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTD  1599
             KH+GL RCGKSCRLRWANHL+P+LKKGAFT EEEH IIELHAKMGNKWARMAA LPGRTD
Sbjct  67    KHSGLFRCGKSCRLRWANHLRPNLKKGAFTREEEHLIIELHAKMGNKWARMAANLPGRTD  126

Query  1598  NEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFE  1419
             NEIKNYWNTRIKRRQRAGLP+YPP+V +QA+ ES++    S  S GD    ++LQ N +E
Sbjct  127   NEIKNYWNTRIKRRQRAGLPLYPPEVCVQALKESHRT---SAISGGDKGTHDILQNNTYE  183

Query  1418  IPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSL  1245
             IP V F +L+ NQ + P  P   DI AS ++ + L SS         ++  KRLR   + 
Sbjct  184   IPDVIFDSLKANQNVLPYVPELPDISASCMMMKVLGSSQYSSFIPPAIHRQKRLRESAAF  243

Query  1244  ---FTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPD-----HPSLSCVIP  1089
                +T    ND  +F  F     D   Q    S          +PD       S S    
Sbjct  244   SPGYTAAVKNDCPLFEQFEDNMFDKAAQPFGQSFP-------FEPDPLTKKSQSFS-AFQ  295

Query  1088  GSHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTE  921
             GSHA  + N S+ EP   A K ELPSLQ   +++ +W + S     LES++  IQSP T 
Sbjct  296   GSHALSHGNFSASEPTLEAVKLELPSLQYPETELENWGTLSCSSSLLESIDAFIQSPQTT  355

Query  920   RSES-GNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEW  744
                   ++SPRNSGLL+A+L+E++TL  +KN    ++S +S  P DI + +  +  ETEW
Sbjct  356   SGVVLDSLSPRNSGLLDALLHEAKTLSSAKNHASDKSSNSS-TPCDIAERSNFNTCETEW  414

Query  743   EGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEML  630
             E Y + +SP+ HSA S F+E    S SSL+E    E  
Sbjct  415   ENYGETLSPMCHSATSFFSESISASGSSLDEQPPAETF  452



>ref|XP_010091315.1| Transcription factor GAMYB [Morus notabilis]
 gb|EXB44289.1| Transcription factor GAMYB [Morus notabilis]
Length=556

 Score =   349 bits (895),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 225/459 (49%), Positives = 298/459 (65%), Gaps = 20/459 (4%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNA  1785
             T+ESED +  K +  SP ++E+ GG++ GGV LKKGPWTS+EDA+L+EYV +HGEGNWNA
Sbjct  5     TNESEDGVLSKYHSESPLIDESNGGSSGGGVLLKKGPWTSSEDALLVEYVKKHGEGNWNA  64

Query  1784  VQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGR  1605
             VQKH+GL+RCGKSCRLRWANHL+P+L+KGAF+ +EE  IIELHAKMGNKWARMA+ LPGR
Sbjct  65    VQKHSGLSRCGKSCRLRWANHLRPNLRKGAFSQDEERLIIELHAKMGNKWARMASHLPGR  124

Query  1604  TDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNY  1425
             TDNEIKNYWNTRIKRRQRAGLP+YPPD+ LQA  E+ Q ++    S GD    + LQVN 
Sbjct  125   TDNEIKNYWNTRIKRRQRAGLPLYPPDLCLQAFQENQQGQNTGGISCGDRGQHDPLQVNS  184

Query  1424  FEIPAVEFKNLELNQQL--HPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPS----KRL  1263
             FEIP V F  L+ N ++  +     D+  +++L +G++  Y     +S + P+    KRL
Sbjct  185   FEIPDVVFDGLKANTEVLSYVSDLTDMSMNTMLLKGMSPQY-----YSFVPPTIHRQKRL  239

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSC-VIPG  1086
             R    +F   +    + F  F  +QND   +V  +S F + +  +LDP+   LS  V  G
Sbjct  240   RESSDVFPDSAGCVQNGFPLFDQFQNDPGDKV--ASSFGASFRPDLDPNKSLLSFDVTQG  297

Query  1085  SHAslnsnsssLEPA-WAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQS-PPTE  921
              H+  N NSS+ +P   A K ELPSLQ   + + +W   S P P LESV+  IQS PP  
Sbjct  298   DHSLPNGNSSASKPIHGAVKLELPSLQYPETDLGTW-GTSPPPPVLESVDAFIQSPPPVG  356

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
               ES   SPRNSGLL+A+++E++ L   +    +  + +SI PSD+ DN   +  E EW+
Sbjct  357   AFESDCSSPRNSGLLDALIHEAKNLSSGQKHSDKSKNSSSISPSDMADNGTLNVCENEWD  416

Query  740   GYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
              Y +PISP GHS  S  NE    S SSL++  S E   G
Sbjct  417   EYREPISPFGHSDTSFMNECFSASGSSLDDPPSAETFTG  455



>ref|XP_010922970.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Elaeis 
guineensis]
Length=553

 Score =   345 bits (885),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 225/465 (48%), Positives = 299/465 (64%), Gaps = 27/465 (6%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVP-LKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             T++S++ M  K  V+SPS E ++GG+  GG   LKKGPWTSAEDAIL++YV +HGEGNWN
Sbjct  5     TNDSDNIMVSKDQVDSPSNEGSSGGSLTGGGQVLKKGPWTSAEDAILVDYVKKHGEGNWN  64

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL+RCGKSCRLRWANHL+P+LKKGAFTPEEE  IIELHA+MGNKWARMAA+LPG
Sbjct  65    AVQKHSGLSRCGKSCRLRWANHLRPNLKKGAFTPEEEQLIIELHARMGNKWARMAAQLPG  124

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKR QRAGLP+YPP++  QA  E+ Q++  + +  G+ + + LLQ N
Sbjct  125   RTDNEIKNYWNTRIKRLQRAGLPLYPPNLSYQASSENQQSQTATEYGHGEKRPNELLQGN  184

Query  1427  YFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNS-SYGPRPFFSTM-NPSKRLR  1260
               ++P V F++L  +Q     +P   DI  SS+L QG  S +YG   F + M N  KR R
Sbjct  185   TSDLPDVMFESLNAHQGALSYAPPFPDISVSSMLTQGFGSQNYG---FMNPMGNRMKRFR  241

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPS-----LSCV  1095
               ++L      + S     F  + ++   ++ +S G         DPD  S         
Sbjct  242   ESETLLPVFDGSVSSALPTFQQFSDEPSEKIRRSFGLGYP----YDPDPSSEIPTPFGGA  297

Query  1094  IPGSHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplpsleSVETLIQSPP  927
             +PGSHA  N N S+  P     K ELPSLQ   + + SW   + P P  E++++ IQSPP
Sbjct  298   VPGSHALSNGNFSASRPLGGTVKMELPSLQYSETDLSSW--FACPSPPPEAIDSYIQSPP  355

Query  926   -TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHET  750
              T   +S  VSPRNSGLL+A+L+E+Q  K   +   + +S + + P  + +++     E 
Sbjct  356   ATASVQSECVSPRNSGLLDALLHEAQARKTQSSE--KNSSSSVVAPGGMAESSGLPLCEA  413

Query  749   EWEGYSDPISPLGHSAASVFNEYT-PISASSLEEHQSVEMLAGED  618
             EWE Y+DPISPLG  AASVFNE T P+S  SL+E Q  +  +G D
Sbjct  414   EWEEYNDPISPLGRPAASVFNECTPPVSGVSLDELQPSKEPSGSD  458



>ref|XP_004251439.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Solanum 
lycopersicum]
Length=484

 Score =   342 bits (877),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 211/459 (46%), Positives = 279/459 (61%), Gaps = 26/459 (6%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAG-GVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             M +T+E  D MT +  +NS SVEEA  G N   G PLKKGPW  AEDAIL +YV  +GEG
Sbjct  1     MCMTTECVDRMTSEVGMNSTSVEEANAGGNIRRGTPLKKGPWLKAEDAILRDYVAEYGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NW++V + TGLARCGKSCRLRW+NHLKP LKKGAFT EEE  I+ +HA++GNKWAR+A+E
Sbjct  61    NWSSVHRRTGLARCGKSCRLRWSNHLKPYLKKGAFTQEEEQLIVAMHAQIGNKWARIASE  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
              PGRTDN+IKN+WNTR+KR++R    +  P V      E  QN++++T S+ ++   +LL
Sbjct  121   FPGRTDNDIKNFWNTRLKRQRREEKYMLSPGVFFGEFSEDKQNKELATSSSANSL-PHLL  179

Query  1436  QVNYFEIPAVEFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTM  1281
               N  EIP  E +N E +QQL+P         S L  PA+SL  QGLNSS+      ST+
Sbjct  180   PNNNVEIPTAENRNFEPSQQLYPPRLLNNDFSSFLGTPATSLRDQGLNSSWNTHSVPSTV  239

Query  1280  NPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS  1101
             + SKR +G +S F   S+ + D+  A   YQND           S   +      H S +
Sbjct  240   HSSKRTQGLESWF---SNRNVDLSQAHHQYQNDGSFFTQSLGFSSLCTHNLTSNYHRSSA  296

Query  1100  CVIPGSHAslnsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPPTE  921
               IPG  A      SS E     K ELPS Q+ + SWD  +S +PS+ES  T IQSPP E
Sbjct  297   SEIPGIQA------SSSEHRLKGKLELPSFQTPMTSWD-SASSVPSIESSSTFIQSPPNE  349

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
              ++S ++SP++S LL A+LY SQT K S +   Q+ S       D+V ++ P   + +W 
Sbjct  350   YTDSCSLSPQSSDLLHAILYGSQTPKASSSNSYQETS------RDVVPDSCPVLRQIQWG  403

Query  740   GYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
                D I+P GH+  SVF+EYTP S  SLE+HQS+    G
Sbjct  404   TNPDAITPSGHAITSVFSEYTPSSGGSLEDHQSIAPFIG  442



>ref|XP_010922971.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Elaeis 
guineensis]
Length=556

 Score =   344 bits (882),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 223/456 (49%), Positives = 295/456 (65%), Gaps = 27/456 (6%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVP-LKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             T++S++ M  K  V+SPS E ++GG+  GG   LKKGPWTSAEDAIL++YV +HGEGNWN
Sbjct  5     TNDSDNIMVSKDQVDSPSNEGSSGGSLTGGGQVLKKGPWTSAEDAILVDYVKKHGEGNWN  64

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL+RCGKSCRLRWANHL+P+LKKGAFTPEEE  IIELHA+MGNKWARMAA+LPG
Sbjct  65    AVQKHSGLSRCGKSCRLRWANHLRPNLKKGAFTPEEEQLIIELHARMGNKWARMAAQLPG  124

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKR QRAGLP+YPP++  QA  E+ Q++  + +  G+ + + LLQ N
Sbjct  125   RTDNEIKNYWNTRIKRLQRAGLPLYPPNLSYQASSENQQSQTATEYGHGEKRPNELLQGN  184

Query  1427  YFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNS-SYGPRPFFSTM-NPSKRLR  1260
               ++P V F++L  +Q     +P   DI  SS+L QG  S +YG   F + M N  KR R
Sbjct  185   TSDLPDVMFESLNAHQGALSYAPPFPDISVSSMLTQGFGSQNYG---FMNPMGNRMKRFR  241

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPS-----LSCV  1095
               ++L      + S     F  + ++   ++ +S G         DPD  S         
Sbjct  242   ESETLLPVFDGSVSSALPTFQQFSDEPSEKIRRSFGLGYP----YDPDPSSEIPTPFGGA  297

Query  1094  IPGSHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplpsleSVETLIQSPP  927
             +PGSHA  N N S+  P     K ELPSLQ   + + SW   + P P  E++++ IQSPP
Sbjct  298   VPGSHALSNGNFSASRPLGGTVKMELPSLQYSETDLSSW--FACPSPPPEAIDSYIQSPP  355

Query  926   -TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHET  750
              T   +S  VSPRNSGLL+A+L+E+Q  K   +   + +S + + P  + +++     E 
Sbjct  356   ATASVQSECVSPRNSGLLDALLHEAQARKTQSSE--KNSSSSVVAPGGMAESSGLPLCEA  413

Query  749   EWEGYSDPISPLGHSAASVFNEYT-PISASSLEEHQ  645
             EWE Y+DPISPLG  AASVFNE T P+S  SL+E Q
Sbjct  414   EWEEYNDPISPLGRPAASVFNECTPPVSGVSLDELQ  449



>ref|XP_004140923.1| PREDICTED: transcription factor GAMYB-like [Cucumis sativus]
 ref|XP_004167337.1| PREDICTED: transcription factor GAMYB-like [Cucumis sativus]
Length=552

 Score =   342 bits (878),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 211/451 (47%), Positives = 281/451 (62%), Gaps = 12/451 (3%)
 Frame = -1

Query  1958  ESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQ  1779
             E ED++  +    SP ++E +GG NA G+ LKKGPWTSAED IL+EYV +HGEGNWNAVQ
Sbjct  7     EIEDNLPSQDQTLSPLLDEDSGG-NASGIILKKGPWTSAEDEILIEYVKKHGEGNWNAVQ  65

Query  1778  KHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTD  1599
             KH+GL+RCGKSCRLRWANHL+P+LKKGAFT EEEH IIELHAKMGNKWARMA  LPGRTD
Sbjct  66    KHSGLSRCGKSCRLRWANHLRPNLKKGAFTAEEEHLIIELHAKMGNKWARMAGHLPGRTD  125

Query  1598  NEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFE  1419
             NEIKNYWNTRIKRRQRAGLP+YPP+V L+      Q +D    +  DT H +LL+ N ++
Sbjct  126   NEIKNYWNTRIKRRQRAGLPLYPPEVCLRTWQALQQTQDSGGSTVVDTDHHDLLRSNSYD  185

Query  1418  IPAVEFKNLELNQQLHPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFT  1239
             IP V F +L+    L     L   +S +L +GL++S        T +  KR R   SLF 
Sbjct  186   IPDVTFHSLKPQSALSYMPELPDISSCMLKRGLDTSQYCNLVQPTFHRQKRFRDSASLFP  245

Query  1238  GLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsns  1059
             G    D  + T F  +++++  Q +QS G    +  N    +        GSH+  N NS
Sbjct  246   G---PDGSVKTPFHQFEDNSYSQAAQSFGTPFAHESNPTTKNAMSFGSFEGSHSLTNGNS  302

Query  1058  ssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPR  891
             S+ + +   +K ELPSLQ   + + SWD  +      ESV+  IQS PT        SP 
Sbjct  303   SASQHSKETEKLELPSLQYPETDLTSWD-TTIQPAMFESVDPFIQSTPTFVLAPDRTSPC  361

Query  890   NSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLG  711
             +SGLLE+++Y S+T+    +   + ++  S+ P D+ D+      +TE + Y++ ISP G
Sbjct  362   HSGLLESLVY-SKTMGPKNHPSDKNSNSCSVTPGDVTDSYNMAASKTEIDDYTEVISPFG  420

Query  710   HSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
             HS +S+F+E TPISA  SS E+    E  +G
Sbjct  421   HSTSSLFSECTPISATGSSYEDPTLTEAFSG  451



>ref|XP_008456638.1| PREDICTED: transcription factor GAMYB [Cucumis melo]
 ref|XP_008456639.1| PREDICTED: transcription factor GAMYB [Cucumis melo]
Length=553

 Score =   339 bits (870),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 215/453 (47%), Positives = 282/453 (62%), Gaps = 15/453 (3%)
 Frame = -1

Query  1958  ESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQ  1779
             E ED++  +    SP ++E +GG NA G+ LKKGPWTSAED IL+EYV +HGEGNWNAVQ
Sbjct  7     EIEDNLPSQDQTLSPLLDEDSGG-NASGIVLKKGPWTSAEDEILIEYVKKHGEGNWNAVQ  65

Query  1778  KHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTD  1599
             KH+GL+RCGKSCRLRWANHL+P+LKKGAFT EEEH IIELHAKMGNKWARMAA LPGRTD
Sbjct  66    KHSGLSRCGKSCRLRWANHLRPNLKKGAFTAEEEHLIIELHAKMGNKWARMAAHLPGRTD  125

Query  1598  NEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFE  1419
             NEIKNYWNTRIKRRQRAGLP+YPP+V L+      Q +D    +  D  H +LL+ N ++
Sbjct  126   NEIKNYWNTRIKRRQRAGLPLYPPEVCLRTWQALQQTQDSGGSTIVDNDHHDLLRANSYD  185

Query  1418  IPAVEFKNLELNQQLHPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFT  1239
             IP V F +L+    L     L   +S +L +GL+SS       S ++  KR R   SLF 
Sbjct  186   IPDVTFHSLKPQSALSYMPELPDISSCMLKRGLDSSQYCNFMQSALHRQKRFRDSASLFP  245

Query  1238  GLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsns  1059
             G    D  + T F  +++++  Q +QS G       N    +        GSH+  N NS
Sbjct  246   G---PDGSVKTPFHQFEDNSYSQAAQSFGTPFAVESNPTTKNAMSFGSFEGSHSLTNGNS  302

Query  1058  ssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSPPTERSESGNV-SP  894
             S+ + +   +K ELPSLQ   + + SWD  +      ESV+  IQS PT   ++ +  SP
Sbjct  303   SASQHSKETEKLELPSLQYPETDLTSWD-TTIQPAMFESVDPFIQSTPTFVLQATDRQSP  361

Query  893   RNSGLLEAVLYESQTLKHSKNTLPQQNSGA-SIIPSDIVDNTFPDFHETEWEGYSDPISP  717
              +SGLLEA++Y        KN    +NS + S+ P D+ D+      +TE + Y++ ISP
Sbjct  362   CHSGLLEALVYPKPM--GPKNHPSDKNSNSCSVTPGDVTDSYNMAASKTEIDDYTEVISP  419

Query  716   LGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
              GHS +S+F+E TPISA  SS E+    E  +G
Sbjct  420   FGHSTSSLFSECTPISATGSSYEDPTLTEAFSG  452



>ref|XP_010904728.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010904729.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010904730.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Elaeis 
guineensis]
Length=540

 Score =   338 bits (867),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 220/451 (49%), Positives = 289/451 (64%), Gaps = 28/451 (6%)
 Frame = -1

Query  1955  SEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQK  1776
             S++ +      +SPS++E + G    G  LKKGPWTSAEDAIL++YV +HGEGNWNAVQK
Sbjct  8     SDNRLVPNDQTDSPSIDEGSSGGR--GQILKKGPWTSAEDAILVDYVKKHGEGNWNAVQK  65

Query  1775  HTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDN  1596
             H+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHA MGNKWARMAA LPGRTDN
Sbjct  66    HSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHATMGNKWARMAALLPGRTDN  125

Query  1595  EIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEI  1416
             EIKNYWNTRIKRRQRAGLP+YPP++ LQA  E+ Q++  S +STG+ + +++LQ N F+I
Sbjct  126   EIKNYWNTRIKRRQRAGLPLYPPNLGLQASSENQQSQTASEYSTGEKRPNDVLQGNCFDI  185

Query  1415  PAVEFKNLELNQ-QLHPQSPL-DIPASSLLAQGLNSSYGPRPFFSTM-NPSKRLRGPDSL  1245
               +   N   +Q  L   SP  DI  SS+L+QG  S      F + M N +KRLR  +S+
Sbjct  186   DVI-LNNSNADQGALSYASPFPDISVSSMLSQGFGSQ--DNNFMNPMWNSAKRLRESESV  242

Query  1244  FTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCV-----IPGSH  1080
                     S        + +++  ++ ++ G         DP+  S   V     +PGSH
Sbjct  243   LPDFHGTVSCELPTCELFLHESSEKIHRTFGLGYL----YDPEPSSKIMVPFDGAVPGSH  298

Query  1079  AslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplpsleSVETLIQSPP-TERS  915
             A LN N S+  P     K ELPSLQ   + + SW   + P P  + ++T IQSPP T   
Sbjct  299   ALLNGNFSASRPLGGTVKLELPSLQYPETVLNSW--LACPSPPPDEIDTYIQSPPATVLV  356

Query  914   ESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGY  735
              S  VSPRNSGLLEA+L+E+Q  K  ++   +++  ++I   D+V+++  +  E E E Y
Sbjct  357   RSECVSPRNSGLLEALLHEAQARKIQQS---EESLSSAITQGDMVESSGFNLWEAECEEY  413

Query  734   SDPISPLGHSAASVFNEYT-PISASSLEEHQ  645
             +DPISPLG  AASVF+E T PIS  SL+E Q
Sbjct  414   NDPISPLGRPAASVFSECTPPISGGSLDELQ  444



>ref|XP_008792434.1| PREDICTED: transcription factor GAMYB-like isoform X3 [Phoenix 
dactylifera]
 ref|XP_008792435.1| PREDICTED: transcription factor GAMYB-like isoform X3 [Phoenix 
dactylifera]
 ref|XP_008792436.1| PREDICTED: transcription factor GAMYB-like isoform X3 [Phoenix 
dactylifera]
 ref|XP_008792437.1| PREDICTED: transcription factor GAMYB-like isoform X3 [Phoenix 
dactylifera]
Length=556

 Score =   338 bits (867),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 221/465 (48%), Positives = 291/465 (63%), Gaps = 27/465 (6%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVP-LKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             T +S+++M     V+SPS E ++GG   GG   LKKGPWTSAEDAIL++YV +HGEGNWN
Sbjct  5     TDDSDNAMVPMDQVDSPSNEGSSGGLLTGGGQVLKKGPWTSAEDAILVDYVKKHGEGNWN  64

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL+RCGKSCRLRWANHL+P+LKKGAFTPEEE  IIELHA+MGNKWARMAA LPG
Sbjct  65    AVQKHSGLSRCGKSCRLRWANHLRPNLKKGAFTPEEEKLIIELHARMGNKWARMAAHLPG  124

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKRRQRAGLP+Y  +V  QA  E+ Q++  + +  G+ + + LLQ N
Sbjct  125   RTDNEIKNYWNTRIKRRQRAGLPLYTSNVPFQASSENQQSQTATAYGNGEKRPNELLQGN  184

Query  1427  YFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNS-SYGPRPFFSTM-NPSKRLR  1260
              F+ P   F +   N      +P   DI  SS+L+QG  S +YG   F + M N  K+ R
Sbjct  185   SFDFPDAIFDSFNANHGALSYAPPFSDISVSSMLSQGFGSQNYG---FMNPMGNHVKQFR  241

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPS-----LSCV  1095
               ++   G   + +        + N+   ++ +S G         DPD  S         
Sbjct  242   ESETSLPGFHGSVTTGLPPLEQFSNEPSEKIQRSFGLGYP----YDPDPSSKDLAPFGGA  297

Query  1094  IPGSHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplpsleSVETLIQSPP  927
             IPGSHA  N N S+  P     K ELPSLQ     + SW   +   P  E+++  IQSPP
Sbjct  298   IPGSHALSNGNFSASRPLGGTVKMELPSLQYPECDLSSW--LACSSPPPEAIDNYIQSPP  355

Query  926   -TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHET  750
              T   +S  VSPRNSGLL+A+L+E+Q  K   +   +++S + + P  +V+++  +F E 
Sbjct  356   ATASVQSECVSPRNSGLLDALLHEAQARKTQSSG--KRSSSSVVAPGGMVESSGLNFCEA  413

Query  749   EWEGYSDPISPLGHSAASVFNEYT-PISASSLEEHQSVEMLAGED  618
              W+ Y+DPISPLG  AASVFNE T P+S  SL+E Q  +  +G D
Sbjct  414   AWKEYNDPISPLGRPAASVFNECTPPVSGGSLDELQPSKEPSGSD  458



>ref|XP_008792432.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Phoenix 
dactylifera]
Length=584

 Score =   338 bits (868),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 221/465 (48%), Positives = 291/465 (63%), Gaps = 27/465 (6%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVP-LKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             T +S+++M     V+SPS E ++GG   GG   LKKGPWTSAEDAIL++YV +HGEGNWN
Sbjct  33    TDDSDNAMVPMDQVDSPSNEGSSGGLLTGGGQVLKKGPWTSAEDAILVDYVKKHGEGNWN  92

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL+RCGKSCRLRWANHL+P+LKKGAFTPEEE  IIELHA+MGNKWARMAA LPG
Sbjct  93    AVQKHSGLSRCGKSCRLRWANHLRPNLKKGAFTPEEEKLIIELHARMGNKWARMAAHLPG  152

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKRRQRAGLP+Y  +V  QA  E+ Q++  + +  G+ + + LLQ N
Sbjct  153   RTDNEIKNYWNTRIKRRQRAGLPLYTSNVPFQASSENQQSQTATAYGNGEKRPNELLQGN  212

Query  1427  YFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNS-SYGPRPFFSTM-NPSKRLR  1260
              F+ P   F +   N      +P   DI  SS+L+QG  S +YG   F + M N  K+ R
Sbjct  213   SFDFPDAIFDSFNANHGALSYAPPFSDISVSSMLSQGFGSQNYG---FMNPMGNHVKQFR  269

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPS-----LSCV  1095
               ++   G   + +        + N+   ++ +S G         DPD  S         
Sbjct  270   ESETSLPGFHGSVTTGLPPLEQFSNEPSEKIQRSFGLGYP----YDPDPSSKDLAPFGGA  325

Query  1094  IPGSHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplpsleSVETLIQSPP  927
             IPGSHA  N N S+  P     K ELPSLQ     + SW   +   P  E+++  IQSPP
Sbjct  326   IPGSHALSNGNFSASRPLGGTVKMELPSLQYPECDLSSW--LACSSPPPEAIDNYIQSPP  383

Query  926   -TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHET  750
              T   +S  VSPRNSGLL+A+L+E+Q  K   +   +++S + + P  +V+++  +F E 
Sbjct  384   ATASVQSECVSPRNSGLLDALLHEAQARKTQSSG--KRSSSSVVAPGGMVESSGLNFCEA  441

Query  749   EWEGYSDPISPLGHSAASVFNEYT-PISASSLEEHQSVEMLAGED  618
              W+ Y+DPISPLG  AASVFNE T P+S  SL+E Q  +  +G D
Sbjct  442   AWKEYNDPISPLGRPAASVFNECTPPVSGGSLDELQPSKEPSGSD  486



>ref|XP_010313492.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010313493.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010313494.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Solanum 
lycopersicum]
Length=474

 Score =   334 bits (856),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 207/449 (46%), Positives = 273/449 (61%), Gaps = 26/449 (6%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEEATGGANAG-GVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTG  1767
             MT +  +NS SVEEA  G N   G PLKKGPW  AEDAIL +YV  +GEGNW++V + TG
Sbjct  1     MTSEVGMNSTSVEEANAGGNIRRGTPLKKGPWLKAEDAILRDYVAEYGEGNWSSVHRRTG  60

Query  1766  LARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIK  1587
             LARCGKSCRLRW+NHLKP LKKGAFT EEE  I+ +HA++GNKWAR+A+E PGRTDN+IK
Sbjct  61    LARCGKSCRLRWSNHLKPYLKKGAFTQEEEQLIVAMHAQIGNKWARIASEFPGRTDNDIK  120

Query  1586  NYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAV  1407
             N+WNTR+KR++R    +  P V      E  QN++++T S+ ++   +LL  N  EIP  
Sbjct  121   NFWNTRLKRQRREEKYMLSPGVFFGEFSEDKQNKELATSSSANSL-PHLLPNNNVEIPTA  179

Query  1406  EFKNLELNQQLHP--------QSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPD  1251
             E +N E +QQL+P         S L  PA+SL  QGLNSS+      ST++ SKR +G +
Sbjct  180   ENRNFEPSQQLYPPRLLNNDFSSFLGTPATSLRDQGLNSSWNTHSVPSTVHSSKRTQGLE  239

Query  1250  SLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAsl  1071
             S F   S+ + D+  A   YQND           S   +      H S +  IPG  A  
Sbjct  240   SWF---SNRNVDLSQAHHQYQNDGSFFTQSLGFSSLCTHNLTSNYHRSSASEIPGIQA--  294

Query  1070  nsnsssLEPAWAKKPELPSLQSQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPR  891
                 SS E     K ELPS Q+ + SWD  +S +PS+ES  T IQSPP E ++S ++SP+
Sbjct  295   ----SSSEHRLKGKLELPSFQTPMTSWD-SASSVPSIESSSTFIQSPPNEYTDSCSLSPQ  349

Query  890   NSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLG  711
             +S LL A+LY SQT K S +   Q+ S       D+V ++ P   + +W    D I+P G
Sbjct  350   SSDLLHAILYGSQTPKASSSNSYQETS------RDVVPDSCPVLRQIQWGTNPDAITPSG  403

Query  710   HSAASVFNEYTPISASSLEEHQSVEMLAG  624
             H+  SVF+EYTP S  SLE+HQS+    G
Sbjct  404   HAITSVFSEYTPSSGGSLEDHQSIAPFIG  432



>ref|XP_010904731.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Elaeis 
guineensis]
Length=513

 Score =   335 bits (859),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 216/446 (48%), Positives = 278/446 (62%), Gaps = 45/446 (10%)
 Frame = -1

Query  1955  SEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQK  1776
             S++ +      +SPS++E + G    G  LKKGPWTSAEDAIL++YV +HGEGNWNAVQK
Sbjct  8     SDNRLVPNDQTDSPSIDEGSSGGR--GQILKKGPWTSAEDAILVDYVKKHGEGNWNAVQK  65

Query  1775  HTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDN  1596
             H+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHA MGNKWARMAA LPGRTDN
Sbjct  66    HSGLFRCGKSCRLRWANHLRPNLKKGAFTQEEEQLIIELHATMGNKWARMAALLPGRTDN  125

Query  1595  EIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEI  1416
             EIKNYWNTRIKRRQRAGLP+YPP++ LQA  E+ Q++  S +STG+ + +++LQ N F+I
Sbjct  126   EIKNYWNTRIKRRQRAGLPLYPPNLGLQASSENQQSQTASEYSTGEKRPNDVLQGNCFDI  185

Query  1415  PAVEFKNLELNQ-QLHPQSPL-DIPASSLLAQGLNSSYGPRPFFSTM-NPSKRLRGPDSL  1245
               +   N   +Q  L   SP  DI  SS+L+QG  S      F + M N +KRLR  +S+
Sbjct  186   DVI-LNNSNADQGALSYASPFPDISVSSMLSQGFGSQ--DNNFMNPMWNSAKRLRESESV  242

Query  1244  FTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslns  1065
                           + P  +   M                          +PGSHA LN 
Sbjct  243   LPDFHG------YLYDPEPSSKIMV--------------------PFDGAVPGSHALLNG  276

Query  1064  nsssLEPAWAK-KPELPSLQ---SQIVSWDspssplpsleSVETLIQSPP-TERSESGNV  900
             N S+  P     K ELPSLQ   + + SW   + P P  + ++T IQSPP T    S  V
Sbjct  277   NFSASRPLGGTVKLELPSLQYPETVLNSW--LACPSPPPDEIDTYIQSPPATVLVRSECV  334

Query  899   SPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPIS  720
             SPRNSGLLEA+L+E+Q  K  ++   +++  ++I   D+V+++  +  E E E Y+DPIS
Sbjct  335   SPRNSGLLEALLHEAQARKIQQS---EESLSSAITQGDMVESSGFNLWEAECEEYNDPIS  391

Query  719   PLGHSAASVFNEYT-PISASSLEEHQ  645
             PLG  AASVF+E T PIS  SL+E Q
Sbjct  392   PLGRPAASVFSECTPPISGGSLDELQ  417



>ref|XP_008792433.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Phoenix 
dactylifera]
Length=582

 Score =   337 bits (864),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 219/456 (48%), Positives = 287/456 (63%), Gaps = 27/456 (6%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVP-LKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             T +S+++M     V+SPS E ++GG   GG   LKKGPWTSAEDAIL++YV +HGEGNWN
Sbjct  33    TDDSDNAMVPMDQVDSPSNEGSSGGLLTGGGQVLKKGPWTSAEDAILVDYVKKHGEGNWN  92

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL+RCGKSCRLRWANHL+P+LKKGAFTPEEE  IIELHA+MGNKWARMAA LPG
Sbjct  93    AVQKHSGLSRCGKSCRLRWANHLRPNLKKGAFTPEEEKLIIELHARMGNKWARMAAHLPG  152

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKRRQRAGLP+Y  +V  QA  E+ Q++  + +  G+ + + LLQ N
Sbjct  153   RTDNEIKNYWNTRIKRRQRAGLPLYTSNVPFQASSENQQSQTATAYGNGEKRPNELLQGN  212

Query  1427  YFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNS-SYGPRPFFSTM-NPSKRLR  1260
              F+ P   F +   N      +P   DI  SS+L+QG  S +YG   F + M N  K+ R
Sbjct  213   SFDFPDAIFDSFNANHGALSYAPPFSDISVSSMLSQGFGSQNYG---FMNPMGNHVKQFR  269

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPS-----LSCV  1095
               ++   G   + +        + N+   ++ +S G         DPD  S         
Sbjct  270   ESETSLPGFHGSVTTGLPPLEQFSNEPSEKIQRSFGLGYP----YDPDPSSKDLAPFGGA  325

Query  1094  IPGSHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplpsleSVETLIQSPP  927
             IPGSHA  N N S+  P     K ELPSLQ     + SW   +   P  E+++  IQSPP
Sbjct  326   IPGSHALSNGNFSASRPLGGTVKMELPSLQYPECDLSSW--LACSSPPPEAIDNYIQSPP  383

Query  926   -TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHET  750
              T   +S  VSPRNSGLL+A+L+E+Q  K   +   +++S + + P  +V+++  +F E 
Sbjct  384   ATASVQSECVSPRNSGLLDALLHEAQARKTQSSG--KRSSSSVVAPGGMVESSGLNFCEA  441

Query  749   EWEGYSDPISPLGHSAASVFNEYT-PISASSLEEHQ  645
              W+ Y+DPISPLG  AASVFNE T P+S  SL+E Q
Sbjct  442   AWKEYNDPISPLGRPAASVFNECTPPVSGGSLDELQ  477



>ref|XP_007133583.1| hypothetical protein PHAVU_011G191300g [Phaseolus vulgaris]
 gb|ESW05577.1| hypothetical protein PHAVU_011G191300g [Phaseolus vulgaris]
Length=554

 Score =   335 bits (858),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 215/433 (50%), Positives = 275/433 (64%), Gaps = 29/433 (7%)
 Frame = -1

Query  1874  VPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGA  1695
             + LKKGPWTS ED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWANHL+P+LKKGA
Sbjct  33    IVLKKGPWTSTEDDILVDYVNKHGEGNWNAVQKHTGLLRCGKSCRLRWANHLRPNLKKGA  92

Query  1694  FTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHL  1515
             FT EEE  I ELHAKMGNKWARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP+V L
Sbjct  93    FTAEEERFIAELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEVCL  152

Query  1514  QAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPLDIPASSL  1335
             Q   ES +N+     + GD  H +LLQ N +EI    F +L+ NQ + P +P   P +S+
Sbjct  153   QGFQESQRNQSNGGLNGGDKMHLDLLQTNSYEIHGAIFDSLKDNQGILPYAP-KFPDASV  211

Query  1334  ---LAQGLNSSYGPRPFFSTMNPS----KRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTC  1176
                + +GL+SS     + S M P+    KRLR     F G +    +    F   +++  
Sbjct  212   YGNMLKGLDSSQ----YCSVMTPASPKHKRLRESTIPFIGSNDTRKNGLYPFSQIRDNNS  267

Query  1175  MQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAW-AKKPELPSLQS--  1005
              +++QS G  +     LDP  PS    +  SH+  N NSS+ +P + A K ELPSLQ   
Sbjct  268   DKIAQSFGMQAL----LDPG-PSSHNSMCYSHSLSNGNSSTSKPTFEAVKLELPSLQYPE  322

Query  1004  -QIVSWDspssplpsleSVETLIQSP-PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN  831
               + SW   S P P LESV+   QSP P    ES   SP+NSGLL+A+LY+++TL  SKN
Sbjct  323   LDLGSW-GTSPPPPLLESVDDFFQSPTPISTLESDCSSPQNSGLLDALLYQAKTLSSSKN  381

Query  830   TLPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPI---SAS  663
                 ++S +S   P D  D++  + +ETEWE Y+DP+SP G  A S+ NE   +   S +
Sbjct  382   HCSDKSSNSSTATPGDRGDSSALNVYETEWEDYADPVSPFG--ATSILNECPALLRASEN  439

Query  662   SLEEHQSVEMLAG  624
             SL+E  S +   G
Sbjct  440   SLDEQLSFQAFTG  452



>ref|XP_008786780.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Phoenix 
dactylifera]
Length=559

 Score =   334 bits (856),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 217/448 (48%), Positives = 283/448 (63%), Gaps = 32/448 (7%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVP--LKKGPWTSAEDAILMEYVTRHGEGNW  1791
             T+ S++ M      +SPS++E + G +  G    LKKGPWTSAEDAIL++YV +HGEGNW
Sbjct  5     TNGSDNRMVPNDQADSPSIDEGSSGGSLTGGGQVLKKGPWTSAEDAILVDYVKKHGEGNW  64

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE+ IIELHA+MGNKWARMAA LP
Sbjct  65    NAVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTLEEENTIIELHARMGNKWARMAAHLP  124

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQV  1431
             GRTDNEIKNYWNTRIKRRQRAGLP+YP DV  QA  ++ Q+   + + TG+ + + +LQ 
Sbjct  125   GRTDNEIKNYWNTRIKRRQRAGLPLYPSDVCHQASSKNQQSRTATEYGTGEKRPNEVLQG  184

Query  1430  NYFEIPAVEFKNLELNQ-QLHPQSPL-DIPASSLLAQGLNSSYGPRPFFSTMNPS----K  1269
             N F +P V F     +Q  L   +P  DI  SS+L+QG  S       +S MNP+    K
Sbjct  185   NSFNLPDVIFDKFNADQGALSYAAPFPDISVSSMLSQGFGSQN-----YSFMNPTWNSVK  239

Query  1268  RLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCV--  1095
             RL   +S+  G     S     F  Y ++   ++ +S G         +P+  S   V  
Sbjct  240   RLPESESVLPGFHGTVSHGLPTFEQYSHEPSEKIQRSFGLDYP----YNPEPSSKIVVPF  295

Query  1094  ---IPGSHAslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQ  936
                +PGSHA LN N S+  P     K ELPSLQ   + + SW   + P P  E+ +T IQ
Sbjct  296   GGAVPGSHALLNGNFSASRPLGGTVKLELPSLQYPETDLSSW--LACPSPPPEATDTYIQ  353

Query  935   SPPTERS-ESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDF  759
             +PP   S +S  VSP NSGLLEA+L+E+Q     KN   +++S + +   D+V+++  + 
Sbjct  354   APPATVSVQSECVSPGNSGLLEALLHEAQA---RKNQPSEKSSSSPVTQGDMVESSGFNL  410

Query  758   HETEWEGYSDPISPLGHSAASVFNEYTP  675
              E EWE Y+DPISPLG  AASVF+E TP
Sbjct  411   CEAEWEEYNDPISPLGRPAASVFSECTP  438



>ref|XP_008786776.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786777.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786778.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786779.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Phoenix 
dactylifera]
Length=562

 Score =   333 bits (855),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 217/448 (48%), Positives = 283/448 (63%), Gaps = 32/448 (7%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVP--LKKGPWTSAEDAILMEYVTRHGEGNW  1791
             T+ S++ M      +SPS++E + G +  G    LKKGPWTSAEDAIL++YV +HGEGNW
Sbjct  5     TNGSDNRMVPNDQADSPSIDEGSSGGSLTGGGQVLKKGPWTSAEDAILVDYVKKHGEGNW  64

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE+ IIELHA+MGNKWARMAA LP
Sbjct  65    NAVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTLEEENTIIELHARMGNKWARMAAHLP  124

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQV  1431
             GRTDNEIKNYWNTRIKRRQRAGLP+YP DV  QA  ++ Q+   + + TG+ + + +LQ 
Sbjct  125   GRTDNEIKNYWNTRIKRRQRAGLPLYPSDVCHQASSKNQQSRTATEYGTGEKRPNEVLQG  184

Query  1430  NYFEIPAVEFKNLELNQ-QLHPQSPL-DIPASSLLAQGLNSSYGPRPFFSTMNPS----K  1269
             N F +P V F     +Q  L   +P  DI  SS+L+QG  S       +S MNP+    K
Sbjct  185   NSFNLPDVIFDKFNADQGALSYAAPFPDISVSSMLSQGFGSQN-----YSFMNPTWNSVK  239

Query  1268  RLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCV--  1095
             RL   +S+  G     S     F  Y ++   ++ +S G         +P+  S   V  
Sbjct  240   RLPESESVLPGFHGTVSHGLPTFEQYSHEPSEKIQRSFGLDYP----YNPEPSSKIVVPF  295

Query  1094  ---IPGSHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplpsleSVETLIQ  936
                +PGSHA LN N S+  P     K ELPSLQ   + + SW   + P P  E+ +T IQ
Sbjct  296   GGAVPGSHALLNGNFSASRPLGGTVKLELPSLQYPETDLSSW--LACPSPPPEATDTYIQ  353

Query  935   SPPTERS-ESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDF  759
             +PP   S +S  VSP NSGLLEA+L+E+Q     KN   +++S + +   D+V+++  + 
Sbjct  354   APPATVSVQSECVSPGNSGLLEALLHEAQA---RKNQPSEKSSSSPVTQGDMVESSGFNL  410

Query  758   HETEWEGYSDPISPLGHSAASVFNEYTP  675
              E EWE Y+DPISPLG  AASVF+E TP
Sbjct  411   CEAEWEEYNDPISPLGRPAASVFSECTP  438



