BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22313_g1_i3 len=1990 path=[1:0-1409 @1411@!:1410-1647
4722:1648-1649 1651:1650-1650 1652:1651-1688 1690:1689-1989]

Length=1990
                                                                      Score     E

ref|XP_009797262.1|  PREDICTED: DNA-directed primase/polymerase p...    843   0.0      
ref|XP_009797263.1|  PREDICTED: DNA-directed primase/polymerase p...    838   0.0      
ref|XP_009599575.1|  PREDICTED: DNA-directed primase/polymerase p...    838   0.0      
ref|XP_009599576.1|  PREDICTED: DNA-directed primase/polymerase p...    835   0.0      
ref|XP_006359463.1|  PREDICTED: coiled-coil domain-containing pro...    834   0.0      
ref|XP_010314290.1|  PREDICTED: DNA-directed primase/polymerase p...    832   0.0      
ref|XP_011076097.1|  PREDICTED: DNA-directed primase/polymerase p...    798   0.0      
ref|XP_009797265.1|  PREDICTED: DNA-directed primase/polymerase p...    797   0.0      
ref|XP_011076098.1|  PREDICTED: DNA-directed primase/polymerase p...    792   0.0      
ref|XP_009797264.1|  PREDICTED: DNA-directed primase/polymerase p...    788   0.0      
ref|XP_009599577.1|  PREDICTED: DNA-directed primase/polymerase p...    782   0.0      
ref|XP_006359464.1|  PREDICTED: coiled-coil domain-containing pro...    768   0.0      
emb|CDP05135.1|  unnamed protein product                                765   0.0      
gb|EYU25154.1|  hypothetical protein MIMGU_mgv1a003719mg                752   0.0      
ref|XP_007038834.1|  Coiled-coil domain-containing protein 111 is...    743   0.0      
ref|XP_007218876.1|  hypothetical protein PRUPE_ppa003300mg             738   0.0      
emb|CBI22633.3|  unnamed protein product                                738   0.0      
ref|XP_008234830.1|  PREDICTED: DNA-directed primase/polymerase p...    734   0.0      
ref|XP_010662672.1|  PREDICTED: DNA-directed primase/polymerase p...    732   0.0      
ref|XP_011046040.1|  PREDICTED: DNA-directed primase/polymerase p...    729   0.0      
ref|XP_010261356.1|  PREDICTED: DNA-directed primase/polymerase p...    726   0.0      
ref|XP_004309176.1|  PREDICTED: coiled-coil domain-containing pro...    717   0.0      
ref|XP_010261354.1|  PREDICTED: DNA-directed primase/polymerase p...    715   0.0      
ref|XP_010261358.1|  PREDICTED: DNA-directed primase/polymerase p...    714   0.0      
ref|XP_009797266.1|  PREDICTED: DNA-directed primase/polymerase p...    706   0.0      
ref|XP_009377568.1|  PREDICTED: DNA-directed primase/polymerase p...    702   0.0      
ref|XP_008362791.1|  PREDICTED: DNA-directed primase/polymerase p...    702   0.0      
ref|XP_002513641.1|  conserved hypothetical protein                     701   0.0      Ricinus communis
ref|XP_009375545.1|  PREDICTED: DNA-directed primase/polymerase p...    698   0.0      
ref|XP_008362790.1|  PREDICTED: DNA-directed primase/polymerase p...    697   0.0      
ref|XP_010314291.1|  PREDICTED: DNA-directed primase/polymerase p...    691   0.0      
ref|XP_010671594.1|  PREDICTED: DNA-directed primase/polymerase p...    692   0.0      
gb|AES75632.2|  DNA primase                                             692   0.0      
ref|XP_007038836.1|  DNA primases isoform 3                             686   0.0      
ref|XP_007038835.1|  DNA primases isoform 2                             686   0.0      
ref|XP_010537140.1|  PREDICTED: DNA-directed primase/polymerase p...    681   0.0      
ref|XP_010537139.1|  PREDICTED: DNA-directed primase/polymerase p...    681   0.0      
ref|XP_006422047.1|  hypothetical protein CICLE_v10006841mg             679   0.0      
ref|NP_001154775.1|  DNA primase                                        678   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004515987.1|  PREDICTED: LOW QUALITY PROTEIN: coiled-coil ...    676   0.0      
ref|XP_003619414.1|  Defensin/CCP-like protein                          676   0.0      
ref|XP_006372378.1|  hypothetical protein POPTR_0017s01050g             669   0.0      
ref|XP_008439308.1|  PREDICTED: DNA-directed primase/polymerase p...    671   0.0      
ref|XP_007152147.1|  hypothetical protein PHAVU_004G106200g             671   0.0      
ref|XP_010060340.1|  PREDICTED: DNA-directed primase/polymerase p...    668   0.0      
ref|XP_007152150.1|  hypothetical protein PHAVU_004G106200g             669   0.0      
gb|KGN57418.1|  hypothetical protein Csa_3G184000                       664   0.0      
ref|XP_010445265.1|  PREDICTED: DNA-directed primase/polymerase p...    665   0.0      
emb|CDX96153.1|  BnaC02g14980D                                          663   0.0      
ref|XP_007152149.1|  hypothetical protein PHAVU_004G106200g             664   0.0      
emb|CDY27048.1|  BnaA02g10680D                                          662   0.0      
gb|KCW90617.1|  hypothetical protein EUGRSUZ_A02722                     661   0.0      
ref|XP_009127215.1|  PREDICTED: DNA-directed primase/polymerase p...    661   0.0      
ref|XP_007152152.1|  hypothetical protein PHAVU_004G106200g             662   0.0      