>gb|AEH05966.1| GAMYB2 protein [Glycine max]
Length=530

 Score =   330 bits (845),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 212/438 (48%), Positives = 271/438 (62%), Gaps = 20/438 (5%)
 Frame = -1

Query  1907  EEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWA  1728
             E   GGA   G+ LKKGPWTS ED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWA
Sbjct  22    ESYEGGA---GIVLKKGPWTSTEDDILVDYVKKHGEGNWNAVQKHTGLLRCGKSCRLRWA  78

Query  1727  NHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRA  1548
             NHL+P+LKKGAFT EEE  I ELHAKMGNKWARMAA LPGRTDNEIKNYWNTRIKR QRA
Sbjct  79    NHLRPNLKKGAFTAEEERVIAELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRCQRA  138

Query  1547  GLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHP  1368
             GLP+YPP+V LQA+ ES  ++     + G+  H + LQ N FEI    F +L+ NQ + P
Sbjct  139   GLPLYPPEVSLQALQESQHSQSSGGLNGGEKMHPDFLQKNSFEIHDGIFDSLKDNQGILP  198

Query  1367  --QSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGP  1194
                   DI     + +GL+SS        T+   KRL+     F            +F  
Sbjct  199   YVHELSDISVYGNMLKGLDSSQYCSFVPPTLPKCKRLKESTIPFIDSCDMKKYDLYSFDQ  258

Query  1193  YQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPS  1014
              +++   +++QS G  +     LDP  PS    +  SH+  N NSS+ +P  A K ELPS
Sbjct  259   IRDNNSNKIAQSFGMQAP----LDPG-PSSHSSMCYSHSLSNGNSSTSKPYEAVKLELPS  313

Query  1013  LQS---QIVSWDspssplpsleSVETLIQSP-PTERSESGNVSPRNSGLLEAVLYESQTL  846
             LQ     + SW   S P   LESV+  +QSP P    ES   SP+NSGLL+A+LY+++T+
Sbjct  314   LQYPELDLGSW-GSSPPPSLLESVDDFLQSPTPISTLESDCSSPQNSGLLDALLYQAKTM  372

Query  845   KHSKNTLPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPIS  669
               SKN    ++S +S   P D  D++  + +ETEWE Y+DP+SP G  A S+ NE T + 
Sbjct  373   SSSKNHCSDKSSNSSTATPGDRADSSALNVYETEWEDYADPVSPFG--ATSILNECTGLR  430

Query  668   A--SSLEEHQSVEMLAGE  621
             A  +SL E   V+ + G+
Sbjct  431   ANMNSLNEQLPVQTITGD  448



>ref|XP_006598058.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Glycine 
max]
 ref|XP_006598059.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Glycine 
max]
 ref|XP_006598060.1| PREDICTED: transcription factor GAMYB-like isoform X3 [Glycine 
max]
 ref|XP_006598061.1| PREDICTED: transcription factor GAMYB-like isoform X4 [Glycine 
max]
 ref|XP_006598062.1| PREDICTED: transcription factor GAMYB-like isoform X5 [Glycine 
max]
 gb|KHN23482.1| Transcription factor GAMYB [Glycine soja]
Length=533

 Score =   329 bits (844),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 212/438 (48%), Positives = 271/438 (62%), Gaps = 20/438 (5%)
 Frame = -1

Query  1907  EEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWA  1728
             E   GGA   G+ LKKGPWTS ED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWA
Sbjct  25    ESYEGGA---GIVLKKGPWTSTEDDILVDYVKKHGEGNWNAVQKHTGLLRCGKSCRLRWA  81

Query  1727  NHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRA  1548
             NHL+P+LKKGAFT EEE  I ELHAKMGNKWARMAA LPGRTDNEIKNYWNTRIKR QRA
Sbjct  82    NHLRPNLKKGAFTAEEERVIAELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRCQRA  141

Query  1547  GLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHP  1368
             GLP+YPP+V LQA+ ES  ++     + G+  H + LQ N FEI    F +L+ NQ + P
Sbjct  142   GLPLYPPEVSLQALQESQHSQSSGGLNGGEKMHPDFLQKNSFEIHDGIFDSLKDNQGILP  201

Query  1367  --QSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGP  1194
                   DI     + +GL+SS        T+   KRL+     F            +F  
Sbjct  202   YVHELSDISVYGNMLKGLDSSQYCSFVPPTLPKCKRLKESTIPFIDSCDMKKYDLYSFDQ  261

Query  1193  YQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPS  1014
              +++   +++QS G  +     LDP  PS    +  SH+  N NSS+ +P  A K ELPS
Sbjct  262   IRDNNSNKIAQSFGMQAP----LDPG-PSSHSSMCYSHSLSNGNSSTSKPYEAVKLELPS  316

Query  1013  LQS---QIVSWDspssplpsleSVETLIQSP-PTERSESGNVSPRNSGLLEAVLYESQTL  846
             LQ     + SW   S P   LESV+  +QSP P    ES   SP+NSGLL+A+LY+++T+
Sbjct  317   LQYPELDLGSW-GSSPPPSLLESVDDFLQSPTPISTLESDCSSPQNSGLLDALLYQAKTM  375

Query  845   KHSKNTLPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPIS  669
               SKN    ++S +S   P D  D++  + +ETEWE Y+DP+SP G  A S+ NE T + 
Sbjct  376   SSSKNHCSDKSSNSSTATPGDRADSSALNVYETEWEDYADPVSPFG--ATSILNECTGLR  433

Query  668   A--SSLEEHQSVEMLAGE  621
             A  +SL E   V+ + G+
Sbjct  434   ANMNSLNEQLPVQTITGD  451



>ref|XP_006853124.1| hypothetical protein AMTR_s00038p00150140 [Amborella trichopoda]
 gb|ERN14591.1| hypothetical protein AMTR_s00038p00150140 [Amborella trichopoda]
Length=574

 Score =   328 bits (841),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 217/464 (47%), Positives = 278/464 (60%), Gaps = 33/464 (7%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGL  1764
             M LK   +SPS++E+ G  + GG  LKKGPWTSAEDA+L+EYV +HGEGNWNAVQKH+GL
Sbjct  1     MGLKDRSSSPSLDESGGCGSGGGGVLKKGPWTSAEDAVLIEYVKKHGEGNWNAVQKHSGL  60

Query  1763  ARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKN  1584
             +RCGKSCRLRWANHL+P+LKKGAFT +EE  IIELHAK+GNKWARMA++LPGRTDNEIKN
Sbjct  61    SRCGKSCRLRWANHLRPNLKKGAFTADEERLIIELHAKIGNKWARMASQLPGRTDNEIKN  120

Query  1583  YWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVE  1404
             YWNTRIKRRQRAGLP+YPPD+HLQA  E  Q+E++  F+  +  HS+ LQ N  + P V 
Sbjct  121   YWNTRIKRRQRAGLPLYPPDLHLQATGEGQQSENIGEFTLNENHHSDFLQSNKLDFPHVS  180

Query  1403  FKNLELNQQ---LHPQSPL-DIPASSLLAQGLNSSYGPRPFF--STMNPSKRLRGPDSLF  1242
             F+ L+ N +   L    P  + P   +L + L       PF   S ++P KRLRG +S  
Sbjct  181   FEALKPNPETLTLPFVPPFSEAPNGGILTRSLGPHQAYTPFIPPSLVHPPKRLRGGESSL  240

Query  1241  TGLSSNDSDIFTAFGPYQNDTCM--QVsqssgfssgyyQNL-----DPD-----HPSLSC  1098
                  N     +    +Q++     Q    +        +L     DPD     +  L  
Sbjct  241   LSTFPNGIIPMSPLNQFQSENYRKNQFHVETNEKFHRPFSLGHHPFDPDPIEKNNALLGS  300

Query  1097  VIPGSHAslnsnsssLEP-AWAKKPELPSLQSQIVS----WDspssplpsleSVETLIQS  933
             V+ GSHA LN   S+ +P   A K ELPSLQ Q +S    W    S  P++E+VE+ IQS
Sbjct  301   VVTGSHALLNGTFSTSKPLCGAVKMELPSLQYQDLSDLKGWGVCPSGPPNIEAVESYIQS  360

Query  932   PPTERSESGN--VSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDF  759
             PP+    + N   SPR+SGLL+A+L+ES  L  S +  P  +      P           
Sbjct  361   PPSMAPPTQNECFSPRSSGLLDALLHESHALGSSASKSPASSEVVGPPPRASSVGPIAGL  420

Query  758   HE-------TEWEGYSDPISPLGHSAASVFNEYT-PISASSLEE  651
              E        EW G+ DPISPLG SAA   +E T P+S +SL E
Sbjct  421   SEHRRVNTCEEWGGFRDPISPLGQSAAICLSESTPPLSTTSLLE  464



>ref|XP_009387062.1| PREDICTED: transcription factor GAMYB-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009387063.1| PREDICTED: transcription factor GAMYB-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009387064.1| PREDICTED: transcription factor GAMYB-like [Musa acuminata subsp. 
malaccensis]
Length=557

 Score =   325 bits (834),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 210/460 (46%), Positives = 269/460 (58%), Gaps = 34/460 (7%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEE--ATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             S+ ++S+  M  K  ++SPS+EE  ++G  N G   LKKGPWTSAEDAIL++YV +HGEG
Sbjct  3     SLPNDSDKRMIPKDQIDSPSIEEGNSSGSLNGGNQVLKKGPWTSAEDAILVDYVKKHGEG  62

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKHTGL+RCGKSCRLRWANHL+P+LKKGAFTPEEE  IIELHAKMGNKWARMAA 
Sbjct  63    NWNAVQKHTGLSRCGKSCRLRWANHLRPNLKKGAFTPEEEQLIIELHAKMGNKWARMAAY  122

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++  Q   E+ Q+   S +S  + Q    L
Sbjct  123   LPGRTDNEIKNYWNTRIKRRQRAGLPLYPPNICYQVSCENQQSNHSSDYSYNEKQPDEFL  182

Query  1436  QVNYFEIPAVEFKNLELNQQLH--PQSPLDIPASSLLAQ--GLNSSYGPRPFFSTMNPSK  1269
             Q    +IP + F N   N  L   P  P DI  SS+L+   G  +   P P    +    
Sbjct  183   QGGNLDIPDIVFDNYTNNGSLSYAPSFP-DIAVSSILSHRFGFQNYALPNPPVCCVERPV  241

Query  1268  RLR-----GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSL  1104
                        ++  G    D+ IF   G  Q    +                DPD  S 
Sbjct  242   ETEHVVPASNGTVNGGCPRLDNVIFEPSGKMQESFGLSCL------------YDPDSSSD  289

Query  1103  SC-----VIPGSHAslnsnsssLE--PAWAKKPELPSLQ-SQIVSWDspssplpsleSVE  948
             S       IPGS ASLN   S+    P    K ELPSLQ ++  S    +      + V 
Sbjct  290   SLAHHGGAIPGSCASLNDTFSASSLIPG-TLKLELPSLQYTETDSNSWLACSSTPFDLVN  348

Query  947   TLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTF  768
             T ++SPPT   ++  VSPR SGLLEA+L+E+  L  +K    ++ S + I P+++ D   
Sbjct  349   TYVKSPPTASLQTDCVSPRKSGLLEALLHEAHVLSSAKKEPSEKISISFITPAELADGPK  408

Query  767   PDFHETEWEGYSDPISPLGHSAASVFNEYTP-ISASSLEE  651
                ++ +   + DP+SPLG SAA VFN+ TP IS + L+E
Sbjct  409   LSINDLKLVEHKDPVSPLGRSAAFVFNDGTPLISGNLLDE  448



>gb|ACA29539.1| GAMYB protein [Glycine max]
 gb|AEH05965.1| GAMYB1 protein [Glycine max]
Length=536

 Score =   322 bits (826),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 210/437 (48%), Positives = 266/437 (61%), Gaps = 20/437 (5%)
 Frame = -1

Query  1907  EEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWA  1728
             E   GGA   G+ LKKGPWTS ED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWA
Sbjct  25    ENYEGGA---GIVLKKGPWTSTEDDILVDYVKKHGEGNWNAVQKHTGLLRCGKSCRLRWA  81

Query  1727  NHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRA  1548
             NHL+P+LKKGAF  EEE    ELHAKMGNKWARMAA LPGRTDNEIKNYWNTRIKRRQRA
Sbjct  82    NHLRPNLKKGAFAAEEERLTAELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRRQRA  141

Query  1547  GLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHP  1368
             GLP+YPP+V LQA+ ES  ++     + GD  H + LQ N +EI    F +L+ NQ + P
Sbjct  142   GLPLYPPEVSLQALQESQHSQSTGGLNGGDKMHPDFLQKNSYEIHDAIFDSLKDNQGILP  201

Query  1367  --QSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGP  1194
                   DI       +GL+SS        T    KRL+     F    +        F  
Sbjct  202   YVHELSDISVYGNKLKGLDSSQYCSFVPPTSPKRKRLKESTIPFIDSCAMKKKDLYPFDQ  261

Query  1193  YQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPS  1014
              Q++   +++QS G  +     LDP   S S +   SH+  N NSS+ +P  A K ELPS
Sbjct  262   IQDNNSDKIAQSFGMQAP----LDPGLSSHSSMC-YSHSLSNGNSSTSKPYEAMKLELPS  316

Query  1013  LQS---QIVSWDspssplpsleSVETLIQSPPTERS-ESGNVSPRNSGLLEAVLYESQTL  846
             LQ     + SW   S P   LESV+  +QSP    + ES   SP+NSGLL+A+LY+++T+
Sbjct  317   LQYPELDLGSW-GSSPPPSLLESVDDFLQSPTAISTLESDCSSPQNSGLLDALLYQAKTM  375

Query  845   KHSKNTLPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPI-  672
               SKN    ++S +S   P D  D++  + +ETEWE Y+DP+SP G  A S+ NE   + 
Sbjct  376   SSSKNHCSDKSSNSSTATPGDRADSSILNVYETEWEDYADPVSPFG--ATSILNECPALR  433

Query  671   -SASSLEEHQSVEMLAG  624
              +A+SL     V+ L G
Sbjct  434   ANANSLNGQLPVQTLTG  450



>gb|AHB19228.1| GAMBY1-like family protein [Glycine max]
Length=536

 Score =   321 bits (823),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 206/429 (48%), Positives = 263/429 (61%), Gaps = 17/429 (4%)
 Frame = -1

Query  1883  AGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLK  1704
             + G+ LKKGPWTS ED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWANHL+P+LK
Sbjct  30    SAGIVLKKGPWTSTEDDILVDYVKKHGEGNWNAVQKHTGLFRCGKSCRLRWANHLRPNLK  89

Query  1703  KGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPD  1524
             KGAF  EEE    ELHAKMGNKWARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP+
Sbjct  90    KGAFAAEEERLTAELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPE  149

Query  1523  VHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHP--QSPLDI  1350
             V LQA+ ES  ++     + GD  H + LQ N +EI    F +L+ NQ + P      DI
Sbjct  150   VSLQALQESQHSQSTGGLNGGDKMHPDFLQKNSYEIHDAIFDSLKDNQGILPYVHELSDI  209

Query  1349  PASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQ  1170
                    +GL+SS        T    KRL+     F    +        F   Q++   +
Sbjct  210   SVYGNKLKGLDSSQYCSFVPPTSPKRKRLKESTIPFIDSCAMKKKDLYPFDQIQDNNSDK  269

Query  1169  VsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQS---QI  999
             ++QS G  +     LDP   S S +   SH+  N NSS+ +P  A K ELPSLQ     +
Sbjct  270   IAQSFGMQAP----LDPGLSSHSSMC-YSHSLSNGNSSTSKPYEAMKLELPSLQYPELDL  324

Query  998   VSWDspssplpsleSVETLIQSPPTERS-ESGNVSPRNSGLLEAVLYESQTLKHSKNTLP  822
              SW   S P   LESV+  +QSP    + ES   SP+NSGLL+A+LY+++T+  SKN   
Sbjct  325   GSW-GSSPPPSLLESVDDFLQSPTAISTLESDCSSPQNSGLLDALLYQAKTMSSSKNHCS  383

Query  821   QQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPI--SASSLEE  651
              ++S +S   P D  D++  + +ETEWE Y+DP+SP G  A S+ NE   +  +A+SL  
Sbjct  384   DKSSNSSTATPGDRADSSILNVYETEWEDYADPVSPFG--ATSILNECPALRANANSLNG  441

Query  650   HQSVEMLAG  624
                V+ L G
Sbjct  442   QLPVQTLTG  450



>ref|XP_006594349.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Glycine 
max]
 ref|XP_006594350.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Glycine 
max]
 ref|XP_006594351.1| PREDICTED: transcription factor GAMYB-like isoform X3 [Glycine 
max]
 ref|XP_006594352.1| PREDICTED: transcription factor GAMYB-like isoform X4 [Glycine 
max]
Length=536

 Score =   320 bits (819),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 205/429 (48%), Positives = 262/429 (61%), Gaps = 17/429 (4%)
 Frame = -1

Query  1883  AGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLK  1704
             + G+ LKKGPWTS ED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWANHL+P+LK
Sbjct  30    SAGIVLKKGPWTSTEDDILVDYVKKHGEGNWNAVQKHTGLFRCGKSCRLRWANHLRPNLK  89

Query  1703  KGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPD  1524
             KGAF  EEE  I ELHAKMGNKWARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP+
Sbjct  90    KGAFAAEEERLIAELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPE  149

Query  1523  VHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHP--QSPLDI  1350
             V L A+ ES  ++     + GD  H + LQ N +EI    F +L+ NQ + P      DI
Sbjct  150   VSLHALQESQHSQSTGGLNGGDKMHPDFLQKNSYEIHDAIFDSLKDNQGILPYVHELSDI  209

Query  1349  PASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQ  1170
                    +GL+SS        T    KRL+     F    +        F   Q++   +
Sbjct  210   SVYGNKLKGLDSSQYCSFVPPTSPKRKRLKESTIPFIDSCAMKKKDLYPFDQIQDNNSDK  269

Query  1169  VsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQS---QI  999
             ++QS G  +     LDP   S S +   SH+  N NSS+ +P  A K ELPSLQ     +
Sbjct  270   IAQSFGMQAP----LDPGLSSHSSMC-YSHSLSNGNSSTSKPYEAMKLELPSLQYPELDL  324

Query  998   VSWDspssplpsleSVETLIQSPPTERS-ESGNVSPRNSGLLEAVLYESQTLKHSKNTLP  822
              SW   S P   LESV+  +QSP    + ES   SP+NSGLL+A+LY+++T+  SKN   
Sbjct  325   GSW-GSSPPPSLLESVDDFLQSPTAISTLESDCSSPQNSGLLDALLYQAKTMSSSKNHCS  383

Query  821   QQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPI--SASSLEE  651
              ++S +S   P D  D++  + +ETEWE Y+DP+SP G  A S+ NE   +  +A+SL  
Sbjct  384   DKSSNSSTATPGDRADSSILNVYETEWEDYADPVSPFG--ATSILNECPALRANANSLNG  441

Query  650   HQSVEMLAG  624
                V+   G
Sbjct  442   QLPVQTFTG  450



>gb|AHB19229.1| GAMYB1-like family protein [Glycine max]
Length=534

 Score =   319 bits (818),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 201/415 (48%), Positives = 257/415 (62%), Gaps = 15/415 (4%)
 Frame = -1

Query  1883  AGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLK  1704
             + G+ LKKGPWTS ED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWANHL+P+LK
Sbjct  30    SAGIVLKKGPWTSTEDDILVDYVKKHGEGNWNAVQKHTGLFRCGKSCRLRWANHLRPNLK  89

Query  1703  KGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPD  1524
             KGAF  EEE  I ELHAKMGNKWARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP+
Sbjct  90    KGAFAAEEERLIAELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPE  149

Query  1523  VHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHP--QSPLDI  1350
             V L A+ ES  ++     + GD  H + LQ N +EI    F +L+ NQ + P      DI
Sbjct  150   VSLHALQESQHSQSTGGLNGGDKMHPDFLQKNSYEIHDAIFDSLKDNQGILPYVHELSDI  209

Query  1349  PASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQ  1170
                    +GL+SS        T    KRL+     F    +        F   Q++   +
Sbjct  210   SVYGNKLKGLDSSQYCSFVPPTSPKRKRLKESTIPFIDSCAMKKKDLYPFDQIQDNNSDK  269

Query  1169  VsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQS---QI  999
             ++QS G  +     LDP   S S +   SH+  N NSS+ +P  A K ELPSLQ     +
Sbjct  270   IAQSFGMQAP----LDPGLSSHSSMC-YSHSLSNGNSSTSKPYEAMKLELPSLQYPELDL  324

Query  998   VSWDspssplpsleSVETLIQSPPTERS-ESGNVSPRNSGLLEAVLYESQTLKHSKNTLP  822
              SW   S P   LESV+  +QSP    + ES   SP+NSGLL+A+LY+++T+  SKN   
Sbjct  325   GSW-GSSPPPSLLESVDDFLQSPTAISTLESDCSSPQNSGLLDALLYQAKTMSSSKNHCS  383

Query  821   QQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASS  660
              ++S +S   P D  D++  + +ETEWE Y+DP+SP G  A S+ NE   + A++
Sbjct  384   DKSSNSSTATPGDRADSSILNVYETEWEDYADPVSPFG--ATSILNECPALRANA  436



>gb|AGN52104.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52214.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=526

 Score =   318 bits (816),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 212/461 (46%), Positives = 273/461 (59%), Gaps = 28/461 (6%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEAT--GGANAGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             S T+ESED +    + +SP   +    GG++ GGV LKKGPWTSAEDAIL+EYV +HGEG
Sbjct  4     SSTAESEDGVL---SADSPLSNDGDNFGGSSNGGVVLKKGPWTSAEDAILVEYVKKHGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKHTGLARCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA 
Sbjct  61    NWNAVQKHTGLARCGKSCRLRWANHLRPNLKKGAFTSEEERLIIELHAKMGNKWARMAAH  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YP D+ LQ++ E NQ         GD   +++L
Sbjct  121   LPGRTDNEIKNYWNTRIKRRQRAGLPLYPSDLCLQSLPE-NQQLSSPRIYGGDKACNDIL  179

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSPLDIPASSLLAQGLNS--SYGPRPFFSTMNPSKRL  1263
             Q N +  P + F +  +     P+ P  IP S  +     S  SYG  P   T+    R 
Sbjct  180   QNNGYRAPDIMFDSYNI-LTFAPEVP-GIPGSVSMGNSFASPHSYGFVP--QTIGVPDRA  235

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPS--LSCVI-  1092
             R PD   +   S   +    F   + D+C+     S  S G     DPDH    LS  + 
Sbjct  236   REPDEPMSDYGSGGVNEAPTFNRTRTDSCVN---KSFQSFGLCFPYDPDHTKKLLSSGVN  292

Query  1091  -PGSHAslnsnsssLEPAWAKKPELPSLQSQ---IVSWDspssplpsleSVETLIQSPPT  924
                   S  + S+S   A A+K ELPSLQ Q   +  WD      P  ES ++L+QSP +
Sbjct  293   QDTPFMSDVTFSASEHFADAQKSELPSLQYQETGLGVWD------PPPESFDSLVQSPLS  346

Query  923   ERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEW  744
                 S   SP +SGLLE ++YE++ L   +N      + +++   ++ D +      TE+
Sbjct  347   GPLPSHCPSPGSSGLLEDLIYEAKALGKLENQSSAWATSSNVSHGEVTDGSAFRTCSTEF  406

Query  743   EGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAGE  621
             +GY DP SP G+S  S+FN YTP +  SLE+  ++  +  E
Sbjct  407   KGYIDPNSPSGNSMGSLFNRYTPTTGRSLEDDVTMHHVKSE  447



>gb|KHN10328.1| Transcription factor GAMYB [Glycine soja]
Length=536

 Score =   318 bits (816),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 208/434 (48%), Positives = 270/434 (62%), Gaps = 27/434 (6%)
 Frame = -1

Query  1883  AGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLK  1704
             + G+ LKKGPWTS ED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWANHL+P+LK
Sbjct  30    SAGIVLKKGPWTSTEDDILVDYVKKHGEGNWNAVQKHTGLFRCGKSCRLRWANHLRPNLK  89

Query  1703  KGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPD  1524
             KG F  EEE  I ELHAKMGNKWARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP+
Sbjct  90    KGPFAAEEERLIAELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPE  149

Query  1523  VHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHP--QSPLDI  1350
             V L A+ ES  ++     + GD  H + LQ N +EI    F +L+ NQ + P      DI
Sbjct  150   VSLHALQESQHSQSTGGLNGGDKMHPDFLQKNSYEIHDAIFDSLKDNQGILPYVHELSDI  209

Query  1349  PASSLLAQGLNSSYGPRPFFSTMNPS--KRLRGPDSLFTGLSS---NDSDIFTAFGPYQN  1185
                    +GL+SS     + S + P+  KR R  +S    + S   N  D++  F   Q+
Sbjct  210   SVYGNKLKGLDSSQ----YCSFVPPTSPKRKRLKESTIPFIDSCAMNKKDLY-PFDQIQD  264

Query  1184  DTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQS  1005
             +   +++QS G  +     LDP   S S +   SH+  N NSS+ +P  A K ELPSLQ 
Sbjct  265   NNSDKIAQSFGMQAP----LDPGLSSHSSMC-YSHSLSNGNSSTSKPYEAMKLELPSLQY  319

Query  1004  ---QIVSWDspssplpsleSVETLIQSPPTERS-ESGNVSPRNSGLLEAVLYESQTLKHS  837
                 + SW   S P   LESV+  +QSP    + ES   SP+NSGLL+A+LY+++T+  S
Sbjct  320   PELDLGSW-GSSPPPSLLESVDDFLQSPTAISTLESDCSSPQNSGLLDALLYQAKTMSSS  378

Query  836   KNTLPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPI--SA  666
             KN    ++S +S   P D  D++  + +ETEWE Y+DP+SP G  A S+ NE   +  +A
Sbjct  379   KNHCSDKSSNSSTATPGDRADSSILNVYETEWEDYADPVSPFG--ATSILNECPALRANA  436

Query  665   SSLEEHQSVEMLAG  624
             +SL     V+   G
Sbjct  437   NSLNGQLPVQTFTG  450



>gb|KEH32923.1| myb transcription factor [Medicago truncatula]
Length=520

 Score =   314 bits (805),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 199/445 (45%), Positives = 263/445 (59%), Gaps = 29/445 (7%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             + +E ED M       S S  E  GG+  GGV LKKGPWTSAEDAIL++YV +HGEGNWN
Sbjct  4     VKNEIEDDMLCNDQTRSRSNGEVNGGSVNGGVVLKKGPWTSAEDAILVDYVRKHGEGNWN  63

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQKH+GL+RCGKSCRLRWANHL+P+LKKG+FT +EEH I +LH++MGN+WARMAA LPG
Sbjct  64    AVQKHSGLSRCGKSCRLRWANHLRPNLKKGSFTADEEHLIAQLHSEMGNRWARMAAHLPG  123

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTR KRR RAGLPIYPP+V L+AI  S   +     + GD  H + L  N
Sbjct  124   RTDNEIKNYWNTRTKRRTRAGLPIYPPEVRLRAIKGSKHGQSTGGINDGDRGHHDFLPKN  183

Query  1427  YFEIPAVEFKNLELNQQLHPQSPL----DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
              +E+    F NL+ NQ + P + L    DI A+S++   L+S     P  STM+      
Sbjct  184   NYEMHDAIFDNLKENQGILPITILPENPDISANSIMRNSLDSPPYCNPLPSTMS------  237

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSH  1080
                  F G S  + + F  F   Q+ +  +  QS    S     LDP  PS + +     
Sbjct  238   -----FLGSSGMNKNWFYPFYHVQDHSSDKTLQSFELHSP----LDPGLPSHNSMYYRHS  288

Query  1079  AslnsnsssLEPAWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSP-PTERSE  912
              S  ++S+S   + A K ELPSLQ   +    W     P P  ESV+   QSP P    E
Sbjct  289   VSNGNSSTSKPTSKAVKLELPSLQYPETGFGGWGGNFPPSPLNESVDVFNQSPLPHCAQE  348

Query  911   SGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGAS-IIPSDIVDNTFPDFHETEWEGY  735
             SG  SP NSG LEA++Y+ +TL +S N    ++S +S   P D  +++  + +ETEW+ Y
Sbjct  349   SGCSSPNNSGTLEAIIYQKKTLPNSNNNCSDKSSHSSTTTPVDGGESSALNMNETEWDDY  408

Query  734   SDPISPLGHSAASVFNEYTPISASS  660
             + P       A S+ NE   ++ ++
Sbjct  409   ASPF-----GATSILNECHAVNTNT  428



>ref|XP_003526354.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Glycine 
max]
Length=510

 Score =   308 bits (790),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 208/435 (48%), Positives = 275/435 (63%), Gaps = 21/435 (5%)
 Frame = -1

Query  1889  ANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPD  1710
              N  GV LKKGPWT+AEDA+L+ YV +HGEGNWNAVQ ++GL+RCGKSCRLRWANHL+P+
Sbjct  26    GNGVGVVLKKGPWTAAEDALLVNYVQKHGEGNWNAVQNYSGLSRCGKSCRLRWANHLRPN  85

Query  1709  LKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYP  1530
             LKKGAFT EEE  I ELHAKMGNKWARMAA LPGRTDNEIKNYWNTR+KRR+RAGLP+YP
Sbjct  86    LKKGAFTAEEERMIAELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRMKRRRRAGLPLYP  145

Query  1529  PDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPLDI  1350
             P+V LQA  E    +     S GD  H + L+ N +EI    F +L+ NQ + P  P D+
Sbjct  146   PEVLLQAFQERKHGQGTGEISDGDGGHRDFLKKNNYEIHDAIFDSLKENQGILPFLP-DL  204

Query  1349  P---ASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDT  1179
             P   A+S L  GL S        ST+     L+     F G S  +S+ F  F   +++T
Sbjct  205   PAISANSFLPNGLGSPPYCNLLPSTLPNHDHLQESTMSFIGSSELNSNRFYPFDHIKDNT  264

Query  1178  CMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEP-AWAKKPELPSLQ--  1008
               ++S+S G  S   + +   H S+ C    SH+  N NSS+ +P + A K ELPSLQ  
Sbjct  265   SDKISESFGLYSPLDRGV--SHGSI-CY---SHSLSNGNSSTSKPTSEAVKSELPSLQIP  318

Query  1007  -SQIVSWDspssplpsleSVETLIQSP-PTERSESGNVSPRNSGLLEAVLYESQTLKHSK  834
              ++  SW   S P P  ES++  I SP P    +SG+ SP NSGLL+A+LY++ TL  SK
Sbjct  319   ETEFGSW-GTSPPPPLNESLDVFIHSPQPPNALDSGSSSPLNSGLLDALLYQANTLGCSK  377

Query  833   NTLPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPIS--AS  663
             N    ++S +SI  P D  + +  + +ETEWE Y+DP+SP G  A S+ NE+  +S   +
Sbjct  378   NNSSDKSSNSSIATPGDRAECSALNMYETEWEDYADPLSPFG--ATSILNEHPVVSTNGN  435

Query  662   SLEEHQSVEMLAGED  618
             S +E +  +  +G +
Sbjct  436   SWDEWELFQTFSGNN  450



>ref|XP_006582387.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Glycine 
max]
Length=514

 Score =   308 bits (788),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 205/418 (49%), Positives = 267/418 (64%), Gaps = 19/418 (5%)
 Frame = -1

Query  1889  ANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPD  1710
              N  GV LKKGPWT+AEDA+L+ YV +HGEGNWNAVQ ++GL+RCGKSCRLRWANHL+P+
Sbjct  26    GNGVGVVLKKGPWTAAEDALLVNYVQKHGEGNWNAVQNYSGLSRCGKSCRLRWANHLRPN  85

Query  1709  LKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYP  1530
             LKKGAFT EEE  I ELHAKMGNKWARMAA LPGRTDNEIKNYWNTR+KRR+RAGLP+YP
Sbjct  86    LKKGAFTAEEERMIAELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRMKRRRRAGLPLYP  145

Query  1529  PDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPLDI  1350
             P+V LQA  E    +     S GD  H + L+ N +EI    F +L+ NQ + P  P D+
Sbjct  146   PEVLLQAFQERKHGQGTGEISDGDGGHRDFLKKNNYEIHDAIFDSLKENQGILPFLP-DL  204

Query  1349  P---ASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDT  1179
             P   A+S L  GL S        ST+     L+     F G S  +S+ F  F   +++T
Sbjct  205   PAISANSFLPNGLGSPPYCNLLPSTLPNHDHLQESTMSFIGSSELNSNRFYPFDHIKDNT  264

Query  1178  CMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEP-AWAKKPELPSLQ--  1008
               ++S+S G  S   + +   H S+ C    SH+  N NSS+ +P + A K ELPSLQ  
Sbjct  265   SDKISESFGLYSPLDRGV--SHGSI-CY---SHSLSNGNSSTSKPTSEAVKSELPSLQIP  318

Query  1007  -SQIVSWDspssplpsleSVETLIQSP-PTERSESGNVSPRNSGLLEAVLYESQTLKHSK  834
              ++  SW   S P P  ES++  I SP P    +SG+ SP NSGLL+A+LY++ TL  SK
Sbjct  319   ETEFGSW-GTSPPPPLNESLDVFIHSPQPPNALDSGSSSPLNSGLLDALLYQANTLGCSK  377

Query  833   NTLPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISAS  663
             N    ++S +SI  P D  + +  + +ETEWE Y+DP+SP G  A S+ NE+  +S +
Sbjct  378   NNSSDKSSNSSIATPGDRAECSALNMYETEWEDYADPLSPFG--ATSILNEHPVVSTN  433



>gb|AGZ16401.1| MYB16, partial [Scutellaria baicalensis]
Length=197

 Score =   296 bits (757),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 167/198 (84%), Gaps = 3/198 (2%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             MS TSESE S   K +++SP+ ++A  G N G   LKKGPWT +ED IL+EYVT+HGEGN
Sbjct  1     MSATSESEMS---KNDLDSPTSDDANSGGNIGESNLKKGPWTLSEDEILVEYVTKHGEGN  57

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKHTGLARCGKSCRLRWANHL+PDLKKGAF+PEEE  IIELHA+MGNKWARMAAEL
Sbjct  58    WNAVQKHTGLARCGKSCRLRWANHLRPDLKKGAFSPEEEPLIIELHARMGNKWARMAAEL  117

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKN+WNTRIKRRQRAGLP+YPPD++L+A++E+ Q E+ +TF + + Q S ++ 
Sbjct  118   PGRTDNEIKNFWNTRIKRRQRAGLPVYPPDIYLKALNENLQMEETNTFLSAEVQCSGMMP  177

Query  1433  VNYFEIPAVEFKNLELNQ  1380
             V+ FEIPAVEFK L +N 
Sbjct  178   VDKFEIPAVEFKTLNMNH  195



>gb|KHN26421.1| Transcription factor GAMYB [Glycine soja]
Length=514

 Score =   306 bits (784),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 204/418 (49%), Positives = 266/418 (64%), Gaps = 19/418 (5%)
 Frame = -1

Query  1889  ANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPD  1710
              N  GV LKKGPWT+AEDA+L+ YV +HGEGNWN VQ ++GL+RCGKSCRLRWANHL+P+
Sbjct  26    GNGVGVVLKKGPWTAAEDALLVNYVQKHGEGNWNVVQNYSGLSRCGKSCRLRWANHLRPN  85

Query  1709  LKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYP  1530
             LKKGAFT EEE  I ELHAKMGNKWARMAA LPGRTDNEIKNYWNTR+KRR+RAGLP+YP
Sbjct  86    LKKGAFTAEEERMIAELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRMKRRRRAGLPLYP  145

Query  1529  PDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPLDI  1350
             P+V LQA  E    +     S GD  H + L+ N +EI    F +L+ NQ + P  P D+
Sbjct  146   PEVLLQAFQERKHGQGTGEISDGDGGHRDFLKKNNYEIHDAIFDSLKENQGILPFLP-DL  204

Query  1349  P---ASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDT  1179
             P   A+S L  GL S        ST+     L+     F G S  +S+ F  F   +++T
Sbjct  205   PAISANSFLPNGLGSPPYCNLLPSTLPNHDHLQESTMSFIGSSELNSNRFYPFDHIKDNT  264

Query  1178  CMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEP-AWAKKPELPSLQ--  1008
               ++S+S G  S   + +   H S+ C    SH+  N NSS+ +P + A K ELPSLQ  
Sbjct  265   SDKISESFGLYSPLDRGV--SHGSI-CY---SHSLSNGNSSTSKPTSEAVKSELPSLQIP  318

Query  1007  -SQIVSWDspssplpsleSVETLIQSP-PTERSESGNVSPRNSGLLEAVLYESQTLKHSK  834
              ++  SW   S P P  ES++  I SP P    +SG+ SP NSGLL+A+LY++ TL  SK
Sbjct  319   ETEFGSW-GTSPPPPLNESLDVFIHSPQPPNALDSGSSSPLNSGLLDALLYQANTLGCSK  377

Query  833   NTLPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISAS  663
             N    ++S +SI  P D  + +  + +ETEWE Y+DP+SP G  A S+ NE+  +S +
Sbjct  378   NNSSDKSSNSSIATPGDRAECSALNMYETEWEDYADPLSPFG--ATSILNEHPVVSTN  433



>ref|XP_011086072.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Sesamum 
indicum]
 ref|XP_011086080.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Sesamum 
indicum]
 ref|XP_011086098.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Sesamum 
indicum]
Length=534

 Score =   305 bits (782),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 203/433 (47%), Positives = 259/433 (60%), Gaps = 24/433 (6%)
 Frame = -1

Query  1895  GGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLK  1716
             G ++  G  LKKGPWT+AEDAIL++YV +HGEGNWNAVQKHTGL+RCGKSCRLRWANHL+
Sbjct  28    GDSSNRGSILKKGPWTTAEDAILIDYVKKHGEGNWNAVQKHTGLSRCGKSCRLRWANHLR  87

Query  1715  PDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPI  1536
             PDLKKGAFT EEE  IIELHA MGNKWARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+
Sbjct  88    PDLKKGAFTSEEERLIIELHANMGNKWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPL  147

Query  1535  YPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPL  1356
             YPP++ L+   E+ Q+ +      GDT+  ++LQ N ++ P + F +L       P+ P 
Sbjct  148   YPPELCLEGPLENQQSLNSCAMYGGDTRSCDILQSNGYKTPDIMFDSL----TYAPKLP-  202

Query  1355  DIPASSLLAQGLNSSYGPRPFFSTMNPSKRL----RGPDSLFTGLSSNDSDIFTAFGPYQ  1188
             DI  S  L     + +G   ++S +  S  L    + PD   +      +    +F    
Sbjct  203   DISDSGSLI----NCFGCPQYYSFVPQSIGLQKCPQDPDEPMSDYGGGTAAETPSFDRAH  258

Query  1187  NDTCMQVsqssgfssgyyQNLDPDHPSLSCVI-PGSHAslnsnsssLEP-AWAKKPELPS  1014
             +D           S G+    DPDH  L   I   SH + N  SS+ +P A A+K ELPS
Sbjct  259   SD---NFENRMSQSFGFCIPYDPDHTELPLGINQDSHFTPNGFSSASKPIAGAEKSELPS  315

Query  1013  LQSQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSK  834
             LQ Q+  +D  +    SLE     IQS       SG  SP + GLLEA+LYE+  L  S 
Sbjct  316   LQYQVNGFDVWNPAHESLE----FIQSSIGWTPPSGCPSPSSCGLLEALLYEANALSQSW  371

Query  833   NTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISA--SS  660
             N    + + ++I  SDI D++       E +GY DP+S LG+S  S+FNE +P  A  SS
Sbjct  372   NQFSDKATSSTISASDITDSSVLKTSSQELKGYLDPLSSLGNSVGSIFNECSPAHAVVSS  431

Query  659   LEEHQSVEMLAGE  621
             LEE   V +L  E
Sbjct  432   LEEKLPVRILKSE  444



>ref|XP_009410451.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410452.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=551

 Score =   305 bits (780),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 200/451 (44%), Positives = 268/451 (59%), Gaps = 32/451 (7%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAG--GVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             + ++SE     + N+ S S++E +   + G  G  LKKGPWTSAEDAIL+EYV +HGEGN
Sbjct  4     LPTKSEKEPIAEDNIFSHSIDEGSREKSIGKDGQVLKKGPWTSAEDAILVEYVKKHGEGN  63

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQK++GL RCGKSCRLRWANHLKP+LKKGAF+ EEE  I++LHAK+GNKWA+MA  L
Sbjct  64    WNAVQKNSGLFRCGKSCRLRWANHLKPNLKKGAFSMEEEEMIVQLHAKIGNKWAKMATFL  123

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKR QRAGLP+YP ++  QA  E+ Q + +S  +    QHS +LQ
Sbjct  124   PGRTDNEIKNYWNTRIKRHQRAGLPLYPNNICFQASDENQQTQIVSCVA---QQHSGILQ  180

Query  1433  VNYFEIPAVEFKNLELNQQ--LHPQSPLDIPASSLLAQGLNS-SYGPRPFFSTMNPSKRL  1263
              N F+IP   F+NL        +  S  D+  SS++     S  YG   +   +N  K++
Sbjct  181   GNSFDIPGTGFENLNNGHADLSYASSFPDLSVSSMICHEYESPDYG---YMDNVNHVKQV  237

Query  1262  -RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCV---  1095
               G D+            F +  P  +   M+      F   Y  + DP+   L+     
Sbjct  238   GAGCDA-----------TFYSGPPSASQFLMEPPGQLTFRLHYPYDPDPNFKDLATFGGE  286

Query  1094  IPGSHAslnsnsssLEP-AWAKKPELPSLQSQIV---SWDspssplpsleSVETLIQSPP  927
             IPG HA      S+  P + A K ELPSLQ       SW +     P+L++V T ++S P
Sbjct  287   IPGRHAFPIDKFSASRPLSGAVKLELPSLQCTETDDSSW-TLCHSTPTLDAVNTYVESSP  345

Query  926   TERS-ESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHET  750
             T  S +   +SPR+SGLL+A+L+E+Q L  SK     + S + I  +++V+ +  +  ET
Sbjct  346   TTVSLQPEAISPRSSGLLDALLHEAQVLSGSKRYSSLKCSSSVIKHNEMVECSGLNISET  405

Query  749   EWEGYSDPISPLGHSAASVFNEYTPISASSL  657
             EWE Y+ P  PLGHSA SV  E TP    SL
Sbjct  406   EWEDYNGPTYPLGHSAPSVLKECTPPVCGSL  436



>ref|XP_007148771.1| hypothetical protein PHAVU_005G012900g [Phaseolus vulgaris]
 gb|ESW20765.1| hypothetical protein PHAVU_005G012900g [Phaseolus vulgaris]
Length=511

 Score =   303 bits (776),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 191/412 (46%), Positives = 259/412 (63%), Gaps = 18/412 (4%)
 Frame = -1

Query  1889  ANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPD  1710
              N GGV LKKGPWT+AED IL++YV +HGEGNWNAVQK++GL+RCGKSCRLRWANHL+P+
Sbjct  26    GNGGGVVLKKGPWTAAEDVILVDYVNKHGEGNWNAVQKYSGLSRCGKSCRLRWANHLRPN  85

Query  1709  LKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYP  1530
             LKKGAFT EEE  I ELHAKMGNKWARMAA LPGRTDNEIKNYWNTR+KRRQRAGLP+YP
Sbjct  86    LKKGAFTAEEEQMIAELHAKMGNKWARMAAHLPGRTDNEIKNYWNTRMKRRQRAGLPLYP  145

Query  1529  PDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSP--L  1356
             P++ +QA  +S   +     + GD  H + ++ N +E+    F +L+ NQ + P  P   
Sbjct  146   PEIVMQAFQDSKHGQGTGEINDGDGCHHDFMEKNNYEMHDAIFDSLKENQGILPFVPELS  205

Query  1355  DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTC  1176
             DI A+S+L   L S        ST+     L+     F G +  +++ F  F  ++++T 
Sbjct  206   DISANSILPNVLGSPPYCNFLPSTLPNQDHLQETSVSFIGSNELNTNGFYPFNHFKDNTS  265

Query  1175  MQVsqssgfssgyyQNLDPDHPSLSC-VIPGSHAslnsnsssLEP-AWAKKPELPSLQ--  1008
              ++++S G  S        DH + S   I  SH+  N N S+ +P + A K ELPSLQ  
Sbjct  266   GKIAESFGLHSPL------DHGASSYGSICYSHSLSNDNYSTSKPTSEAVKSELPSLQYP  319

Query  1007  -SQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPRNSGLLEAVLY-ESQTLKHSK  834
              ++ VSW   S P P  ES++ LI SP    +     SP +   L   LY +++ L +SK
Sbjct  320   ETEFVSW-GSSPPPPLNESIDVLIHSPQPPYALDSGSSPLSCCFLNEFLYQQAKALNYSK  378

Query  833   NTLPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEY  681
             N    ++S +SI  P D  +++  + +ETEWE Y+DP+SP G  A S+ NE+
Sbjct  379   NNWSDKSSSSSIATPVDRAESSALNMYETEWEDYADPVSPFG--ATSILNEH  428



>ref|XP_006578396.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Glycine 
max]
Length=514

 Score =   301 bits (772),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 192/414 (46%), Positives = 251/414 (61%), Gaps = 15/414 (4%)
 Frame = -1

Query  1889  ANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPD  1710
              N  G+ LKKGPWT+AED +L+ YV +HGEGNWNAVQK++GL+RCGKSCRLRWANHL+P+
Sbjct  26    GNGVGMVLKKGPWTAAEDVLLVNYVQKHGEGNWNAVQKYSGLSRCGKSCRLRWANHLRPN  85

Query  1709  LKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYP  1530
             LKKGAFT EEE  I ELHAKMGNKWARMAA L GRTDNEIKNYWNTR+KRRQRAGLP+YP
Sbjct  86    LKKGAFTAEEERMIAELHAKMGNKWARMAAHLHGRTDNEIKNYWNTRMKRRQRAGLPLYP  145

Query  1529  PDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPLDI  1350
             P+V LQA  E    +     S GD  H + L+ N +EI    F +L+ NQ + P  P D+
Sbjct  146   PEVLLQAFQERKHGQGTGEISNGDGGHHDFLKKNNYEIHDAIFDSLKENQGILPFLP-DL  204

Query  1349  P---ASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDT  1179
             P   A+S L   L S        ST+      +     F G S  +S+ F  F   +++ 
Sbjct  205   PAISANSFLPNCLGSPPYCNFLPSTLPNHDHFQESTMSFIGSSELNSNEFYPFDRIKDNN  264

Query  1178  CMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQ---  1008
               ++S+S G  S     LD    S   +      S  ++S+S   + A K ELPSLQ   
Sbjct  265   SDKISESFGLYSP----LDRGASSHGSICYSHSLSNGNSSTSKLISEAAKSELPSLQIPE  320

Query  1007  SQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNT  828
             ++   W   S P P  ES++  I SP    +     SP NSGLL+A+LY++ TL  SKN 
Sbjct  321   TEFGCW-GTSPPPPLNESLDVFIHSPQPPNALDSGSSPLNSGLLDALLYQANTLGCSKNN  379

Query  827   LPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPIS  669
                ++  +SI  P D  +++  + +ETEWE Y+DP+SP G  A S+ NE+  +S
Sbjct  380   SSDKSLNSSIATPGDRAESSALNMYETEWEDYADPLSPFG--ATSILNEHPVVS  431



>ref|XP_009381364.1| PREDICTED: transcription factor GAMYB-like [Musa acuminata subsp. 
malaccensis]
Length=562

 Score =   303 bits (775),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 197/454 (43%), Positives = 283/454 (62%), Gaps = 25/454 (6%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAG--GVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             ++++S+  M  + +++  SV+E   G +    G  LKKGPWTSAEDA+L+EYV  HGEGN
Sbjct  4     LSTKSDMEMIPEAHMDMLSVDEGRRGKSVSKDGQVLKKGPWTSAEDALLVEYVKEHGEGN  63

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQK++GL+RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LHAKMGNKWA+MA +L
Sbjct  64    WNAVQKNSGLSRCGKSCRLRWANHLRPNLKKGAFTPEEEQLIIKLHAKMGNKWAQMATQL  123

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSN-LL  1437
             PGRTDNEIKN+WNTRIKR QRAGLP+YPP+V  QA     Q + +S+     TQH N +L
Sbjct  124   PGRTDNEIKNFWNTRIKRLQRAGLPLYPPNVCCQASDGDQQTQIVSSV----TQHQNDIL  179

Query  1436  QVNYFEIPAVEFKNLELNQ-QLHPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
             Q N F  P + F+N + +   L   S     + S + QG  S      + + +N  ++LR
Sbjct  180   QGNNFNFPDIVFENFDPDHGDLSYASSFPDISMSRMCQGFESQ--DHGYTNMLNNVEQLR  237

Query  1259  GPDSLFTGLSSNDSDIFTAFG--PYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
               +++  G  S       +    P++    +Q++           N+  +  +    I  
Sbjct  238   DSETINVGYYSTFYSGLPSVSQFPFEPSGKIQLAFGLDNPYDPDANIK-NLATFGGEISL  296

Query  1085  SHAslnsnsssLEP---AWAKKPELPSLQSQIV---SWDspssplpsleSVETLIQSPPT  924
             SHA  N N S+  P   AW  K ELPSLQ   +   SW +       LE+V+T ++S PT
Sbjct  297   SHALSNGNFSASRPLPGAW--KLELPSLQHAEIDDSSW-TAYHSTAHLEAVDTYVESSPT  353

Query  923   ERS-ESGNVSPRNSGLLEAVLYESQTLKH-SKNTLPQQNSGASIIPSDIVDNTFPDFHET  750
               S +S  +SPR+SGLLE +L+E+Q L +  +++  + +S ++I  +++++++  +F + 
Sbjct  354   AVSLQSECISPRSSGLLEVMLHEAQALSNSKRHSSQKSSSSSAITHNEMLESSGLNFFDI  413

Query  749   EWEGYSDPISPLGHSAASVFNEYT-PISASSLEE  651
              WE  +DPISPLG SAAS+FNE+  PI+ SS+ E
Sbjct  414   GWEDCNDPISPLGCSAASIFNEFMPPINGSSIHE  447



>ref|XP_003523913.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Glycine 
max]
 gb|KHN45784.1| Transcription factor GAMYB [Glycine soja]
Length=510

 Score =   301 bits (770),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 192/414 (46%), Positives = 251/414 (61%), Gaps = 15/414 (4%)
 Frame = -1

Query  1889  ANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPD  1710
              N  G+ LKKGPWT+AED +L+ YV +HGEGNWNAVQK++GL+RCGKSCRLRWANHL+P+
Sbjct  26    GNGVGMVLKKGPWTAAEDVLLVNYVQKHGEGNWNAVQKYSGLSRCGKSCRLRWANHLRPN  85

Query  1709  LKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYP  1530
             LKKGAFT EEE  I ELHAKMGNKWARMAA L GRTDNEIKNYWNTR+KRRQRAGLP+YP
Sbjct  86    LKKGAFTAEEERMIAELHAKMGNKWARMAAHLHGRTDNEIKNYWNTRMKRRQRAGLPLYP  145

Query  1529  PDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPLDI  1350
             P+V LQA  E    +     S GD  H + L+ N +EI    F +L+ NQ + P  P D+
Sbjct  146   PEVLLQAFQERKHGQGTGEISNGDGGHHDFLKKNNYEIHDAIFDSLKENQGILPFLP-DL  204

Query  1349  P---ASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDT  1179
             P   A+S L   L S        ST+      +     F G S  +S+ F  F   +++ 
Sbjct  205   PAISANSFLPNCLGSPPYCNFLPSTLPNHDHFQESTMSFIGSSELNSNEFYPFDRIKDNN  264

Query  1178  CMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAKKPELPSLQ---  1008
               ++S+S G  S     LD    S   +      S  ++S+S   + A K ELPSLQ   
Sbjct  265   SDKISESFGLYSP----LDRGASSHGSICYSHSLSNGNSSTSKLISEAAKSELPSLQIPE  320

Query  1007  SQIVSWDspssplpsleSVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNT  828
             ++   W   S P P  ES++  I SP    +     SP NSGLL+A+LY++ TL  SKN 
Sbjct  321   TEFGCW-GTSPPPPLNESLDVFIHSPQPPNALDSGSSPLNSGLLDALLYQANTLGCSKNN  379

Query  827   LPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPIS  669
                ++  +SI  P D  +++  + +ETEWE Y+DP+SP G  A S+ NE+  +S
Sbjct  380   SSDKSLNSSIATPGDRAESSALNMYETEWEDYADPLSPFG--ATSILNEHPVVS  431



>ref|XP_009410453.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=526

 Score =   299 bits (765),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 196/444 (44%), Positives = 258/444 (58%), Gaps = 43/444 (10%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAG--GVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             + ++SE     + N+ S S++E +   + G  G  LKKGPWTSAEDAIL+EYV +HGEGN
Sbjct  4     LPTKSEKEPIAEDNIFSHSIDEGSREKSIGKDGQVLKKGPWTSAEDAILVEYVKKHGEGN  63

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQK++GL RCGKSCRLRWANHLKP+LKKGAF+ EEE  I++LHAK+GNKWA+MA  L
Sbjct  64    WNAVQKNSGLFRCGKSCRLRWANHLKPNLKKGAFSMEEEEMIVQLHAKIGNKWAKMATFL  123

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKR QRAGLP+YP ++  QA  E+ Q + +S  +    QHS +LQ
Sbjct  124   PGRTDNEIKNYWNTRIKRHQRAGLPLYPNNICFQASDENQQTQIVSCVA---QQHSGILQ  180

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGP  1254
              N F+IP   F+NL  N           P  S+ A G ++++   P     + S+ L  P
Sbjct  181   GNSFDIPGTGFENLN-NGHADLSYASSFPDLSVGA-GCDATFYSGP----PSASQFLMEP  234

Query  1253  DSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAs  1074
                 T         F    PY  D   +                 D  +    IPG HA 
Sbjct  235   PGQLT---------FRLHYPYDPDPNFK-----------------DLATFGGEIPGRHAF  268

Query  1073  lnsnsssLEP-AWAKKPELPSLQSQIV---SWDspssplpsleSVETLIQSPPTERS-ES  909
                  S+  P + A K ELPSLQ       SW +     P+L++V T ++S PT  S + 
Sbjct  269   PIDKFSASRPLSGAVKLELPSLQCTETDDSSW-TLCHSTPTLDAVNTYVESSPTTVSLQP  327

Query  908   GNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSD  729
               +SPR+SGLL+A+L+E+Q L  SK     + S + I  +++V+ +  +  ETEWE Y+ 
Sbjct  328   EAISPRSSGLLDALLHEAQVLSGSKRYSSLKCSSSVIKHNEMVECSGLNISETEWEDYNG  387

Query  728   PISPLGHSAASVFNEYTPISASSL  657
             P  PLGHSA SV  E TP    SL
Sbjct  388   PTYPLGHSAPSVLKECTPPVCGSL  411



>ref|XP_004514304.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Cicer 
arietinum]
 ref|XP_004514305.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Cicer 
arietinum]
 ref|XP_004514306.1| PREDICTED: transcription factor GAMYB-like isoform X3 [Cicer 
arietinum]
 ref|XP_004514307.1| PREDICTED: transcription factor GAMYB-like isoform X4 [Cicer 
arietinum]
Length=550

 Score =   294 bits (753),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 206/458 (45%), Positives = 268/458 (59%), Gaps = 23/458 (5%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             +  E ED M L  +   P + +     +  GV LKKGPWTSAED IL+ YV ++GEGNWN
Sbjct  5     MKKEIEDGMLLNDHT-EPQLNDEGYEGSVCGVVLKKGPWTSAEDDILVNYVKKNGEGNWN  63

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQK TGL RCGKSCRLRWANHL+P+LKKGAF  EEE  I ELH+K+GN+WARMAA+LPG
Sbjct  64    AVQKQTGLLRCGKSCRLRWANHLRPNLKKGAFNAEEELLIAELHSKLGNRWARMAAQLPG  123

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ-V  1431
             RTDNEIKNYWNTR+KR QRAGLP+YPP V      E+ +++     +     H + LQ  
Sbjct  124   RTDNEIKNYWNTRVKRCQRAGLPVYPPGVQ----QETPRDQSTGGINGDHKLHPDFLQKK  179

Query  1430  NYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRG  1257
             +Y +I    F +L+ NQ + P  P   DI A   +  G +S        +T N    L  
Sbjct  180   SYDDIHDAIFDSLKDNQGILPYVPELCDISAYGNMLNGFDSYQYCSFLPATSNHKILLES  239

Query  1256  PDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHA  1077
                      +N+   F  F   Q++T   ++QS G  S     LDP   S S +   SH+
Sbjct  240   TMPFLDSSGNNNRSGFYPFDHIQDNTSDNLTQSFGMQSP----LDPGLSSHSSMC-YSHS  294

Query  1076  slnsnsssLEPAWAKKPELPSLQSQIV---SWDspssplpsleSVETLIQS-PPTERSES  909
               N NSS+ +P  A K ELPSLQ   +   SW   SS  P LES+E  IQS  P    ES
Sbjct  295   LKNGNSSTSKPFEAVKLELPSLQYSEIDLGSW-GTSSTPPLLESIEDFIQSDTPISTLES  353

Query  908   GNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASI-IPSDIVDNTFPDFHETEWEGYS  732
                SP+NSGLL+A+LY ++TL  SKN    + S +SI  P D  D++  + +E EWE Y+
Sbjct  354   DCSSPQNSGLLDALLYPAKTLGSSKNNFYDKCSNSSIATPGDRADSSALNMYEPEWEEYA  413

Query  731   DPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
             DP+ P G  A+S+ NE+  +SA  +SL+E   V+   G
Sbjct  414   DPVPPFG--ASSILNEFPAVSANRNSLDEQPPVQNFDG  449



>ref|XP_011091869.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Sesamum 
indicum]
 ref|XP_011091870.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Sesamum 
indicum]
 ref|XP_011091872.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Sesamum 
indicum]
 ref|XP_011091873.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Sesamum 
indicum]
Length=536

 Score =   292 bits (747),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 202/462 (44%), Positives = 255/462 (55%), Gaps = 28/462 (6%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNW  1791
             S T+ESED +    +  S   +  +G +N GG  LKKGPWTSAEDAIL++YV +HGEGNW
Sbjct  4     SSTTESEDGVLSADSPLSNDGDNFSGSSN-GGFVLKKGPWTSAEDAILVDYVKKHGEGNW  62

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LP
Sbjct  63    NAVQKHSGLLRCGKSCRLRWANHLRPNLKKGAFTSEEERLIIELHAKMGNKWARMAAHLP  122

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQV  1431
             GRTDNEIKNYWNTRIKRRQRAGLP+YPPD+ L  + E+ Q         GD     +L+ 
Sbjct  123   GRTDNEIKNYWNTRIKRRQRAGLPLYPPDLCLDPLPENQQQLSSPGICAGDKGCHEILES  182

Query  1430  NYFEIPAVEFKNLELNQQLHPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNP---SKRLR  1260
               +E   + F +        PQ P DI  S   + G    +G   F+S   P    K  +
Sbjct  183   TGYETHDLMFDSFNF-LPYTPQFP-DISGSVSTSNG----FGSPQFYSFAQPIGVPKHAQ  236

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHP----SLSCVI  1092
              PD           +    F   Q  +C      S      Y    PDH     S     
Sbjct  237   EPDEPMLDYGGGAPNETPPFDRTQTASCTNKMSESFGLCFPYV---PDHTKKLLSFGVGQ  293

Query  1091  PGSHAslnsnsssLEPAWAKKPELPSLQSQ---IVSWDspssplpsleSVETLIQSPPTE  921
                  S   +S+S   A A++ ELPSLQ Q   I  WD      P+ ES+++ +QSP   
Sbjct  294   DSEIMSNVISSASKHSAGAQELELPSLQYQETGIGLWD------PAPESLDSFVQSPLPG  347

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
                S   S  +SGLLE +LYE++ L  S+N      + +++   DI D++    +  E++
Sbjct  348   PLPSHCPSSGSSGLLEDLLYEAKALSKSENQSSDWAASSNMSHGDITDSSALQTYSREFK  407

Query  740   GYSDPISPLGHSAASVFNEYTPIS--ASSLEEHQSVEMLAGE  621
             GY DP SP G+S  S+FN  TP     SSLEE   V  +  E
Sbjct  408   GYLDPSSPSGNSMGSIFNGCTPTGTLGSSLEEDMPVRHVKTE  449



>gb|KEH19184.1| myb transcription factor [Medicago truncatula]
Length=546

 Score =   292 bits (747),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 207/457 (45%), Positives = 267/457 (58%), Gaps = 25/457 (5%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             +  E ED M     + S   +E    + A GV LKKGPWTSAED IL+ YV ++GEGNWN
Sbjct  5     MKKEIEDEMLDDDRIGSEFNDEEYDRS-ARGVLLKKGPWTSAEDDILVNYVKKNGEGNWN  63

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQK TGL RCGKSCRLRWANHL+P+LKKG FT EEE  I ELHAK+GNKWARMAA LPG
Sbjct  64    AVQKQTGLLRCGKSCRLRWANHLRPNLKKGTFTAEEEQLICELHAKLGNKWARMAAHLPG  123

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTRIKRR RAGLP+YPP+V  Q +H     +     ++G+  H + LQ  
Sbjct  124   RTDNEIKNYWNTRIKRRHRAGLPLYPPEVLQQTLH----GQSTDGINSGNKVHPDFLQKK  179

Query  1427  YFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGP  1254
              F+I    +  ++ NQ + P      DI A S +  G +SS       ST +  K  R  
Sbjct  180   NFDIHDAIYDCMKDNQGMLPYVAELPDISAYSNMLNGFDSSQYSSFGQSTSSNHKHFRDS  239

Query  1253  DSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAs  1074
                F   S  D + +  F   Q+DT  + +QS G  S  +      H S+ C    SH+ 
Sbjct  240   TIPFLDFSCIDRNGYYPFDHIQDDTFYKWTQSFGMQSPLHHAGPSSHSSM-CY---SHSL  295

Query  1073  lnsnsssLEPAWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSP-PTERSESG  906
              N NSS+ +P      ELPS+Q   + + SW   S P P LESV+  I+SP P    ES 
Sbjct  296   KNGNSSTSKPF----EELPSIQYPETDLGSW-GTSPPPPLLESVDDFIKSPTPISTLESD  350

Query  905   NVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSD  729
               SP+NSGLL++VLY  +T   SKN    ++S +S   P +  D++  + ++TEWE  +D
Sbjct  351   CSSPQNSGLLQSVLYPRKTPSSSKNQFYGKSSNSSTATPGERADSSALNMYDTEWEESAD  410

Query  728   PISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLAG  624
             P+SP G S  S+ NE   +SA  SSL+E   V  + G
Sbjct  411   PVSPFGTS--SILNECPAVSANRSSLDEQPPVHTVNG  445



>dbj|BAD68205.1| putative transcription factor GAMyb [Oryza sativa Japonica Group]
 dbj|BAG88931.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score =   285 bits (728),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 179/393 (46%), Positives = 229/393 (58%), Gaps = 20/393 (5%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             + SES+  M  +  ++SP  ++ + G +    GG PLKKGPWTSAEDAIL++YV +HGEG
Sbjct  4     VKSESDCDMIHQEQMDSPVADDGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGEG  63

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFT EEE  II+LH+KMGNKWARMAA 
Sbjct  64    NWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTAEEERLIIQLHSKMGNKWARMAAH  123

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+ +E  Q    S F  G+   ++LL
Sbjct  124   LPGRTDNEIKNYWNTRIKRCQRAGLPIYPTSVCNQSSNEDQQCS--SDFDCGENLSNDLL  181

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRL  1263
               N   +P     N   N +  P +P    +  S+LL Q   S      F   +N +  L
Sbjct  182   NANGLYLPDFTCDNFIANSEALPYAPHLSAVSISNLLGQSFASKSC--SFMDQVNQTGML  239

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             +  D +  GLS   + + ++   + ND+                +           + GS
Sbjct  240   KQSDGVLPGLSDTINGVISSVDQFSNDSEKLKQAVGFDYLHEANSTSKIIAPFGGALNGS  299

Query  1082  HAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP---  930
             HA LN N S+  P     K ELPSLQ   S   SW   +        E V+  +QSP   
Sbjct  300   HAFLNGNFSASRPTSGPLKMELPSLQDTESDPNSWLKYTVAPALQPTELVDPYLQSPAAT  359

Query  929   PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN  831
             P+ +SE    SPRNSGLLE +++E+QTL+  KN
Sbjct  360   PSVKSEC--ASPRNSGLLEELIHEAQTLRSGKN  390



>ref|NP_001044592.1| Os01g0812000 [Oryza sativa Japonica Group]
 sp|Q0JIC2.1|GAM1_ORYSJ RecName: Full=Transcription factor GAMYB; AltName: Full=OsGAMyb 
[Oryza sativa Japonica Group]
 dbj|BAB85242.1| transcription factor GAMyb [Oryza sativa Japonica Group]
 dbj|BAF06506.1| Os01g0812000 [Oryza sativa Japonica Group]
 gb|EAZ13907.1| hypothetical protein OsJ_03832 [Oryza sativa Japonica Group]
 dbj|BAG95742.1| unnamed protein product [Oryza sativa Japonica Group]
Length=553

 Score =   285 bits (730),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 179/393 (46%), Positives = 229/393 (58%), Gaps = 20/393 (5%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             + SES+  M  +  ++SP  ++ + G +    GG PLKKGPWTSAEDAIL++YV +HGEG
Sbjct  4     VKSESDCDMIHQEQMDSPVADDGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGEG  63

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFT EEE  II+LH+KMGNKWARMAA 
Sbjct  64    NWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTAEEERLIIQLHSKMGNKWARMAAH  123

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+ +E  Q    S F  G+   ++LL
Sbjct  124   LPGRTDNEIKNYWNTRIKRCQRAGLPIYPTSVCNQSSNEDQQCS--SDFDCGENLSNDLL  181

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRL  1263
               N   +P     N   N +  P +P    +  S+LL Q   S      F   +N +  L
Sbjct  182   NANGLYLPDFTCDNFIANSEALPYAPHLSAVSISNLLGQSFASKSC--SFMDQVNQTGML  239

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             +  D +  GLS   + + ++   + ND+                +           + GS
Sbjct  240   KQSDGVLPGLSDTINGVISSVDQFSNDSEKLKQAVGFDYLHEANSTSKIIAPFGGALNGS  299

Query  1082  HAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP---  930
             HA LN N S+  P     K ELPSLQ   S   SW   +        E V+  +QSP   
Sbjct  300   HAFLNGNFSASRPTSGPLKMELPSLQDTESDPNSWLKYTVAPALQPTELVDPYLQSPAAT  359

Query  929   PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN  831
             P+ +SE    SPRNSGLLE +++E+QTL+  KN
Sbjct  360   PSVKSEC--ASPRNSGLLEELIHEAQTLRSGKN  390



>ref|XP_006644884.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006644885.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Oryza 
brachyantha]
Length=553

 Score =   285 bits (729),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 180/393 (46%), Positives = 228/393 (58%), Gaps = 20/393 (5%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             + SES+  M  +  ++SP  ++ + G +    GG PLKKGPWTSAEDAIL++YV +HGEG
Sbjct  4     VKSESDCEMIHQDQMDSPVADDGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGEG  63

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFT EEE  II+LH+KMGNKWARMAA 
Sbjct  64    NWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTAEEERLIIQLHSKMGNKWARMAAH  123

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+ +E  Q    S F  G+   ++LL
Sbjct  124   LPGRTDNEIKNYWNTRIKRCQRAGLPIYPTSVCNQSSNEDQQGS--SDFDCGENLSNDLL  181

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRL  1263
               N   +P     N   N +  P +P    +  S+LL Q   S      F   +N +  L
Sbjct  182   NANGLYLPDFTCDNFIANSEALPYAPHLSAVSISNLLGQSFASKNC--SFMDQVNQTGML  239

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             +  D +  GLS   + +      + ND+                +           + GS
Sbjct  240   KQSDGVLPGLSDTINGVLPLVDQFSNDSEKLNQAVGFDYLHEANSSSKIIAPFGGALNGS  299

Query  1082  HAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP---  930
             HA LN N S+  P     K ELPSLQ   S   SW   +        E V+  +QSP   
Sbjct  300   HAFLNGNFSASRPTSGPLKMELPSLQDTESDPNSWLKYTVAPALQPTELVDPYLQSPAAT  359

Query  929   PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN  831
             P+ +SE   VSPRNSGLLE +++E+QTL+  KN
Sbjct  360   PSVKSEC--VSPRNSGLLEELIHEAQTLRSGKN  390



>emb|CAA67000.1| transcription factor GAMyb [Oryza sativa Indica Group]
Length=553

 Score =   285 bits (729),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 179/393 (46%), Positives = 229/393 (58%), Gaps = 20/393 (5%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             + SES+  M  +  ++SP  ++ + G +    GG PLKKGPWTSAEDAIL++YV +HGEG
Sbjct  4     VKSESDCEMIHQEQMDSPVADDGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGEG  63

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFT EEE  II+LH+KMGNKWARMAA 
Sbjct  64    NWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTAEEERLIIQLHSKMGNKWARMAAH  123

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+ +E  Q    S F  G+   ++LL
Sbjct  124   LPGRTDNEIKNYWNTRIKRCQRAGLPIYPTSVCNQSSNEDQQCS--SDFDCGENLSNDLL  181

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRL  1263
               N   +P     N   N +  P +P    +  S+LL Q   S      F   +N +  L
Sbjct  182   NANGLYLPDFTCDNFIANSEALPYAPHLSAVSISNLLGQSFASKSC--SFMDQVNQTGML  239

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             +  D +  GLS   + + ++   + ND+                +           + GS
Sbjct  240   KQSDGVLPGLSDTINGVISSVDQFSNDSEKLKQAVGFDYLHEANSTSKIIAPFGGALNGS  299

Query  1082  HAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP---  930
             HA LN N S+  P     K ELPSLQ   S   SW   +        E V+  +QSP   
Sbjct  300   HAFLNGNFSASRPTSGPLKMELPSLQDTESDPNSWLKYTVAPALQPTELVDPYLQSPAAT  359

Query  929   PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN  831
             P+ +SE    SPRNSGLLE +++E+QTL+  KN
Sbjct  360   PSVKSEC--ASPRNSGLLEELIHEAQTLRSGKN  390



>sp|A2WW87.1|GAM1_ORYSI RecName: Full=Transcription factor GAMYB; AltName: Full=OsGAMyb 
[Oryza sativa Indica Group]
 gb|EAY76233.1| hypothetical protein OsI_04169 [Oryza sativa Indica Group]
Length=553

 Score =   285 bits (728),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 179/393 (46%), Positives = 229/393 (58%), Gaps = 20/393 (5%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             + SES+  M  +  ++SP  ++ + G +    GG PLKKGPWTSAEDAIL++YV +HGEG
Sbjct  4     VKSESDCEMIHQEQMDSPVADDGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGEG  63

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFT EEE  II+LH+KMGNKWARMAA 
Sbjct  64    NWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTAEEERLIIQLHSKMGNKWARMAAH  123

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+ +E  Q    S F  G+   ++LL
Sbjct  124   LPGRTDNEIKNYWNTRIKRCQRAGLPIYPTSVCNQSSNEDQQCS--SDFDCGENLSNDLL  181

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRL  1263
               N   +P     N   N +  P +P    +  S+LL Q   S      F   +N +  L
Sbjct  182   NANGLYLPDFTCDNFIANSEALPYAPHLSAVSISNLLGQSFASKSC--SFMDQVNQTGML  239

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             +  D +  GLS   + + ++   + ND+                +           + GS
Sbjct  240   KQSDGVLPGLSDTINGVISSVDQFSNDSEKLKQAVGFDYLHEANSTSKIIAPFGGALNGS  299

Query  1082  HAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP---  930
             HA LN N S+  P     K ELPSLQ   S   SW   +        E V+  +QSP   
Sbjct  300   HAFLNGNFSASRPTSGPLKMELPSLQDTESDPNSWLKYTVAPALQPTELVDPYLQSPAAT  359

Query  929   PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN  831
             P+ +SE    SPRNSGLLE +++E+QTL+  KN
Sbjct  360   PSVKSEC--ASPRNSGLLEELVHEAQTLRSGKN  390



>gb|EMS62608.1| Transcription factor GAMYB [Triticum urartu]
Length=589

 Score =   283 bits (724),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 200/456 (44%), Positives = 252/456 (55%), Gaps = 40/456 (9%)
 Frame = -1

Query  1967  ITSESE-DSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             + SES+ + M  +  ++SP  ++ + G +    GG PLKKGPWTSAEDAIL++YV +HGE
Sbjct  41    VKSESDCEMMHQEDQMDSPVGDDGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGE  100

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LH+KMGNKWARMAA
Sbjct  101   GNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIIQLHSKMGNKWARMAA  160

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNL  1440
              LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+ +E  Q    S F+ G+   S+L
Sbjct  161   HLPGRTDNEIKNYWNTRIKRCQRAGLPIYPASVCNQSSNEDQQGS--SDFNCGENLSSDL  218

Query  1439  LQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKR  1266
             L  N   +P     N   N +    +P    +  SSLL Q   S      F   +N +  
Sbjct  219   LNGNGLYLPDFTCDNFIANSEALSYAPQLSAVSISSLLGQSFASKNC--GFMDQVNQAGM  276

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             L+ PD L  GLS   +   ++   + ND+                +           + G
Sbjct  277   LKQPDPLLPGLSDTINGALSSVDQFSNDSENLKKALGFDYLHEANSSSKIIAPFGGALTG  336

Query  1085  SHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP--  930
             SHA LN   S+        K ELPSLQ   S   SW   +        E V+  +QSP  
Sbjct  337   SHAFLNGTFSTSRTINGPLKMELPSLQDTESDPNSWLKYTVAPAMQPTELVDPYLQSPTA  396

Query  929   -PTERSESGNVSPRNSGLLEAVLYESQTLKHSKNT--LPQQNSGASIIPSD--IVDNTFP  765
              P+ +SE   VSPRNSGLLE +L+E+Q LK  KN     + +S +   P D  +V   F 
Sbjct  397   TPSVKSEC--VSPRNSGLLEELLHEAQGLKSGKNQQLSVRSSSSSVSTPCDTTVVSPEF-  453

Query  764   DFHETEWEGYSDPISPLGHSAASVFNEYTPISASSL  657
             D  +  WE       PL        NEY P S +SL
Sbjct  454   DICQDYWE------EPL--------NEYAPFSGNSL  475



>ref|XP_004516524.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Cicer 
arietinum]
 ref|XP_004516525.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Cicer 
arietinum]
Length=504

 Score =   280 bits (716),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 194/441 (44%), Positives = 256/441 (58%), Gaps = 22/441 (5%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWN  1788
             + +E+ED M       S   +E  GG+  G V LKKGPWTSAEDAIL++YV +HGEGNWN
Sbjct  4     VKTENEDDMQCNDQTRSQLNDEGNGGSVGGVVVLKKGPWTSAEDAILVDYVRKHGEGNWN  63

Query  1787  AVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPG  1608
             AVQK++GL+RCGKSCRLRWANHL+P+LKKG+FT +EE  I +LH+KMGNKWARMAA LPG
Sbjct  64    AVQKNSGLSRCGKSCRLRWANHLRPNLKKGSFTADEEQLIAKLHSKMGNKWARMAAHLPG  123

Query  1607  RTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVN  1428
             RTDNEIKNYWNTR KR QRAGLP+YP +V  +   E  + +     + GD  H + L  N
Sbjct  124   RTDNEIKNYWNTRTKRCQRAGLPVYPKEVRKRPFQEGQRGQGTGGINDGDRGHHDFLPKN  183

Query  1427  YFEIPAVEFKNLELNQQ-------LHPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSK  1269
              +E+    F NL L Q        + P++P DI A+S+L    +S        S +    
Sbjct  184   NYEMHDAIFDNLNLKQNQGILPIAIVPENP-DISANSILLNSFDSPPYCNSVPSALPNHH  242

Query  1268  RLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIP  1089
              LR     F G S  + + F  +   Q+ T  ++ QS    S     LDP  PS    + 
Sbjct  243   HLRESTMPFLGSSGTNKNWFYPYYHVQDHTSDKIVQSFELHSP----LDPS-PSSHYSMC  297

Query  1088  GSHAslnsnsssLEP-AWAKKPELPSLQ---SQIVSWDspssplpsleSVETLIQSP-PT  924
               H+  N NSS+ +P + A K ELPSLQ   +    W       P  ESV+   QSP P 
Sbjct  298   YLHSLSNGNSSTSKPTSKAVKLELPSLQYPETGFGGW-GTFPQPPLNESVDVFNQSPLPH  356

Query  923   ERSESGNVSPRNSGLLEAVLYESQTL-KHSKNTLPQQNSGASIIPSDIVDNTFPDFHETE  747
                ESG  SP NSG LEA++Y+S+T      N+  + +  ++  P D  +++  + +ETE
Sbjct  357   AALESGCSSPHNSGTLEALVYQSKTFPNSKNNSSDKSSHSSTATPVDRAESSVLNMNETE  416

Query  746   WEGYSDPISPLGHSAASVFNE  684
             WE Y+D  SP G  A S+ NE
Sbjct  417   WEDYTDRASPFG--ATSILNE  435



>dbj|BAE92565.1| transcription factor GAMYB [Triticum monococcum]
Length=552

 Score =   280 bits (717),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 199/456 (44%), Positives = 251/456 (55%), Gaps = 40/456 (9%)
 Frame = -1

Query  1967  ITSESE-DSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             + SES+ + M  +  ++SP  ++ + G +    GG PLKKGPWTSAEDAIL++YV +HGE
Sbjct  4     VKSESDCEMMHQEDQMDSPVGDDGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGE  63

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LH+KMGNKWARMAA
Sbjct  64    GNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIIQLHSKMGNKWARMAA  123

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNL  1440
              LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+ +E  Q    S F+ G+   S+L
Sbjct  124   HLPGRTDNEIKNYWNTRIKRCQRAGLPIYPASVCNQSSNEDQQGS--SDFNCGENLSSDL  181

Query  1439  LQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKR  1266
             L  N   +P     N   N +    +P    +  SSLL Q   S      F   +N +  
Sbjct  182   LNGNGLYLPDFTCDNFIANSEALSYAPQLSAVSISSLLGQSFASKNC--GFMDQVNQAGM  239

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             L+  D L  GLS   +   ++   + ND+                +           + G
Sbjct  240   LKQSDPLLPGLSDTINGTLSSVDQFSNDSENLKKALGFDYLHEANSSSKMIAPFGGALTG  299

Query  1085  SHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP--  930
             SHA LN   S+        K ELPSLQ   S   SW   +        E V+  +QSP  
Sbjct  300   SHAFLNGTFSTSRTINGPLKMELPSLQDTESDPNSWLKYTVAPAMQPTELVDPYLQSPTA  359

Query  929   -PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN--TLPQQNSGASIIPSD--IVDNTFP  765
              P+ +SE   VSPRNSGLLE +L+E+Q LK  KN     + +S +   P D  +V   F 
Sbjct  360   TPSVKSEC--VSPRNSGLLEELLHEAQGLKSGKNQQLSVRSSSSSVSTPCDTTVVSPEF-  416

Query  764   DFHETEWEGYSDPISPLGHSAASVFNEYTPISASSL  657
             D  +  WE       PL        NEY P S +SL
Sbjct  417   DICQDYWE------EPL--------NEYAPFSGNSL  438



>gb|AAT37169.1| transcription factor Myb3 [Triticum aestivum]
Length=503

 Score =   278 bits (711),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 198/456 (43%), Positives = 251/456 (55%), Gaps = 40/456 (9%)
 Frame = -1

Query  1967  ITSESE-DSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             + SES+ + M  +  ++SP  ++ + G +    GG PLKKGPWTSAEDAIL++YV +HGE
Sbjct  4     VKSESDCEMMHQEDQMDSPVGDDGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGE  63

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LH+KMGNKWARMAA
Sbjct  64    GNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIIQLHSKMGNKWARMAA  123

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNL  1440
              LPGRTD+EIKNYWNTRIKR QRAGLPIYP  V  Q+ +E  Q    S F+ G+   S+L
Sbjct  124   HLPGRTDDEIKNYWNTRIKRCQRAGLPIYPASVCNQSSNEDQQGS--SDFNCGENLSSDL  181

Query  1439  LQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKR  1266
             L  N   +P     N   N +    +P    +  SSLL Q   S      F   +N +  
Sbjct  182   LNGNGLYLPDFTCDNFIANSEALSYAPQLSAVSISSLLGQSFASKNC--GFMDQVNQAGM  239

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             L+  D L  GLS   +   ++   + ND+                +           + G
Sbjct  240   LKQSDPLLPGLSDTINGALSSVDQFSNDSENLKKALGFDYLHEANSSSKMIAPFGGTLTG  299

Query  1085  SHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP--  930
             SHA LN   S+        K ELPSLQ   S   SW   +        E V+  +QSP  
Sbjct  300   SHAFLNGTFSTSRTINGPLKMELPSLQDTESDPNSWLKYTVAPAMQPTELVDPYLQSPTA  359

Query  929   -PTERSESGNVSPRNSGLLEAVLYESQTLKHSKNT--LPQQNSGASIIPSD--IVDNTFP  765
              P+ +SE   VSPRNSGLLE +L+E+Q LK  KN     + +S +   P D  +V   F 
Sbjct  360   TPSVKSEC--VSPRNSGLLEELLHEAQGLKSGKNQQLSVRSSSSSVSTPCDTTVVSPEF-  416

Query  764   DFHETEWEGYSDPISPLGHSAASVFNEYTPISASSL  657
             D  +  WE       PL        NEY P S +SL
Sbjct  417   DICQDYWE------EPL--------NEYAPFSGNSL  438



>gb|EMT06573.1| Transcription factor GAMYB [Aegilops tauschii]
Length=541

 Score =   279 bits (713),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 193/432 (45%), Positives = 240/432 (56%), Gaps = 38/432 (9%)
 Frame = -1

Query  1901  ATGGA--NAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWA  1728
             ++GG+    GG PLKKGPWTSAEDAIL++YV +HGEGNWNAVQK+TGL RCGKSCRLRWA
Sbjct  17    SSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWA  76

Query  1727  NHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRA  1548
             NHL+P+LKKGAFTPEEE  II+LH+KMGNKWARMAA LPGRTDNEIKNYWNTRIKR QRA
Sbjct  77    NHLRPNLKKGAFTPEEERLIIQLHSKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRCQRA  136

Query  1547  GLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHP  1368
             GLPIYP  V  Q+ +E  Q    S F+ G+   S+LL  N   +P     N   N +   
Sbjct  137   GLPIYPASVCNQSSNEDQQGS--SDFNCGENLSSDLLNGNGLYLPDFTCDNFIANSEALS  194