ref|XP_006401781.1|  hypothetical protein EUTSA_v10012991mg             661   0.0      
gb|KHN42464.1|  Coiled-coil domain-containing protein 111 like          659   0.0      
ref|XP_003533145.1|  PREDICTED: coiled-coil domain-containing pro...    659   0.0      
ref|XP_006587267.1|  PREDICTED: coiled-coil domain-containing pro...    659   0.0      
ref|XP_010482657.1|  PREDICTED: DNA-directed primase/polymerase p...    656   0.0      
ref|XP_006281914.1|  hypothetical protein CARUB_v10028119mg             654   0.0      
ref|XP_010662673.1|  PREDICTED: DNA-directed primase/polymerase p...    649   0.0      
ref|XP_009400728.1|  PREDICTED: DNA-directed primase/polymerase p...    649   0.0      
gb|KFK26881.1|  hypothetical protein AALP_AA8G305600                    649   0.0      
dbj|BAB10428.1|  unnamed protein product                                647   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805582.1|  PREDICTED: DNA-directed primase/polymerase p...    647   0.0      
ref|XP_004140828.1|  PREDICTED: coiled-coil domain-containing pro...    644   0.0      
ref|XP_007152145.1|  hypothetical protein PHAVU_004G106200g             634   0.0      
ref|XP_010919130.1|  PREDICTED: DNA-directed primase/polymerase p...    637   0.0      
ref|XP_007152148.1|  hypothetical protein PHAVU_004G106200g             629   0.0      
ref|XP_010105736.1|  Coiled-coil domain-containing protein 111-li...    625   0.0      
ref|XP_003563145.1|  PREDICTED: DNA-directed primase/polymerase p...    620   0.0      
ref|XP_008362792.1|  PREDICTED: DNA-directed primase/polymerase p...    612   0.0      
dbj|BAJ91837.1|  predicted protein                                      614   0.0      
ref|XP_010442824.1|  PREDICTED: DNA-directed primase/polymerase p...    615   0.0      
dbj|BAD31083.1|  unknown protein                                        610   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC81996.1|  hypothetical protein OsI_25931                          606   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004957651.1|  PREDICTED: coiled-coil domain-containing pro...    604   0.0      
gb|AAU44590.1|  hypothetical protein AT5G52800                          598   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_200092.2|  DNA primase                                           598   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482658.1|  PREDICTED: DNA-directed primase/polymerase p...    598   0.0      
ref|XP_004157215.1|  PREDICTED: LOW QUALITY PROTEIN: coiled-coil ...    592   0.0      
ref|XP_010060347.1|  PREDICTED: DNA-directed primase/polymerase p...    593   0.0      
ref|XP_002864194.1|  hypothetical protein ARALYDRAFT_495344             589   0.0      
ref|XP_006657679.1|  PREDICTED: coiled-coil domain-containing pro...    586   0.0      
ref|NP_001141209.1|  hypothetical protein                               584   0.0      Zea mays [maize]
gb|EMT07272.1|  Coiled-coil domain-containing 111-like protein          550   0.0      
ref|XP_010261360.1|  PREDICTED: DNA-directed primase/polymerase p...    542   0.0      
ref|XP_006829019.1|  hypothetical protein AMTR_s00001p00249650          536   7e-180   
ref|NP_001032064.1|  DNA primase                                        530   1e-179   Arabidopsis thaliana [mouse-ear cress]
gb|AES75633.2|  DNA primase                                             530   2e-176   
gb|EPS68297.1|  hypothetical protein M569_06472                         519   2e-175   
ref|XP_003619415.1|  Coiled-coil domain-containing protein              521   2e-172   
gb|EEE67132.1|  hypothetical protein OsJ_24177                          515   1e-171   Oryza sativa Japonica Group [Japonica rice]
gb|KDO56812.1|  hypothetical protein CISIN_1g008891mg                   513   1e-171   
gb|KDP22216.1|  hypothetical protein JCGZ_26047                         459   1e-152   
gb|ACN33809.1|  unknown                                                 428   5e-138   Zea mays [maize]
ref|XP_008343839.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...    386   2e-124   
dbj|BAJ95285.1|  predicted protein                                      359   2e-114   
ref|XP_002994070.1|  hypothetical protein SELMODRAFT_236910             357   8e-113   
ref|XP_008651088.1|  PREDICTED: hypothetical protein isoform X1         293   8e-87    
ref|XP_005848262.1|  hypothetical protein CHLNCDRAFT_51806              295   2e-86    
gb|KFM28761.1|  Coiled-coil domain-containing protein 111-like pr...    268   1e-78    
ref|XP_002505865.1|  predicted protein                                  263   1e-74    Micromonas commoda
ref|XP_009375541.1|  PREDICTED: DNA-directed primase/polymerase p...    246   4e-73    
ref|XP_009375540.1|  PREDICTED: DNA-directed primase/polymerase p...    241   2e-71    
ref|XP_005646844.1|  hypothetical protein COCSUDRAFT_42641              243   1e-69    
ref|XP_003452338.1|  PREDICTED: coiled-coil domain-containing pro...    240   4e-67    