Query  1367  QSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGP  1194
              +P    +  SSLL Q   S      F   +N +  L+ PD L  GLS   +   ++   
Sbjct  195   YAPQLSAVSISSLLGQSFASKNC--GFMGQVNQAGMLKQPDPLLPGLSDTINGALSSVDQ  252

Query  1193  YQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAK-KPELP  1017
             + ND+                +           + GSHA LN   S+        K ELP
Sbjct  253   FSNDSENLKKALGFDYLHEANSSSKIIAPFGGALTGSHAFLNGTFSTSRTINGPLKMELP  312

Query  1016  SLQ---SQIVSWDspssplps--leSVETLIQSP---PTERSESGNVSPRNSGLLEAVLY  861
             SLQ   S   SW   +        E V+  +QSP   P+ +SE   VSPRNSGLLE +L+
Sbjct  313   SLQDTESDPNSWLKYTVAPAMQPTELVDPYLQSPTATPSVKSEC--VSPRNSGLLEELLH  370

Query  860   ESQTLKHSKNT--LPQQNSGASIIPSD--IVDNTFPDFHETEWEGYSDPISPLGHSAASV  693
             E+Q L+  KN     + +S +   P D  +V   F D  +  W+       PL       
Sbjct  371   EAQGLRSGKNQQLSVRSSSSSVSTPCDTTVVSPEF-DLCQDYWD------EPL-------  416

Query  692   FNEYTPISASSL  657
              NEY P S +SL
Sbjct  417   -NEYAPFSGNSL  427



>ref|XP_010543777.1| PREDICTED: transcription factor GAMYB-like [Tarenaya hassleriana]
 ref|XP_010543778.1| PREDICTED: transcription factor GAMYB-like [Tarenaya hassleriana]
 ref|XP_010543779.1| PREDICTED: transcription factor GAMYB-like [Tarenaya hassleriana]
 ref|XP_010543780.1| PREDICTED: transcription factor GAMYB-like [Tarenaya hassleriana]
 ref|XP_010543781.1| PREDICTED: transcription factor GAMYB-like [Tarenaya hassleriana]
Length=560

 Score =   278 bits (710),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 177/396 (45%), Positives = 243/396 (61%), Gaps = 29/396 (7%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGG-ANAGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             MS T +  D+        SP+ E  +G  +   G  LKKGPWT+AEDA+L++YV +HGEG
Sbjct  1     MSHTMDESDNGMYNKRDESPAAENGSGCRSRWAGTVLKKGPWTTAEDAVLIDYVKKHGEG  60

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQK+TGL+RCGKSCRLRWANHL+P+LKKGAF+ EEE  I+ELHAKMGNKWARMAA 
Sbjct  61    NWNAVQKYTGLSRCGKSCRLRWANHLRPNLKKGAFSQEEEQLIVELHAKMGNKWARMAAH  120

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++H++A+  + +      F+  D ++ + L
Sbjct  121   LPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEMHVEALQWNQE------FTESDQRYQDFL  174

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLA-QGLNSSY--GPRPFFSTMNPS  1272
             QV   E P V F +L++   + P +    D+ + ++L   G +SS   G RP    M P+
Sbjct  175   QVGSCE-PNVLFDSLKVVSGMVPSASDLSDVASCNMLGNNGASSSCYKGFRP--PIMQPT  231

Query  1271  KRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPS----L  1104
             KR R   ++     SN  D F +    Q+    ++S+S  FS       D D P+     
Sbjct  232   KRFREQGAILPVYCSNIKDEFPSLEEIQSTAPRKISKSFSFSFPR----DTDPPNRVQHY  287

Query  1103  SCVIPGSHAslnsnsssLEPAWAK-KPELPSLQSQIVSWDspssp----lpsleSVETLI  939
             S VIPGSH  +++   S +P++   K ELPS Q    ++D   +        LESV+   
Sbjct  288   SDVIPGSHTLMDAIFPSSKPSFGTVKLELPSFQYPETNFDQLKASLSPHSDLLESVDAFF  347

Query  938   QSPPTERS-ESGNVSPRNSGLLEAVLYESQTLKHSK  834
             Q PPT R  E+   S  ++GLL+ +L+E++    +K
Sbjct  348   QFPPTMRKLEADCYSSCDTGLLDMLLHEAKIRTGTK  383



>gb|AEV91157.1| R2R3-MYB protein [Triticum aestivum]
 emb|CDM84650.1| unnamed protein product [Triticum aestivum]
Length=552

 Score =   277 bits (708),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 179/394 (45%), Positives = 229/394 (58%), Gaps = 22/394 (6%)
 Frame = -1

Query  1967  ITSESE-DSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             + SES+ + M  +  ++SP  ++ + G +    GG PLKKGPWTSAEDAIL++YV +HGE
Sbjct  4     VKSESDCEMMHQEDQMDSPVGDDGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGE  63

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LH+KMGNKWARMAA
Sbjct  64    GNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIIQLHSKMGNKWARMAA  123

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNL  1440
              LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+   SN+++  S F+ G+   S+L
Sbjct  124   HLPGRTDNEIKNYWNTRIKRCQRAGLPIYPASVCNQS---SNEDQGSSDFNCGENLSSDL  180

Query  1439  LQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKR  1266
             L  N   +P     N   N +    +P    +  SSLL Q   S      F   +N +  
Sbjct  181   LNGNGLYLPDFTCDNFIANSEALSYAPQLSAVSISSLLGQSFASKNC--GFMDQVNQAGM  238

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             L+  D L  GLS   +   ++   + ND+                +           + G
Sbjct  239   LKQSDHLLPGLSDTINGALSSVDQFPNDSEKLKKALGFDYLHEANSSSKTIAPFGGALTG  298

Query  1085  SHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP--  930
             SHA LN   S+        K ELPSLQ   S   SW   +        E V+  +QSP  
Sbjct  299   SHAFLNGTFSTSRTINGPLKMELPSLQDTESDPNSWLKYTVAPAMQPTELVDPYLQSPTA  358

Query  929   -PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN  831
              P+ +SE    SPRNSGLLE +L+E+Q L+  +N
Sbjct  359   TPSVKSEC--ASPRNSGLLEELLHEAQGLRSGRN  390



>ref|XP_011091874.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Sesamum 
indicum]
Length=510

 Score =   275 bits (704),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 190/440 (43%), Positives = 244/440 (55%), Gaps = 27/440 (6%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNW  1791
             S T+ESED +    +  S   +  +G +N GG  LKKGPWTSAEDAIL++YV +HGEGNW
Sbjct  4     SSTTESEDGVLSADSPLSNDGDNFSGSSN-GGFVLKKGPWTSAEDAILVDYVKKHGEGNW  62

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQKH+GL RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LP
Sbjct  63    NAVQKHSGLLRCGKSCRLRWANHLRPNLKKGAFTSEEERLIIELHAKMGNKWARMAAHLP  122

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQV  1431
             GRTDNEIKNYWNTRIKRRQRAGLP+YPPD+ L  + E+ Q         GD     +L+ 
Sbjct  123   GRTDNEIKNYWNTRIKRRQRAGLPLYPPDLCLDPLPENQQQLSSPGICAGDKGCHEILES  182

Query  1430  NYFEIPAVEFKNLELNQQLHPQSPLDIPASSLLAQGLNSSYGPRPFFSTMNP---SKRLR  1260
               +E   + F +        PQ P DI  S   + G    +G   F+S   P    K  +
Sbjct  183   TGYETHDLMFDSFNF-LPYTPQFP-DISGSVSTSNG----FGSPQFYSFAQPIGVPKHAQ  236

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHP----SLSCVI  1092
              PD           +    F   Q  +C      S      Y    PDH     S     
Sbjct  237   EPDEPMLDYGGGAPNETPPFDRTQTASCTNKMSESFGLCFPYV---PDHTKKLLSFGVGQ  293

Query  1091  PGSHAslnsnsssLEPAWAKKPELPSLQSQ---IVSWDspssplpsleSVETLIQSPPTE  921
                  S   +S+S   A A++ ELPSLQ Q   I  WD      P+ ES+++ +QSP   
Sbjct  294   DSEIMSNVISSASKHSAGAQELELPSLQYQETGIGLWD------PAPESLDSFVQSPLPG  347

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
                S   S  +SGLLE +LYE++ L  S+N      + +++   DI D++    +  E++
Sbjct  348   PLPSHCPSSGSSGLLEDLLYEAKALSKSENQSSDWAASSNMSHGDITDSSALQTYSREFK  407

Query  740   GYSDPISP-LGHSAASVFNE  684
             GY DP SP + H    V+++
Sbjct  408   GYLDPSSPSVRHVKTEVYDQ  427



>gb|ABO38439.1| transcription factor [Triticum dicoccon]
 gb|ABO38440.1| transcription factor [Triticum dicoccon]
 gb|ABO38441.1| transcription factor [Triticum dicoccon]
 gb|ABO38442.1| transcription factor [Triticum dicoccon]
 gb|ABO38444.1| transcription factor [Triticum dicoccon]
 gb|ABO38445.1| transcription factor [Triticum dicoccon]
 gb|ABO38446.1| transcription factor [Triticum dicoccon]
 gb|ABO38448.1| transcription factor [Triticum dicoccon]
 gb|ABO38449.1| transcription factor [Triticum dicoccoides]
 gb|ABO38450.1| transcription factor [Triticum dicoccoides]
 gb|ABO38451.1| transcription factor [Triticum dicoccoides]
 gb|ABO38452.1| transcription factor [Triticum dicoccoides]
 gb|ABO38453.1| transcription factor [Triticum dicoccoides]
 gb|ABO38454.1| transcription factor [Triticum dicoccoides]
 gb|ABO38455.1| transcription factor [Triticum dicoccoides]
 gb|ABO38456.1| transcription factor [Triticum dicoccoides]
 gb|ABO38457.1| transcription factor [Triticum dicoccoides]
 gb|ABO38458.1| transcription factor [Triticum dicoccoides]
 gb|ABO38476.1| transcription factor [Triticum aestivum]
 gb|ABO38477.1| transcription factor [Triticum aestivum]
 gb|ABO38478.1| transcription factor [Triticum aestivum]
 gb|ABO38480.1| transcription factor [Triticum aestivum]
 gb|ABO38481.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38482.1| transcription factor [Triticum aestivum]
 gb|ABO38483.1| transcription factor [Triticum aestivum]
 gb|ABO38485.1| transcription factor [Triticum aestivum]
 gb|ABO38486.1| transcription factor [Triticum aestivum]
 gb|ABO38488.1| transcription factor [Triticum aestivum]
 gb|ABO38489.1| transcription factor [Triticum aestivum]
 gb|ABO38490.1| transcription factor [Triticum aestivum]
 gb|ABO38492.1| transcription factor [Triticum aestivum]
 gb|ABO38493.1| transcription factor [Triticum aestivum]
 gb|ABO38494.1| transcription factor [Triticum aestivum]
 gb|ABO38495.1| transcription factor [Triticum aestivum]
 gb|ABO38496.1| transcription factor [Triticum aestivum]
 gb|ABO38497.1| transcription factor [Triticum aestivum]
 gb|ABO38498.1| transcription factor [Triticum aestivum]
 gb|ABO38499.1| transcription factor [Triticum aestivum]
 gb|ABO38500.1| transcription factor [Triticum aestivum]
 gb|ABO38501.1| transcription factor [Triticum aestivum]
 gb|ABO38502.1| transcription factor [Triticum aestivum]
 gb|ABO38503.1| transcription factor [Triticum aestivum]
 gb|ABO38505.1| transcription factor [Triticum aestivum]
 gb|ABO38506.1| transcription factor [Triticum aestivum]
 gb|ABO38508.1| transcription factor [Triticum aestivum]
 gb|ABO38510.1| transcription factor [Triticum aestivum]
 gb|ABO38512.1| transcription factor [Triticum aestivum]
 gb|ABO38513.1| transcription factor [Triticum aestivum]
 gb|ABO38514.1| transcription factor [Triticum aestivum]
 gb|ABO38515.1| transcription factor [Triticum aestivum]
 gb|ABO38516.1| transcription factor [Triticum aestivum]
 gb|ABO38517.1| transcription factor [Triticum aestivum]
 gb|ABO38518.1| transcription factor [Triticum aestivum]
 gb|ABO38519.1| transcription factor [Triticum aestivum]
 gb|ABO38520.1| transcription factor [Triticum aestivum]
Length=550

 Score =   276 bits (706),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 193/469 (41%), Positives = 255/469 (54%), Gaps = 33/469 (7%)
 Frame = -1

Query  1967  ITSESE-DSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             + SES+ + M  +  ++SP  ++ + G +    GG PLKKGPWTSAEDAIL++YV +HGE
Sbjct  4     VKSESDCEMMHQEDQMDSPVGDDGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGE  63

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LH+KMGNKWARMAA
Sbjct  64    GNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIIQLHSKMGNKWARMAA  123

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNL  1440
              LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+   SN+++  S F+ G+   S+L
Sbjct  124   HLPGRTDNEIKNYWNTRIKRCQRAGLPIYPASVCNQS---SNEDQGSSDFNCGENLSSDL  180

Query  1439  LQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKR  1266
             L  N   +P     N   N +    +P    +  SSLL Q   S      F   +N +  
Sbjct  181   LNGNGLYLPDFTCDNFIANSEALSYAPQLSAVSISSLLGQSFASKNC--GFMDQVNQAGM  238

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             L+  D L  GLS   +   ++   + ND+                +           + G
Sbjct  239   LKQSDHLLPGLSDTINGALSSVDQFPNDSEKLKKALGFDYLHEANSSSKTIAPFGGALTG  298

Query  1085  SHAslnsnsssLEPAWAK-KPELPSLQSQIV---SWDspssplps--leSVETLIQSP--  930
             SHA LN    +        K ELPSLQ       SW   +        E V+  +QSP  
Sbjct  299   SHAFLNGTFFTSRTINGPLKMELPSLQDTEFDPNSWLKYTVAPAMQPTELVDPYLQSPTA  358

Query  929   -PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN--TLPQQNSGASIIPSDIVDNTFPDF  759
              P+ +SE    SPRNSGLLE +L+E+Q L+  +N     + +S +   P D    +  D 
Sbjct  359   TPSVKSEC--ASPRNSGLLEELLHEAQGLRSGRNQQLSVRSSSSSVSTPCDTTVISPEDL  416

Query  758   HETEWE----GYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
              +  WE     Y+ P      S  S+     P+SA+S +  Q  ++  G
Sbjct  417   CQEYWEERLNEYAAPF-----SGNSLTGSTAPVSAASPDVFQLSKLSPG  460



>gb|ABO38443.1| transcription factor [Triticum dicoccon]
 gb|ABO38447.1| transcription factor [Triticum dicoccon]
 gb|ABO38459.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38460.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38461.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38462.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38463.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38464.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38465.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38466.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38467.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38468.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38469.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38470.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38471.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38472.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38473.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38474.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38475.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38479.1| transcription factor [Triticum aestivum]
 gb|ABO38484.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38487.1| transcription factor [Triticum dicoccon]
 gb|ABO38491.1| transcription factor [Triticum aestivum]
 gb|ABO38504.1| transcription factor [Triticum turgidum subsp. durum]
 gb|ABO38507.1| transcription factor [Triticum aestivum]
 gb|ABO38509.1| transcription factor [Triticum aestivum]
 gb|ABO38511.1| transcription factor [Triticum aestivum]
Length=550

 Score =   276 bits (706),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 193/469 (41%), Positives = 255/469 (54%), Gaps = 33/469 (7%)
 Frame = -1

Query  1967  ITSESE-DSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             + SES+ + M  +  ++SP  ++ + G +    GG PLKKGPWTSAEDAIL++YV +HGE
Sbjct  4     VKSESDCEMMHQEDQMDSPVGDDGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGE  63

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LH+KMGNKWARMAA
Sbjct  64    GNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIIQLHSKMGNKWARMAA  123

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNL  1440
              LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+   SN+++  S F+ G+   S+L
Sbjct  124   HLPGRTDNEIKNYWNTRIKRCQRAGLPIYPASVCNQS---SNEDQGSSDFNCGENLSSDL  180

Query  1439  LQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKR  1266
             L  N   +P     N   N +    +P    +  SSLL Q   S      F   +N +  
Sbjct  181   LNGNGLYLPDFTCDNFIANSEALSYAPQLSAVSISSLLGQSFASKNC--GFMDQVNQAGM  238

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             L+  D L  GLS   +   ++   + ND+                +           + G
Sbjct  239   LKQSDHLLPGLSDTINGALSSVDQFPNDSEKLKKALGFDYLHEANSSSKTIAPFGGALTG  298

Query  1085  SHAslnsnsssLEPAWAK-KPELPSLQSQIV---SWDspssplps--leSVETLIQSP--  930
             SHA LN    +        K ELPSLQ       SW   +        E V+  +QSP  
Sbjct  299   SHAFLNGTFFTSRTINGPLKMELPSLQDTEFDPNSWLKYTVAPAMQPTELVDPYLQSPTA  358

Query  929   -PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN--TLPQQNSGASIIPSDIVDNTFPDF  759
              P+ +SE    SPRNSGLLE +L+E+Q L+  +N     + +S +   P D    +  D 
Sbjct  359   TPSVKSEC--ASPRNSGLLEELLHEAQGLRSGRNQQLSVRSSSSSVSTPCDTTVISPEDL  416

Query  758   HETEWE----GYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
              +  WE     Y+ P      S  S+     P+SA+S +  Q  ++  G
Sbjct  417   CQEYWEERLNEYAAPF-----SGNSLTGSTAPVSAASPDVFQLSKLSPG  460



>ref|XP_006287506.1| hypothetical protein CARUB_v10000715mg [Capsella rubella]
 gb|EOA20404.1| hypothetical protein CARUB_v10000715mg [Capsella rubella]
Length=458

 Score =   273 bits (698),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 176/385 (46%), Positives = 230/385 (60%), Gaps = 35/385 (9%)
 Frame = -1

Query  1877  GVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKG  1698
             G  LKKGPW+SAED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWANHL+P+LKKG
Sbjct  31    GSGLKKGPWSSAEDDILIDYVNKHGEGNWNAVQKHTGLFRCGKSCRLRWANHLRPNLKKG  90

Query  1697  AFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVH  1518
             AF+ EEE  I+ELHAKMGN+WARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++H
Sbjct  91    AFSQEEEQLIVELHAKMGNRWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEMH  150

Query  1517  LQAIHESNQNEDMSTFSTGDTQHSNLLQV-----NYFEIPAVEFKNLELNQQLHPQSPLD  1353
             ++ + E +Q    S     DT+HS+ LQ+     N+F      F NL     + P +  D
Sbjct  151   VEVL-EWSQEYAKSRIMGEDTRHSDFLQLGSCQSNFF------FDNLNFVTDIVPGASSD  203

Query  1352  IPASSLLAQGLNSSYGPR--PFFS-TMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQND  1182
             +  ++      N++   R   F +  M  SKRL   + L+ G SS     F +   +QN 
Sbjct  204   LADTTGYKNLGNAASSTRYGNFMTPIMTSSKRLWESELLYPGCSSTIKQEFPSPEQFQNT  263

Query  1181  TCMQVsqssgfssgyyQNLDPDHPSLS-----CVIPGSHAslnsnsssLEPAWAK-KPEL  1020
                +VS++  FS       D DHP         +IP SH   +    S +P++ + K EL
Sbjct  264   YPQKVSKTCSFSVP----CDVDHPLFGNQHSPVMIPDSHTPTDGIVPSSKPSYGEVKLEL  319

Query  1019  PSLQSQIVSWDspssplp-----sleSVETLIQSPP--TERSESGNVSPRNSGLLEAVLY  861
             PS Q    ++D             L+  +  IQSPP  T R ES   S  ++GLL+ +L 
Sbjct  320   PSFQYSEATFDQWKKSSSPPHSDLLDPFDAYIQSPPPLTGREESDYFSNCDTGLLDMLLL  379

Query  860   ESQTLKH-SKNTLPQQNSGASIIPS  789
             E++   + +KN+L    S AS IPS
Sbjct  380   EAKIRNNTTKNSL--YKSCASTIPS  402



>ref|XP_006287507.1| hypothetical protein CARUB_v10000715mg [Capsella rubella]
 gb|EOA20405.1| hypothetical protein CARUB_v10000715mg [Capsella rubella]
Length=524

 Score =   273 bits (697),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 176/386 (46%), Positives = 231/386 (60%), Gaps = 37/386 (10%)
 Frame = -1

Query  1877  GVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKG  1698
             G  LKKGPW+SAED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWANHL+P+LKKG
Sbjct  31    GSGLKKGPWSSAEDDILIDYVNKHGEGNWNAVQKHTGLFRCGKSCRLRWANHLRPNLKKG  90

Query  1697  AFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVH  1518
             AF+ EEE  I+ELHAKMGN+WARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++H
Sbjct  91    AFSQEEEQLIVELHAKMGNRWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEMH  150

Query  1517  LQAIHESNQNEDMSTFSTGDTQHSNLLQV-----NYFEIPAVEFKNLELNQQLHPQSPLD  1353
             ++ + E +Q    S     DT+HS+ LQ+     N+F      F NL     + P +  D
Sbjct  151   VEVL-EWSQEYAKSRIMGEDTRHSDFLQLGSCQSNFF------FDNLNFVTDIVPGASSD  203

Query  1352  IPASSLLAQGLNSSYGPRPFFSTMNP----SKRLRGPDSLFTGLSSNDSDIFTAFGPYQN  1185
             + A +   + L ++     + + M P    SKRL   + L+ G SS     F +   +QN
Sbjct  204   L-ADTTGYKNLGNAASSTRYGNFMTPIMTSSKRLWESELLYPGCSSTIKQEFPSPEQFQN  262

Query  1184  DTCMQVsqssgfssgyyQNLDPDHPSLS-----CVIPGSHAslnsnsssLEPAWAK-KPE  1023
                 +VS++  FS       D DHP         +IP SH   +    S +P++ + K E
Sbjct  263   TYPQKVSKTCSFSVP----CDVDHPLFGNQHSPVMIPDSHTPTDGIVPSSKPSYGEVKLE  318

Query  1022  LPSLQSQIVSWDspssplp-----sleSVETLIQSPP--TERSESGNVSPRNSGLLEAVL  864
             LPS Q    ++D             L+  +  IQSPP  T R ES   S  ++GLL+ +L
Sbjct  319   LPSFQYSEATFDQWKKSSSPPHSDLLDPFDAYIQSPPPLTGREESDYFSNCDTGLLDMLL  378

Query  863   YESQTLKH-SKNTLPQQNSGASIIPS  789
              E++   + +KN+L    S AS IPS
Sbjct  379   LEAKIRNNTTKNSL--YKSCASTIPS  402



>ref|XP_003564452.1| PREDICTED: transcription factor GAMYB-like [Brachypodium distachyon]
Length=556

 Score =   272 bits (696),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 195/459 (42%), Positives = 256/459 (56%), Gaps = 38/459 (8%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             + SES+  M  +  ++SP  ++ + G +     G PLKKGPWTSAEDAIL++YV +HGEG
Sbjct  4     VKSESDCEMMHQDQMDSPVADDGSSGGSPHRGSGPPLKKGPWTSAEDAILVDYVKKHGEG  63

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LH+KMGNKWARMAA 
Sbjct  64    NWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIIQLHSKMGNKWARMAAH  123

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKR QRAGLPIYP  +  Q+ +E  Q    S F+ GD   S+LL
Sbjct  124   LPGRTDNEIKNYWNTRIKRCQRAGLPIYPASICNQSANEDQQGS--SDFNCGDNISSDLL  181

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRL  1263
               N   +P     N   N +    +P    +  S+LL Q   S      F   +N +  L
Sbjct  182   NGNGLYLPDFTCDNFIGNSEALSYAPQLSAVSISNLLGQSFASKNC--GFMDQVNQAGML  239

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPD--HPSLSCVIP  1089
             +  D L  GLS   +   ++   + ND+  ++ Q+ GF   +  N       P     + 
Sbjct  240   KQSDGLLPGLSDTINGTLSSVDQFSNDS-QKLKQTLGFDYLHEANSSSKIVAPFFEGALT  298

Query  1088  GSHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP-  930
             GSHA LN N S+        K ELPSLQ   S   SW   +        E ++  +QSP 
Sbjct  299   GSHAFLNGNFSTSRATNGPLKMELPSLQDTESDPNSWLKYTVAPAMQPTELIDPYLQSPT  358

Query  929   --PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN--TLPQQNSGASIIPSDIVDNTFPD  762
               P+ +SE  + S RNSGLLE VL  ++ L+  KN     + +S +   P D      P+
Sbjct  359   TTPSVKSECASPS-RNSGLLEEVL-GAEVLRSGKNQQQSVRSSSSSVSTPCDTTVGC-PE  415

Query  761   FHETE--WEGYSDPISPLGHSAASVFNEYTPISASSLEE  651
             F   +  WE +           ++  +EY P S +SL E
Sbjct  416   FDLCQEYWEEH----------GSTYLSEYAPFSGNSLTE  444



>gb|AAD31395.1|AF114162_1 gibberellin MYB transcription factor [Lolium temulentum]
Length=548

 Score =   271 bits (693),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 184/421 (44%), Positives = 235/421 (56%), Gaps = 35/421 (8%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWTSAEDAIL++YV +HGEGNWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFT
Sbjct  42    LKKGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFT  101

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             PEEE  II+LH+KMGNKWARMAA LPGRTDNEIKNYWNTRIKR QRAGLP+YP  V  Q+
Sbjct  102   PEEERLIIQLHSKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRCQRAGLPVYPASVINQS  161

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSL  1335
              +E  Q    S F+ G+   +N L  N   +P     N   N +    +P    +  S+L
Sbjct  162   ANEDQQGS--SDFNCGENLSNNHLNGNGLYLPDFTCDNFIANSEALSYAPQLSAVSISNL  219

Query  1334  LAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqss  1155
             L Q   S    R  F  M+ +  L+  DSL  GLS   +   ++   + ND+        
Sbjct  220   LGQSFASK---RCGF--MDQAGMLKQSDSLLPGLSDTVNGALSSVDQFSNDSGKLRQALG  274

Query  1154  gfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWD  987
                     +           + GSHA LN   S+        K ELPSLQ   S   SW 
Sbjct  275   FDYLHEANSSSKILAPFGGALTGSHAYLNGTFSASRSTNGPLKMELPSLQDTESDPNSWL  334

Query  986   spssplps--leSVETLIQSP---PTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLP  822
               +        E V+  +QSP   P+ +SE    SPRNSGLLE +L++++ L+  KN  P
Sbjct  335   KYTVAPTMHPTELVDPYLQSPTATPSAKSEC--ASPRNSGLLEELLHQAEALRSGKNQQP  392

Query  821   --QQNSGASIIPSD--IVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSLE  654
               + +S +   P D  +V   F D  +  WE +S           ++ +EY P S +SL 
Sbjct  393   SVRSSSSSVSTPCDTTVVSPDF-DLCQEYWEEHS----------GAMLHEYVPFSGNSLT  441

Query  653   E  651
             E
Sbjct  442   E  442



>gb|AAG22863.1| transcription factor GAMyb [Hordeum vulgare subsp. vulgare]
Length=553

 Score =   269 bits (688),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 185/419 (44%), Positives = 228/419 (54%), Gaps = 36/419 (9%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWTSAEDAIL++YV +HGEGNWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFT
Sbjct  42    LKKGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFT  101

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             PEEE  II+LH+KMGNKWARMAA LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+
Sbjct  102   PEEERLIIQLHSKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRCQRAGLPIYPASVCNQS  161

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSL  1335
              +E  Q    S F+ G+   S+LL  N   +P     N   N +    +P    +  SSL
Sbjct  162   SNEDQQGS--SDFNCGENLSSDLLNGNGLYLPDFTCDNFIANSEALSYAPQLSAVSISSL  219

Query  1334  LAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqss  1155
             L Q   S      F   +N +  L+  D L  GLS   +   ++   + ND+        
Sbjct  220   LGQSFASKNC--GFMDQVNQAGMLKQSDPLLPGLSDTINGALSSVDQFSNDSEKLKQALG  277

Query  1154  gfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWD  987
                     +           + GSHA LN   S+        K ELPSLQ   S   SW 
Sbjct  278   FDYLHEANSSSKIIAPFGGALTGSHAFLNGTFSTSRTINGPLKMELPSLQDTESDPNSWL  337

Query  986   spssplps--leSVETLIQSP---PTERSESGNVSPRNSGLLEAVLYESQTLKHSKNT--  828
               +        E V+  +QSP   P+ +SE    SPRNSGLLE +L+E+Q L+  KN   
Sbjct  338   KYTVAPAMQPTELVDPYMQSPTATPSVKSEC--ASPRNSGLLEELLHEAQGLRSGKNKQL  395

Query  827   LPQQNSGASIIPSD--IVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSL  657
               + +S +   P D  +V   F D  +  WE                 NEY P S +SL
Sbjct  396   SVRSSSSSVSTPCDTTVVSPEF-DLCQEYWE--------------ERLNEYAPFSGNSL  439



>emb|CAA61021.1| GAMyb protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score =   269 bits (688),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 185/419 (44%), Positives = 228/419 (54%), Gaps = 36/419 (9%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWTSAEDAIL++YV +HGEGNWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFT
Sbjct  42    LKKGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFT  101

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             PEEE  II+LH+KMGNKWARMAA LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+
Sbjct  102   PEEERLIIQLHSKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRCQRAGLPIYPASVCNQS  161

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSL  1335
              +E  Q    S F+ G+   S+LL  N   +P     N   N +    +P    +  SSL
Sbjct  162   SNEDQQGS--SDFNCGENLSSDLLNGNGLYLPDFTCDNFIANSEALSYAPQLSAVSISSL  219

Query  1334  LAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqss  1155
             L Q   S      F   +N +  L+  D L  GLS   +   ++   + ND+        
Sbjct  220   LGQSFASKNC--GFMDQVNQAGMLKQSDPLLPGLSDTINGALSSVDQFSNDSEKLKQALG  277

Query  1154  gfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWD  987
                     +           + GSHA LN   S+        K ELPSLQ   S   SW 
Sbjct  278   FDYLHEANSSSKIIAPFGGALTGSHAFLNGTFSTSRTINGPLKMELPSLQDTESDPNSWL  337

Query  986   spssplps--leSVETLIQSP---PTERSESGNVSPRNSGLLEAVLYESQTLKHSKN--T  828
               +        E V+  +QSP   P+ +SE    SPRNSGLLE +L+E+Q L+  KN   
Sbjct  338   KYTVAPAMQPTELVDPYLQSPTATPSVKSEC--ASPRNSGLLEELLHEAQGLRSGKNQQL  395

Query  827   LPQQNSGASIIPSD--IVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSL  657
               + +S +   P D  +V   F D  +  WE                 NEY P S +SL
Sbjct  396   SVRSSSSSVSTPCDTTVVSPEF-DLCQEYWE--------------ERLNEYAPFSGNSL  439



>ref|XP_002456516.1| hypothetical protein SORBIDRAFT_03g037680 [Sorghum bicolor]
 gb|EES01636.1| hypothetical protein SORBIDRAFT_03g037680 [Sorghum bicolor]
Length=556

 Score =   268 bits (686),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 185/457 (40%), Positives = 246/457 (54%), Gaps = 32/457 (7%)
 Frame = -1

Query  1958  ESEDSMTLKGNVNSPSVEEATGGANA------GGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             E +  M L+  ++SP  ++ + G  +       G PLKKGPWTSAEDAIL++YV +HGEG
Sbjct  9     EGDCEMMLQDQMDSPVADDVSSGGGSPHPHRGAGPPLKKGPWTSAEDAILVDYVKKHGEG  68

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LHAKMGNKWARMAA 
Sbjct  69    NWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIIQLHAKMGNKWARMAAH  128

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMS-TFSTGDTQHSNL  1440
              PGR D EIKNYWNTRIKR QRA LPIYP  V  Q+   SN+++ +S  ++ G+   ++L
Sbjct  129   FPGRIDVEIKNYWNTRIKRCQRASLPIYPASVCNQS---SNEDQQVSGDYNGGENISNDL  185

Query  1439  LQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKR  1266
             L  N   +P     N   N +    +P    +  S+LL Q   S      F   ++ +  
Sbjct  186   LSGNSLYLPDFTSDNFIANPEALSYAPQLSAVSISNLLGQSFASKNC--SFMDQVDQAGM  243

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             L+    +   LS     + ++   + ND+                            + G
Sbjct  244   LKQSSCVLPALSDAIDGVLSSVDQFSNDSEKLKQALGFDYLNEANASSKSIAPFGVALTG  303

Query  1085  SHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP--  930
             SHA LN N S+  P     K ELPSLQ   S   SW   +        E V+  +QSP  
Sbjct  304   SHAFLNGNFSASRPTNGPLKMELPSLQDTESDPNSWLKYTVAPAMQPTELVDPYLQSPSA  363

Query  929   -PTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQ-----QNSGASIIPSDIVDNTF  768
              P+ +SE    SPRNSGLLE +L+E+Q L+  KN  P       ++G     + +V   F
Sbjct  364   TPSVKSEC--ASPRNSGLLEELLHEAQALRSGKNQQPSVRSSSSSAGTPCETTTVVSPEF  421

Query  767   PDFHETEWEGY-SDPISPLGHSAASVFNEYTPISASS  660
              D  +  WE      +S   H + +   E TP+SA+S
Sbjct  422   -DMGQEYWEEQPGSFLSEYAHFSGNSLTESTPVSAAS  457



>ref|XP_010423386.1| PREDICTED: transcription factor GAMYB-like [Camelina sativa]
 ref|XP_010423387.1| PREDICTED: transcription factor GAMYB-like [Camelina sativa]
Length=525

 Score =   267 bits (683),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 174/410 (42%), Positives = 231/410 (56%), Gaps = 27/410 (7%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPW+SAED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWANHL+P+LKKGAF+
Sbjct  33    LKKGPWSSAEDDILIDYVNKHGEGNWNAVQKHTGLFRCGKSCRLRWANHLRPNLKKGAFS  92

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              EEE  I+ELHAKMGN+WARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++HL+ 
Sbjct  93    QEEEQLIVELHAKMGNRWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEMHLEV  152

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPLDIPASSLLA  1329
             + E +Q    S     D +HS+ LQ+   E   V F NL     + P +  D+   +   
Sbjct  153   L-EWSQEYAKSRLMAEDRRHSDFLQLGSCE-SNVFFDNLNFVTDMAPGAS-DLADMTAYK  209

Query  1328  QGLNSSYGPR--PFFSTMNP-SKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqs  1158
                N++  PR   F + M P SKR    + L+ G SS     F +   +QN +  Q    
Sbjct  210   NLANAASSPRYENFMTPMMPCSKRFWESELLYPGCSSAIKQEFPSPEQFQNTSSPQ---K  266

Query  1157  sgfssgyyQNLDPDHPSLS------CVIPGSHAslnsnsssLEPA--WAKKPELPSLQSQ  1002
                +  +      DHP          VIP SH        S +P+   A K ELPS Q  
Sbjct  267   ISKTCSFSVPCHVDHPLYGNQQHSPVVIPDSHTLTGGIVPSSKPSSYGAVKLELPSFQYS  326

Query  1001  IVSWDspssplp-----sleSVETLIQS--PPTERSESGNVSPRNSGLLEAVLYESQTLK  843
               ++D             L+  +  I S  PPT R ES   S  ++GLL+ +L E++   
Sbjct  327   ETTFDQWKKSSSPPHSDLLDPFDAYIHSPPPPTGRQESYCFSNCDTGLLDMLLLEAKIRN  386

Query  842   HSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASV  693
              +      ++  ++I P+D+ + T     +T+ E + + +  L HS  S 
Sbjct  387   STTKNDLYKSCASTIPPADLGEVT---VSQTKSEEFDNSLKTLVHSEIST  433



>ref|XP_006399071.1| hypothetical protein EUTSA_v10013329mg [Eutrema salsugineum]
 gb|ESQ40524.1| hypothetical protein EUTSA_v10013329mg [Eutrema salsugineum]
Length=501

 Score =   266 bits (679),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 175/416 (42%), Positives = 235/416 (56%), Gaps = 30/416 (7%)
 Frame = -1

Query  1877  GVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKG  1698
             G  LKKGPW+SAED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWANHL+P+LKKG
Sbjct  29    GNALKKGPWSSAEDDILVDYVKKHGEGNWNAVQKHTGLFRCGKSCRLRWANHLRPNLKKG  88

Query  1697  AFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVH  1518
             AF+ EEE  I+ELHAKMGN+WARMAA LPGRTDNEIKNYWNTRIKRR RAGLP+YPP++H
Sbjct  89    AFSQEEEQLIVELHAKMGNRWARMAAHLPGRTDNEIKNYWNTRIKRRLRAGLPLYPPEMH  148

Query  1517  LQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSP--LDIPA  1344
             ++ +  S +  + S    GD +H + LQ+   E   V F +L     + P +    D+ +
Sbjct  149   VEVLEWSPEYTE-SRILGGDRRHQDFLQLGSCE-SNVFFDSLNFVSDMLPGTSNLADMVS  206

Query  1343  SSLLAQGLNSSYGPR--PFFSTMNP-SKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCM  1173
                L  G +S   PR   F   + P SKR RG +SL+ G SS   +   +   +QN    
Sbjct  207   CKTLGNGASS---PRYEDFMPLLIPSSKRFRGSESLYPGCSSTIKEEIPSPEHFQNTAPQ  263

Query  1172  QVsqssgfssgyyQNLDPDHPSLS-----CVIPGSHAslnsnsssLEPAW-AKKPELPSL  1011
             ++S++  F        D DH          +IP SH   +    +  P+  A K ELPS 
Sbjct  264   KISKTCSFLVP----CDVDHLPYGNQHSPVMIPDSHTLTDGLVPTSNPSLGAVKLELPSF  319

Query  1010  QSQIVSWDspssplpsleS-----VETLIQSPPTERSESGNVSPR-NSGLLEAVLYESQT  849
             Q    ++D         +S      +  IQSPP    E  +  P  ++GLL+ +L E++ 
Sbjct  320   QYSEATFDQWKKSASPPQSDILDPFDAYIQSPPPLGREDSDCFPNCDTGLLDMLLLEAKI  379

Query  848   LKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEY  681
               +S N      S AS  PS++V  +       E   + D +  L HS  S+  ++
Sbjct  380   RNNSTNN-SLYKSCASTSPSNVVGVSVSQIKSEE---FDDSLKSLVHSEISISTQH  431



>ref|XP_010544306.1| PREDICTED: transcription factor MYB104-like isoform X2 [Tarenaya 
hassleriana]
Length=470

 Score =   264 bits (674),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 185/422 (44%), Positives = 253/422 (60%), Gaps = 45/422 (11%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+ EDAIL+EYV  HGEGNWNAVQKH+GL+RCGKSCRLRW NHL+PDL+KGAFT
Sbjct  36    LKKGPWTTDEDAILLEYVQEHGEGNWNAVQKHSGLSRCGKSCRLRWVNHLRPDLRKGAFT  95

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              EEE R+IELHA MGNKWARMAAELPGRTDNEIKN+WNTR+KR QRAGLPIYP +V  Q 
Sbjct  96    HEEERRVIELHALMGNKWARMAAELPGRTDNEIKNFWNTRLKRLQRAGLPIYPDEVRQQV  155

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVN-YFEIPAVEFKNLELNQQL--HPQSPLDIPASS  1338
             +  +   +++   ++ D Q  +L++ +   +IP + F  L LN  L  +P  P   P++ 
Sbjct  156   LTAAQNGQNVDALASDDAQGQDLVRSDGSMDIPEITFNKLGLNSNLVSYPSVP---PSTR  212

Query  1337  LLAQGLNSSYG--PRPFFSTMNPSKRLRGPDSLFTGLS---SNDSDIFTAFGPYQ---ND  1182
             ++   +  S+G  P     T  P+     P++LFTG+    +N+ +      PY     D
Sbjct  213   MIEGNIVDSFGLIPPTSMPTSMPTCHWE-PETLFTGMDGYVTNEPEFNFYNCPYDRMGGD  271

Query  1181  TCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPA-WAKKPELPSL--  1011
                +++ SS            +  S   V+P SH    S+SSS   A   K+ ELPS+  
Sbjct  272   DPFRMNLSSYPYFQSTL----EQSSQFNVLPDSHLPGCSSSSSAPFADGGKELELPSIQY  327

Query  1010  ----QSQIVSWDspssplpsleSVETLIQSPPTERSESGNVSP-RNSGLLEAVLYESQTL  846
                 Q+  +  D+ S  +P LESV+TLIQSP T+     +  P +N+GLLE+VLY+SQ L
Sbjct  328   VDNTQNACIWEDNTSDLMPPLESVDTLIQSPLTDHHTLSDCPPSQNNGLLESVLYQSQML  387

Query  845   KHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISA  666
               S   +   +SG              +  +T+    S  +SP   S++S+ +++TPISA
Sbjct  388   SGSMKAV--DSSGMR------------EVKDTD----SVSVSPFLQSSSSIISQFTPISA  429

Query  665   SS  660
             SS
Sbjct  430   SS  431



>ref|XP_010544307.1| PREDICTED: transcription factor MYB104-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010544308.1| PREDICTED: transcription factor MYB104-like isoform X3 [Tarenaya 
hassleriana]
Length=463

 Score =   263 bits (673),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 185/422 (44%), Positives = 253/422 (60%), Gaps = 45/422 (11%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+ EDAIL+EYV  HGEGNWNAVQKH+GL+RCGKSCRLRW NHL+PDL+KGAFT
Sbjct  26    LKKGPWTTDEDAILLEYVQEHGEGNWNAVQKHSGLSRCGKSCRLRWVNHLRPDLRKGAFT  85

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              EEE R+IELHA MGNKWARMAAELPGRTDNEIKN+WNTR+KR QRAGLPIYP +V  Q 
Sbjct  86    HEEERRVIELHALMGNKWARMAAELPGRTDNEIKNFWNTRLKRLQRAGLPIYPDEVRQQV  145

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVN-YFEIPAVEFKNLELNQQL--HPQSPLDIPASS  1338
             +  +   +++   ++ D Q  +L++ +   +IP + F  L LN  L  +P  P   P++ 
Sbjct  146   LTAAQNGQNVDALASDDAQGQDLVRSDGSMDIPEITFNKLGLNSNLVSYPSVP---PSTR  202

Query  1337  LLAQGLNSSYG--PRPFFSTMNPSKRLRGPDSLFTGLS---SNDSDIFTAFGPYQ---ND  1182
             ++   +  S+G  P     T  P+     P++LFTG+    +N+ +      PY     D
Sbjct  203   MIEGNIVDSFGLIPPTSMPTSMPTCHWE-PETLFTGMDGYVTNEPEFNFYNCPYDRMGGD  261

Query  1181  TCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPA-WAKKPELPSL--  1011
                +++ SS            +  S   V+P SH    S+SSS   A   K+ ELPS+  
Sbjct  262   DPFRMNLSSYPYFQSTL----EQSSQFNVLPDSHLPGCSSSSSAPFADGGKELELPSIQY  317

Query  1010  ----QSQIVSWDspssplpsleSVETLIQSPPTERSESGNVSP-RNSGLLEAVLYESQTL  846
                 Q+  +  D+ S  +P LESV+TLIQSP T+     +  P +N+GLLE+VLY+SQ L
Sbjct  318   VDNTQNACIWEDNTSDLMPPLESVDTLIQSPLTDHHTLSDCPPSQNNGLLESVLYQSQML  377

Query  845   KHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISA  666
               S   +   +SG              +  +T+    S  +SP   S++S+ +++TPISA
Sbjct  378   SGSMKAV--DSSGMR------------EVKDTD----SVSVSPFLQSSSSIISQFTPISA  419

Query  665   SS  660
             SS
Sbjct  420   SS  421



>ref|XP_010544305.1| PREDICTED: transcription factor MYB104-like isoform X1 [Tarenaya 
hassleriana]
Length=473

 Score =   263 bits (673),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 187/422 (44%), Positives = 253/422 (60%), Gaps = 45/422 (11%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+ EDAIL+EYV  HGEGNWNAVQKH+GL+RCGKSCRLRW NHL+PDL+KGAFT
Sbjct  36    LKKGPWTTDEDAILLEYVQEHGEGNWNAVQKHSGLSRCGKSCRLRWVNHLRPDLRKGAFT  95

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              EEE R+IELHA MGNKWARMAAELPGRTDNEIKN+WNTR+KR QRAGLPIYP +V  Q 
Sbjct  96    HEEERRVIELHALMGNKWARMAAELPGRTDNEIKNFWNTRLKRLQRAGLPIYPDEVRQQV  155

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVN-YFEIPAVEFKNLELNQQL--HPQSPLDIPASS  1338
             +  +   +++   ++ D Q  +L++ +   +IP + F  L LN  L  +P  P   P++ 
Sbjct  156   LTAAQNGQNVDALASDDAQGQDLVRSDGSMDIPEITFNKLGLNSNLVSYPSVP---PSTR  212

Query  1337  LLAQGLNSSYGPRPFFS--TMNPSKRLRGPDSLFTGLS---SNDSDIFTAFGPYQ---ND  1182
             ++   +  S+G  P  S  T  P+     P++LFTG+    +N+ +      PY     D
Sbjct  213   MIEGNIVDSFGLIPPTSMPTSMPTCHWE-PETLFTGMDGYVTNEPEFNFYNCPYDRMGGD  271

Query  1181  TCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPA-WAKKPELPSLQ-  1008
                +++ SS            +  S   V+P SH    S+SSS   A   K+ ELPS+Q 
Sbjct  272   DPFRMNLSSYPYFQSTL----EQSSQFNVLPDSHLPGCSSSSSAPFADGGKELELPSIQY  327

Query  1007  ----SQIVSW-DspssplpsleSVETLIQSPPTERSESGNVSP-RNSGLLEAVLYESQTL  846
                      W D+ S  +P LESV+TLIQSP T+     +  P +N+GLLE+VLY+SQ L
Sbjct  328   VDNTQNACIWEDNTSDLMPPLESVDTLIQSPLTDHHTLSDCPPSQNNGLLESVLYQSQML  387

Query  845   KHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISA  666
               S   +   +SG              +  +T+    S  +SP   S++S+ +++TPISA
Sbjct  388   SGSMKAV--DSSGMR------------EVKDTD----SVSVSPFLQSSSSIISQFTPISA  429

Query  665   SS  660
             SS
Sbjct  430   SS  431



>gb|EYU42075.1| hypothetical protein MIMGU_mgv1a025316mg [Erythranthe guttata]
Length=387

 Score =   260 bits (664),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 150/195 (77%), Gaps = 2/195 (1%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNW  1791
             S T+ESED + L  +    +  E +GG++ G   LKKGPWT+AED+IL++YV RHGEGNW
Sbjct  4     STTTESEDGV-LSADSPLSNDGENSGGSSNGNALLKKGPWTTAEDSILVDYVKRHGEGNW  62

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQKH+GL+RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LP
Sbjct  63    NAVQKHSGLSRCGKSCRLRWANHLRPNLKKGAFTSEEERLIIELHAKMGNKWARMAAHLP  122

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQV  1431
             GRTDNEIKNYWNTRIKRRQRAGLP+YPPD+ L A+ E NQ+        GD    +++Q+
Sbjct  123   GRTDNEIKNYWNTRIKRRQRAGLPLYPPDLCLHALPE-NQHHGSPGIYDGDKGCHDIMQI  181

Query  1430  NYFEIPAVEFKNLEL  1386
             N +E P   F N  +
Sbjct  182   NGYETPDFMFDNFNI  196



>ref|XP_010491156.1| PREDICTED: transcription factor GAMYB-like [Camelina sativa]
Length=529

 Score =   263 bits (673),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 172/410 (42%), Positives = 228/410 (56%), Gaps = 26/410 (6%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPW+SAED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWANHL+P+LKKGAF+
Sbjct  36    LKKGPWSSAEDDILIDYVNKHGEGNWNAVQKHTGLFRCGKSCRLRWANHLRPNLKKGAFS  95

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              EEE  I+ELHAKMGN+WARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++HL+ 
Sbjct  96    QEEEQLIVELHAKMGNRWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEMHLEV  155

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPLDIPASSLLA  1329
             + E +Q    S     D +HS+ LQ+   E   V F NL            D+   +   
Sbjct  156   L-EWSQEYAKSRLMGEDRRHSDFLQLGSCE-SDVFFDNLSFVTTDMVPGGSDLSDMTAYK  213

Query  1328  QGLNSSYGPR--PFFSTMNP-SKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqs  1158
                N++  PR   F + M P SKR    + L+ G SS     F +   +QN +  Q    
Sbjct  214   NLANAASSPRYDNFMTPMVPCSKRFWESELLYPGCSSTIKQEFPSPEQFQNTSSPQ---K  270

Query  1157  sgfssgyyQNLDPDHPSLS------CVIPGSHAslnsnsssLEPAW--AKKPELPSLQSQ  1002
                +  +    D DHP          VIP SH        S +P+   A K ELPS Q  
Sbjct  271   ISKTCSFSVPCDVDHPLYGNQQHSPVVIPDSHTLTGGIVPSSKPSSYEAVKLELPSFQYS  330

Query  1001  IVSWDspssplp-----sleSVETLIQSP--PTERSESGNVSPRNSGLLEAVLYESQTLK  843
               ++D             L+  ++ I S   PT R ES   S  ++GLL+ +L E++   
Sbjct  331   ETTFDQWKKSSSPPHSDLLDPFDSYIHSSPLPTGRQESDCFSNCDTGLLDMLLLEAKIRN  390

Query  842   HSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASV  693
              +      ++  ++I P+D+ + T     +T+ E + + +    HS  S 
Sbjct  391   STTKNDLYKSCASTIPPADLGEVT---VSQTKSEEFDNSLKSFVHSEIST  437



>emb|CAB40189.1| myb protein [Avena sativa]
Length=546

 Score =   264 bits (674),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 190/452 (42%), Positives = 247/452 (55%), Gaps = 34/452 (8%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEE--ATGGA--NAGGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             + SES+  M  +  ++SP  ++  ++GG+    GG PLKKGPWTSAEDAIL++YV +HGE
Sbjct  4     VKSESDCEMMHEDQMDSPLADDGGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGE  63

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LH+KMGNKWARMAA
Sbjct  64    GNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIIQLHSKMGNKWARMAA  123

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNL  1440
              LPGRTDNEIKNYWNTRIKR QRAGL IYP  +  Q+ +E  Q    S F+ G+   +NL
Sbjct  124   NLPGRTDNEIKNYWNTRIKRCQRAGLTIYPASIINQSANEDQQGS--SDFNCGENLSNNL  181

Query  1439  LQVNYFEIPAVEFKNLELNQQLHPQSPLDIPA--SSLLAQGLNSSYGPRPFFSTMNPSKR  1266
             L  N   +P     N   N +    +P    A  S+LL Q   S          M+ +  
Sbjct  182   LNGNGLYLPDFTCDNFIANSEALSYAPQLSAASISNLLGQSFASKG-----CGFMDQAGM  236

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             L+  DSL  GLS   +   ++   + ND+                +           + G
Sbjct  237   LKQSDSLLPGLSDTINGALSSVDQFSNDSEKLKQALGFDYLHEANSSSRIIAPFGGALTG  296

Query  1085  SHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP-P  927
             SHA LN   S+        K ELPSLQ   S   SW   +        E V+  + SP P
Sbjct  297   SHAYLNGTFSASRSTNGPLKMELPSLQDTESDPNSWLKYTVAPTMQPTELVDPYLHSPAP  356

Query  926   TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLP--QQNSGASIIPSD--IVDNTFPDF  759
             T   +S   SPRNSGLLE +++E++ L+  KN  P  + +S +   P D  +V   F D 
Sbjct  357   TPSVKSECASPRNSGLLEELIHEAEALRSGKNQQPSVRSSSSSVSTPCDTTVVSPEF-DL  415

Query  758   HETEWEGYSDPISPLGHSAASVFNEYTPISAS  663
              +  WE          H +  +  EY P S +
Sbjct  416   CQEYWE---------EHPSTMLVQEYAPFSGT  438



>ref|XP_002871198.1| ATMYB33/MYB33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47457.1| ATMYB33/MYB33 [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   263 bits (671),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 181/417 (43%), Positives = 237/417 (57%), Gaps = 35/417 (8%)
 Frame = -1

Query  1877  GVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKG  1698
             G  LKKGPW+SAED IL++YV +HGEGNWNAVQ+HTGL RCGKSCRLRWANHL+P+LKKG
Sbjct  29    GHALKKGPWSSAEDDILIDYVNKHGEGNWNAVQRHTGLFRCGKSCRLRWANHLRPNLKKG  88

Query  1697  AFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVH  1518
             AF+ EEE  I+ELHAKMGN+WARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++H
Sbjct  89    AFSQEEEQLILELHAKMGNRWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEMH  148

Query  1517  LQAIHESNQNEDMSTFSTGDTQHSNLLQV-----NYFEIPAVEFKNLELNQQLHPQSPL-  1356
             ++A+  S Q    S     D +H + LQ+     N+F      F +L     +     L 
Sbjct  149   VEALDWS-QEYAKSRVMGEDGRHQDFLQLGSCESNFF------FDSLNFTDMVPGAFDLA  201

Query  1355  DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTC  1176
             D+ A   L  G +S          M  SKRL   + L+ G SS     F +   +QN + 
Sbjct  202   DMTAYKNLGNGASSPRYENFMTPIMPSSKRLWESELLYPGCSSTVKQEFLSPEQFQNTSP  261

Query  1175  MQVsqssgfssgyyQNLDPDHPSLS-----CVIPGSHAslnsnsssLEPAW-AKKPELPS  1014
              ++S++  FS       D +HP         +I  SH   +    S +P++ A K ELPS
Sbjct  262   QKISKTCSFSVP----CDVEHPLYGNRHSPIMISDSHTPTDGIVPSSKPSYGAVKLELPS  317

Query  1013  LQSQIVSWDspssplp-----sleSVETLIQS--PPTERSESGNVSPRNSGLLEAVLYES  855
              Q    ++D             L+  +T IQS  PPT R ES   S  ++GLL+ +L E+
Sbjct  318   FQYSETTFDQWKKSSSPPHSHLLDPFDTYIQSPPPPTGREESDLYSSFDTGLLDMLLLEA  377

Query  854   QTLKH-SKNTLPQQNSGASIIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFN  687
             +   + +KN L    S AS IPS   D       +T+ E + + +  L HS  S  N
Sbjct  378   KIRNNTTKNNL--YKSCASTIPS--ADLGKVTVSQTKSEDFDNSLKSLVHSDMSTQN  430



>ref|NP_001130632.1| MYBGA transcription factor [Zea mays]
 ref|XP_008672038.1| PREDICTED: MYBGA transcription factor isoform X1 [Zea mays]
 gb|ACF78930.1| unknown [Zea mays]
 gb|ACG43004.1| transcription factor GAMYB [Zea mays]
 gb|ACN27389.1| unknown [Zea mays]
 gb|ACN28525.1| unknown [Zea mays]
 gb|ADX60162.1| MYBGA transcription factor [Zea mays]
 tpg|DAA57168.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=559

 Score =   263 bits (673),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 185/450 (41%), Positives = 242/450 (54%), Gaps = 29/450 (6%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEEATGGANA----GGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQK  1776
             M L+  ++S   ++ + G  +     G PLKKGPWTSAEDAIL++YV ++GEGNWNAVQK
Sbjct  18    MMLQEQMDSLVADDVSSGGGSPHRGVGTPLKKGPWTSAEDAILVDYVKKNGEGNWNAVQK  77

Query  1775  HTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDN  1596
             +TGL RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LHAKMGNKWARMA  LPGRTDN
Sbjct  78    NTGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIIQLHAKMGNKWARMAGHLPGRTDN  137

Query  1595  EIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEI  1416
             EIKNYWNTRIKR QRA LPIYP  V  Q+ +E  Q      F+ G+   ++LL  N   +
Sbjct  138   EIKNYWNTRIKRCQRASLPIYPASVCNQSTNEDQQLS--GNFNGGENISNDLLSGNSLYL  195

Query  1415  PAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLF  1242
             P     N   N +    +P    +  S+LL Q   S      F   ++ +  L+    + 
Sbjct  196   PDFTSDNFIANPEALSYAPQLSAVSISNLLGQSFASKSC--SFMDQVDQAGMLKQSGCVL  253

Query  1241  TGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsn  1062
               LS     + ++   + ND+                            + GSHA LN N
Sbjct  254   PALSDAIDSVLSSADHFSNDSEKLRQALGFDYLNEANASSKSIAPFGVALTGSHAFLNGN  313

Query  1061  sssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP---PTERSES  909
              S+  P     K ELPSLQ   S   SW   +        E V+  +QSP   P+ +SE 
Sbjct  314   FSASRPTNGPLKMELPSLQDTESDPNSWLKYTVAPAMQPTELVDPYLQSPSATPSVKSEC  373

Query  908   GNVSPRNSGLLEAVLYESQTLKHSKN-----TLPQQNSGASIIPSDIVDNTFPDFHETEW  744
                SPRNSGLLE +L+E+Q L+  KN          ++G     + +V   F D  +  W
Sbjct  374   --ASPRNSGLLEELLHEAQALRSGKNQQSSVRSSSSSAGTPYETTTVVSPEF-DMGQEYW  430

Query  743   EGY-SDPISPLGHSAASVFNEYT-PISASS  660
             E   S  +S   H + + F E T P+SA+S
Sbjct  431   EEQPSSFLSEYAHFSGNSFTESTPPVSAAS  460



>ref|XP_004970317.1| PREDICTED: transcription factor GAMYB-like [Setaria italica]
Length=551

 Score =   263 bits (671),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 188/461 (41%), Positives = 246/461 (53%), Gaps = 27/461 (6%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGGANA----GGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             + SES+  M L+  ++SP  ++ + G  +     G PLKKGPWTSAEDAIL++YV +HGE
Sbjct  4     VKSESDCDMMLQDQMDSPVADDVSSGEGSPHRGSGPPLKKGPWTSAEDAILVDYVKKHGE  63

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+TGL RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LHAKMGNKWARMAA
Sbjct  64    GNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIIQLHAKMGNKWARMAA  123

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNL  1440
              LPGRTDNEIKNYWNTRIKR QRAGLPIYP  V  Q+  E  Q      F+  +   ++L
Sbjct  124   NLPGRTDNEIKNYWNTRIKRCQRAGLPIYPASVCNQSSSEDQQVS--GDFNCSENISNDL  181

Query  1439  LQVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKR  1266
             L  N   +P     N   N      +P    +   +LL Q   S      F   ++ S  
Sbjct  182   LSGNGLYLPDFTSDNFIANPDALSYAPHLSAVSIGNLLGQSFASKNC--SFMDQVDHSGM  239

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             L+    +   LS     + ++   + N +                            + G
Sbjct  240   LKQSGCVLPALSDTIDGVLSSVDQFSNGSEKLKQALGFDYLNEANASSKTIAPFGVALSG  299

Query  1085  SHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplps--leSVETLIQSP--  930
             SHA LN N S+  P     K ELPSLQ   S   SW   +        E V+  + SP  
Sbjct  300   SHAFLNGNFSASRPINGPLKRELPSLQDTESDPNSWLKYTLAPAMQPTELVDPYLHSPIA  359

Query  929   -PTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLP--QQNSGASIIPSDIVDNTFPDF  759
              P+ +SE    SPRNSGLLE +L+E+Q  +  KN  P  + +S ++  P +      P+F
Sbjct  360   TPSVKSEC--ASPRNSGLLEELLHEAQG-RSGKNRQPSVRSSSSSANTPCETTTVVSPEF  416

Query  758   HET--EWEG-YSDPISPLGHSAASVFNEYTPISASSLEEHQ  645
                   W+  +S  I+     +   F E TP+SA+S +  Q
Sbjct  417   DLCPEYWDDHHSSFINECAPFSGYSFTESTPVSAASPDIFQ  457



>ref|NP_196228.1| myb domain protein 33 [Arabidopsis thaliana]
 dbj|BAA98199.1| MYB family transcription factor-like [Arabidopsis thaliana]
 gb|AED90964.1| myb domain protein 33 [Arabidopsis thaliana]
Length=451

 Score =   259 bits (662),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 171/381 (45%), Positives = 222/381 (58%), Gaps = 29/381 (8%)
 Frame = -1

Query  1877  GVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKG  1698
             G  LKKGPW+SAED IL++YV +HGEGNWNAVQKHT L RCGKSCRLRWANHL+P+LKKG
Sbjct  29    GHALKKGPWSSAEDDILIDYVNKHGEGNWNAVQKHTSLFRCGKSCRLRWANHLRPNLKKG  88

Query  1697  AFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVH  1518
             AF+ EEE  I+ELHAKMGN+WARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++H
Sbjct  89    AFSQEEEQLIVELHAKMGNRWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEMH  148

Query  1517  LQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPLDIPASS  1338
             ++A+ E +Q    S     D +H + LQ+   E   V F  L     +      D+   +
Sbjct  149   VEAL-EWSQEYAKSRVMGEDRRHQDFLQLGSCE-SNVFFDTLNFTDMV--PGTFDLADMT  204

Query  1337  LLAQGLNSSYGPRPFFSTMNP----SKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQ  1170
                   N +  PR + + M P    SKRL   + L+ G SS     F++   ++N +   
Sbjct  205   AYKNMGNCASSPR-YENFMTPTIPSSKRLWESELLYPGCSSTIKQEFSSPEQFRNTSPQT  263

Query  1169  VsqssgfssgyyQNLDPDHPSLS-----CVIPGSHAslnsnsssLEPAW-AKKPELPSLQ  1008
             +S++  FS       D +HP         +IP SH   +      +P + A K ELPS Q
Sbjct  264   ISKTCSFSVP----CDVEHPLYGNRHSPVMIPDSHTPTDGIVPYSKPLYGAVKLELPSFQ  319

Query  1007  SQIVSWDspssplp-----sleSVETLIQS--PPTERSESGNVSPRNSGLLEAVLYESQT  849
                 ++D             L+  +T IQS  PPT   ES   S  ++GLL+ +L E++ 
Sbjct  320   YSETTFDQWKKSSSPPHSDLLDPFDTYIQSPPPPTGGEESDLYSNFDTGLLDMLLLEAKI  379

Query  848   LKHS-KNTLPQQNSGASIIPS  789
               +S KN L    S AS IPS
Sbjct  380   RNNSTKNNL--YRSCASTIPS  398



>ref|XP_006297374.1| hypothetical protein CARUB_v10013393mg [Capsella rubella]
 gb|EOA30272.1| hypothetical protein CARUB_v10013393mg [Capsella rubella]
Length=546

 Score =   261 bits (668),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 175/398 (44%), Positives = 238/398 (60%), Gaps = 21/398 (5%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANA---GGVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             T ES+D M    +  SP+ +    G  +   GGV LKKGPWTS ED IL++YV +HGEGN
Sbjct  6     TVESDDGMHSSIHNESPAADRIANGYRSRGRGGV-LKKGPWTSTEDGILIDYVKKHGEGN  64

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKHT LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+E+HAKMGNKWA+MA  L
Sbjct  65    WNAVQKHTSLARCGKSCRLRWANHLRPNLKKGAFSQEEEQLIVEMHAKMGNKWAQMAEHL  124

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQ  1434
             PGRTDNEIKNYWNTRIKRRQRAGLP+YPP++H++ +  S +            +H + LQ
Sbjct  125   PGRTDNEIKNYWNTRIKRRQRAGLPLYPPEIHVEDLQWSEEYTKSKIIGVDRRRHHDFLQ  184

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPS-KRL  1263
             +   +  A+ F +L     L P +    D+ A +LL  G +SS+    + S + PS K+ 
Sbjct  185   LGNAKANAL-FDDLNFAASLLPAASDLSDLVACNLLGTGASSSWY-ESYMSPILPSPKQF  242

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDP--DHPSLS-CVI  1092
                 S F   SSN    F +   +QN T  Q +  S   S    +  P  + PS    +I
Sbjct  243   WESGSRFPMCSSNIKHEFQSPEHFQN-TASQKNPRSCSISPCGVHHPPYGNQPSSDMMMI  301

Query  1091  PGSHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDspssp-----lpsleSVETLIQS  933
               SH   +    + +P++ A K ELPS Q S+  ++D   +         L+SV+  IQS
Sbjct  302   LDSHTFTDGMLPTSKPSFGAVKLELPSFQYSETSAFDQWKATPSPPQSDLLDSVDAYIQS  361

Query  932   -PPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLP  822
              PP+E  ES   S  ++GLL+ +L+E++    +K++LP
Sbjct  362   PPPSEIEESDCFSSCDTGLLDMLLHEAKIKTSAKHSLP  399



>gb|EPS59038.1| hypothetical protein M569_15771, partial [Genlisea aurea]
Length=160

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 135/161 (84%), Gaps = 3/161 (2%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGN  1794
             MS+TS+S++ M  + +++SPS      G+N    PLKKGPWTS EDAIL++YV +HGEGN
Sbjct  3     MSMTSDSDERMVPQNSIDSPSNNGENVGSNG---PLKKGPWTSGEDAILIDYVNKHGEGN  59

Query  1793  WNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAEL  1614
             WNAVQKH+GL+RCGKSCRLRWANHL+PDLKKGAFT EEE RIIELHAKMGNKWARMA EL
Sbjct  60    WNAVQKHSGLSRCGKSCRLRWANHLRPDLKKGAFTAEEERRIIELHAKMGNKWARMATEL  119

Query  1613  PGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQ  1491
             PGRTDNEIKN+WNTRIKRRQRAGLPIYP  +  Q  +ES Q
Sbjct  120   PGRTDNEIKNFWNTRIKRRQRAGLPIYPNYISSQVKNESQQ  160



>ref|XP_002882732.1| hypothetical protein ARALYDRAFT_478481 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58991.1| hypothetical protein ARALYDRAFT_478481 [Arabidopsis lyrata subsp. 
lyrata]
Length=551

 Score =   261 bits (667),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 167/422 (40%), Positives = 239/422 (57%), Gaps = 28/422 (7%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGGVP--LKKGPWTSAEDAILMEYVTRHGEG  1797
             + T +S+D M    +  SP+ +  + G  + G    LKKGPWTS ED IL++YV +HGEG
Sbjct  5     TTTVDSDDGMHSSIHNESPAADSISNGCRSRGKSRVLKKGPWTSTEDGILIDYVKKHGEG  64

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWNAVQKHT LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+E+HAKMGNKWA+MA  
Sbjct  65    NWNAVQKHTSLARCGKSCRLRWANHLRPNLKKGAFSQEEEQLIVEMHAKMGNKWAQMAEH  124

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++H++    S +    +       +H + L
Sbjct  125   LPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEIHVEDFQWSEEYTKSNIIRVDRRRHQDFL  184

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRL  1263
             Q+   +   V F +L     L P +    D+ A ++L  G +SS         +   +++
Sbjct  185   QLGNSKA-NVLFDDLNFAASLLPAASDLSDLVACNMLGTGPSSSRYESYMPPILPSPRQI  243

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS------  1101
                 S F   SSN    F +   +QN      +      S      D DHP         
Sbjct  244   WESGSRFPMCSSNIKHEFQSPEHFQN-----TASQKNPRSCSISPCDVDHPPYGNQHLSD  298

Query  1100  CVIPGSHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDspssp-----lpsleSVETL  942
              +IP SH  +     + +P++ A K ELPS Q S+  ++D   +         L+SV+  
Sbjct  299   MMIPDSHTLMYGMLPTSKPSFGAVKLELPSFQYSETSAFDQWKTTPSPPHSDLLDSVDAY  358

Query  941   IQSPPTER-SESGNVSPRNSGLLEAVLYESQTLKHSKNTL----PQQNSGASIIPSDIVD  777
             IQSPP+ +  ES   S  ++GLL+ +L+E++    +K++L    PQ++  ++   +++  
Sbjct  359   IQSPPSSQVEESDCFSSCDTGLLDMLLHEAKIKTSAKHSLLMSSPQKSFSSTTCTTNVTQ  418

Query  776   NT  771
             N 
Sbjct  419   NV  420



>emb|CDY56849.1| BnaCnng31260D [Brassica napus]
Length=503

 Score =   259 bits (662),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 173/403 (43%), Positives = 232/403 (58%), Gaps = 34/403 (8%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATG---GANAGGVPLKKGPWTSAEDAILMEYVTRHG  1803
             MS T+ES+D       ++SP+ +   G    +   G  LKKGPWTS ED IL+ YV +HG
Sbjct  1     MSYTAESDDD-----GMHSPAGDSIGGYGCKSRGKGSVLKKGPWTSTEDGILINYVRKHG  55

Query  1802  EGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMA  1623
             EGNWNAVQK+T LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+++HAKMGNKWA+MA
Sbjct  56    EGNWNAVQKYTSLARCGKSCRLRWANHLRPNLKKGAFSQEEERLIVQMHAKMGNKWAQMA  115

Query  1622  AELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSN  1443
               LPGRTDNEIKNYWNTRIKRR RAGLP+YPP++H++ +  S +    +       +H +
Sbjct  116   EHLPGRTDNEIKNYWNTRIKRRHRAGLPLYPPELHVEDLQWSEEYTTSNVTRVNRRRHQD  175

Query  1442  LLQVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNP--  1275
             +LQ+   +   V F +L     L P +   LD+   ++L  G +SS    P+ S M P  
Sbjct  176   ILQLGNSKA-DVLFDDLNFATNLLPGASDVLDMFTCNMLGTGASSS----PYESYMPPIL  230

Query  1274  --SKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS  1101
                K+LR   SLF   SSN    F +  P+QN     +S         Y N  P      
Sbjct  231   PSPKQLRDSGSLFPMCSSNIKQEFHSPEPFQNPRSCSISPCDVGHHSPYGNQRPS----D  286

Query  1100  CVIPGSHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDspssplps------leSVET  945
              +I  SHA  +    + +P + A K ELPS Q S+   +D   +  PS      L+SV+ 
Sbjct  287   VMISDSHAFTDGMLPTSKPLFGAVKLELPSFQYSETSGFDQWKTTTPSPPHSDPLDSVDA  346

Query  944   LIQSPP---TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTL  825
              IQSPP    E  ES   S  ++GLL+ +L  ++    +K +L
Sbjct  347   YIQSPPPLEIEEDESNCFSSCDTGLLDMLLPNAKIKTSAKRSL  389



>ref|NP_850779.1| myb domain protein 33 [Arabidopsis thaliana]
 ref|NP_001078537.1| myb domain protein 33 [Arabidopsis thaliana]
 gb|AAL58844.1|AF411969_1 putative transcription factor MYB33 [Arabidopsis thaliana]
 dbj|BAC43518.1| putative transcription factor MYB33 [Arabidopsis thaliana]
 gb|AAP04034.1| putative MYB family transcription factor [Arabidopsis thaliana]
 gb|AAS10086.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AED90965.1| myb domain protein 33 [Arabidopsis thaliana]
 gb|AED90966.1| myb domain protein 33 [Arabidopsis thaliana]
Length=520

 Score =   258 bits (660),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 171/381 (45%), Positives = 222/381 (58%), Gaps = 29/381 (8%)
 Frame = -1

Query  1877  GVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKG  1698
             G  LKKGPW+SAED IL++YV +HGEGNWNAVQKHT L RCGKSCRLRWANHL+P+LKKG
Sbjct  29    GHALKKGPWSSAEDDILIDYVNKHGEGNWNAVQKHTSLFRCGKSCRLRWANHLRPNLKKG  88

Query  1697  AFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVH  1518
             AF+ EEE  I+ELHAKMGN+WARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++H
Sbjct  89    AFSQEEEQLIVELHAKMGNRWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEMH  148

Query  1517  LQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPLDIPASS  1338
             ++A+ E +Q    S     D +H + LQ+   E   V F  L     +      D+   +
Sbjct  149   VEAL-EWSQEYAKSRVMGEDRRHQDFLQLGSCE-SNVFFDTLNFTDMV--PGTFDLADMT  204

Query  1337  LLAQGLNSSYGPRPFFSTMNP----SKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQ  1170
                   N +  PR + + M P    SKRL   + L+ G SS     F++   ++N +   
Sbjct  205   AYKNMGNCASSPR-YENFMTPTIPSSKRLWESELLYPGCSSTIKQEFSSPEQFRNTSPQT  263

Query  1169  VsqssgfssgyyQNLDPDHPSLS-----CVIPGSHAslnsnsssLEPAW-AKKPELPSLQ  1008
             +S++  FS       D +HP         +IP SH   +      +P + A K ELPS Q
Sbjct  264   ISKTCSFSVP----CDVEHPLYGNRHSPVMIPDSHTPTDGIVPYSKPLYGAVKLELPSFQ  319

Query  1007  SQIVSWDspssplp-----sleSVETLIQS--PPTERSESGNVSPRNSGLLEAVLYESQT  849
                 ++D             L+  +T IQS  PPT   ES   S  ++GLL+ +L E++ 
Sbjct  320   YSETTFDQWKKSSSPPHSDLLDPFDTYIQSPPPPTGGEESDLYSNFDTGLLDMLLLEAKI  379

Query  848   LKHS-KNTLPQQNSGASIIPS  789
               +S KN L    S AS IPS
Sbjct  380   RNNSTKNNL--YRSCASTIPS  398



>ref|XP_010452523.1| PREDICTED: transcription factor GAMYB-like [Camelina sativa]
 ref|XP_010452524.1| PREDICTED: transcription factor GAMYB-like [Camelina sativa]
Length=527

 Score =   258 bits (660),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 177/413 (43%), Positives = 230/413 (56%), Gaps = 31/413 (8%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPW+SAED IL++YV +HGEGNWNAVQKHTGL RCGKSCRLRWANHL+P+LKKGAF+
Sbjct  33    LKKGPWSSAEDDILIDYVNKHGEGNWNAVQKHTGLFRCGKSCRLRWANHLRPNLKKGAFS  92

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              +EE  I+ELHAKMGN+WARMAA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++HL+ 
Sbjct  93    QDEEQLIVELHAKMGNRWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEMHLEV  152

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPLDIPASSLLA  1329
             +  S Q    + F   D +HS+ LQ+   E   V F NL            D+   +   
Sbjct  153   LDWS-QEYAKNRFMGEDRRHSDFLQLGSCE-SDVFFDNLGFVTTDMVPGASDLSDMTAYK  210

Query  1328  QGLNSSYGPR--PFFSTMNP-SKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqs  1158
                N++  PR   F + M P S+R    + L+ G SS     F +   + N +  Q    
Sbjct  211   NMANAASSPRYDNFMAPMMPCSRRFWESELLYPGCSSTIKQEFPSPEQFVNTSSPQ---K  267

Query  1157  sgfssgyyQNLDPDHPSLS-------CVIPGSHAslnsnsssLEPA--WAKKPELPSLQS  1005
                +  +    D  HP L         VIP SH        S +P+   A K ELPS Q 
Sbjct  268   ISKTCSFSVPCDVYHPLLYGNQQHSPVVIPDSHTPTGGIVPSSKPSSYGAVKLELPSFQY  327

Query  1004  QIVSWDspssplp-----sleSVETLIQS--PPTERSESGNVSPRNSGLLEAVLYESQTL  846
                ++D             L+  ++ I S  PPT R ES   S  ++GLL+ +L E++  
Sbjct  328   SETTFDQWKKSSSPPHSDLLDPFDSYIHSPPPPTGRQESDCFSNCDTGLLDMLLLEAKIR  387

Query  845   KH-SKNTLPQQNSGASIIPS-DIVDNTFPDFHETEWEGYSDPISPLGHSAASV  693
                +KN L    S AS IPS D+ + T     +T+ E + + +    HS  S 
Sbjct  388   NSTTKNNL--YKSCASTIPSADLGEVT---VSQTKSEEFDNSLKSFVHSEIST  435



>ref|XP_006407447.1| hypothetical protein EUTSA_v10020455mg [Eutrema salsugineum]
 gb|ESQ48900.1| hypothetical protein EUTSA_v10020455mg [Eutrema salsugineum]
Length=547

 Score =   258 bits (658),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 168/401 (42%), Positives = 230/401 (57%), Gaps = 26/401 (6%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGAN---AGGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             + T ES+D M    +  SP+ + + G  N     G  LKKGPWTS+ED IL+ YV +HGE
Sbjct  5     TTTVESDDGMQSSIHNESPAAD-SIGNDNRSRGKGKVLKKGPWTSSEDGILINYVKKHGE  63

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQKHT L+RCGKSCRLRWANHL+P+LKKGAF+ EEE  I+E+HAKMGNKWA MA 
Sbjct  64    GNWNAVQKHTSLSRCGKSCRLRWANHLRPNLKKGAFSQEEEQLIVEMHAKMGNKWAHMAE  123

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNL  1440
              LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++H++ +  S +    + F     ++ + 
Sbjct  124   HLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEIHVEDLQWSEEYTTSNIFGVDRRRNQDF  183

Query  1439  LQVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKR  1266
             LQ+   +  A+ F +L +   L P +    D+ A ++L  G  +S         +   KR
Sbjct  184   LQLGNSKANAL-FDDLNIATSLLPGASDLSDMFACNMLGTGATTSRYESYMPPILPSPKR  242

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHP------SL  1104
             L    S F   SSN    F +   +QN      +Q     S      + DHP      S 
Sbjct  243   LLESGSRFPMCSSNIKHEFQSPEHFQN-----TAQQKNHKSCSISPCEVDHPRNGNRHSS  297

Query  1103  SCVIPGSHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDspssp-----lpsleSVET  945
               +IP SH   +    + +P + A K ELPS Q S+  ++D   +         ++SV+ 
Sbjct  298   DMMIPNSHTFTDGMLPTSKPIFGAVKLELPSFQYSETSAFDLWKTTPPSPQSDLVDSVDA  357

Query  944   LIQS-PPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTL  825
              IQS PP E  ES   S  ++GLL+ +L+E++    +K+ L
Sbjct  358   YIQSPPPLEIEESDCFSSCDTGLLDMLLHEAKIKTSAKHRL  398



>ref|XP_009146725.1| PREDICTED: transcription factor GAMYB isoform X2 [Brassica rapa]
Length=499

 Score =   256 bits (655),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 178/424 (42%), Positives = 240/424 (57%), Gaps = 40/424 (9%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANA--GGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             MS T+ES+D       ++SP+ +    G  +   G  LKKGPWTS ED IL+ YV +HGE
Sbjct  1     MSYTAESDDD-----GMHSPAGDSIGYGCKSRGKGSVLKKGPWTSTEDGILINYVRKHGE  55

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+T LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+++HAKMGNKWA+MA 
Sbjct  56    GNWNAVQKYTSLARCGKSCRLRWANHLRPNLKKGAFSQEEERLIVQMHAKMGNKWAQMAE  115

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQ-HSN  1443
              LPGRTDNEIKNYWNTRIKRR RAGLP+YPP++H++ +  S +    +       + H +
Sbjct  116   HLPGRTDNEIKNYWNTRIKRRHRAGLPLYPPELHVEDLQWSEEYITSNVTRVNRRRHHQD  175

Query  1442  LLQVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNP--  1275
             +LQ+   +   V F +L     L P +   LD+   ++L  G +SS    P+ S M P  
Sbjct  176   ILQLGNSKA-DVLFDDLNFATSLLPGASDVLDMFTCNMLGTGASSS----PYESYMPPIL  230

Query  1274  --SKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS  1101
                K+LR   SLF   SSN    F +  P+QN     +S         Y N    HPS  
Sbjct  231   PSPKQLRESGSLFPMCSSNIKQEFHSPEPFQNPRSCSISPCDVGHHSPYGN---QHPS-D  286

Query  1100  CVIPGSHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDspssp-----lpsleSVETL  942
              +I  SHA  +    + +P + A K ELPS Q S+   +D   +         L+SV+  
Sbjct  287   VMISDSHAFTDGMLPTSKPLFGAVKLELPSFQYSETSGFDQWKTTPSPPHSDPLDSVDAY  346

Query  941   IQSPP---TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTL-------PQQNSGASIIP  792
             IQSPP    E+ ES   S  ++GLL+ +L  ++    +K +L       P Q S     P
Sbjct  347   IQSPPPLEIEKDESNCFSSCDTGLLDMLLPNAKIKTSAKRSLALPEIPIPTQLSAGENSP  406

Query  791   SDIV  780
              ++V
Sbjct  407   GNVV  410



>ref|NP_187751.1| myb domain protein 65 [Arabidopsis thaliana]
 gb|AAG43496.1|AF048840_1 MYB65 [Arabidopsis thaliana]
 gb|AAG51434.1|AC008153_7 putative transcription factor; 45591-47464 [Arabidopsis thaliana]
 gb|AAO41985.1| putative Myb DNA-binding protein [Arabidopsis thaliana]
 gb|AAO50653.1| putative Myb DNA-binding protein [Arabidopsis thaliana]
 gb|AAS10055.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE75047.1| myb domain protein 65 [Arabidopsis thaliana]
Length=553

 Score =   258 bits (658),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 169/418 (40%), Positives = 242/418 (58%), Gaps = 22/418 (5%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGG--VPLKKGPWTSAEDAILMEYVTRHGEGNW  1791
             T++S+D M    +  SP+ +  + G  + G    LKKGPWTS ED IL++YV +HGEGNW
Sbjct  7     TADSDDGMHSSIHNESPAPDSISNGCRSRGKRSVLKKGPWTSTEDGILIDYVKKHGEGNW  66

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQKHT LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+E+HAKMGNKWA+MA  LP
Sbjct  67    NAVQKHTSLARCGKSCRLRWANHLRPNLKKGAFSQEEEQLIVEMHAKMGNKWAQMAEHLP  126

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTG-DTQHSNLLQ  1434
             GRTDNEIKNYWNTRIKRRQRAGLP+YPP++++  +H S +    +        +H + LQ
Sbjct  127   GRTDNEIKNYWNTRIKRRQRAGLPLYPPEIYVDDLHWSEEYTKSNIIRVDRRRRHQDFLQ  186

Query  1433  VNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLR  1260
             +   +   V F +L     L P +    D+ A ++L  G +SS         +   K++ 
Sbjct  187   LGNSK-DNVLFDDLNFAASLLPAASDLSDLVACNMLGTGASSSRYESYMPPILPSPKQIW  245

Query  1259  GPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDP---DHPSLSCVIP  1089
                S F   SSN    F +   +QN T +Q +  S   S    +  P    H S   ++P
Sbjct  246   ESGSRFPMCSSNIKHEFQSPEHFQN-TAVQKNPRSCSISPCDVDHHPYENQHSSHMMMVP  304

Query  1088  GSHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDspssp-----lpsleSVETLIQS-  933
              SH        + +P + A K ELPS Q S+  ++D   +         L+SV+  IQS 
Sbjct  305   DSHTVTYGMHPTSKPLFGAVKLELPSFQYSETSAFDQWKTTPSPPHSDLLDSVDAYIQSP  364