ref|XP_008409885.1|  PREDICTED: DNA-directed primase/polymerase p...    240   4e-67    
ref|XP_002604053.1|  hypothetical protein BRAFLDRAFT_119781             250   5e-67    Branchiostoma floridae
ref|XP_007510266.1|  predicted protein                                  238   1e-66    
ref|XP_005942086.1|  PREDICTED: coiled-coil domain-containing pro...    238   2e-66    
ref|XP_007551815.1|  PREDICTED: DNA-directed primase/polymerase p...    238   2e-66    
ref|XP_005726854.1|  PREDICTED: coiled-coil domain-containing pro...    238   2e-66    
ref|XP_005807233.1|  PREDICTED: coiled-coil domain-containing pro...    237   3e-66    
ref|XP_008285051.1|  PREDICTED: DNA-directed primase/polymerase p...    238   4e-66    
gb|KHJ46087.1|  herpesviridae UL52/UL70 DNA primase                     236   5e-66    
ref|XP_004549536.1|  PREDICTED: coiled-coil domain-containing pro...    237   7e-66    
gb|KFD59083.1|  hypothetical protein M513_00246                         234   1e-65    
ref|XP_006787198.1|  PREDICTED: coiled-coil domain-containing pro...    234   5e-65    
ref|XP_002604042.1|  hypothetical protein BRAFLDRAFT_71668              239   1e-64    Branchiostoma floridae
ref|XP_004084349.1|  PREDICTED: coiled-coil domain-containing pro...    233   3e-64    
ref|XP_010743226.1|  PREDICTED: DNA-directed primase/polymerase p...    231   7e-64    
emb|CDW59956.1|  Herpes UL52 domain containing protein                  227   6e-63    
ref|XP_009206218.1|  PREDICTED: DNA-directed primase/polymerase p...    226   4e-62    
ref|XP_006026671.1|  PREDICTED: coiled-coil domain-containing pro...    226   1e-61    
ref|XP_006026668.1|  PREDICTED: coiled-coil domain-containing pro...    227   1e-61    
ref|XP_008055415.1|  PREDICTED: DNA-directed primase/polymerase p...    226   2e-61    
ref|XP_003978395.1|  PREDICTED: coiled-coil domain-containing pro...    224   4e-61    
ref|XP_006026673.1|  PREDICTED: coiled-coil domain-containing pro...    222   8e-61    
ref|XP_003380119.1|  coiled-coil domain-containing protein 111          224   1e-60    
ref|XP_341434.3|  PREDICTED: DNA-directed primase/polymerase protein    222   2e-60    Rattus norvegicus [brown rat]
sp|Q32PL8.2|PRIPO_DANRE  RecName: Full=DNA-directed primase/polym...    221   3e-60    Danio rerio [leopard danio]
ref|XP_006916437.1|  PREDICTED: coiled-coil domain-containing pro...    220   1e-59    
gb|ELT98007.1|  hypothetical protein CAPTEDRAFT_224955                  219   1e-59    
ref|XP_004682561.1|  PREDICTED: coiled-coil domain-containing pro...    220   2e-59    
ref|NP_001001184.1|  DNA-directed primase/polymerase protein            220   2e-59    Mus musculus [mouse]
ref|NP_001032455.1|  DNA-directed primase/polymerase protein            219   2e-59    Danio rerio [leopard danio]
ref|XP_010643496.1|  PREDICTED: DNA-directed primase/polymerase p...    219   4e-59    
ref|XP_006916438.1|  PREDICTED: coiled-coil domain-containing pro...    218   5e-59    
ref|XP_001162592.1|  PREDICTED: DNA-directed primase/polymerase p...    219   6e-59    Pan troglodytes
ref|XP_003063911.1|  predicted protein                                  221   6e-59    
ref|XP_004610468.1|  PREDICTED: coiled-coil domain-containing pro...    219   6e-59    
ref|XP_010342697.1|  PREDICTED: DNA-directed primase/polymerase p...    218   7e-59    
ref|XP_003823513.1|  PREDICTED: DNA-directed primase/polymerase p...    218   8e-59    
ref|XP_010342695.1|  PREDICTED: DNA-directed primase/polymerase p...    218   9e-59    
ref|XP_005630048.1|  PREDICTED: coiled-coil domain-containing pro...    218   1e-58    
ref|XP_004757779.1|  PREDICTED: coiled-coil domain-containing pro...    218   2e-58    
ref|XP_004021740.1|  PREDICTED: coiled-coil domain-containing pro...    218   2e-58    
ref|NP_689896.1|  DNA-directed primase/polymerase protein isoform 1     218   2e-58    Homo sapiens [man]
ref|XP_005262869.2|  PREDICTED: coiled-coil domain-containing pro...    216   2e-58    
ref|XP_005373542.1|  PREDICTED: coiled-coil domain-containing pro...    217   2e-58    
ref|XP_005362641.1|  PREDICTED: coiled-coil domain-containing pro...    216   3e-58    
ref|XP_010708083.1|  PREDICTED: DNA-directed primase/polymerase p...    216   3e-58    
ref|XP_009446919.1|  PREDICTED: DNA-directed primase/polymerase p...    217   3e-58    
ref|XP_010834062.1|  PREDICTED: DNA-directed primase/polymerase p...    217   3e-58    
ref|XP_008975366.1|  PREDICTED: DNA-directed primase/polymerase p...    216   4e-58    
ref|XP_005517715.1|  PREDICTED: coiled-coil domain-containing pro...    217   5e-58    
ref|XP_004757780.1|  PREDICTED: coiled-coil domain-containing pro...    216   5e-58    
ref|XP_003271526.1|  PREDICTED: coiled-coil domain-containing pro...    216   5e-58    
ref|XP_010342696.1|  PREDICTED: DNA-directed primase/polymerase p...    216   5e-58    
ref|XP_006026672.1|  PREDICTED: coiled-coil domain-containing pro...    215   6e-58    
ref|XP_004040738.1|  PREDICTED: coiled-coil domain-containing pro...    216   7e-58    
ref|XP_008990643.1|  PREDICTED: DNA-directed primase/polymerase p...    216   7e-58    