Query  932   PPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTL----PQQNSGASIIPSDIVDNT  771
             PP++  ES   S  ++GLL+ +L+E++    +K++L    PQ++  ++   +++  N 
Sbjct  365   PPSQVEESDCFSSCDTGLLDMLLHEAKIKTSAKHSLLMSSPQKSFSSTTCTTNVTQNV  422



>ref|XP_009146724.1| PREDICTED: transcription factor GAMYB isoform X1 [Brassica rapa]
Length=502

 Score =   256 bits (654),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 173/402 (43%), Positives = 233/402 (58%), Gaps = 33/402 (8%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANA--GGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             MS T+ES+D       ++SP+ +    G  +   G  LKKGPWTS ED IL+ YV +HGE
Sbjct  1     MSYTAESDDD-----GMHSPAGDSIGYGCKSRGKGSVLKKGPWTSTEDGILINYVRKHGE  55

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+T LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+++HAKMGNKWA+MA 
Sbjct  56    GNWNAVQKYTSLARCGKSCRLRWANHLRPNLKKGAFSQEEERLIVQMHAKMGNKWAQMAE  115

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQ-HSN  1443
              LPGRTDNEIKNYWNTRIKRR RAGLP+YPP++H++ +  S +    +       + H +
Sbjct  116   HLPGRTDNEIKNYWNTRIKRRHRAGLPLYPPELHVEDLQWSEEYITSNVTRVNRRRHHQD  175

Query  1442  LLQVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNP--  1275
             +LQ+   +   V F +L     L P +   LD+   ++L  G +SS    P+ S M P  
Sbjct  176   ILQLGNSKA-DVLFDDLNFATSLLPGASDVLDMFTCNMLGTGASSS----PYESYMPPIL  230

Query  1274  --SKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS  1101
                K+LR   SLF   SSN    F +  P+QN     +S         Y N    HPS  
Sbjct  231   PSPKQLRESGSLFPMCSSNIKQEFHSPEPFQNPRSCSISPCDVGHHSPYGN---QHPS-D  286

Query  1100  CVIPGSHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDspssp-----lpsleSVETL  942
              +I  SHA  +    + +P + A K ELPS Q S+   +D   +         L+SV+  
Sbjct  287   VMISDSHAFTDGMLPTSKPLFGAVKLELPSFQYSETSGFDQWKTTPSPPHSDPLDSVDAY  346

Query  941   IQSPP---TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTL  825
             IQSPP    E+ ES   S  ++GLL+ +L  ++    +K +L
Sbjct  347   IQSPPPLEIEKDESNCFSSCDTGLLDMLLPNAKIKTSAKRSL  388



>gb|AFQ37424.1| myb domain protein 33 [Larix kaempferi]
Length=603

 Score =   258 bits (658),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 204/476 (43%), Positives = 259/476 (54%), Gaps = 69/476 (14%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWTSAEDAIL+EYV +HGEGNWNAVQKH+GL RCGKSCRLRWANHL+P+LKKGAFT
Sbjct  33    LKKGPWTSAEDAILVEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFT  92

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              EEE  IIELHAK+G+KWARMAA+LPGRTDNEIKNYWNTRIKRRQR GLP+YPPD+ LQ 
Sbjct  93    AEEEQIIIELHAKLGSKWARMAAQLPGRTDNEIKNYWNTRIKRRQRQGLPLYPPDLPLQQ  152

Query  1508  IHESNQNED--MSTFSTGDTQHSN-------LLQVNYFEIPAVEFKNLELNQQLHPQSPL  1356
              +  NQ     ++      TQH+N       L      EIP V F  L+  Q  H  +  
Sbjct  153   SNNENQQNQQPINGADAATTQHNNSHSHHEFLSNSTKLEIPNVTFDGLKPGQ--HALTYT  210

Query  1355  DIPA------SSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFT-GLSSNDSDIFTAFG  1197
               PA      SS+L Q +  S G R   + +  +KR+R  +S+ + G+        T FG
Sbjct  211   SFPALTEVSMSSILNQAMGLSQGYR-MVNPIQRAKRIRDSESMMSFGIGGGG---ITPFG  266

Query  1196  PYQNDT--------CM---------QVsqssgfssgyyQNLD-------PDHPSLS----  1101
              + +DT        C          Q ++  G S      LD       P  P+LS    
Sbjct  267   QFVDDTPAKSIGEPCFKAARRLPYAQPARLDGSSYAQPARLDGFVSNGFPYDPNLSNRNS  326

Query  1100  ---------CVIPGSHAslnsnsssLEPAWAKKPELPS--LQSQIVSWDspssplpsleS  954
                       ++ GSHA LN N S   P    K ELPS  L   + +  +    + +   
Sbjct  327   NHNLSTPFGSLMIGSHALLNGNLSPPTPLPGVKLELPSSQLAESVHTTGTRLGTVNTHTD  386

Query  953   VETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIP-----S  789
               +   SPP   +     SP NSGLLEA+L+ESQ +    N   + +   + +P     S
Sbjct  387   NNSYTLSPPVPSTHVDGFSPHNSGLLEALLHESQAMGSGGNK--RSSEMITQLPPISSRS  444

Query  788   DIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYT-PISASSLEEHQSVEMLAG  624
             ++ +       ETE   YSDPI+PLG  AASVF+E T P+S S  +E  S +   G
Sbjct  445   NLTNCVGASQSETECGEYSDPITPLGGPAASVFSENTPPLSTSPWDESSSAQSAIG  500



>ref|XP_010558042.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Tarenaya 
hassleriana]
Length=558

 Score =   256 bits (655),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 190/439 (43%), Positives = 261/439 (59%), Gaps = 22/439 (5%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANA--GGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             MS T++  D      + N  S  +   G  +   G  LKKGPWT+AEDAIL++YV +HGE
Sbjct  1     MSHTTDESDDGMYSNHHNEASGADIGSGCRSRWDGTVLKKGPWTTAEDAILIDYVKKHGE  60

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+TGL+RCGKSCRLRWANHL+P+LKKGAF+ EEE  IIELHA+MGNKWARMAA
Sbjct  61    GNWNAVQKYTGLSRCGKSCRLRWANHLRPNLKKGAFSEEEEQLIIELHARMGNKWARMAA  120

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNL  1440
              LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++H++A+ + NQ    +       +H + 
Sbjct  121   HLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEMHVEAL-QWNQEYTKTEIIGPAKRHQDF  179

Query  1439  LQVNYFEIPAVEFKNLELNQQLHPQS--PLDIPASSLLAQGLNSSYGPRPFFSTMNPSKR  1266
             LQV   E P V F +L++   + P +    DIP+ ++L  G +SS   + F   +  S +
Sbjct  180   LQVGNCE-PNVLFDSLKVVTGMVPSALDISDIPSCNILGNGASSSQY-KSFIPPLMQSPK  237

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
              R   SLF+G  SN  D F +   +Q+    ++S+S GFS     +    +     VI G
Sbjct  238   -RESRSLFSGYCSNIKDEFLSPEEFQSSAQQKISKSLGFSFPRDADPPDGNQHYPDVING  296

Query  1085  SHAslnsns-ssLEPAWAK-KPELPSLQSQIVSWDs----pssplpsleSVETLIQS-PP  927
             SH  +++   +S +P+    K ELPS Q    ++D      +     LESV+  IQS PP
Sbjct  297   SHTLMDAIFPTSSKPSLGTVKSELPSFQYPETNFDQWNAPSTLHSDLLESVDAYIQSPPP  356

Query  926   TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPS-DI----VDNTFPD  762
               R+E+      N+GLL+ VL+E++    +KN         S I S DI    + +  P+
Sbjct  357   MGRTETDCYDSCNTGLLDTVLHEAKIRTGAKNGSFSSEKSFSSITSPDIAAEGITHNDPE  416

Query  761   FHETEWEGYSDPISPLGHS  705
                 E+EG +  + PL +S
Sbjct  417   TKYKEFEGTT--LEPLANS  433



>emb|CDY08526.1| BnaA05g27620D [Brassica napus]
Length=502

 Score =   254 bits (649),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 171/402 (43%), Positives = 231/402 (57%), Gaps = 33/402 (8%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANA--GGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             MS T+ES+D       ++SP+ +    G  +   G  LKKGPWTS ED IL+ YV +HGE
Sbjct  1     MSYTAESDDD-----GMHSPAGDSIGYGCKSRGKGSVLKKGPWTSTEDGILINYVRKHGE  55

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+T LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+++HAKMGNKWA+MA 
Sbjct  56    GNWNAVQKYTSLARCGKSCRLRWANHLRPNLKKGAFSQEEERLIVQMHAKMGNKWAQMAE  115

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQ-HSN  1443
              LPGRTDNEIKNYWNTRIKRR RAGLP+YPP++H++ +  S +    +       + H +
Sbjct  116   HLPGRTDNEIKNYWNTRIKRRHRAGLPLYPPELHVEDLQWSEEYITSNVTRVNRRRHHQD  175

Query  1442  LLQVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNP--  1275
             +LQ+   +   V F +L     L P +   LD+   ++L  G +SS    P+ S M P  
Sbjct  176   ILQLGNSKA-DVLFDDLNFATSLLPGASDVLDMFTCNMLGTGASSS----PYESYMPPIL  230

Query  1274  --SKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLS  1101
                K+LR   SLF   SSN    F +  P+QN     +S         Y N  P      
Sbjct  231   PSPKQLRESGSLFPICSSNIKQEFHSPEPFQNPRSCSISPCDVGHHSPYGNQRPS----D  286

Query  1100  CVIPGSHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDspssp-----lpsleSVETL  942
              +I  SHA  +    + +P + A K ELPS Q S+   +D   +         L+SV+  
Sbjct  287   VMISDSHAFTDGMLLTSKPLFGAVKLELPSFQYSETSGFDQWKTTPSPPHSDPLDSVDAY  346

Query  941   IQSPP---TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTL  825
             IQSPP    E+ ES   S  ++GLL+ +L  ++    +K +L
Sbjct  347   IQSPPPLEIEKDESNCFSSCDTGLLDMLLPNAKIKTSAKRSL  388



>ref|XP_010558038.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558039.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558040.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Tarenaya 
hassleriana]
Length=569

 Score =   256 bits (654),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 190/439 (43%), Positives = 261/439 (59%), Gaps = 22/439 (5%)
 Frame = -1

Query  1973  MSITSESEDSMTLKGNVNSPSVEEATGGANA--GGVPLKKGPWTSAEDAILMEYVTRHGE  1800
             MS T++  D      + N  S  +   G  +   G  LKKGPWT+AEDAIL++YV +HGE
Sbjct  1     MSHTTDESDDGMYSNHHNEASGADIGSGCRSRWDGTVLKKGPWTTAEDAILIDYVKKHGE  60

Query  1799  GNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAA  1620
             GNWNAVQK+TGL+RCGKSCRLRWANHL+P+LKKGAF+ EEE  IIELHA+MGNKWARMAA
Sbjct  61    GNWNAVQKYTGLSRCGKSCRLRWANHLRPNLKKGAFSEEEEQLIIELHARMGNKWARMAA  120

Query  1619  ELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNL  1440
              LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP++H++A+ + NQ    +       +H + 
Sbjct  121   HLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEMHVEAL-QWNQEYTKTEIIGPAKRHQDF  179

Query  1439  LQVNYFEIPAVEFKNLELNQQLHPQS--PLDIPASSLLAQGLNSSYGPRPFFSTMNPSKR  1266
             LQV   E P V F +L++   + P +    DIP+ ++L  G +SS   + F   +  S +
Sbjct  180   LQVGNCE-PNVLFDSLKVVTGMVPSALDISDIPSCNILGNGASSSQY-KSFIPPLMQSPK  237

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
              R   SLF+G  SN  D F +   +Q+    ++S+S GFS     +    +     VI G
Sbjct  238   -RESRSLFSGYCSNIKDEFLSPEEFQSSAQQKISKSLGFSFPRDADPPDGNQHYPDVING  296

Query  1085  SHAslnsns-ssLEPAWAK-KPELPSLQSQIVSWDs----pssplpsleSVETLIQS-PP  927
             SH  +++   +S +P+    K ELPS Q    ++D      +     LESV+  IQS PP
Sbjct  297   SHTLMDAIFPTSSKPSLGTVKSELPSFQYPETNFDQWNAPSTLHSDLLESVDAYIQSPPP  356

Query  926   TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPS-DI----VDNTFPD  762
               R+E+      N+GLL+ VL+E++    +KN         S I S DI    + +  P+
Sbjct  357   MGRTETDCYDSCNTGLLDTVLHEAKIRTGAKNGSFSSEKSFSSITSPDIAAEGITHNDPE  416

Query  761   FHETEWEGYSDPISPLGHS  705
                 E+EG +  + PL +S
Sbjct  417   TKYKEFEGTT--LEPLANS  433



>gb|EYU42906.1| hypothetical protein MIMGU_mgv1a007686mg [Erythranthe guttata]
Length=398

 Score =   250 bits (638),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 164/234 (70%), Gaps = 17/234 (7%)
 Frame = -1

Query  1970  SITSESEDSMTLKGNVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNW  1791
             S T+ES+D + L  +    +  E +GG++ G   LKKGPWT+AED+IL++YV RHGEGNW
Sbjct  4     STTTESDDGV-LSADSPLSNDGENSGGSSNGNALLKKGPWTTAEDSILVDYVKRHGEGNW  62

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQKH+GL+RCGKSCRLRWANHL+P+LKKGAFT EEE  IIELHAKMGNKWARMAA LP
Sbjct  63    NAVQKHSGLSRCGKSCRLRWANHLRPNLKKGAFTSEEERLIIELHAKMGNKWARMAAHLP  122

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQV  1431
             GRTDNEIKNYWNTRIKRRQRAGLP+YPPD+ L A+ E NQ+        G     +++Q+
Sbjct  123   GRTDNEIKNYWNTRIKRRQRAGLPLYPPDLCLHALPE-NQHHGSPGIYEG---CHDIMQI  178

Query  1430  NYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNP  1275
             N +E P   F N  +       SP   + P    ++  +++S G  P F T  P
Sbjct  179   NGYETPDFMFDNFNI-------SPYTSEFPG---ISATVSTSNGFAPQFCTFGP  222



>emb|CDY69320.1| BnaAnng29990D, partial [Brassica napus]
Length=203

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 137/182 (75%), Gaps = 3/182 (2%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGG---ANAGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             +T ES+D+M       SPS  + TG    +   G  LKKGPWTS ED IL++YV RHGEG
Sbjct  6     VTDESDDAMYSSIYNESPSAADNTGSGCTSRGKGSVLKKGPWTSTEDGILIDYVKRHGEG  65

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWN VQKHT LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+E+HA+MGNKWA+MA  
Sbjct  66    NWNTVQKHTSLARCGKSCRLRWANHLRPNLKKGAFSKEEEQLIVEMHARMGNKWAQMAEH  125

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP  H++ +H S +    ++  T   +H ++L
Sbjct  126   LPGRTDNEIKNYWNTRIKRRQRAGLPLYPPGTHVEDLHWSQEYHPSTSNVTDRRRHQDIL  185

Query  1436  QV  1431
             Q+
Sbjct  186   QL  187



>emb|CDY72198.1| BnaAnng40310D, partial [Brassica napus]
Length=203

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGG---ANAGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             +T ES+D+M       SPS  +  G    +   G  LKKGPWTS ED IL++YV RHGEG
Sbjct  6     VTDESDDAMYSSIYNESPSAADNIGSGCTSRGKGSVLKKGPWTSTEDGILIDYVKRHGEG  65

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWN VQKHT LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+E+HA+MGNKWA+MA  
Sbjct  66    NWNTVQKHTSLARCGKSCRLRWANHLRPNLKKGAFSKEEEQLIVEMHARMGNKWAQMAEH  125

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP  H++ +H S Q    ++  T   +H ++L
Sbjct  126   LPGRTDNEIKNYWNTRIKRRQRAGLPLYPPGTHVEDLHWSQQYHPSTSNVTDRRRHQDIL  185

Query  1436  QV  1431
             Q+
Sbjct  186   QL  187



>ref|XP_010495790.1| PREDICTED: transcription factor GAMYB-like [Camelina sativa]
Length=547

 Score =   249 bits (637),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 165/395 (42%), Positives = 230/395 (58%), Gaps = 17/395 (4%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGG--ANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNW  1791
             T ES+D M       S + +  + G  +   G  LKKGPWTS ED IL++YV +HGEGNW
Sbjct  6     TVESDDGMHSSIYNESSAADSISNGYRSRGRGGALKKGPWTSTEDGILIDYVKKHGEGNW  65

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQKHT LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+E+HAK+GNKWA+MA  LP
Sbjct  66    NAVQKHTSLARCGKSCRLRWANHLRPNLKKGAFSEEEEQLIVEMHAKIGNKWAQMAEHLP  125

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQV  1431
             GRTDNEIKNYWNTRIKRRQRAGLP+YPP++H++ +  S ++   +       +  + LQ+
Sbjct  126   GRTDNEIKNYWNTRIKRRQRAGLPLYPPEIHVEDLQWSEEDTKSNIIRVDRRRRQDFLQL  185

Query  1430  NYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRG  1257
                +   + F +L     L P +    D+ A ++L  G +SS+        +   K+L  
Sbjct  186   GNSKANLL-FDDLSFAASLLPAASDLSDLVACNMLGTGASSSWYESYMPPILPSPKQLWD  244

Query  1256  PDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDP---DHPSLSCVIPG  1086
               S F   SSN      +   +QN T  Q +  S   S  Y +  P    H S   +I  
Sbjct  245   SGSRFPMCSSNIKHEVQSPEYFQN-TASQKNPRSCSISPCYVDHPPYGNQHSSDMMMILD  303

Query  1085  SHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDspssp-----lpsleSVETLIQS-P  930
             SH   +    + +P++ A K ELPS Q S+  ++D   +         L+SV+  IQS P
Sbjct  304   SHTLADGMLPTSKPSFGAVKLELPSFQYSETSAFDQWKATPSPPHSDLLDSVDAYIQSPP  363

Query  929   PTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTL  825
             P+E  ES   S  ++GLL+ +L+E++    +K++L
Sbjct  364   PSEIEESDCFSSCDTGLLDMLLHEAKIKTSAKHSL  398



>dbj|BAA96421.1| GAMyb protein [Triticum aestivum]
Length=163

 Score =   236 bits (603),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 128/157 (82%), Gaps = 2/157 (1%)
 Frame = -1

Query  1883  AGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLK  1704
              GG PLKKGPWTSAEDAIL++YV +HGEGNWNAVQK+TGL RCGKSCRLRWANHL+P+LK
Sbjct  5     GGGPPLKKGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHLRPNLK  64

Query  1703  KGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPD  1524
             KGAFTPEEE  II+LH+KMGNKWARMAA LPGRTDNEIKNYWNTRIKR QRAGLPIYP  
Sbjct  65    KGAFTPEEERLIIQLHSKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRCQRAGLPIYPAS  124

Query  1523  VHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEIP  1413
             V  Q+ +E  Q    S F+ G+   S+LL  N   +P
Sbjct  125   VCNQSSNEDQQGS--SDFNCGENLSSDLLNGNGLYLP  159



>ref|XP_010464847.1| PREDICTED: transcription factor GAMYB-like [Camelina sativa]
Length=542

 Score =   249 bits (635),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 167/416 (40%), Positives = 238/416 (57%), Gaps = 21/416 (5%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGG--ANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNW  1791
             T ES+D M       S + +  + G  +   G  LKKGPWTS ED IL++YV +HGEGNW
Sbjct  6     TVESDDGMHSSIYNESSAADSISNGYRSRGRGGALKKGPWTSTEDGILIDYVKKHGEGNW  65

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQKHT LARCGKSCRLRWANHL+P+LKKGAF+ +EE  I+ELHAK+GNKWA+MA  LP
Sbjct  66    NAVQKHTSLARCGKSCRLRWANHLRPNLKKGAFSEDEEQLIVELHAKLGNKWAQMAEHLP  125

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQV  1431
             GRTDNEIKNYWNTRIKRRQRAGLP+YPP++H++ +  S ++   +       +  + LQ 
Sbjct  126   GRTDNEIKNYWNTRIKRRQRAGLPLYPPEIHVEDLQWSEEDTKSNIIRVDRRRRQDFLQF  185

Query  1430  NYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRG  1257
                +   + F NL     L P +    D+ A ++L  G +SS+        +   K++  
Sbjct  186   GNSKANLL-FDNLSFAASLLPAASDISDLVACNMLGTGASSSWYESYMPPILPSPKQVWE  244

Query  1256  PDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDP---DHPSLSCVIPG  1086
               S F   SSN      +   +QN T  Q +  S   S  Y +  P    H S   +I  
Sbjct  245   SGSRFPMCSSNIKHEVQSPEYFQN-TASQKNPRSCSISPCYVDHPPYGNQHSSDMMMILD  303

Query  1085  SHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDspssp-----lpsleSVETLIQS-P  930
             SH   +    + +P++ A K ELPS Q S+  ++D   +         L+SV+  IQS P
Sbjct  304   SHTLTDGMLPTSKPSFGAVKLELPSFQYSETSAFDQWKTTPSPPHSDLLDSVDAYIQSPP  363

Query  929   PTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTL----PQQNSGASIIPSDIVDN  774
             P++  ES   S  ++GLL+ +L+E++    +K++L    P+++  ++   +D   N
Sbjct  364   PSQIEESDCFSSCDTGLLDMLLHEAKIKTSAKHSLLSSSPEKSFCSTTCTTDATQN  419



>ref|XP_009121138.1| PREDICTED: transcription factor GAMYB-like isoform X2 [Brassica 
rapa]
Length=472

 Score =   245 bits (625),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 167/412 (41%), Positives = 226/412 (55%), Gaps = 52/412 (13%)
 Frame = -1

Query  1997  VVPKYYSDMSITSESEDSMTLKGNVNSPSVEEATGG---ANAGGVPLKKGPWTSAEDAIL  1827
             +V +  S   +T ES+D+M       SPS  +  G    +   G  LKKGPWTS ED IL
Sbjct  1     MVEREMSYTMVTDESDDAMYSSIYNESPSAADNIGSGCTSRGKGSVLKKGPWTSTEDGIL  60

Query  1826  MEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKM  1647
             ++YV RHGEGNWN VQKHT LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+E+HA+M
Sbjct  61    IDYVKRHGEGNWNTVQKHTSLARCGKSCRLRWANHLRPNLKKGAFSKEEEQLIVEMHARM  120

Query  1646  GNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFS  1467
             GNKWA+MA  LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP  H++ +H S +    ++  
Sbjct  121   GNKWAQMAEHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPGTHVEDLHWSQEYHPSTSNV  180

Query  1466  TGDTQHSNLLQV---------NYFEIPAVEFKNLELNQQLHPQSPLDIPASSLLAQGLNS  1314
             T   +H ++LQ+         +      V F++L     L P +  DI  S +L  G  S
Sbjct  181   TDRRRHQDILQLGNSKANVLFDDLTFANVLFEDLNFATSLLPVAS-DI--SDMLGTGA-S  236

Query  1313  SYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyy  1134
             SY      S  N  +  + P+             F    P +N     +S    + + + 
Sbjct  237   SYMSPILPSHSNIRQAFQSPEH------------FQNAAPQKNPRSCSISDHPLYGNQHR  284

Query  1133  QNL---DPDHPSLSCVIPGSHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDs----p  981
              ++   D  H     ++P S           +P + A K ELPS Q S+   +D      
Sbjct  285   TDVMIQDSHHTFTDGMVPTS-----------KPLFGAVKLELPSFQYSEASGFDQWTTPS  333

Query  980   ssplpsleSVETLIQS-PPTERSESGNVSPRNSGLLEAVLYESQ---TLKHS  837
             +     L+SV+T IQS PP E  E    S  ++GLL+ +L+E++   + KHS
Sbjct  334   TPQSDLLDSVDTYIQSPPPLEIDEPDCFSSCDTGLLDMLLHEAKIKASAKHS  385



>emb|CDY66041.1| BnaCnng49390D [Brassica napus]
Length=481

 Score =   245 bits (626),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 163/404 (40%), Positives = 223/404 (55%), Gaps = 51/404 (13%)
 Frame = -1

Query  1967  ITSESEDSMTLKGNVNSPSVEEATGG---ANAGGVPLKKGPWTSAEDAILMEYVTRHGEG  1797
             +T ES+D+M       SPS  +  G    +   G  LKKGPWTS ED IL++YV RHGEG
Sbjct  6     VTDESDDAMYSSIYNESPSAADNIGSGCTSRGKGSVLKKGPWTSTEDGILIDYVKRHGEG  65

Query  1796  NWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAE  1617
             NWN VQKHT LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+E+HA+MGNKWA+MA  
Sbjct  66    NWNTVQKHTSLARCGKSCRLRWANHLRPNLKKGAFSKEEEQLIVEMHARMGNKWAQMAEH  125

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP  H++ +H S Q    ++  T   +H ++L
Sbjct  126   LPGRTDNEIKNYWNTRIKRRQRAGLPLYPPGTHVEDLHWSQQYHPSTSNVTDRRRHQDIL  185

Query  1436  QV---------NYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFF  1290
             Q+         +      V F++L     L P +    D+ + ++L  G +S   P    
Sbjct  186   QLGNSKANVLFDDLTFANVLFEDLNFATSLLPVASDISDMFSCNMLGTGASSYMSP-ILP  244

Query  1289  STMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNL---DP  1119
             S  N  +  + P+             F    P +N     +S    + + +  ++   D 
Sbjct  245   SHSNIRQAFQSPEH------------FQNAAPQKNPRSCSISDHPMYGNQHRTDVMIQDS  292

Query  1118  DHPSLSCVIPGSHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDs----pssplpsle  957
              H     ++P S           +P + A K ELPS Q S+   +D      +     L+
Sbjct  293   HHTFTDGMVPTS-----------KPLFGAVKLELPSFQYSEASGFDQWTTPSTPQSDLLD  341

Query  956   SVETLIQS-PPTERSESGNVSPRNSGLLEAVLYESQ---TLKHS  837
             SV+T IQS PP E  E    S  ++GLL+ +L+E++   + KHS
Sbjct  342   SVDTYIQSPPPLEIDEPDCFSSCDTGLLDMLLHEAKIKASAKHS  385



>ref|XP_009121136.1| PREDICTED: transcription factor GAMYB-like isoform X1 [Brassica 
rapa]
Length=475

 Score =   245 bits (625),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 167/412 (41%), Positives = 226/412 (55%), Gaps = 52/412 (13%)
 Frame = -1

Query  1997  VVPKYYSDMSITSESEDSMTLKGNVNSPSVEEATGG---ANAGGVPLKKGPWTSAEDAIL  1827
             +V +  S   +T ES+D+M       SPS  +  G    +   G  LKKGPWTS ED IL
Sbjct  1     MVEREMSYTMVTDESDDAMYSSIYNESPSAADNIGSGCTSRGKGSVLKKGPWTSTEDGIL  60

Query  1826  MEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKM  1647
             ++YV RHGEGNWN VQKHT LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+E+HA+M
Sbjct  61    IDYVKRHGEGNWNTVQKHTSLARCGKSCRLRWANHLRPNLKKGAFSKEEEQLIVEMHARM  120

Query  1646  GNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFS  1467
             GNKWA+MA  LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP  H++ +H S +    ++  
Sbjct  121   GNKWAQMAEHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPGTHVEDLHWSQEYHPSTSNV  180

Query  1466  TGDTQHSNLLQV---------NYFEIPAVEFKNLELNQQLHPQSPLDIPASSLLAQGLNS  1314
             T   +H ++LQ+         +      V F++L     L P +  DI  S +L  G  S
Sbjct  181   TDRRRHQDILQLGNSKANVLFDDLTFANVLFEDLNFATSLLPVAS-DI--SDMLGTGA-S  236

Query  1313  SYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyy  1134
             SY      S  N  +  + P+             F    P +N     +S    + + + 
Sbjct  237   SYMSPILPSHSNIRQAFQSPEH------------FQNAAPQKNPRSCSISDHPLYGNQHR  284

Query  1133  QNL---DPDHPSLSCVIPGSHAslnsnsssLEPAW-AKKPELPSLQ-SQIVSWDs----p  981
              ++   D  H     ++P S           +P + A K ELPS Q S+   +D      
Sbjct  285   TDVMIQDSHHTFTDGMVPTS-----------KPLFGAVKLELPSFQYSEASGFDQWTTPS  333

Query  980   ssplpsleSVETLIQS-PPTERSESGNVSPRNSGLLEAVLYESQ---TLKHS  837
             +     L+SV+T IQS PP E  E    S  ++GLL+ +L+E++   + KHS
Sbjct  334   TPQSDLLDSVDTYIQSPPPLEIDEPDCFSSCDTGLLDMLLHEAKIKASAKHS  385



>gb|ADX60123.1| MYB transcription factor [Zea mays]
Length=267

 Score =   235 bits (599),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 128/252 (51%), Positives = 161/252 (64%), Gaps = 11/252 (4%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEEATGGANA----GGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQK  1776
             M L+  ++S   ++ + G  +     G PLKKGPWTSAEDAIL++YV ++GEGNWNAVQK
Sbjct  18    MMLQEQMDSLVADDVSSGGGSPHRGVGTPLKKGPWTSAEDAILVDYVKKNGEGNWNAVQK  77

Query  1775  HTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDN  1596
             +TGL RCGKSCRLRWANHL+P+LKKGAFTPEEE  II+LHAKMGNKWARMA  LPGRTDN
Sbjct  78    NTGLFRCGKSCRLRWANHLRPNLKKGAFTPEEERLIIQLHAKMGNKWARMAGHLPGRTDN  137

Query  1595  EIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQVNYFEI  1416
             EIKNYWNTRIKR QRA LPIYP  V  Q+ +E  Q      F+ G+   ++LL  N   +
Sbjct  138   EIKNYWNTRIKRCQRASLPIYPASVCNQSTNEDQQLS--GNFNGGENISNDLLSGNSLYL  195

Query  1415  PAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLF  1242
             P     N   N +    +P    +  S+LL Q   S      F   ++ +  L+    + 
Sbjct  196   PDFTSDNFIANPEALSYAPQLSAVSISNLLGQSFASK--SCSFMDQVDQAGMLKQSGCVL  253

Query  1241  TGLS-SNDSDIF  1209
               LS + DS +F
Sbjct  254   PALSDAIDSVLF  265



>ref|XP_006408602.1| hypothetical protein EUTSA_v10002011mg [Eutrema salsugineum]
 gb|ESQ50055.1| hypothetical protein EUTSA_v10002011mg [Eutrema salsugineum]
Length=386

 Score =   239 bits (609),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 164/391 (42%), Positives = 220/391 (56%), Gaps = 60/391 (15%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
               KGPWTSAED +L+ YV +HG+GNWNAVQKH+GL+RCGKSCRLRW NHL+PDLKKGAFT
Sbjct  20    FHKGPWTSAEDQLLIAYVDKHGDGNWNAVQKHSGLSRCGKSCRLRWVNHLRPDLKKGAFT  79

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              +EE R+IELHA MGNKWARMAAELPGRTDNEIKN+WNTR+KR QR GLPIYP +V  QA
Sbjct  80    EKEEQRVIELHASMGNKWARMAAELPGRTDNEIKNFWNTRLKRLQRLGLPIYPDEVREQA  139

Query  1508  IHESNQN-EDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQ-QLHPQSPL-DIPASS  1338
             ++ +  N ++  +     +Q S  L+ +  EIP V+FK L+LN    + QS L ++P  +
Sbjct  140   MNTAAHNGQNTDSLDAHHSQES--LEPDSLEIPEVDFKYLQLNNCSSYYQSMLRNVPTGN  197

Query  1337  LLAQGLNSSYGPRPFF-----------STMNPSKRLRGPDSL--FTGLSSNDSDIFTAFG  1197
             L+ Q        RP F             M   KR R P++   F G  +          
Sbjct  198   LMRQ--------RPCFFQPNMYNLTGSMYMPNRKRFREPETAIPFVGCYAT---------  240

Query  1196  PYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAW---AKKP  1026
                N+   Q+             L   +P    V+P SH   N+  SS        A+K 
Sbjct  241   ---NEQSGQLWNYP---------LGDSNPEQFSVLPDSHLLGNATYSSPSGPLIHEAEKL  288

Query  1025  ELPSLQS---QIVSWDspssplpsleSVET---LIQSPPTERSESGNVSPRNSGLLEAVL  864
             ELPS Q    Q    D  +     +  +++   L+QSP T+++ S   S    GLLE+V+
Sbjct  289   ELPSFQCFEPQEEPGDWITQETNPMPELDSDNALVQSPLTDQTPSDCPSSFCDGLLESVV  348

Query  863   YESQTLKHSKNTLPQQNSGASIIPSDIVDNT  771
             Y S   + + NT    +S + +I S ++D+T
Sbjct  349   YGSPGERQATNT----DSDSPLIQSSLLDHT  375



>emb|CBI28806.3| unnamed protein product [Vitis vinifera]
Length=426

 Score =   239 bits (610),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 122/135 (90%), Gaps = 3/135 (2%)
 Frame = -1

Query  1895  GGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLK  1716
             GGAN G   LKKGPWT+AEDA+L+EYV RHGEGNWN+VQK++GL+RCGKSCRLRWANHL+
Sbjct  23    GGANQG---LKKGPWTTAEDAVLVEYVKRHGEGNWNSVQKNSGLSRCGKSCRLRWANHLR  79

Query  1715  PDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPI  1536
             P+LKKGAF+PEEE  I+ELHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGLP+
Sbjct  80    PNLKKGAFSPEEERLIVELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRVKRRQRAGLPL  139

Query  1535  YPPDVHLQAIHESNQ  1491
             YP  V  +A+H+  Q
Sbjct  140   YPQGVQKEALHQQQQ  154



>ref|XP_006296237.1| hypothetical protein CARUB_v10025403mg [Capsella rubella]
 gb|EOA29135.1| hypothetical protein CARUB_v10025403mg [Capsella rubella]
Length=395

 Score =   236 bits (602),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 156/228 (68%), Gaps = 18/228 (8%)
 Frame = -1

Query  1886  NAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDL  1707
             NA      KGPWT AED +L+ YV +HG+GNWNAVQKH+GL+RCGKSCRLRW NHL+PDL
Sbjct  14    NATEKAFTKGPWTQAEDNLLIAYVDKHGDGNWNAVQKHSGLSRCGKSCRLRWVNHLRPDL  73

Query  1706  KKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPP  1527
             KKGAFT +EE R+IELHA +GNKWARMA ELPGRTDNEIKN+WNTR+KR+QR GLP+YP 
Sbjct  74    KKGAFTEKEEQRVIELHALLGNKWARMAGELPGRTDNEIKNFWNTRLKRQQRLGLPVYPD  133

Query  1526  DVHLQAIHESNQNEDMSTFSTGDTQHS-NLLQVNYFEIPAVEFKNLELNQQLHPQSPLD-  1353
             +V  QA++ + Q+   S  ++ D  HS + ++ +  EIP ++F++L LNQ  +  S L  
Sbjct  134   EVREQAMNAATQSGFNSDHNSLDGHHSQDSMESDCVEIPQLDFQHLPLNQTSYYHSMLRV  193

Query  1352  IPASSLLAQ-------------GLNSSYGPRPFFSTMNPSKRLRGPDS  1248
             +P+S +                 L +S  P P+ ST    KR R P++
Sbjct  194   VPSSGVFVTQQRPCFFQPSNMYNLVASSSPPPYMST---GKRYREPET  238



>ref|XP_002880852.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57111.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=387

 Score =   236 bits (601),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 157/375 (42%), Positives = 217/375 (58%), Gaps = 33/375 (9%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
               KGPWT AED +L+ YV +HG+GNWNAVQKH+GL+RCGKSCRLRW NHL+PDLKKGAFT
Sbjct  20    FTKGPWTQAEDNLLIAYVDKHGDGNWNAVQKHSGLSRCGKSCRLRWVNHLRPDLKKGAFT  79

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              +EE R+IELHA +GNKWARMAAELPGRTDNEIKN+WNTR+KR QR GLP+YP +V  QA
Sbjct  80    EKEEKRVIELHALLGNKWARMAAELPGRTDNEIKNFWNTRLKRLQRLGLPVYPDEVREQA  139

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQ-QLHPQSPL-DIPASSL  1335
             ++ + Q+  ++T S       + L+ +  EIP ++F++L LNQ   + QS L ++P + +
Sbjct  140   MNAATQS-GLNTDSLDGHHSQDSLEADCVEIPELDFQHLPLNQCSSYYQSMLRNVPPTGV  198

Query  1334  LAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqss  1155
               +        RP+F   N    +  P  + TG  S + +     G   N+    +    
Sbjct  199   FVRQ-------RPYFFQPNMYNLITTPPYMSTGKRSREPETAFPGGYGMNEQSPPLWNY-  250

Query  1154  gfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssL-EP--AWAKKPELPSLQ--SQIVSW  990
                        P   ++S  +P SH   N+  SS  EP     +K ELPS Q   +   W
Sbjct  251   -----------PFVENISEQLPDSHLFGNATYSSSPEPLIQGVEKLELPSFQYLEEPGGW  299

Query  989   --DspssplpsleSVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQ  816
               +         ES  TL+QSP T+ + S   S    GLLE+V+Y S   K + +T    
Sbjct  300   GAEQSDQMPEHHESDNTLVQSPLTDHTPSDCPSSLYDGLLESVVYGSSGEKPATDT----  355

Query  815   NSGASIIPSDIVDNT  771
             +S +S+  S ++ +T
Sbjct  356   DSESSLFQSSLLGHT  370



>emb|CBI26650.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  1895  GGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLK  1716
             GG++AGGV LKKGPWT+AEDAIL+EYVT+HGEGNWNAVQK++GLARCGKSCRLRWANHL+
Sbjct  17    GGSDAGGVALKKGPWTAAEDAILVEYVTKHGEGNWNAVQKNSGLARCGKSCRLRWANHLR  76

Query  1715  PDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPI  1536
             P+LKKG+F+ EEE  I+ELHAK+GNKWARMAA+LPGRTDNEIKNYWNTRIKRR R GLP+
Sbjct  77    PNLKKGSFSAEEERVILELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRIKRRLRQGLPV  136

Query  1535  YPPDVHLQA  1509
             YP +V  Q+
Sbjct  137   YPQEVQNQS  145



>ref|XP_010657205.1| PREDICTED: transcription factor GAMYB isoform X2 [Vitis vinifera]
Length=511

 Score =   238 bits (608),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 122/135 (90%), Gaps = 3/135 (2%)
 Frame = -1

Query  1895  GGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLK  1716
             GGAN G   LKKGPWT+AEDA+L+EYV RHGEGNWN+VQK++GL+RCGKSCRLRWANHL+
Sbjct  23    GGANQG---LKKGPWTTAEDAVLVEYVKRHGEGNWNSVQKNSGLSRCGKSCRLRWANHLR  79

Query  1715  PDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPI  1536
             P+LKKGAF+PEEE  I+ELHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGLP+
Sbjct  80    PNLKKGAFSPEEERLIVELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRVKRRQRAGLPL  139

Query  1535  YPPDVHLQAIHESNQ  1491
             YP  V  +A+H+  Q
Sbjct  140   YPQGVQKEALHQQQQ  154



>ref|XP_002268969.1| PREDICTED: transcription factor GAMYB isoform X1 [Vitis vinifera]
Length=519

 Score =   238 bits (606),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 122/135 (90%), Gaps = 3/135 (2%)
 Frame = -1

Query  1895  GGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLK  1716
             GGAN G   LKKGPWT+AEDA+L+EYV RHGEGNWN+VQK++GL+RCGKSCRLRWANHL+
Sbjct  23    GGANQG---LKKGPWTTAEDAVLVEYVKRHGEGNWNSVQKNSGLSRCGKSCRLRWANHLR  79

Query  1715  PDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPI  1536
             P+LKKGAF+PEEE  I+ELHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGLP+
Sbjct  80    PNLKKGAFSPEEERLIVELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRVKRRQRAGLPL  139

Query  1535  YPPDVHLQAIHESNQ  1491
             YP  V  +A+H+  Q
Sbjct  140   YPQGVQKEALHQQQQ  154



>ref|XP_009133920.1| PREDICTED: transcription factor MYB104-like [Brassica rapa]
Length=435

 Score =   235 bits (600),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 209/374 (56%), Gaps = 50/374 (13%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
               KGPWTSAED +L+ YV +HG+GNWNAVQKH+GL+RCGKSCRLRW NHL+PDLKKG+FT
Sbjct  20    FHKGPWTSAEDQLLIAYVDKHGDGNWNAVQKHSGLSRCGKSCRLRWVNHLRPDLKKGSFT  79

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              +EE R+IELHA MGNKWARMA ELPGRTDNEIKN+WNTR+KR QR GLPIYP +V  QA
Sbjct  80    DKEEQRVIELHASMGNKWARMATELPGRTDNEIKNFWNTRVKRLQRLGLPIYPDEVREQA  139

Query  1508  IHESNQN-EDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASS  1338
             ++ + QN  +  +F    +Q S  L+++  EIP   FK+L+LN        L   IP  +
Sbjct  140   MNAAAQNGHNADSFDGHHSQES--LELDCLEIPDFNFKHLQLNGGSSFLQTLLSSIPTGN  197

Query  1337  LLAQGLNSSYGPRPFFSTMNP------SKRLRGPDSLF---TGLSSNDSDIFTAFGPYQN  1185
              + Q   S + P  +    +P       KR R P++ F    G ++++        P+  
Sbjct  198   QMRQN-PSLFQPNIYNVIASPYQQPPNRKRFREPETAFPYTGGYATDEQSAQLWNSPFVE  256

Query  1184  DTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSH--AslnsnsssLEPAW--AKKPELP  1017
              T                      P    V P SH   +  + SS  EP    A+K ELP
Sbjct  257   ST----------------------PGQFNVAPDSHFLGNATAYSSPSEPLILGAEKLELP  294