sp|Q96LW4.2|PRIPO_HUMAN  RecName: Full=DNA-directed primase/polym...    216   7e-58    Homo sapiens [man]
ref|XP_008620707.1|  hypothetical protein SDRG_16281                    215   8e-58    
ref|XP_004281783.1|  PREDICTED: coiled-coil domain-containing pro...    215   8e-58    
ref|XP_532846.3|  PREDICTED: coiled-coil domain-containing protei...    215   9e-58    Canis lupus familiaris [dogs]
ref|XP_005630049.1|  PREDICTED: coiled-coil domain-containing pro...    215   1e-57    
ref|XP_007998588.1|  PREDICTED: DNA-directed primase/polymerase p...    214   1e-57    
ref|XP_006970953.1|  PREDICTED: DNA-directed primase/polymerase p...    214   1e-57    
ref|NP_001287697.1|  DNA-directed primase/polymerase protein isof...    215   1e-57    
ref|XP_007466581.1|  PREDICTED: DNA-directed primase/polymerase p...    215   1e-57    
ref|XP_006187620.1|  PREDICTED: coiled-coil domain-containing pro...    215   1e-57    
ref|XP_010115563.1|  PREDICTED: DNA-directed primase/polymerase p...    216   1e-57    
ref|XP_005483900.1|  PREDICTED: coiled-coil domain-containing pro...    213   1e-57    
ref|XP_010972867.1|  PREDICTED: DNA-directed primase/polymerase p...    215   1e-57    
ref|XP_007998585.1|  PREDICTED: DNA-directed primase/polymerase p...    215   1e-57    
ref|XP_006744795.1|  PREDICTED: coiled-coil domain-containing pro...    215   1e-57    
ref|XP_007177925.1|  PREDICTED: DNA-directed primase/polymerase p...    215   1e-57    
emb|CCA21367.1|  conserved hypothetical protein                         216   2e-57    
emb|CAI46079.1|  hypothetical protein                                   214   2e-57    Homo sapiens [man]
ref|XP_004893080.1|  PREDICTED: coiled-coil domain-containing pro...    214   2e-57    
ref|XP_010834061.1|  PREDICTED: DNA-directed primase/polymerase p...    214   2e-57    
ref|XP_003899457.1|  PREDICTED: DNA-directed primase/polymerase p...    214   2e-57    
ref|XP_006198039.1|  PREDICTED: coiled-coil domain-containing pro...    214   2e-57    
ref|XP_008315112.1|  PREDICTED: DNA-directed primase/polymerase p...    214   2e-57    
ref|XP_004893078.1|  PREDICTED: coiled-coil domain-containing pro...    214   2e-57    
ref|XP_010376227.1|  PREDICTED: DNA-directed primase/polymerase p...    214   2e-57    
ref|XP_004893079.1|  PREDICTED: coiled-coil domain-containing pro...    214   2e-57    
emb|CCI50664.1|  unnamed protein product                                209   2e-57    
ref|XP_003495520.1|  PREDICTED: DNA-directed primase/polymerase p...    214   3e-57    
ref|XP_005483897.1|  PREDICTED: coiled-coil domain-containing pro...    214   3e-57    
ref|XP_005556457.1|  PREDICTED: coiled-coil domain-containing pro...    214   3e-57    
ref|XP_008515502.1|  PREDICTED: DNA-directed primase/polymerase p...    212   3e-57    
ref|XP_008150149.1|  PREDICTED: DNA-directed primase/polymerase p...    214   3e-57    
ref|XP_005329280.1|  PREDICTED: coiled-coil domain-containing pro...    214   3e-57    
ref|XP_005972659.1|  PREDICTED: coiled-coil domain-containing pro...    214   3e-57    
ref|XP_004428795.1|  PREDICTED: coiled-coil domain-containing pro...    214   4e-57    
ref|XP_008708709.1|  PREDICTED: DNA-directed primase/polymerase p...    213   4e-57    
ref|XP_010863692.1|  PREDICTED: DNA-directed primase/polymerase p...    213   5e-57    
ref|XP_010376228.1|  PREDICTED: DNA-directed primase/polymerase p...    213   5e-57    
ref|XP_008851796.1|  PREDICTED: DNA-directed primase/polymerase p...    213   5e-57    
ref|XP_002709540.1|  PREDICTED: DNA-directed primase/polymerase p...    213   5e-57    Oryctolagus cuniculus [domestic rabbit]
ref|XP_003469156.1|  PREDICTED: coiled-coil domain-containing pro...    213   5e-57    
ref|XP_004389724.1|  PREDICTED: LOW QUALITY PROTEIN: coiled-coil ...    213   6e-57    
gb|ETL81452.1|  hypothetical protein L917_18227                         215   7e-57    
ref|XP_007998587.1|  PREDICTED: DNA-directed primase/polymerase p...    213   7e-57    
ref|XP_004579316.1|  PREDICTED: coiled-coil domain-containing pro...    213   7e-57    
ref|XP_007177929.1|  PREDICTED: DNA-directed primase/polymerase p...    213   7e-57    
ref|XP_008515496.1|  PREDICTED: DNA-directed primase/polymerase p...    213   8e-57    
ref|XP_005883918.1|  PREDICTED: coiled-coil domain-containing pro...    213   8e-57    
gb|ETP04317.1|  hypothetical protein F441_18882                         215   9e-57    
ref|XP_001491218.2|  PREDICTED: LOW QUALITY PROTEIN: coiled-coil ...    213   1e-56    Equus caballus [domestic horse]
gb|ETI34418.1|  hypothetical protein F443_19074                         215   1e-56    
ref|XP_008923017.1|  PREDICTED: DNA-directed primase/polymerase p...    213   1e-56    
ref|XP_003205563.1|  PREDICTED: DNA-directed primase/polymerase p...    213   1e-56    
ref|XP_007627840.1|  PREDICTED: DNA-directed primase/polymerase p...    212   1e-56    
gb|ETK74767.1|  hypothetical protein L915_18498                         215   1e-56    
ref|XP_009206217.1|  PREDICTED: DNA-directed primase/polymerase p...    212   1e-56    
ref|XP_004412788.1|  PREDICTED: coiled-coil domain-containing pro...    212   1e-56    
ref|XP_005556459.1|  PREDICTED: coiled-coil domain-containing pro...    212   1e-56    
ref|XP_008515501.1|  PREDICTED: DNA-directed primase/polymerase p...    212   1e-56    
ref|XP_008409909.1|  PREDICTED: DNA-directed primase/polymerase p...    211   1e-56    
ref|XP_008708708.1|  PREDICTED: DNA-directed primase/polymerase p...    212   1e-56    
gb|ETM34647.1|  hypothetical protein L914_18311                         214   2e-56    
ref|XP_004666443.1|  PREDICTED: LOW QUALITY PROTEIN: coiled-coil ...    212   2e-56    
gb|ETL28194.1|  hypothetical protein L916_18398                         214   2e-56    
ref|XP_008515499.1|  PREDICTED: DNA-directed primase/polymerase p...    211   2e-56    
ref|XP_004349736.1|  conserved hypothetical protein                     213   3e-56    
ref|XP_006916435.1|  PREDICTED: coiled-coil domain-containing pro...    211   3e-56    
ref|XP_008248743.1|  PREDICTED: DNA-directed primase/polymerase p...    211   3e-56    
ref|XP_009573928.1|  PREDICTED: DNA-directed primase/polymerase p...    211   3e-56    
gb|ETO63209.1|  hypothetical protein F444_19026                         213   4e-56    
ref|XP_005226028.1|  PREDICTED: DNA-directed primase/polymerase p...    208   6e-56    
ref|XP_006882341.1|  PREDICTED: coiled-coil domain-containing pro...    210   6e-56    
ref|XP_003133387.2|  PREDICTED: coiled-coil domain-containing pro...    210   6e-56    
gb|ETP32454.1|  hypothetical protein F442_18855                         213   7e-56    
ref|XP_003486917.1|  PREDICTED: coiled-coil domain-containing pro...    207   8e-56    
ref|XP_006263936.1|  PREDICTED: coiled-coil domain-containing pro...    210   8e-56    
ref|XP_009517785.1|  hypothetical protein PHYSODRAFT_310394             213   8e-56    
emb|CCI50665.1|  unnamed protein product                                204   8e-56    
ref|XP_009509499.1|  PREDICTED: DNA-directed primase/polymerase p...    209   2e-55    
ref|XP_005698770.1|  PREDICTED: LOW QUALITY PROTEIN: coiled-coil ...    209   2e-55    
ref|XP_007099074.1|  PREDICTED: DNA-directed primase/polymerase p...    209   2e-55    
ref|XP_003401024.1|  PREDICTED: coiled-coil domain-containing pro...    206   3e-55    
ref|XP_009375542.1|  PREDICTED: DNA-directed primase/polymerase p...    197   3e-55    
ref|NP_001068956.1|  DNA-directed primase/polymerase protein            208   3e-55    Bos taurus [bovine]
ref|XP_006092756.1|  PREDICTED: coiled-coil domain-containing pro...    208   4e-55    
ref|XP_009932265.1|  PREDICTED: DNA-directed primase/polymerase p...    208   5e-55    
ref|XP_005226027.1|  PREDICTED: DNA-directed primase/polymerase p...    207   5e-55    
ref|XP_007891053.1|  PREDICTED: DNA-directed primase/polymerase p...    208   7e-55    
ref|XP_002907386.1|  conserved hypothetical protein                     209   8e-55    
ref|XP_008515503.1|  PREDICTED: DNA-directed primase/polymerase p...    204   1e-54    
ref|XP_007998589.1|  PREDICTED: DNA-directed primase/polymerase p...    203   3e-54    
ref|XP_008515504.1|  PREDICTED: DNA-directed primase/polymerase p...    203   3e-54    
ref|XP_005030553.1|  PREDICTED: coiled-coil domain-containing pro...    206   4e-54    
ref|XP_007102906.1|  PREDICTED: DNA-directed primase/polymerase p...    203   4e-54    
ref|XP_005226029.1|  PREDICTED: DNA-directed primase/polymerase p...    203   4e-54    
ref|XP_009099170.1|  PREDICTED: DNA-directed primase/polymerase p...    206   5e-54    
ref|XP_005630052.1|  PREDICTED: coiled-coil domain-containing pro...    202   5e-54    
ref|XP_006608201.1|  PREDICTED: coiled-coil domain-containing pro...    202   6e-54    
ref|XP_007102899.1|  PREDICTED: DNA-directed primase/polymerase p...    204   6e-54    
ref|XP_007517716.1|  PREDICTED: DNA-directed primase/polymerase p...    204   6e-54    
ref|XP_008559030.1|  PREDICTED: DNA-directed primase/polymerase p...    202   8e-54    
ref|XP_009969760.1|  PREDICTED: DNA-directed primase/polymerase p...    204   1e-53    
ref|XP_002914063.1|  PREDICTED: coiled-coil domain-containing pro...    204   1e-53    
ref|XP_005045179.1|  PREDICTED: coiled-coil domain-containing pro...    204   1e-53    
ref|XP_008559028.1|  PREDICTED: DNA-directed primase/polymerase p...    202   1e-53    
ref|XP_008559029.1|  PREDICTED: DNA-directed primase/polymerase p...    201   1e-53    
ref|XP_010000807.1|  PREDICTED: DNA-directed primase/polymerase p...    204   1e-53    
ref|XP_003773078.1|  PREDICTED: coiled-coil domain-containing pro...    204   2e-53    
ref|XP_006930629.1|  PREDICTED: coiled-coil domain-containing pro...    201   2e-53    
ref|XP_009864562.1|  PREDICTED: DNA-directed primase/polymerase p...    204   2e-53    
ref|XP_010131584.1|  PREDICTED: DNA-directed primase/polymerase p...    204   2e-53    
ref|XP_006630161.1|  PREDICTED: coiled-coil domain-containing pro...    203   3e-53    
ref|XP_004481814.1|  PREDICTED: coiled-coil domain-containing pro...    201   3e-53    