Query  1016  SLQSQIV-----SWDspssplpsleSVET----LIQSPPTERSESGNVSPRNSGLLEAVL  864
             S Q          W++P      ++++E+    ++ SP T+++ S   S    GLLE+V+
Sbjct  295   SFQCFDTQEDPGDWETPQHSNNPMQAIESDNTLVLSSPLTDQTPSECPSAFCDGLLESVV  354

Query  863   YESQTLKHSKNTLP  822
             Y S   K +  T P
Sbjct  355   YGSSGEKQTTTTDP  368



>ref|XP_002278003.1| PREDICTED: protein ODORANT1-like [Vitis vinifera]
Length=464

 Score =   236 bits (602),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  1895  GGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLK  1716
             GG++AGGV LKKGPWT+AEDAIL+EYVT+HGEGNWNAVQK++GLARCGKSCRLRWANHL+
Sbjct  17    GGSDAGGVALKKGPWTAAEDAILVEYVTKHGEGNWNAVQKNSGLARCGKSCRLRWANHLR  76

Query  1715  PDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPI  1536
             P+LKKG+F+ EEE  I+ELHAK+GNKWARMAA+LPGRTDNEIKNYWNTRIKRR R GLP+
Sbjct  77    PNLKKGSFSAEEERVILELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRIKRRLRQGLPV  136

Query  1535  YPPDVHLQA  1509
             YP +V  Q+
Sbjct  137   YPQEVQNQS  145



>ref|XP_002983020.1| hypothetical protein SELMODRAFT_117411, partial [Selaginella 
moellendorffii]
 gb|EFJ15829.1| hypothetical protein SELMODRAFT_117411, partial [Selaginella 
moellendorffii]
Length=137

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = -1

Query  1925  VNSPSVEEATGGA--NAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCG  1752
             + S S + + GGA  +A    LKKGPWTSAED+IL+ YV +HGEGNWN VQK +GL RCG
Sbjct  1     MESGSEDHSDGGAPCSAATAALKKGPWTSAEDSILVAYVQKHGEGNWNNVQKQSGLYRCG  60

Query  1751  KSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNT  1572
             KSCRLRWANHL+P+LKKGAFTPEEE  IIELHAK+GNKWARMA +LPGRTDNEIKNYWNT
Sbjct  61    KSCRLRWANHLRPNLKKGAFTPEEERLIIELHAKLGNKWARMATQLPGRTDNEIKNYWNT  120

Query  1571  RIKRRQRAGLPIYPPDV  1521
             RIKRRQRAGLP+YPPD+
Sbjct  121   RIKRRQRAGLPVYPPDI  137



>gb|KFK24363.1| hypothetical protein AALP_AAs49231U000100, partial [Arabis alpina]
Length=311

 Score =   229 bits (584),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 144/221 (65%), Gaps = 3/221 (1%)
 Frame = -1

Query  1964  TSESEDSMTLKGNVNSPSVEEATGGANAGGVP--LKKGPWTSAEDAILMEYVTRHGEGNW  1791
             T ES+D M    +  SP  +    G  + G    LKKGPW+S ED IL+ YV +HGEGNW
Sbjct  5     TVESDDGMDSSIHYESPGADSIGNGCRSKGKGNVLKKGPWSSTEDGILINYVKKHGEGNW  64

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAVQ HT LARCGKSCRLRWANHL+P+LKKGAF+ EEE  I+E+HA+MGNKWARMA  LP
Sbjct  65    NAVQSHTSLARCGKSCRLRWANHLRPNLKKGAFSQEEEQLIVEMHAQMGNKWARMAEHLP  124

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLLQV  1431
             GRTDNEIKNYWNTRIKRRQRAGLP+YP ++H   +  S +    +       +H + LQ+
Sbjct  125   GRTDNEIKNYWNTRIKRRQRAGLPLYPSEIHDGDLQWSEEYTKSNIIRVDRRRHQDFLQL  184

Query  1430  NYFEIPAV-EFKNLELNQQLHPQSPLDIPASSLLAQGLNSS  1311
                +   + E  N   ++      P D+ A  +L  G +SS
Sbjct  185   GNLKANDLWEELNFASSRLPGASDPSDLVACHMLRNGASSS  225



>ref|XP_006452391.1| hypothetical protein CICLE_v10010620mg [Citrus clementina]
 gb|ESR65631.1| hypothetical protein CICLE_v10010620mg [Citrus clementina]
Length=429

 Score =   233 bits (593),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 7/146 (5%)
 Frame = -1

Query  1937  LKGNVNSPSVEEATGGANA-------GGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQ  1779
             L GN N   +E   GG N        GGV LKKGPWT+AEDAIL EYV +HGEGNWNAVQ
Sbjct  2     LLGNSNGEQLESGVGGLNVSDGSGGEGGVQLKKGPWTAAEDAILTEYVRKHGEGNWNAVQ  61

Query  1778  KHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTD  1599
             ++TGLARCGKSCRLRWANHL+P+LKKG F+PEEE  I+ELHA++GNKWARMAA+LPGRTD
Sbjct  62    RNTGLARCGKSCRLRWANHLRPNLKKGTFSPEEERLIVELHAQLGNKWARMAAQLPGRTD  121

Query  1598  NEIKNYWNTRIKRRQRAGLPIYPPDV  1521
             NEIKNYWNTR+KRR R GLP+YPP++
Sbjct  122   NEIKNYWNTRVKRRHRQGLPLYPPEI  147



>emb|CDX83247.1| BnaA03g22590D [Brassica napus]
Length=435

 Score =   233 bits (594),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 208/374 (56%), Gaps = 50/374 (13%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
               KGPWTSAED +L+ YV +HG+GNWNAVQKH+GL+RCGKSCRLRW NHL+PDLKKG+FT
Sbjct  20    FHKGPWTSAEDQLLIAYVDKHGDGNWNAVQKHSGLSRCGKSCRLRWVNHLRPDLKKGSFT  79

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              +EE R+IELHA MGNKWARMA ELPGRTDNEIKN+WNTR+KR QR GLPIYP +V  QA
Sbjct  80    DKEEQRVIELHASMGNKWARMATELPGRTDNEIKNFWNTRVKRLQRLGLPIYPDEVREQA  139

Query  1508  IHESNQNEDMSTFSTGDTQHSN-LLQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASS  1338
             ++ + QN   +   + D  HS   L+++  EIP   FK+L+LN        L   IP  +
Sbjct  140   MNAAAQNGHNA--DSLDGHHSQESLELDCLEIPDFNFKHLQLNGGSSFLQTLLSSIPTGN  197

Query  1337  LLAQGLNSSYGPRPFFSTMNP------SKRLRGPDSLF---TGLSSNDSDIFTAFGPYQN  1185
              + Q   S + P  +    +P       KR R P++ F    G ++++        P+  
Sbjct  198   QMRQN-PSLFQPNIYNVIASPYQQPPNRKRFREPETAFPYTGGYATDEQSAQLWNSPFVE  256

Query  1184  DTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGSH--AslnsnsssLEPAW--AKKPELP  1017
              T                      P    V P SH   +  + SS  EP    A+K ELP
Sbjct  257   TT----------------------PGQFNVAPDSHFLGNATTYSSPSEPLILGAEKLELP  294

Query  1016  SLQSQIV-----SWDspssplpsleSVET----LIQSPPTERSESGNVSPRNSGLLEAVL  864
             S Q          W++P      ++++E+    ++ SP T+++ S   S    GLLE+V+
Sbjct  295   SFQCFDTQEDPGDWETPQHSNNPMQAIESDNTLVLSSPLTDQTPSECPSAFCDGLLESVV  354

Query  863   YESQTLKHSKNTLP  822
             Y S   K +  T P
Sbjct  355   YGSSGEKQTTTTDP  368



>gb|AGJ83731.1| transcription factor GAMYB-like protein, partial [Caragana korshinskii]
Length=267

 Score =   227 bits (579),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 144/215 (67%), Gaps = 2/215 (1%)
 Frame = -1

Query  1805  GEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARM  1626
             GEGNWNAVQK TGL RCGKSCRLRWANHL+P+LKKGAFT EEE  I ELHAKMGNKWARM
Sbjct  1     GEGNWNAVQKQTGLLRCGKSCRLRWANHLRPNLKKGAFTAEEERLIAELHAKMGNKWARM  60

Query  1625  AAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHS  1446
             AA LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP+V LQA+ E+   +       G+  H+
Sbjct  61    AAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEVCLQALQETQHGQSTGGIDCGNKVHA  120

Query  1445  NLLQVNYFEIPAVEFKNLELNQQLHPQ-SPL-DIPASSLLAQGLNSSYGPRPFFSTMNPS  1272
             + LQ   +EI    F +L+ NQ + P  S L DI +   +  G +SS       ST + +
Sbjct  121   DFLQEKSYEINDAMFGSLKDNQGILPYVSELHDISSYGSMLNGFDSSQYFSFVPSTSSNT  180

Query  1271  KRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQV  1167
             KRLR     F   S  + + F  FG  Q++T  ++
Sbjct  181   KRLRESAMSFLDSSGMNRNGFYPFGHIQDNTSDKI  215



>ref|NP_001241838.1| uncharacterized protein LOC100857038 [Zea mays]
 gb|ACN36123.1| unknown [Zea mays]
Length=439

 Score =   233 bits (593),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 158/387 (41%), Positives = 213/387 (55%), Gaps = 23/387 (6%)
 Frame = -1

Query  1958  ESEDSMTLKGNVNSP---SVEEATGGANAG-GVPLKKGPWTSAEDAILMEYVTRHGEGNW  1791
             E +D M  +  ++SP    V  +      G G PLKKGPWT AEDAIL++YV +HG GNW
Sbjct  13    EGKDEMMSQDQMDSPVDNDVSSSRRSPRRGVGAPLKKGPWTDAEDAILIDYVKKHGVGNW  72

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAV+K+T L RCGKSCRLRWANHL+P+LKK AFTPEEE  II+LHAK+GNKW+RMA  LP
Sbjct  73    NAVRKNTELLRCGKSCRLRWANHLRPNLKKEAFTPEEERLIIQLHAKLGNKWSRMAIHLP  132

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMS-TFSTGDTQHSNLLQ  1434
             GRTDNEIKNYWNTR KR +RA LPIYP  V  Q+   SN+++ +S   + G+   ++LL 
Sbjct  133   GRTDNEIKNYWNTRKKRCERASLPIYPAGVRNQS---SNEDQQLSGDLNGGENMSNDLLS  189

Query  1433  VNYFEIPAVEFKNLELNQQLH---PQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRL  1263
              N   +P  +F N     +L    PQ P  +  S+LL Q   S      F   ++ +  L
Sbjct  190   GNSLCLP--DFNNDSFRAKLKALPPQLPA-VSISNLLGQSFASKGC--SFMDQVDQAGML  244

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             +   S    LS    D+ ++   + ND+   +                        + GS
Sbjct  245   KQSGSALPTLSDAIDDVISSVDQFSNDSEKLMQTLGFGYLNEANATSKSIAPFGVALTGS  304

Query  1082  HAslnsnsssLEPAWA-KKPELPSLQSQIVSWDspssplpsleSVETLIQS---PPTERS  915
             HA LN   S+        K E PS+Q+  + + +    +   E V+  +QS    P+ +S
Sbjct  305   HAPLNGIFSASRLTNGPSKMEPPSVQNSRLKY-TVDPAMQPTELVDPYMQSLSATPSVKS  363

Query  914   ESGNVSPRNSGLLEAVLYESQTLKHSK  834
             E    SPRNSGL E +L+E   L+  K
Sbjct  364   EC--ASPRNSGLFEELLHEPHALRSGK  388



>ref|XP_006475135.1| PREDICTED: myb-like protein A-like [Citrus sinensis]
Length=564

 Score =   236 bits (602),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 7/146 (5%)
 Frame = -1

Query  1937  LKGNVNSPSVEEATGGANA-------GGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQ  1779
             L GN N   +E   GG N        GGV LKKGPWT+AEDAIL EYV +HGEGNWNAVQ
Sbjct  2     LLGNSNGEQLESGVGGLNVSDGSGGEGGVQLKKGPWTAAEDAILTEYVRKHGEGNWNAVQ  61

Query  1778  KHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTD  1599
             ++TGLARCGKSCRLRWANHL+P+LKKG F+PEEE  I+ELHA++GNKWARMAA+LPGRTD
Sbjct  62    RNTGLARCGKSCRLRWANHLRPNLKKGTFSPEEERLIVELHAQLGNKWARMAAQLPGRTD  121

Query  1598  NEIKNYWNTRIKRRQRAGLPIYPPDV  1521
             NEIKNYWNTR+KRR R GLP+YPP++
Sbjct  122   NEIKNYWNTRVKRRHRQGLPLYPPEI  147



>ref|NP_001152014.1| transcription factor GAMYB [Zea mays]
 gb|ACG45389.1| transcription factor GAMYB [Zea mays]
Length=537

 Score =   235 bits (600),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 202/356 (57%), Gaps = 19/356 (5%)
 Frame = -1

Query  1877  GVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKG  1698
             G PLKKGPWT AEDAILM+YV +HG GNWNAV+K+T L RCGKSCRLRWANHL+P+LKK 
Sbjct  38    GAPLKKGPWTDAEDAILMDYVKKHGVGNWNAVRKNTELFRCGKSCRLRWANHLRPNLKKE  97

Query  1697  AFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVH  1518
             AFTPEEE  II+LHAK+GNKW+RMA  LPGRTDNEIKNYWNTR KR +RA LPIYP  V 
Sbjct  98    AFTPEEERLIIQLHAKLGNKWSRMAIHLPGRTDNEIKNYWNTRKKRCERASLPIYPAGVR  157

Query  1517  LQAIHESNQNEDMS-TFSTGDTQHSNLLQVNYFEIPAVEFKN---LELNQQLHPQSPLDI  1350
              Q+   SN+++ +S   + G+   ++LL  N   +P  +F N   L   Q L PQ P  +
Sbjct  158   NQS---SNEDQQLSGDLNGGENMSNDLLSGNSLCLP--DFNNDSFLAKLQALPPQLPA-V  211

Query  1349  PASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQ  1170
               S+LL Q   S      F   ++ +  L+   S    LS    D+ ++   + ND+   
Sbjct  212   SISNLLGQSFASKGC--SFMDQVDQAGMLKQSGSALPTLSDAIDDVISSVDQFSNDSEKL  269

Query  1169  VsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPAWA-KKPELPSLQSQIVS  993
             +                        + GSHA LN   S+        K E PS+Q+  + 
Sbjct  270   MQTLGFGYLNEANATSKSIVPFGVALTGSHAPLNGIFSASRLTNGPSKMEPPSVQNSRLK  329

Query  992   WDspssplpsleSVETLIQS---PPTERSESGNVSPRNSGLLEAVLYESQTLKHSK  834
             + +    +   E V+  +QS    P+ +SE    SPRNSGL E +L+E   L+  K
Sbjct  330   Y-TVDPAMQPTELVDPYMQSLSATPSVKSEC--ASPRNSGLFEELLHEPHALRSGK  382



>gb|KDO62745.1| hypothetical protein CISIN_1g046419mg [Citrus sinensis]
Length=505

 Score =   234 bits (597),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 7/146 (5%)
 Frame = -1

Query  1937  LKGNVNSPSVEEATGGANA-------GGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQ  1779
             L GN N   +E   GG N        GGV LKKGPWT+AEDAIL EYV +HGEGNWNAVQ
Sbjct  2     LLGNSNGEQLESGVGGLNVSDGSGGEGGVQLKKGPWTAAEDAILTEYVRKHGEGNWNAVQ  61

Query  1778  KHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTD  1599
             ++TGLARCGKSCRLRWANHL+P+LKKG F+PEEE  I+ELHA++GNKWARMAA+LPGRTD
Sbjct  62    RNTGLARCGKSCRLRWANHLRPNLKKGTFSPEEERLIVELHAQLGNKWARMAAQLPGRTD  121

Query  1598  NEIKNYWNTRIKRRQRAGLPIYPPDV  1521
             NEIKNYWNTR+KRR R GLP+YPP++
Sbjct  122   NEIKNYWNTRVKRRHRQGLPLYPPEI  147



>gb|ACF83574.1| unknown [Zea mays]
 gb|ACN31855.1| unknown [Zea mays]
 gb|AFW84795.1| putative MYB DNA-binding domain superfamily protein isoform 1 
[Zea mays]
 gb|AFW84796.1| putative MYB DNA-binding domain superfamily protein isoform 2 
[Zea mays]
 gb|AFW84797.1| putative MYB DNA-binding domain superfamily protein isoform 3 
[Zea mays]
 gb|AIB04810.1| MYB transcription factor, partial [Zea mays]
Length=492

 Score =   233 bits (595),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 158/387 (41%), Positives = 213/387 (55%), Gaps = 23/387 (6%)
 Frame = -1

Query  1958  ESEDSMTLKGNVNSP---SVEEATGGANAG-GVPLKKGPWTSAEDAILMEYVTRHGEGNW  1791
             E +D M  +  ++SP    V  +      G G PLKKGPWT AEDAIL++YV +HG GNW
Sbjct  13    EGKDEMMSQDQMDSPVDNDVSSSRRSPRRGVGAPLKKGPWTDAEDAILIDYVKKHGVGNW  72

Query  1790  NAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELP  1611
             NAV+K+T L RCGKSCRLRWANHL+P+LKK AFTPEEE  II+LHAK+GNKW+RMA  LP
Sbjct  73    NAVRKNTELLRCGKSCRLRWANHLRPNLKKEAFTPEEERLIIQLHAKLGNKWSRMAIHLP  132

Query  1610  GRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMS-TFSTGDTQHSNLLQ  1434
             GRTDNEIKNYWNTR KR +RA LPIYP  V  Q+   SN+++ +S   + G+   ++LL 
Sbjct  133   GRTDNEIKNYWNTRKKRCERASLPIYPAGVRNQS---SNEDQQLSGDLNGGENMSNDLLS  189

Query  1433  VNYFEIPAVEFKNLELNQQLH---PQSPLDIPASSLLAQGLNSSYGPRPFFSTMNPSKRL  1263
              N   +P  +F N     +L    PQ P  +  S+LL Q   S      F   ++ +  L
Sbjct  190   GNSLCLP--DFNNDSFRAKLKALPPQLPA-VSISNLLGQSFASKGC--SFMDQVDQAGML  244

Query  1262  RGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPGS  1083
             +   S    LS    D+ ++   + ND+   +                        + GS
Sbjct  245   KQSGSALPTLSDAIDDVISSVDQFSNDSEKLMQTLGFGYLNEANATSKSIAPFGVALTGS  304

Query  1082  HAslnsnsssLEPAWA-KKPELPSLQSQIVSWDspssplpsleSVETLIQS---PPTERS  915
             HA LN   S+        K E PS+Q+  + + +    +   E V+  +QS    P+ +S
Sbjct  305   HAPLNGIFSASRLTNGPSKMEPPSVQNSRLKY-TVDPAMQPTELVDPYMQSLSATPSVKS  363

Query  914   ESGNVSPRNSGLLEAVLYESQTLKHSK  834
             E    SPRNSGL E +L+E   L+  K
Sbjct  364   EC--ASPRNSGLFEELLHEPHALRSGK  388



>gb|EPS59267.1| hypothetical protein M569_15542, partial [Genlisea aurea]
Length=134

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -1

Query  1928  NVNSPSVEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGK  1749
             N +  S+ E++ G  A  V LKKGPWTSAEDA+L +YV  HGEGNWN+VQ  TGLARCGK
Sbjct  1     NDDDNSLGESSNGGKA--VALKKGPWTSAEDAVLTDYVRNHGEGNWNSVQTQTGLARCGK  58

Query  1748  SCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTR  1569
             SCRLRWANHL+P+LKKGAFT EEE  I+ELHAKMGNKWARMAA LPGRTDNEIKNYWNTR
Sbjct  59    SCRLRWANHLRPNLKKGAFTSEEERLIVELHAKMGNKWARMAAHLPGRTDNEIKNYWNTR  118

Query  1568  IKRRQRAGLPIYPPDV  1521
             IKRRQR+G P+YPPD+
Sbjct  119   IKRRQRSGQPLYPPDL  134



>ref|XP_010473083.1| PREDICTED: transcription factor MYB104-like [Camelina sativa]
Length=407

 Score =   231 bits (588),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 150/218 (69%), Gaps = 10/218 (5%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
               KGPWT AED +L+ YV +HG+GNWNAVQKH+GL+RCGKSCRLRW NHL+PDLKKGAFT
Sbjct  20    FTKGPWTQAEDNLLIAYVDKHGDGNWNAVQKHSGLSRCGKSCRLRWVNHLRPDLKKGAFT  79

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              +EE R+IELHA +GNKWARMA ELPGRTDNEIKN+WNTR+KR QR GLP+YP DV  QA
Sbjct  80    EKEEQRVIELHALLGNKWARMAGELPGRTDNEIKNFWNTRLKRLQRLGLPVYPDDVREQA  139

Query  1508  IHESNQNEDMSTFSTGDTQHS-NLLQVNYFEIPAVEFKNLELNQ--QLHPQSPLDIPASS  1338
             ++ + Q+  ++   + D  HS + L+ +  EIP ++F++L LNQ    +      +P S 
Sbjct  140   MNAATQS-GLNNGHSLDGHHSQDSLESDSVEIPELDFQHLPLNQCSSYYKSMLRSVPTSG  198

Query  1337  LLAQGLNSSYGPRPFF------STMNPSKRLRGPDSLF  1242
             +  +     + P  +       S M+  KR R P++ F
Sbjct  199   VFVRQNPCFFQPNVYHLMSSSPSYMSTGKRSREPETAF  236



>ref|XP_002964589.1| hypothetical protein SELMODRAFT_81112, partial [Selaginella moellendorffii]
 gb|EFJ34922.1| hypothetical protein SELMODRAFT_81112, partial [Selaginella moellendorffii]
Length=139

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWTSAEDAIL+ YV++HGEGNWN VQKH+GL+RCGKSCRLRWANHL+P+LKKGAFT
Sbjct  24    LKKGPWTSAEDAILVAYVSKHGEGNWNNVQKHSGLSRCGKSCRLRWANHLRPNLKKGAFT  83

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDV  1521
             P+EE  IIELHAK+GNKWARMAA+LPGRTDNEIKNYWNTRIKRR RAGLP+YP DV
Sbjct  84    PDEERLIIELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRIKRRLRAGLPVYPSDV  139



>ref|XP_002988806.1| hypothetical protein SELMODRAFT_128781, partial [Selaginella 
moellendorffii]
 gb|EFJ10068.1| hypothetical protein SELMODRAFT_128781, partial [Selaginella 
moellendorffii]
Length=139

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWTSAEDAIL+ YV++HGEGNWN VQKH+GL+RCGKSCRLRWANHL+P+LKKGAFT
Sbjct  24    LKKGPWTSAEDAILVAYVSKHGEGNWNNVQKHSGLSRCGKSCRLRWANHLRPNLKKGAFT  83

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDV  1521
             P+EE  IIELHAK+GNKWARMAA+LPGRTDNEIKNYWNTRIKRR RAGLP+YP DV
Sbjct  84    PDEERLIIELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRIKRRLRAGLPVYPSDV  139



>emb|CDY38535.1| BnaC03g26620D [Brassica napus]
Length=432

 Score =   230 bits (587),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
               KGPWTSAED +L+ YV +HG+GNWNAVQKH+GL+RCGKSCRLRW NHL+PDLKKG+FT
Sbjct  20    FHKGPWTSAEDQLLIAYVDKHGDGNWNAVQKHSGLSRCGKSCRLRWVNHLRPDLKKGSFT  79

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              +EE R+IELHA MGNKWARMA ELPGRTDNEIKN+WNTR+KR QR GLPIYP +V  QA
Sbjct  80    DKEEQRVIELHASMGNKWARMATELPGRTDNEIKNFWNTRVKRLQRLGLPIYPDEVREQA  139

Query  1508  IHESNQNEDMSTFSTGDTQHSN-LLQVNYFEIPAVEFKNLELN  1383
             ++ + QN   +   + D  HS   L+++  EIP + FK+L+LN
Sbjct  140   MNAAAQNGHNA--DSLDGHHSQESLELDCLEIPELNFKHLQLN  180



>ref|XP_001764220.1| predicted protein [Physcomitrella patens]
 gb|EDQ71061.1| predicted protein [Physcomitrella patens]
Length=117

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -1

Query  1877  GVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKG  1698
             G  LKKGPWTSAED+IL+ YVT+HGEGNWN+VQKH+GL RCGKSCRLRWANHL+P+LKKG
Sbjct  1     GGSLKKGPWTSAEDSILISYVTKHGEGNWNSVQKHSGLFRCGKSCRLRWANHLRPNLKKG  60

Query  1697  AFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYP  1530
             AFTPEEE  I+ELHAK+GNKWARMAA+LPGRTDNEIKNYWNTRIKRR RAGLP+YP
Sbjct  61    AFTPEEERTIVELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRIKRRMRAGLPVYP  116



>ref|XP_002965541.1| hypothetical protein SELMODRAFT_84369, partial [Selaginella moellendorffii]
 gb|EFJ32961.1| hypothetical protein SELMODRAFT_84369, partial [Selaginella moellendorffii]
Length=137

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = -1

Query  1925  VNSPSVEEATGGA--NAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCG  1752
             + S S + + GGA  +A    LKKGPWTSAED+IL+ YV +HGEGNWN VQK +GL RCG
Sbjct  1     MESGSEDHSDGGAPCSAAAAALKKGPWTSAEDSILVAYVQKHGEGNWNNVQKQSGLYRCG  60

Query  1751  KSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNT  1572
             KSCRLRWANHL+P+LKKGAFTPEEE  IIELHAK+GNKWARMA +LPGRTDNEIKNYWNT
Sbjct  61    KSCRLRWANHLRPNLKKGAFTPEEERLIIELHAKLGNKWARMATQLPGRTDNEIKNYWNT  120

Query  1571  RIKRRQRAGLPIYPPDV  1521
             RIKRRQRAGLP+YPPD+
Sbjct  121   RIKRRQRAGLPVYPPDI  137



>ref|XP_001778412.1| predicted protein [Physcomitrella patens]
 gb|EDQ56770.1| predicted protein [Physcomitrella patens]
Length=117

 Score =   219 bits (557),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -1

Query  1877  GVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKG  1698
             G  LKKGPWTSAED+IL+ YVT+HGEGNWN+VQKH+GL RCGKSCRLRWANHL+P+LKKG
Sbjct  1     GGALKKGPWTSAEDSILISYVTKHGEGNWNSVQKHSGLFRCGKSCRLRWANHLRPNLKKG  60

Query  1697  AFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYP  1530
             AFTPEEE  I+ELHAK+GNKWARMAA+LPGRTDNEIKNYWNTRIKRR RAGLP+YP
Sbjct  61    AFTPEEERIIVELHAKIGNKWARMAAQLPGRTDNEIKNYWNTRIKRRMRAGLPVYP  116



>emb|CDY66700.1| BnaCnng51960D [Brassica napus]
Length=444

 Score =   228 bits (582),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+ EDAIL EYV +HGEGNWNAVQK++GL RCGKSCRLRWANHL+P+LKKG+F+
Sbjct  17    LKKGPWTTKEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCRLRWANHLRPNLKKGSFS  76

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             P+EE  IIELHAKMGNKWARMA++LPGRTDNEIKNYWNTR+KRRQRAGLP+YP ++H Q 
Sbjct  77    PDEEKIIIELHAKMGNKWARMASQLPGRTDNEIKNYWNTRMKRRQRAGLPLYPHEIHHQG  136

Query  1508  IHESNQNEDMSTFSTGDTQHSN  1443
             I   ++ E  ++F   +  HSN
Sbjct  137   IDNDDEFE-FNSFQFSNQDHSN  157



>ref|NP_180805.1| myb domain protein 101 [Arabidopsis thaliana]
 gb|AAC25928.1| putative MYB family transcription factor [Arabidopsis thaliana]
 gb|AAM15072.1| putative MYB family transcription factor [Arabidopsis thaliana]
 gb|AAS10046.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAF01205.1| putative MYB family transcription factor [Arabidopsis thaliana]
 gb|ABH04488.1| At2g32460 [Arabidopsis thaliana]
 gb|AEC08688.1| myb domain protein 101 [Arabidopsis thaliana]
Length=490

 Score =   229 bits (585),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 129/162 (80%), Gaps = 5/162 (3%)
 Frame = -1

Query  1904  EATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWAN  1725
             E T  A   G  LKKGPWT+ EDAIL EYV +HGEGNWNAVQK++GL RCGKSCRLRWAN
Sbjct  6     ETTATATMEGRGLKKGPWTTTEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCRLRWAN  65

Query  1724  HLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAG  1545
             HL+P+LKKG+FTP+EE  II+LHAK+GNKWARMA++LPGRTDNEIKNYWNTR+KRRQRAG
Sbjct  66    HLRPNLKKGSFTPDEEKIIIDLHAKLGNKWARMASQLPGRTDNEIKNYWNTRMKRRQRAG  125

Query  1544  LPIYPPDVHLQAIHESNQNE-DMSTFSTG----DTQHSNLLQ  1434
             LP+YP ++  Q I   ++ E D+++F       D  H N++Q
Sbjct  126   LPLYPHEIQHQGIDIDDEFEFDLTSFQFQNQDLDHNHQNMIQ  167



>gb|AAL58845.1|AF411970_1 putative transcription factor MYB101 [Arabidopsis thaliana]
Length=490

 Score =   229 bits (585),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 129/162 (80%), Gaps = 5/162 (3%)
 Frame = -1

Query  1904  EATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWAN  1725
             E T  A   G  LKKGPWT+ EDAIL EYV +HGEGNWNAVQK++GL RCGKSCRLRWAN
Sbjct  6     ETTATATMEGRGLKKGPWTTTEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCRLRWAN  65

Query  1724  HLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAG  1545
             HL+P+LKKG+FTP+EE  II+LHAK+GNKWARMA++LPGRTDNEIKNYWNTR+KRRQRAG
Sbjct  66    HLRPNLKKGSFTPDEEKIIIDLHAKLGNKWARMASQLPGRTDNEIKNYWNTRMKRRQRAG  125

Query  1544  LPIYPPDVHLQAIHESNQNE-DMSTFSTG----DTQHSNLLQ  1434
             LP+YP ++  Q I   ++ E D+++F       D  H N++Q
Sbjct  126   LPLYPHEIQHQGIDIDDEFEFDLTSFQFQNQDLDHNHQNMIQ  167



>emb|CDY68663.1| BnaAnng27960D [Brassica napus]
Length=457

 Score =   228 bits (582),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+ EDAIL EYV +HGEGNWNAVQK++GL RCGKSCRLRWANHL+P LKKG+F+
Sbjct  17    LKKGPWTTTEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCRLRWANHLRPHLKKGSFS  76

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             P+EE  IIELHAKMGNKWARMA++LPGRTDNEIKNYWNTR+KRRQRAGLP+YP ++H Q 
Sbjct  77    PDEEKIIIELHAKMGNKWARMASQLPGRTDNEIKNYWNTRMKRRQRAGLPLYPHEIHHQG  136

Query  1508  IHESNQNEDMSTFSTGDTQHSN  1443
             I   ++ E  ++F   +  HSN
Sbjct  137   IDNDDEFE-FNSFQFSNQDHSN  157



>ref|XP_007020787.1| Transcription factor MYB811 [Theobroma cacao]
 gb|EOY12312.1| Transcription factor MYB811 [Theobroma cacao]
Length=585

 Score =   231 bits (590),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 121/148 (82%), Gaps = 7/148 (5%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEEATGGANA-------GGVPLKKGPWTSAEDAILMEYVTRHGEGNWNA  1785
             M + G  N  + +   GG +        GG+ LKKGPWT+AEDA+L EYV  HGEGNWNA
Sbjct  2     MLMMGGNNQVTTQNEGGGTSGMHNSCVEGGLTLKKGPWTAAEDAVLAEYVRTHGEGNWNA  61

Query  1784  VQKHTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGR  1605
             VQK+TGLARCGKSCRLRWANHL+P+LKKGAF+PEEE  I+ELHAKMGNKWARMA +LPGR
Sbjct  62    VQKNTGLARCGKSCRLRWANHLRPNLKKGAFSPEEERIIVELHAKMGNKWARMATQLPGR  121

Query  1604  TDNEIKNYWNTRIKRRQRAGLPIYPPDV  1521
             TDNEIKNYWNTR+KR+QR GLP+YPP++
Sbjct  122   TDNEIKNYWNTRVKRKQRQGLPLYPPEI  149



>ref|XP_007015385.1| Myb domain protein 33, putative isoform 2 [Theobroma cacao]
 gb|EOY33004.1| Myb domain protein 33, putative isoform 2 [Theobroma cacao]
Length=383

 Score =   226 bits (576),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 164/341 (48%), Positives = 213/341 (62%), Gaps = 18/341 (5%)
 Frame = -1

Query  1628  MAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQH  1449
             MAAELPGRTDNEIKNYWNTRIKR QRAGLPIYPPDV LQ      ++ + ++   GD+  
Sbjct  1     MAAELPGRTDNEIKNYWNTRIKRLQRAGLPIYPPDVCLQVNRSQEESHNAASLPNGDSYA  60

Query  1448  SNLLQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNP  1275
             SNLLQ + FEIP VEF+NLELNQ     SP+  DIPA+++L + + SSYG    F   +P
Sbjct  61    SNLLQSDAFEIPRVEFENLELNQGCLSYSPMLHDIPANTMLKR-VGSSYGYGLMFPIAHP  119

Query  1274  SKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCV  1095
             +KRLR   S +  + +  +         +N    +       SS Y  NL  +  +   +
Sbjct  120   TKRLRESVSNYFSMPNQLT---------ENAYKKRFDGPLMISSPYDSNLSTNDQASFGI  170

Query  1094  IPGSHAslnsnsssLEPAWAK-KPELPSLQ---SQIVSWDspssplpsleSVETLIQSPP  927
              PGS A LNSN S  EP     K ELPS Q   +Q  SW +P+ PLP +ESV+ LIQSP 
Sbjct  171   PPGSDAPLNSNFSPSEPMSGPIKLELPSYQYSDTQEDSWVNPAYPLPLVESVDNLIQSPS  230

Query  926   TERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETE  747
              E+++S   +P+NSGLLEAVL+ESQ LK SK+   QQ+S  S++  D V N   +  E E
Sbjct  231   IEQAKSDYFTPQNSGLLEAVLHESQKLKSSKDDSCQQSSSTSVL--DDVANFSLNHCEIE  288

Query  746   WEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSVEMLAG  624
             +E + DP SPL HSAASVF+E+TP+S SS +E Q +E + G
Sbjct  289   FEAHCDPNSPLAHSAASVFSEFTPVSGSSSDEPQFIESILG  329



>ref|XP_007046374.1| Myb domain protein 101, putative [Theobroma cacao]
 gb|EOY02206.1| Myb domain protein 101, putative [Theobroma cacao]
Length=486

 Score =   229 bits (583),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+AEDAILMEYV +HGEGNWNAVQK++GL RCGKSCRLRWANHL+P+LKKG+F+
Sbjct  17    LKKGPWTAAEDAILMEYVKKHGEGNWNAVQKNSGLMRCGKSCRLRWANHLRPNLKKGSFS  76

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDV  1521
             PEEE  IIELHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGLPIYP +V
Sbjct  77    PEEERIIIELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRMKRRQRAGLPIYPQEV  132



>gb|KDO54678.1| hypothetical protein CISIN_1g039708mg [Citrus sinensis]
Length=511

 Score =   229 bits (584),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 118/136 (87%), Gaps = 8/136 (6%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+AEDAILMEYV +HGEGNWNAVQK++GL RCGKSCRLRWANHL+P+LKKG+F+
Sbjct  21    LKKGPWTAAEDAILMEYVKKHGEGNWNAVQKNSGLMRCGKSCRLRWANHLRPNLKKGSFS  80

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDV----  1521
             PEEE  IIELHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGLPIYP ++    
Sbjct  81    PEEEKIIIELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRMKRRQRAGLPIYPQEIQDKA  140

Query  1520  ----HLQAIHESNQNE  1485
                 HL   H+  QN+
Sbjct  141   AAAFHLHQHHKRPQNQ  156



>ref|XP_006447574.1| hypothetical protein CICLE_v10014958mg [Citrus clementina]
 ref|XP_006469761.1| PREDICTED: putative DNA helicase ino-80-like [Citrus sinensis]
 gb|ESR60814.1| hypothetical protein CICLE_v10014958mg [Citrus clementina]
Length=511

 Score =   229 bits (584),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 118/136 (87%), Gaps = 8/136 (6%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+AEDAILMEYV +HGEGNWNAVQK++GL RCGKSCRLRWANHL+P+LKKG+F+
Sbjct  21    LKKGPWTAAEDAILMEYVKKHGEGNWNAVQKNSGLMRCGKSCRLRWANHLRPNLKKGSFS  80

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDV----  1521
             PEEE  IIELHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGLPIYP ++    
Sbjct  81    PEEEKIIIELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRMKRRQRAGLPIYPQEIQDKA  140

Query  1520  ----HLQAIHESNQNE  1485
                 HL   H+  QN+
Sbjct  141   AAAFHLHQHHKRPQNQ  156



>emb|CDY04471.1| BnaA07g12970D [Brassica napus]
Length=368

 Score =   225 bits (573),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 6/162 (4%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
               KGPWTSAED +L  YV +HGEGNWNAVQKH+GL+RCGKSCRLRW NHL+P LKKG FT
Sbjct  20    FHKGPWTSAEDQLLTAYVDKHGEGNWNAVQKHSGLSRCGKSCRLRWVNHLRPSLKKGGFT  79

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              +EE R+IELHA MGNKWARMAA+LPGRTDNEIKN+WNTR+K+ QR GLPIYP +V  QA
Sbjct  80    DKEEQRVIELHASMGNKWARMAAQLPGRTDNEIKNFWNTRLKKLQRLGLPIYPDEVREQA  139

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELN  1383
             ++ + QN   S  S    Q S  L+ +  EIP  +FK L+LN
Sbjct  140   MNAAVQNGQNSDHS----QES--LEPDCLEIPEFDFKYLQLN  175



>ref|XP_008342013.1| PREDICTED: transcription factor MYB104-like [Malus domestica]
Length=526

 Score =   229 bits (583),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 6/140 (4%)
 Frame = -1

Query  1910  VEEATGGANAGGV------PLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGK  1749
             V EA  GA  GG        LKKGPWT+AEDAIL+EYV +HGEGNWNAVQK++GLARCGK
Sbjct  11    VHEAAVGAQRGGSHHHHQQSLKKGPWTAAEDAILIEYVKKHGEGNWNAVQKNSGLARCGK  70

Query  1748  SCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTR  1569
             SCRLRWANHL+P+LKKG+ +PEEE  IIELHAK GNKWARMA++LPGRTDNEIKNYWNTR
Sbjct  71    SCRLRWANHLRPNLKKGSLSPEEEKLIIELHAKFGNKWARMASQLPGRTDNEIKNYWNTR  130

Query  1568  IKRRQRAGLPIYPPDVHLQA  1509
             +KRRQRAGLPIYP D+  +A
Sbjct  131   MKRRQRAGLPIYPRDLQQEA  150



>ref|XP_009592281.1| PREDICTED: transcription factor RAX3 [Nicotiana tomentosiformis]
Length=508

 Score =   228 bits (580),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 116/130 (89%), Gaps = 3/130 (2%)
 Frame = -1

Query  1901  ATGGANAGGV---PLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRW  1731
             ++GG   GG     LKKGPWT+ EDAILMEYV +HGEGNWNAVQ+++GL RCGKSCRLRW
Sbjct  11    SSGGGRNGGTSRQALKKGPWTATEDAILMEYVKKHGEGNWNAVQRNSGLMRCGKSCRLRW  70

Query  1730  ANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQR  1551
             ANHL+P+LKKGAF+PEEE  IIELHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQR
Sbjct  71    ANHLRPNLKKGAFSPEEERIIIELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRLKRRQR  130

Query  1550  AGLPIYPPDV  1521
             AGLPIYP ++
Sbjct  131   AGLPIYPQEL  140



>gb|KHG05273.1| Transcription factor GAMYB [Gossypium arboreum]
Length=523

 Score =   228 bits (580),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = -1

Query  1877  GVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKG  1698
             GV LKKGPWT+AEDA+L EYV  HGEGNWNAVQ++TGLARCGKSCRLRWANHL+P+LKKG
Sbjct  20    GVMLKKGPWTAAEDAVLAEYVRTHGEGNWNAVQRNTGLARCGKSCRLRWANHLRPNLKKG  79

Query  1697  AFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVH  1518
             AF+PEEE  I+ELHA MGNKWARMAA LPGRTDNEIKNYWNTR+KRRQR GLP+YPP++ 
Sbjct  80    AFSPEEERIIVELHAIMGNKWARMAARLPGRTDNEIKNYWNTRVKRRQRQGLPLYPPEI-  138

Query  1517  LQAIHESNQ  1491
              Q+++   Q
Sbjct  139   -QSLYSQTQ  146



>ref|XP_008455547.1| PREDICTED: transcription factor MYB86 [Cucumis melo]
Length=509

 Score =   227 bits (578),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWTSAED IL++YV +HGEGNWNAVQKHTGLARCGKSCRLRWANHL+P+LKKG+F+
Sbjct  38    LKKGPWTSAEDGILIDYVKKHGEGNWNAVQKHTGLARCGKSCRLRWANHLRPNLKKGSFS  97