ref|XP_001121815.3|  PREDICTED: coiled-coil domain-containing pro...    200   3e-53    Apis mellifera [bee]
ref|XP_008490170.1|  PREDICTED: DNA-directed primase/polymerase p...    203   3e-53    
ref|XP_008990648.1|  PREDICTED: DNA-directed primase/polymerase p...    201   3e-53    
ref|XP_005500238.1|  PREDICTED: coiled-coil domain-containing pro...    200   5e-53    
ref|XP_001420065.1|  predicted protein                                  200   7e-53    
gb|KDR20422.1|  Coiled-coil domain-containing protein                   201   7e-53    
ref|XP_005483901.1|  PREDICTED: coiled-coil domain-containing pro...    200   9e-53    
ref|XP_004481809.1|  PREDICTED: coiled-coil domain-containing pro...    201   9e-53    
ref|XP_003081466.1|  unnamed protein product                            200   9e-53    
ref|XP_006160503.1|  PREDICTED: coiled-coil domain-containing pro...    201   1e-52    
gb|EZA49165.1|  Coiled-coil domain-containing protein                   198   2e-52    
gb|KFW02991.1|  Coiled-coil domain-containing protein 111               200   2e-52    
ref|XP_004312698.1|  PREDICTED: coiled-coil domain-containing pro...    199   4e-52    
ref|XP_005500236.1|  PREDICTED: coiled-coil domain-containing pro...    200   4e-52    
ref|XP_008975367.1|  PREDICTED: DNA-directed primase/polymerase p...    199   5e-52    
ref|XP_006160504.1|  PREDICTED: coiled-coil domain-containing pro...    199   5e-52    
gb|EFN88011.1|  Coiled-coil domain-containing protein 111               195   1e-51    
gb|KFO87982.1|  Coiled-coil domain-containing protein 111               198   1e-51    
ref|XP_006008496.1|  PREDICTED: coiled-coil domain-containing pro...    198   3e-51    
gb|KFP74733.1|  Coiled-coil domain-containing protein 111               197   3e-51    
ref|XP_005149092.1|  PREDICTED: coiled-coil domain-containing pro...    197   3e-51    
ref|XP_001369409.2|  PREDICTED: DNA-directed primase/polymerase p...    197   3e-51    
emb|CCI50666.1|  unnamed protein product                                191   6e-51    
ref|XP_007422764.1|  PREDICTED: DNA-directed primase/polymerase p...    195   6e-51    
ref|XP_009640654.1|  PREDICTED: DNA-directed primase/polymerase p...    196   1e-50    
ref|XP_007496123.1|  PREDICTED: DNA-directed primase/polymerase p...    193   1e-50    
ref|XP_005415589.1|  PREDICTED: coiled-coil domain-containing pro...    196   1e-50    
ref|XP_005556460.1|  PREDICTED: coiled-coil domain-containing pro...    194   3e-50    
ref|XP_010016656.1|  PREDICTED: DNA-directed primase/polymerase p...    194   3e-50    
ref|XP_002123260.1|  PREDICTED: DNA-directed primase/polymerase p...    193   3e-50    
ref|XP_009275635.1|  PREDICTED: DNA-directed primase/polymerase p...    194   5e-50    
ref|XP_006128555.1|  PREDICTED: coiled-coil domain-containing pro...    192   5e-50    
ref|XP_008515500.1|  PREDICTED: DNA-directed primase/polymerase p...    193   6e-50    
ref|XP_002402586.1|  conserved hypothetical protein                     190   1e-49    
ref|XP_009674955.1|  PREDICTED: DNA-directed primase/polymerase p...    193   1e-49    
ref|XP_007939079.1|  PREDICTED: DNA-directed primase/polymerase p...    194   2e-49    
ref|XP_009328948.1|  PREDICTED: DNA-directed primase/polymerase p...    192   2e-49    
ref|XP_009890079.1|  PREDICTED: DNA-directed primase/polymerase p...    192   2e-49    
ref|XP_005846496.1|  hypothetical protein CHLNCDRAFT_135708             189   2e-49    
gb|EFX83557.1|  hypothetical protein DAPPUDRAFT_301610                  189   3e-49    
ref|XP_006509524.1|  PREDICTED: coiled-coil domain-containing pro...    188   3e-49    
ref|XP_010568307.1|  PREDICTED: DNA-directed primase/polymerase p...    191   4e-49    
emb|CAN68011.1|  hypothetical protein VITISV_005111                     182   4e-49    
ref|XP_003415881.1|  PREDICTED: DNA-directed primase/polymerase p...    191   5e-49    
ref|XP_010568305.1|  PREDICTED: DNA-directed primase/polymerase p...    191   5e-49    
ref|XP_007496122.1|  PREDICTED: DNA-directed primase/polymerase p...    188   8e-49    
ref|XP_010163799.1|  PREDICTED: DNA-directed primase/polymerase p...    190   1e-48    
ref|XP_009909170.1|  PREDICTED: DNA-directed primase/polymerase p...    190   1e-48    
ref|XP_010279842.1|  PREDICTED: DNA-directed primase/polymerase p...    190   1e-48    
ref|XP_008990647.1|  PREDICTED: DNA-directed primase/polymerase p...    187   2e-48    
ref|XP_005483898.1|  PREDICTED: coiled-coil domain-containing pro...    187   4e-48    
ref|XP_005706537.1|  DNA primase                                        185   4e-48    
ref|XP_006075196.1|  PREDICTED: LOW QUALITY PROTEIN: coiled-coil ...    189   5e-48    
ref|XP_009486600.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...    188   5e-48    
gb|KGL98656.1|  Coiled-coil domain-containing protein 111               187   5e-48    
ref|XP_006563615.1|  PREDICTED: coiled-coil domain-containing pro...    184   5e-48    
ref|XP_009206220.1|  PREDICTED: DNA-directed primase/polymerase p...    184   1e-47    
ref|XP_006128553.1|  PREDICTED: coiled-coil domain-containing pro...    187   1e-47    
gb|KFO99407.1|  Coiled-coil domain-containing protein 111               186   2e-47    
ref|XP_010196859.1|  PREDICTED: DNA-directed primase/polymerase p...    187   2e-47    
gb|EGI67558.1|  Coiled-coil domain-containing protein 111               184   2e-47    
ref|XP_006677625.1|  hypothetical protein BATDEDRAFT_87146              184   3e-47    
ref|XP_008110024.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...    186   3e-47    
ref|XP_011051259.1|  PREDICTED: DNA-directed primase/polymerase p...    182   4e-47    
ref|XP_002190203.2|  PREDICTED: coiled-coil domain-containing pro...    185   7e-47    
emb|CDJ85893.1|  DNA primase domain containing protein                  183   8e-47    
ref|XP_008708710.1|  PREDICTED: DNA-directed primase/polymerase p...    183   1e-46    
gb|KHG27835.1|  Coiled-coil domain-containing protein                   174   2e-46    
gb|KFV82202.1|  Coiled-coil domain-containing protein 111               182   3e-46    
ref|XP_006772733.1|  PREDICTED: coiled-coil domain-containing pro...    182   3e-46    
gb|KFV63234.1|  Coiled-coil domain-containing protein 111               182   3e-46    
ref|XP_008178742.1|  PREDICTED: DNA-directed primase/polymerase p...    179   3e-46    
ref|XP_007177930.1|  PREDICTED: DNA-directed primase/polymerase p...    181   4e-46    
ref|XP_005630050.1|  PREDICTED: coiled-coil domain-containing pro...    181   4e-46    
ref|XP_004639861.1|  PREDICTED: coiled-coil domain-containing pro...    180   1e-45    
ref|XP_005500237.1|  PREDICTED: coiled-coil domain-containing pro...    179   2e-45    
ref|XP_001603706.1|  PREDICTED: DNA-directed primase/polymerase p...    178   2e-45    
ref|XP_785583.2|  PREDICTED: coiled-coil domain-containing protei...    181   2e-45    
ref|XP_005045180.1|  PREDICTED: coiled-coil domain-containing pro...    178   3e-45    
ref|XP_008639692.1|  PREDICTED: DNA-directed primase/polymerase p...    180   3e-45    
ref|XP_010399824.1|  PREDICTED: DNA-directed primase/polymerase p...    180   3e-45    
ref|XP_009810558.1|  PREDICTED: DNA-directed primase/polymerase p...    180   3e-45    
ref|XP_010214495.1|  PREDICTED: DNA-directed primase/polymerase p...    179   4e-45    
ref|XP_007657695.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...    174   4e-45    
emb|CDJ87614.1|  DNA primase domain containing protein                  178   4e-45    
ref|XP_008872654.1|  hypothetical protein H310_08602                    179   5e-45    
gb|KFO65054.1|  Coiled-coil domain-containing protein 111               179   6e-45    
ref|XP_008896940.1|  hypothetical protein PPTG_05187                    180   6e-45    
ref|XP_008166617.1|  PREDICTED: DNA-directed primase/polymerase p...    179   6e-45    
ref|XP_010399823.1|  PREDICTED: DNA-directed primase/polymerase p...    179   7e-45    
ref|XP_005645690.1|  hypothetical protein COCSUDRAFT_43486              181   7e-45    
ref|XP_010310310.1|  PREDICTED: DNA-directed primase/polymerase p...    177   2e-44    
gb|EYC10424.1|  hypothetical protein Y032_0055g2551                     174   3e-44    
ref|XP_007054525.1|  PREDICTED: DNA-directed primase/polymerase p...    176   5e-44    
gb|EYC10427.1|  hypothetical protein Y032_0055g2551                     175   5e-44    
gb|EYC10426.1|  hypothetical protein Y032_0055g2551                     175   7e-44    
gb|EYC10428.1|  hypothetical protein Y032_0055g2551                     175   9e-44    
ref|XP_005839895.1|  hypothetical protein GUITHDRAFT_101365             179   1e-43    
gb|EYC10425.1|  hypothetical protein Y032_0055g2551                     174   2e-43    
gb|KFP85035.1|  Coiled-coil domain-containing protein 111               173   4e-43    
gb|EFZ19925.1|  hypothetical protein SINV_07915                         172   6e-43    
ref|XP_003792880.1|  PREDICTED: coiled-coil domain-containing pro...    172   1e-42    
ref|XP_010158168.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...    170   4e-42    
gb|KFM24669.1|  Coiled-coil domain-containing protein 111-like pr...    166   2e-41    
ref|XP_009832577.1|  hypothetical protein H257_08417                    166   6e-41    
ref|XP_009375543.1|  PREDICTED: DNA-directed primase/polymerase p...    154   2e-40    
gb|KDO21180.1|  hypothetical protein SPRG_22272                         163   4e-40    
ref|XP_006128554.1|  PREDICTED: coiled-coil domain-containing pro...    162   1e-39    
dbj|GAM18005.1|  hypothetical protein SAMD00019534_011800               161   3e-39    
gb|KHJ82648.1|  herpesviridae UL52/UL70 DNA primase                     157   2e-38    
ref|XP_003950531.1|  PREDICTED: DNA-directed primase/polymerase p...    156   4e-38    
ref|XP_008975368.1|  PREDICTED: DNA-directed primase/polymerase p...    156   5e-38    
ref|XP_005445414.1|  PREDICTED: coiled-coil domain-containing pro...    156   9e-38    
ref|XP_005230889.1|  PREDICTED: coiled-coil domain-containing pro...    155   1e-37    