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              EEE  IIELHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGLP+YP ++  +A
Sbjct  98    QEEERIIIELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRMKRRQRAGLPLYPLEIQQEA  157



>ref|XP_010923867.1| PREDICTED: transcription factor MYB44-like [Elaeis guineensis]
Length=468

 Score =   226 bits (575),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -1

Query  1910  VEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRW  1731
             ++   G   +    LKKGPWT+AEDAILMEYV +HGEGNWNAVQK++GL RCGKSCRLRW
Sbjct  1     MKSGGGAEESSAAALKKGPWTAAEDAILMEYVKKHGEGNWNAVQKNSGLNRCGKSCRLRW  60

Query  1730  ANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQR  1551
             ANHL+PDLKKG FT EEE  I+ LHA++GNKWARMAA+LPGRTDNEIKNYWNTRIKRR+R
Sbjct  61    ANHLRPDLKKGTFTREEELLILHLHAQLGNKWARMAAQLPGRTDNEIKNYWNTRIKRRKR  120

Query  1550  AGLPIYPPDVHLQAI  1506
             AGLP+YPP++  Q +
Sbjct  121   AGLPLYPPEIQRQVL  135



>ref|NP_001077993.1| myb domain protein 101 [Arabidopsis thaliana]
 gb|AEC08689.1| myb domain protein 101 [Arabidopsis thaliana]
Length=478

 Score =   226 bits (575),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 126/153 (82%), Gaps = 5/153 (3%)
 Frame = -1

Query  1877  GVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKG  1698
             G  LKKGPWT+ EDAIL EYV +HGEGNWNAVQK++GL RCGKSCRLRWANHL+P+LKKG
Sbjct  3     GRGLKKGPWTTTEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCRLRWANHLRPNLKKG  62

Query  1697  AFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVH  1518
             +FTP+EE  II+LHAK+GNKWARMA++LPGRTDNEIKNYWNTR+KRRQRAGLP+YP ++ 
Sbjct  63    SFTPDEEKIIIDLHAKLGNKWARMASQLPGRTDNEIKNYWNTRMKRRQRAGLPLYPHEIQ  122

Query  1517  LQAIHESNQNE-DMSTFSTG----DTQHSNLLQ  1434
              Q I   ++ E D+++F       D  H N++Q
Sbjct  123   HQGIDIDDEFEFDLTSFQFQNQDLDHNHQNMIQ  155



>dbj|BAJ61444.1| R2R3-MYB transcription factor [Lupinus albus]
Length=422

 Score =   224 bits (570),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 170/372 (46%), Positives = 223/372 (60%), Gaps = 21/372 (6%)
 Frame = -1

Query  1730  ANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQR  1551
             ANHL+P+LKKGAFT EEE  + ELHAKMGNKWARMA  LPGRTDNEIKNYWNTRIKR QR
Sbjct  1     ANHLRPNLKKGAFTAEEEQLVTELHAKMGNKWARMAVHLPGRTDNEIKNYWNTRIKRCQR  60

Query  1550  AGLPIYPPDVHLQAIHESNQNEDMST---FSTGDTQHSNLLQVNYFEIPAVEFKNLELNQ  1380
             AGLP+YPP+V L+A  ES Q++   +   F+ G   H N L  N +EI    F +L+ +Q
Sbjct  61    AGLPLYPPEVWLKAFQESQQSQSSESTGGFNAGSKVHHNFLHKNSYEIHDSVFDSLKDSQ  120

Query  1379  QLHPQSPL--DIPASSLLAQGLNSSYGPRPFFSTMNPSKRLRGPDSLFTGLSSNDSDIFT  1206
             ++ P  P   DI   S + + L+SS       ST    K LR     F G S  + ++F 
Sbjct  121   RISPNVPELPDIYDYSNMLKSLDSSQYCSFVPSTSPIHKCLRESTMPFLGSSEMNRNVFY  180

Query  1205  AFGPYQNDTCMQVsqssgfssgyyQNLDPDH-PSLSCVIPGSHAslnsnsssLEPAW-AK  1032
              F   Q +   +++QS G  S        DH PS    +  SH+  N NSS+ +P + A 
Sbjct  181   PFDHIQANASDKIAQSFGMQSSL------DHCPSSHSSMCYSHSLSNGNSSTSKPTYEAV  234

Query  1031  KPELPSLQSQIV---SWDspssplpsleSVETLIQSP-PTERSESGNVSPRNSGLLEAVL  864
             K ELPSLQ   +   SW   S P P L SV+  IQSP P    ES + SPRNSGLL+A+L
Sbjct  235   KLELPSLQYPKIDLGSW-GTSPPPPLLYSVDDFIQSPTPISAMESDSSSPRNSGLLDALL  293

Query  863   YESQTLKHSKNTLPQQNSGASI-IPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFN  687
             Y+++T+  SKN    ++S +SI  P    D++  + HETEWE ++DP+SP G  A S+ N
Sbjct  294   YQARTMSSSKNHYSDKSSNSSIATPGHRADSSMLNMHETEWEDHTDPVSPFG--ATSILN  351

Query  686   EYTPISASSLEE  651
             E    +A+SL+E
Sbjct  352   ECPVANANSLDE  363



>emb|CAA78388.1| protein 3 [Petunia x hybrida]
Length=517

 Score =   226 bits (576),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 116/130 (89%), Gaps = 3/130 (2%)
 Frame = -1

Query  1901  ATGGANAGGVP---LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRW  1731
             +TG +N  G     LKKGPWT+AED+ILMEYV +HGEGNWNAVQ+++GL RCGKSCRLRW
Sbjct  14    STGRSNGAGSSRQVLKKGPWTAAEDSILMEYVKKHGEGNWNAVQRNSGLMRCGKSCRLRW  73

Query  1730  ANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQR  1551
             ANHL+P+LKKGAFT EEE  IIELHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQR
Sbjct  74    ANHLRPNLKKGAFTVEEERIIIELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRLKRRQR  133

Query  1550  AGLPIYPPDV  1521
             AGLPIYP ++
Sbjct  134   AGLPIYPQEL  143



>ref|XP_010276128.1| PREDICTED: myb-related protein B-like [Nelumbo nucifera]
Length=485

 Score =   225 bits (573),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+AEDAIL+EYV RHGEGNWNAVQK++GL+RCGKSCRLRWANHL+P+LKKG+F+
Sbjct  31    LKKGPWTAAEDAILIEYVKRHGEGNWNAVQKNSGLSRCGKSCRLRWANHLRPNLKKGSFS  90

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             P+EE  I+ELH+K+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGLP+YP D+  +A
Sbjct  91    PDEERLILELHSKLGNKWARMAAQLPGRTDNEIKNYWNTRVKRRQRAGLPLYPQDIQKRA  150



>dbj|BAG75111.1| transcription factor MYB811 [Fagus crenata]
Length=566

 Score =   227 bits (578),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 115/129 (89%), Gaps = 3/129 (2%)
 Frame = -1

Query  1907  EEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWA  1728
             E  +GG    GV LKKGPWT+AED ILMEYV +HGEGNWNAVQ+++GLARCGKSCRLRWA
Sbjct  25    EAESGGV---GVTLKKGPWTAAEDGILMEYVRKHGEGNWNAVQRNSGLARCGKSCRLRWA  81

Query  1727  NHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRA  1548
             NHL+P+LKKGAF+PEEE  I+ELHAK GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQR 
Sbjct  82    NHLRPNLKKGAFSPEEERLILELHAKYGNKWARMAAQLPGRTDNEIKNYWNTRVKRRQRQ  141

Query  1547  GLPIYPPDV  1521
             GLP+YP D+
Sbjct  142   GLPLYPHDI  150



>gb|KDP22719.1| hypothetical protein JCGZ_01821 [Jatropha curcas]
 gb|AIT52225.1| MYB family protein [Jatropha curcas]
Length=541

 Score =   226 bits (576),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 115/125 (92%), Gaps = 2/125 (2%)
 Frame = -1

Query  1904  EATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWAN  1725
             E++   N GG  LKKGPWT++EDAIL+EYV RHGEGNWN+VQK++GL RCGKSCRLRWAN
Sbjct  12    ESSQKTNQGG--LKKGPWTASEDAILIEYVKRHGEGNWNSVQKNSGLMRCGKSCRLRWAN  69

Query  1724  HLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAG  1545
             HL+P+LKKG+FTPEEE  IIELHAK+GNKWARMA++LPGRTDNEIKN+WNTR+KRRQRAG
Sbjct  70    HLRPNLKKGSFTPEEERIIIELHAKLGNKWARMASQLPGRTDNEIKNFWNTRMKRRQRAG  129

Query  1544  LPIYP  1530
             LPIYP
Sbjct  130   LPIYP  134



>ref|XP_006855906.1| hypothetical protein AMTR_s00037p00177500 [Amborella trichopoda]
 gb|ERN17373.1| hypothetical protein AMTR_s00037p00177500 [Amborella trichopoda]
Length=540

 Score =   226 bits (576),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  1883  AGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLK  1704
             A    LKKGPWTSAEDAIL+EYV +HGEGNWNAVQK++GL+RCGKSCRLRWANHL+P+LK
Sbjct  24    AMAASLKKGPWTSAEDAILVEYVKKHGEGNWNAVQKNSGLSRCGKSCRLRWANHLRPNLK  83

Query  1703  KGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPD  1524
             KG+F+PEEE  I+ LHAK+GNKWARMAA+LPGRTDNEIKNYWNTRIKRRQRAGLP+YP +
Sbjct  84    KGSFSPEEERLILHLHAKLGNKWARMAAQLPGRTDNEIKNYWNTRIKRRQRAGLPLYPAE  143

Query  1523  VHLQAI  1506
             +  Q +
Sbjct  144   MQRQVL  149



>ref|XP_007149977.1| hypothetical protein PHAVU_005G115500g [Phaseolus vulgaris]
 gb|ESW21971.1| hypothetical protein PHAVU_005G115500g [Phaseolus vulgaris]
Length=478

 Score =   224 bits (571),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             ++KGPWT AEDAIL+EYV +HGEGNWN+V K++GL RCGKSCRLRWANHL+P+LKKGAF+
Sbjct  33    VRKGPWTPAEDAILVEYVKKHGEGNWNSVHKNSGLFRCGKSCRLRWANHLRPNLKKGAFS  92

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             PEEE  II+LH+K+GNKWARMAA+LPGRTDNEIKN+WNTR+KRRQRAGLPIYPP+VH++A
Sbjct  93    PEEEQVIIDLHSKLGNKWARMAAQLPGRTDNEIKNFWNTRMKRRQRAGLPIYPPEVHVEA  152

Query  1508  I  1506
              
Sbjct  153   T  153



>emb|CDY67258.1| BnaAnng23930D [Brassica napus]
Length=430

 Score =   223 bits (568),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 116/134 (87%), Gaps = 4/134 (3%)
 Frame = -1

Query  1910  VEEATGGAN----AGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSC  1743
             +E+A G AN     GGV LKKGPWT+AED IL  YV  +GEGNWNAVQK+TGLARCGKSC
Sbjct  8     IEKAGGSANHMSNGGGVVLKKGPWTAAEDEILSVYVRENGEGNWNAVQKNTGLARCGKSC  67

Query  1742  RLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIK  1563
             RLRWANHL+P+L+KG+FT +EE  II+LHA++GNKWARMAA+LPGRTDNEIKNYWNTR+K
Sbjct  68    RLRWANHLRPNLRKGSFTGDEERLIIQLHAQLGNKWARMAAQLPGRTDNEIKNYWNTRLK  127

Query  1562  RRQRAGLPIYPPDV  1521
             R QR GLP+YPPD+
Sbjct  128   RLQRQGLPLYPPDI  141



>emb|CDX71481.1| BnaC04g17160D [Brassica napus]
Length=570

 Score =   226 bits (577),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 152/359 (42%), Positives = 203/359 (57%), Gaps = 58/359 (16%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
               KGPWTSAED +L+ YV +HGEGNWN VQKH+GL+RCGKSCRLRW NHL+P LKKG+FT
Sbjct  20    FHKGPWTSAEDQLLIGYVDKHGEGNWNTVQKHSGLSRCGKSCRLRWVNHLRPSLKKGSFT  79

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              +EE R++ELHA MGNKWARMAA+LPGRTDNEIKN+WNTR+K+ QR GLPIYP +V  QA
Sbjct  80    DKEEQRVVELHASMGNKWARMAAQLPGRTDNEIKNFWNTRLKKLQRLGLPIYPDEVREQA  139

Query  1508  IHESNQNEDMSTFSTGDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSPL--DIPASSL  1335
             ++ + QN   S  S    Q S  L+ +  EIP  +FK L+LN     QS L  ++P  ++
Sbjct  140   MNAAAQNGQNSDHS----QES--LEPDCLEIPEFDFKYLQLNNY---QSVLLRNVPMGNM  190

Query  1334  LAQGLNSSYGPRPFFSTMNP-----SKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQ  1170
             +    + S+ P  +    +P      KR+R            ++D         N+   Q
Sbjct  191   MK---HCSFQPNMYNLIGSPYMSPNRKRVR----------EQETDFLDTGDYATNEQSAQ  237

Query  1169  VsqssgfssgyyQNLDPDHPSLSCVIPGSHAslnsnsssLEPA--WAKKPELPSLQSQIV  996
             +     F                 V+P SH   N+ + S  P+   A+K ELPS Q    
Sbjct  238   LWNQKQFH----------------VVPESHLLGNATTYSSPPSEPEAEKLELPSFQCFDP  281

Query  995   SWDspssplpsleSVE---TLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNT  828
               D  +     + +VE   TL+QSP T+        P +SGLLE+V+Y S   K + N+
Sbjct  282   PGDWETQHSNPMPAVESDRTLVQSPLTD-------CP-SSGLLESVVYGSSGEKQATNS  332



>gb|KDO47779.1| hypothetical protein CISIN_1g011938mg [Citrus sinensis]
Length=361

 Score =   221 bits (562),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 217/349 (62%), Gaps = 18/349 (5%)
 Frame = -1

Query  1643  NKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFST  1464
             +K   +  +LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP+V  QA+ ES Q ++++  ++
Sbjct  16    SKIIFIFCQLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEVSFQALQES-QCQNINGINS  74

Query  1463  GDTQHSNLLQVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFF  1290
             GD  H +LLQ N +EIP V F +L+ NQ + P  P   DI AS++L +GL S Y    F 
Sbjct  75    GDKGHHDLLQANGYEIPDVVFDSLKANQGVLPYVPDIPDITASTMLMKGLGSQYC--SFV  132

Query  1289  -STMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDH  1113
                M+  KRLR    LF+    +  + F +F  + NDT  ++++S G S     +  P  
Sbjct  133   PPVMHRPKRLRESVPLFSAYGGSVKNEF-SFDQFHNDTSDKIARSFGLSFPLDPDTTPKA  191

Query  1112  PSLSCVIPGSHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVET  945
             P    ++ GSH   N N S+ +P   A K ELPSLQ   + + SW   SSP P LE+V+ 
Sbjct  192   PESFGMLQGSHTLSNGNFSASKPNLGAVKLELPSLQYTETDLGSW-GTSSPQPLLETVDA  250

Query  944   LIQS-PPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTF  768
              IQS PPT   +SG  SPRNSGLL+A+++ES TL   KN    ++S +S +  D+ D+  
Sbjct  251   FIQSPPPTGTLDSGCPSPRNSGLLDALIHESNTL---KNHSSDKSSNSSSVTPDVADSCT  307

Query  767   PDFHETEWEGYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLA  627
              +F ETEWE YSDP+SPLGHSA S+FNE TP+SA  SSL+E   VE   
Sbjct  308   RNFCETEWEDYSDPLSPLGHSATSLFNECTPLSASGSSLDEQAPVETFG  356



>ref|XP_004144591.1| PREDICTED: uncharacterized protein LOC101204619 [Cucumis sativus]
 gb|KGN43516.1| hypothetical protein Csa_7G043580 [Cucumis sativus]
Length=500

 Score =   224 bits (572),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+AED IL++YV +HGEGNWNAVQKHTGLARCGKSCRLRWANHL+P+LKKG+F+
Sbjct  30    LKKGPWTAAEDGILIDYVKKHGEGNWNAVQKHTGLARCGKSCRLRWANHLRPNLKKGSFS  89

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
              EEE  IIELHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGLP+YP ++  +A
Sbjct  90    QEEERIIIELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRMKRRQRAGLPLYPLEIQQEA  149



>ref|XP_003541947.1| PREDICTED: transcription factor GAMYB-like [Glycine max]
Length=479

 Score =   224 bits (571),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             ++KGPWT  EDAILMEYV +HGEGNWN+VQK++GL RCGKSCRLRWANHL+P+LKKGAF+
Sbjct  24    VRKGPWTPEEDAILMEYVKKHGEGNWNSVQKNSGLLRCGKSCRLRWANHLRPNLKKGAFS  83

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             PEEE  II+LH+K+GNKWARMAA+LPGRTDNEIKN+WNTR+KRRQRAGLPIYPP+VH +A
Sbjct  84    PEEEQVIIDLHSKLGNKWARMAAQLPGRTDNEIKNFWNTRMKRRQRAGLPIYPPEVHAEA  143



>ref|XP_004243474.1| PREDICTED: uncharacterized protein LOC101254917 [Solanum lycopersicum]
Length=486

 Score =   224 bits (570),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -1

Query  1895  GGANAGGV--PLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANH  1722
             G  N GG    LKKGPWT+ EDAILM+YV +HGEGNWNAVQ+++GL RCGKSCRLRWANH
Sbjct  7     GTRNGGGTRQALKKGPWTAGEDAILMDYVKKHGEGNWNAVQRNSGLMRCGKSCRLRWANH  66

Query  1721  LKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGL  1542
             L+P LKKGAFTPEEE  II+LHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGL
Sbjct  67    LRPHLKKGAFTPEEERIIIDLHAKLGNKWARMAAQLPGRTDNEIKNYWNTRLKRRQRAGL  126

Query  1541  PIYPPDV  1521
             PIYP ++
Sbjct  127   PIYPQEL  133



>gb|AAG28525.1|AF198498_1 anther-specific myb-related protein 2 [Nicotiana tabacum]
Length=474

 Score =   223 bits (569),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = -1

Query  1886  NAGGVP--LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKP  1713
             N GG    LKKGPWT+AEDAILMEYV ++GEGNWNAVQ+++GL RCGKSCRLRWANHL+P
Sbjct  12    NNGGTRQVLKKGPWTAAEDAILMEYVKKNGEGNWNAVQRNSGLMRCGKSCRLRWANHLRP  71

Query  1712  DLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIY  1533
             +LKKGAF+ EEE  I+ELHAK+GNKWARMAA++PGRTDNEIKNYWNTR+KRRQRAGLPIY
Sbjct  72    NLKKGAFSLEEERFIVELHAKLGNKWARMAAQMPGRTDNEIKNYWNTRLKRRQRAGLPIY  131

Query  1532  PPDVHLQ  1512
             P D+  Q
Sbjct  132   PQDIQPQ  138



>ref|XP_006366585.1| PREDICTED: transcription factor RAX3-like [Solanum tuberosum]
Length=484

 Score =   223 bits (569),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -1

Query  1895  GGANAGGV--PLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANH  1722
             G  N GG    LKKGPWT+ EDAILM+YV +HGEGNWNAVQ+++GL RCGKSCRLRWANH
Sbjct  7     GMRNGGGTRQALKKGPWTAGEDAILMDYVKKHGEGNWNAVQRNSGLMRCGKSCRLRWANH  66

Query  1721  LKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGL  1542
             L+P LKKGAFTPEEE  II+LHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGL
Sbjct  67    LRPHLKKGAFTPEEERIIIDLHAKLGNKWARMAAQLPGRTDNEIKNYWNTRLKRRQRAGL  126

Query  1541  PIYPPDV  1521
             PIYP ++
Sbjct  127   PIYPQEL  133



>ref|XP_006432325.1| hypothetical protein CICLE_v100007563mg, partial [Citrus clementina]
 gb|ESR45565.1| hypothetical protein CICLE_v100007563mg, partial [Citrus clementina]
Length=331

 Score =   219 bits (557),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 161/339 (47%), Positives = 213/339 (63%), Gaps = 18/339 (5%)
 Frame = -1

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP+V  QA+ ES Q ++++  ++GD  H +LL
Sbjct  1     LPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEVSFQALQES-QCQNINGINSGDKGHHDLL  59

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFF-STMNPSKR  1266
             Q N +EIP V F +L+ NQ + P  P   DI AS++L +GL S Y    F    M+  KR
Sbjct  60    QANGYEIPDVVFDSLKANQGVLPYVPDIPDITASTMLMKGLGSQYC--SFVPPVMHRPKR  117

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             LR    LF+G   +  + F +F  + NDT  ++++S G S     +  P  P    ++ G
Sbjct  118   LRESVPLFSGYGGSVKNEF-SFDQFHNDTSDKIARSFGLSFPLDPDTTPKAPESFGMLQG  176

Query  1085  SHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQS-PPTE  921
             SH   N N S+ +P   A K ELPSLQ   + + SW   SSP P LE+V+  IQS PPT 
Sbjct  177   SHTLSNGNFSASKPNLGAVKLELPSLQYTETDLGSW-GTSSPQPLLETVDAFIQSPPPTG  235

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
               +SG  SPRNSGLL+A+++ES  L   KN    ++S +S +  D+ D+   +F ETEWE
Sbjct  236   TLDSGCPSPRNSGLLDALIHESNIL---KNHSSDKSSNSSSVTPDVADSCTRNFCETEWE  292

Query  740   GYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEML  630
              YSDP+SPLGHSA S+FNE TP+SA  SSL+E   VE  
Sbjct  293   DYSDPLSPLGHSATSLFNECTPLSASGSSLDEQAPVETF  331



>ref|XP_009132851.1| PREDICTED: myb-related protein 306-like [Brassica rapa]
Length=457

 Score =   223 bits (567),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKG WT+ EDAIL EYV +HGEGNWNAVQK++GL RCGKSCRLRWANHL+P+LKKG+F+
Sbjct  17    LKKGSWTTTEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCRLRWANHLRPNLKKGSFS  76

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             P+EE  IIELHAKMGNKWARMA++LPGRTDNEIKNYWNTR+KRRQRAGLP+ P ++H Q 
Sbjct  77    PDEEKIIIELHAKMGNKWARMASQLPGRTDNEIKNYWNTRMKRRQRAGLPLSPHEIHHQG  136

Query  1508  IHESNQNEDMSTFSTGDTQHSN  1443
             I   ++ E  ++F   +  HSN
Sbjct  137   IDNDDEFE-FNSFQFSNQDHSN  157



>ref|XP_008230038.1| PREDICTED: transcription factor MYB108-like [Prunus mume]
Length=522

 Score =   224 bits (572),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 7/141 (5%)
 Frame = -1

Query  1910  VEEATGGANAGGV-------PLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCG  1752
             V EA   A  GG         LKKGPWT+AED ILMEYV +HGEGNWNAVQK++GLARCG
Sbjct  11    VHEAEEAAQRGGSHHNHQQRGLKKGPWTAAEDGILMEYVKKHGEGNWNAVQKNSGLARCG  70

Query  1751  KSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNT  1572
             KSCRLRWANHL+P+LKKG+ +P+EE  IIELHAK GNKWARMA++LPGRTDNEIKNYWNT
Sbjct  71    KSCRLRWANHLRPNLKKGSLSPDEERLIIELHAKFGNKWARMASQLPGRTDNEIKNYWNT  130

Query  1571  RIKRRQRAGLPIYPPDVHLQA  1509
             RIKRRQRAGLP+YP D+  +A
Sbjct  131   RIKRRQRAGLPVYPHDLQPEA  151



>ref|XP_007217274.1| hypothetical protein PRUPE_ppa017451mg [Prunus persica]
 gb|EMJ18473.1| hypothetical protein PRUPE_ppa017451mg [Prunus persica]
Length=510

 Score =   224 bits (571),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 115/142 (81%), Gaps = 11/142 (8%)
 Frame = -1

Query  1910  VEEATGGANAGGVP-----------LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGL  1764
             V EA   A  GG             LKKGPWT+AED ILMEYV +HGEGNWNAVQK++GL
Sbjct  11    VHEAEAAAQRGGSHHNHHQQHQQRGLKKGPWTAAEDGILMEYVKKHGEGNWNAVQKNSGL  70

Query  1763  ARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKN  1584
             ARCGKSCRLRWANHL+P+LKKG+ +P+EE  IIELHAK GNKWARMA++LPGRTDNEIKN
Sbjct  71    ARCGKSCRLRWANHLRPNLKKGSLSPDEERLIIELHAKFGNKWARMASQLPGRTDNEIKN  130

Query  1583  YWNTRIKRRQRAGLPIYPPDVH  1518
             YWNTRIKRRQRAGLP+YP D+ 
Sbjct  131   YWNTRIKRRQRAGLPVYPHDLQ  152



>ref|XP_009398956.1| PREDICTED: myb-related protein P-like [Musa acuminata subsp. 
malaccensis]
Length=432

 Score =   222 bits (565),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = -1

Query  1910  VEEATGGANAGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRW  1731
              EE   G       LKKGPWT AEDAIL+E+V RHGEGNWNAVQ+H+GLARCGKSCRLRW
Sbjct  3     AEEGERGGKKAERGLKKGPWTPAEDAILVEHVRRHGEGNWNAVQRHSGLARCGKSCRLRW  62

Query  1730  ANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQR  1551
             ANHL+P+LKKG+FTP+EE  I+ LHA++GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQR
Sbjct  63    ANHLRPNLKKGSFTPDEELLILRLHAQLGNKWARMAAQLPGRTDNEIKNYWNTRLKRRQR  122

Query  1550  AGLPIYPPDVHLQAIHESNQNEDMSTF  1470
             AGLPIYPP++      +    +  ST 
Sbjct  123   AGLPIYPPELQEAVGFDHQLKQQASTL  149



>emb|CDY19890.1| BnaC09g31560D [Brassica napus]
Length=429

 Score =   221 bits (564),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 115/134 (86%), Gaps = 4/134 (3%)
 Frame = -1

Query  1910  VEEATGGAN----AGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSC  1743
             +E+A G AN     GGV LKKGPWT+AED IL  YV  +GEGNWNAVQK+TGL RCGKSC
Sbjct  8     IEKAGGSANHMSNGGGVVLKKGPWTAAEDEILSVYVRENGEGNWNAVQKNTGLVRCGKSC  67

Query  1742  RLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIK  1563
             RLRWANHL+P+L+KG+FT +EE  II+LHA++GNKWARMAA+LPGRTDNEIKNYWNTR+K
Sbjct  68    RLRWANHLRPNLRKGSFTGDEERLIIQLHAQLGNKWARMAAQLPGRTDNEIKNYWNTRLK  127

Query  1562  RRQRAGLPIYPPDV  1521
             R QR GLP+YPPD+
Sbjct  128   RLQRQGLPLYPPDI  141



>ref|XP_006432326.1| hypothetical protein CICLE_v100007563mg, partial [Citrus clementina]
 gb|ESR45566.1| hypothetical protein CICLE_v100007563mg, partial [Citrus clementina]
Length=355

 Score =   219 bits (558),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 161/340 (47%), Positives = 213/340 (63%), Gaps = 18/340 (5%)
 Frame = -1

Query  1616  LPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTFSTGDTQHSNLL  1437
             LPGRTDNEIKNYWNTRIKRRQRAGLP+YPP+V  QA+ ES Q ++++  ++GD  H +LL
Sbjct  1     LPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEVSFQALQES-QCQNINGINSGDKGHHDLL  59

Query  1436  QVNYFEIPAVEFKNLELNQQLHPQSP--LDIPASSLLAQGLNSSYGPRPFF-STMNPSKR  1266
             Q N +EIP V F +L+ NQ + P  P   DI AS++L +GL S Y    F    M+  KR
Sbjct  60    QANGYEIPDVVFDSLKANQGVLPYVPDIPDITASTMLMKGLGSQYC--SFVPPVMHRPKR  117

Query  1265  LRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDHPSLSCVIPG  1086
             LR    LF+G   +  + F +F  + NDT  ++++S G S     +  P  P    ++ G
Sbjct  118   LRESVPLFSGYGGSVKNEF-SFDQFHNDTSDKIARSFGLSFPLDPDTTPKAPESFGMLQG  176

Query  1085  SHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSWDspssplpsleSVETLIQS-PPTE  921
             SH   N N S+ +P   A K ELPSLQ   + + SW   SSP P LE+V+  IQS PPT 
Sbjct  177   SHTLSNGNFSASKPNLGAVKLELPSLQYTETDLGSW-GTSSPQPLLETVDAFIQSPPPTG  235

Query  920   RSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNSGASIIPSDIVDNTFPDFHETEWE  741
               +SG  SPRNSGLL+A+++ES  L   KN    ++S +S +  D+ D+   +F ETEWE
Sbjct  236   TLDSGCPSPRNSGLLDALIHESNIL---KNHSSDKSSNSSSVTPDVADSCTRNFCETEWE  292

Query  740   GYSDPISPLGHSAASVFNEYTPISA--SSLEEHQSVEMLA  627
              YSDP+SPLGHSA S+FNE TP+SA  SSL+E   VE   
Sbjct  293   DYSDPLSPLGHSATSLFNECTPLSASGSSLDEQAPVETFG  332



>ref|XP_006352041.1| PREDICTED: myb-related protein Pp2-like [Solanum tuberosum]
Length=476

 Score =   222 bits (566),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+ EDAILMEYV +HGEGNWNAVQ+++GL RCGKSCRLRWANHL+P LKKGAF+
Sbjct  32    LKKGPWTTTEDAILMEYVKKHGEGNWNAVQRNSGLMRCGKSCRLRWANHLRPHLKKGAFS  91

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDV  1521
              EEE  I+ELHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGLPIYP D+
Sbjct  92    LEEERLIVELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRLKRRQRAGLPIYPQDI  147



>ref|XP_008808424.1| PREDICTED: LOW QUALITY PROTEIN: tyrosine-protein phosphatase 
non-receptor type 23-like [Phoenix dactylifera]
Length=486

 Score =   223 bits (567),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+AEDAILMEYV ++GEGNWNAVQK++GL RCGKSCRLRWANHL+P+L+KG FT
Sbjct  18    LKKGPWTAAEDAILMEYVKKYGEGNWNAVQKNSGLNRCGKSCRLRWANHLRPNLRKGPFT  77

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             PEEE  I+ LHA++GNKWARMAA+LPGRTDNEIKNYWNTRIKRR+RAGLP+YPP+V  Q 
Sbjct  78    PEEELLILHLHAQLGNKWARMAAQLPGRTDNEIKNYWNTRIKRRKRAGLPLYPPEVQRQV  137

Query  1508  I  1506
             +
Sbjct  138   L  138



>ref|XP_010089493.1| Transcription factor GAMYB [Morus notabilis]
 gb|EXB37886.1| Transcription factor GAMYB [Morus notabilis]
Length=494

 Score =   223 bits (567),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 4/145 (3%)
 Frame = -1

Query  1943  MTLKGNVNSPSVEE---ATGGANAGGV-PLKKGPWTSAEDAILMEYVTRHGEGNWNAVQK  1776
             M +  N N    EE     GG N GG   LKKGPWT+AEDAIL+EYV + GEGNWNAVQK
Sbjct  4     MMINHNSNGTETEERRVTAGGENKGGTRGLKKGPWTAAEDAILVEYVKKRGEGNWNAVQK  63

Query  1775  HTGLARCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDN  1596
             + GLARCGKSCRLRWANHL+P+LKKGAF+ +EE  IIELHAK+GNKWARMA++LPGRTDN
Sbjct  64    NVGLARCGKSCRLRWANHLRPNLKKGAFSHQEERIIIELHAKLGNKWARMASQLPGRTDN  123

Query  1595  EIKNYWNTRIKRRQRAGLPIYPPDV  1521
             EIKNYWNTR+KRRQRAGLP+YP ++
Sbjct  124   EIKNYWNTRMKRRQRAGLPLYPQEL  148



>ref|XP_004251522.1| PREDICTED: transcription factor GAMYB-like [Solanum lycopersicum]
Length=461

 Score =   222 bits (565),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+ EDAILMEYV +HGEGNWNAVQ+++GL RCGKSCRLRWANHL+P LKKGAF+
Sbjct  20    LKKGPWTTTEDAILMEYVKKHGEGNWNAVQRNSGLMRCGKSCRLRWANHLRPHLKKGAFS  79

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDV  1521
              EEE  I+ELHAK+GNKWARMAA+LPGRTDNEIKNYWNTR+KRRQRAGLPIYP D+
Sbjct  80    LEEERLIVELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRLKRRQRAGLPIYPQDI  135



>gb|KHN30812.1| Transcription factor GAMYB [Glycine soja]
Length=414

 Score =   220 bits (561),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 159/361 (44%), Positives = 212/361 (59%), Gaps = 42/361 (12%)
 Frame = -1

Query  1649  MGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQAIHESNQNEDMSTF  1470
             MGNKWARMAAELPGRTDNEIKNYWNTRIKR QRAGLPIYP ++  + ++ + +++++ T 
Sbjct  1     MGNKWARMAAELPGRTDNEIKNYWNTRIKRMQRAGLPIYPEELCQRILNGNQESQNVGTM  60

Query  1469  STGDTQHSNLLQVNYFEIPAVEFKNLELNQQL-HPQSPLDIPASSLLAQGLNSSYGPRPF  1293
             +     H +L Q N F+IP VEFKN +    L H  S  D+P SSL  Q  +SS+     
Sbjct  61    TNEACHHDDLSQTNNFDIPDVEFKNFKFRHGLPHVPSIFDMPESSLFDQSSDSSHSYNFL  120

Query  1292  FSTMNPSKRLRGPDSLFTGLSSNDSDIFTAFGPYQNDTCMQVsqssgfssgyyQNLDPDH  1113
             F TM P+KR R  + L+    S   +    F  Y N T  ++S               DH
Sbjct  121   FPTMRPTKRPRESEMLYDSFGSCSINAAPLFDQYGNYTFEKIS---------------DH  165

Query  1112  PSLSCV---------------IPGSHAslnsnsssLEPAW-AKKPELPSLQ---SQIVSW  990
             P LS                 + GSHA+LN N+S+  P + A K ELPSLQ   +Q  SW
Sbjct  166   PGLSLPCDPVLNTTDQFHGDNLTGSHAALNGNASASVPIFGAMKLELPSLQYPETQHGSW  225

Query  989   DspssplpsleSVETLIQSPPTERSESGNVSPRNSGLLEAVLYESQTLKHSKNTLPQQNS  810
              +P SPLPSLESV+TLIQSP  E   S  +SP++SGLLEA++Y S++LK S N L  Q +
Sbjct  226   GTPMSPLPSLESVDTLIQSPTLEPILSDPISPQSSGLLEAIVYNSKSLKGSNNDLLLQET  285

Query  809   GAS---IIPSDIVDNTFPDFHETEWEGYSDPISPLGHSAASVFNEYTPISASSLEEHQSV  639
              A+   +     ++++F    +TEW+   DP SPLG SAASV  +YTP+   S++ +QS 
Sbjct  286   IATANEVANISTLNHSF----QTEWDELGDPNSPLGQSAASVLTDYTPVRMCSVDGYQST  341

Query  638   E  636
             E
Sbjct  342   E  342



>ref|XP_009781770.1| PREDICTED: transcription factor GAMYB-like [Nicotiana sylvestris]
Length=474

 Score =   222 bits (566),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = -1

Query  1886  NAGGV--PLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKP  1713
             N GG    LKKGPWT+AEDAILMEYV ++GEGNWNAVQ+++GL RCGKSCRLRWANHL+P
Sbjct  12    NNGGTRQVLKKGPWTAAEDAILMEYVKKNGEGNWNAVQRNSGLMRCGKSCRLRWANHLRP  71

Query  1712  DLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIY  1533
             +LKKGAF+ EEE  I+ELHAK+GNKWARMAA++PGRTDNEIKNYWNTR+KRRQRAGLPIY
Sbjct  72    NLKKGAFSLEEERFIVELHAKLGNKWARMAAQMPGRTDNEIKNYWNTRLKRRQRAGLPIY  131

Query  1532  PPDVHLQ  1512
             P D+  Q
Sbjct  132   PQDIQPQ  138



>gb|KHN36528.1| Transcription factor GAMYB [Glycine soja]
Length=479

 Score =   222 bits (566),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             ++KGPWT  EDAILMEYV +HGEGNWN+VQK++GL RCGKSCRLRWANHL+P+LKKGAF+
Sbjct  24    VRKGPWTPEEDAILMEYVKKHGEGNWNSVQKNSGLLRCGKSCRLRWANHLRPNLKKGAFS  83

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             PEEE  II+LH+K+GNKWARMAA+LPGRTD+EIKN+WNTR+KRRQRAGLPIYPP+VH +A
Sbjct  84    PEEEQVIIDLHSKLGNKWARMAAQLPGRTDDEIKNFWNTRMKRRQRAGLPIYPPEVHAEA  143



>ref|XP_009120026.1| PREDICTED: transcription factor MYB104-like [Brassica rapa]
Length=575

 Score =   224 bits (572),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 116/134 (87%), Gaps = 4/134 (3%)
 Frame = -1

Query  1910  VEEATGGAN----AGGVPLKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSC  1743
             +E+A G AN     GGV LKKGPWT+AED IL  YV  +GEGNWNAVQK+TGLARCGKSC
Sbjct  8     IEKAGGSANHMSNGGGVVLKKGPWTAAEDEILSVYVRENGEGNWNAVQKNTGLARCGKSC  67

Query  1742  RLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIK  1563
             RLRWANHL+P+L+KG+FT +EE  II+LHA++GNKWARMAA+LPGRTDNEIKNYWNTR+K
Sbjct  68    RLRWANHLRPNLRKGSFTGDEERLIIQLHAQLGNKWARMAAQLPGRTDNEIKNYWNTRLK  127

Query  1562  RRQRAGLPIYPPDV  1521
             R QR GLP+YPPD+
Sbjct  128   RLQRQGLPLYPPDI  141



>ref|XP_008379641.1| PREDICTED: transcription factor RAX1 [Malus domestica]
Length=494

 Score =   223 bits (567),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 115/140 (82%), Gaps = 10/140 (7%)
 Frame = -1

Query  1910  VEEATGGANAGGVP----------LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLA  1761
             V E   GA  GG            LKKGPWT AEDAIL+EYV +HGEGNWNAVQK++GLA
Sbjct  12    VXETAVGAQRGGSHHHHNHHHQRGLKKGPWTGAEDAILVEYVKKHGEGNWNAVQKNSGLA  71

Query  1760  RCGKSCRLRWANHLKPDLKKGAFTPEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNY  1581
             RCGKSCRLRWANHL+P+LKKG+ +PEEE  IIELHAK GNKWARMA++LPGRTDNEIKNY
Sbjct  72    RCGKSCRLRWANHLRPNLKKGSLSPEEERLIIELHAKFGNKWARMASQLPGRTDNEIKNY  131

Query  1580  WNTRIKRRQRAGLPIYPPDV  1521
             WNTR+KRRQRAGLP+YP D+
Sbjct  132   WNTRMKRRQRAGLPVYPHDL  151



>ref|XP_010931683.1| PREDICTED: transcription factor GAMYB-like, partial [Elaeis guineensis]
Length=163

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+AEDAIL EYV +HGEGNWNAVQK++GL RCGKSCRLRWANHL+P+LKKGAFT
Sbjct  32    LKKGPWTAAEDAILREYVKKHGEGNWNAVQKNSGLNRCGKSCRLRWANHLRPNLKKGAFT  91

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             PEEE  I+ LHA +GNKWARMAA LPGRTDNEIKNYWNTR+KRRQR GLP+YPP++  Q 
Sbjct  92    PEEELLILHLHAHVGNKWARMAAHLPGRTDNEIKNYWNTRMKRRQRTGLPLYPPEMQRQF  151

Query  1508  I  1506
             +
Sbjct  152   L  152



>ref|XP_006296077.1| hypothetical protein CARUB_v10025227mg [Capsella rubella]
 gb|EOA28975.1| hypothetical protein CARUB_v10025227mg [Capsella rubella]
Length=485

 Score =   222 bits (566),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+ EDAIL EYV +HGEGNWNAVQK++GL RCGKSCRLRWANHL+P+LKKG+FT
Sbjct  6     LKKGPWTATEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCRLRWANHLRPNLKKGSFT  65

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVH  1518
             P+EE  IIELHAK+GNKWARMA++LPGRTDNEIKNYWNTR+KRRQRAGLP+YP ++H
Sbjct  66    PDEEKIIIELHAKLGNKWARMASQLPGRTDNEIKNYWNTRMKRRQRAGLPLYPHEIH  122



>ref|XP_010510013.1| PREDICTED: transcription factor GAMYB-like [Camelina sativa]
Length=503

 Score =   223 bits (567),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -1

Query  1868  LKKGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHLKPDLKKGAFT  1689
             LKKGPWT+ EDAIL EYV +HGEGNWNAVQK++GL RCGKSCRLRWANHL+P+LKKG+FT
Sbjct  18    LKKGPWTATEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCRLRWANHLRPNLKKGSFT  77

Query  1688  PEEEHRIIELHAKMGNKWARMAAELPGRTDNEIKNYWNTRIKRRQRAGLPIYPPDVHLQA  1509
             P+EE  IIELHAK+GNKWARMA++LPGRTDNEIKNYWNTR+KRRQRAGLP+YP D   Q 
Sbjct  78    PDEEKIIIELHAKLGNKWARMASQLPGRTDNEIKNYWNTRMKRRQRAGLPLYPHDTQHQH  137

Query  1508  IHE  1500
              H+
Sbjct  138   DHQ  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6326231589360