ref|NP_001287696.1|  DNA-directed primase/polymerase protein isof...    154   1e-37    
gb|KIH53682.1|  hypothetical protein ANCDUO_16185                       153   2e-37    
gb|EJK49498.1|  hypothetical protein THAOC_31622                        156   4e-37    
gb|EDL78891.1|  similar to Hypothetical MGC86034 (predicted)            152   5e-37    
ref|XP_008209043.1|  PREDICTED: DNA-directed primase/polymerase p...    152   8e-37    
ref|XP_002428759.1|  conserved hypothetical protein                     152   8e-37    
ref|XP_009206221.1|  PREDICTED: DNA-directed primase/polymerase p...    151   2e-36    
ref|XP_010376229.1|  PREDICTED: DNA-directed primase/polymerase p...    151   2e-36    
ref|XP_005282034.1|  PREDICTED: DNA-directed primase/polymerase p...    150   7e-36    
emb|CDQ64201.1|  unnamed protein product                                148   1e-35    
ref|XP_010399825.1|  PREDICTED: DNA-directed primase/polymerase p...    150   1e-35    
ref|XP_006509525.1|  PREDICTED: coiled-coil domain-containing pro...    147   2e-35    
gb|KFP55460.1|  Coiled-coil domain-containing protein 111               147   3e-35    
ref|XP_006509526.1|  PREDICTED: coiled-coil domain-containing pro...    147   3e-35    
ref|XP_010818558.1|  PREDICTED: DNA-directed primase/polymerase p...    147   4e-35    
ref|XP_005537326.1|  hypothetical protein, conserved                    148   5e-35    
ref|XP_009599574.1|  PREDICTED: DNA-directed primase/polymerase p...    137   1e-34    
gb|KFW12758.1|  Coiled-coil domain-containing protein 111               147   2e-34    
ref|XP_005825005.1|  hypothetical protein GUITHDRAFT_115788             146   3e-34    
ref|XP_006817142.1|  PREDICTED: coiled-coil domain-containing pro...    145   3e-34    
ref|XP_008248747.1|  PREDICTED: DNA-directed primase/polymerase p...    145   5e-34    
ref|XP_002179432.1|  predicted protein                                  148   7e-34    
gb|EFN72789.1|  Coiled-coil domain-containing protein 111               142   1e-33    
gb|EPQ18684.1|  Coiled-coil domain-containing protein 111               143   2e-33    
ref|XP_001898035.1|  hypothetical protein Bm1_32955                     144   2e-33    
ref|XP_005793287.1|  hypothetical protein EMIHUDRAFT_222233             140   3e-33    
emb|CDP94367.1|  Protein Bm9552, isoform c                              144   3e-33    
gb|EFO25208.2|  hypothetical protein LOAG_03275                         143   3e-33    
dbj|BAC27128.1|  unnamed protein product                                138   1e-32    
ref|XP_006509527.1|  PREDICTED: coiled-coil domain-containing pro...    138   2e-32    
ref|XP_006714198.1|  PREDICTED: coiled-coil domain-containing pro...    136   1e-31    
ref|XP_002604014.1|  hypothetical protein BRAFLDRAFT_71697              140   2e-31    
ref|XP_009045354.1|  hypothetical protein LOTGIDRAFT_230191             140   2e-31    
ref|XP_008248757.1|  PREDICTED: DNA-directed primase/polymerase p...    135   5e-31    
ref|XP_009163880.1|  hypothetical protein T265_01557                    137   6e-31    
ref|XP_001181663.2|  PREDICTED: coiled-coil domain-containing pro...    138   7e-31    
ref|XP_001641377.1|  predicted protein                                  129   9e-31    
ref|XP_002949743.1|  hypothetical protein VOLCADRAFT_120785             138   1e-30    
dbj|GAA49586.1|  coiled-coil domain-containing protein 111              134   2e-30    
gb|EFA80172.1|  coiled-coil domain containing protein                   133   3e-30    
ref|NP_001026308.1|  coiled-coil domain containing 111                  132   4e-30    
gb|KDD71281.1|  hypothetical protein H632_c5388p0                       127   9e-30    
gb|ELK23518.1|  Coiled-coil domain-containing protein 111               133   4e-29    
ref|XP_004997902.1|  hypothetical protein PTSG_01919                    131   2e-28    
ref|XP_002287384.1|  predicted protein                                  131   2e-28    
ref|XP_009915246.1|  PREDICTED: DNA-directed primase/polymerase p...    127   3e-28    
ref|XP_009563971.1|  PREDICTED: DNA-directed primase/polymerase p...    129   6e-28    
ref|XP_010189489.1|  PREDICTED: DNA-directed primase/polymerase p...    128   8e-28    
ref|XP_001749128.1|  hypothetical protein                               128   9e-28    
ref|XP_009944738.1|  PREDICTED: DNA-directed primase/polymerase p...    125   1e-27    
gb|ELR50989.1|  Coiled-coil domain-containing protein 111               122   4e-27    
ref|XP_004207780.1|  PREDICTED: coiled-coil domain-containing pro...    122   4e-27    
ref|XP_005903217.1|  PREDICTED: coiled-coil domain-containing pro...    122   4e-27    
ref|XP_010593945.1|  PREDICTED: DNA-directed primase/polymerase p...    125   5e-27    
ref|XP_005066578.1|  PREDICTED: coiled-coil domain-containing pro...    118   1e-26    
ref|XP_010818557.1|  PREDICTED: DNA-directed primase/polymerase p...    122   1e-26    
ref|XP_007422763.1|  PREDICTED: DNA-directed primase/polymerase p...    123   2e-26    
ref|XP_005262874.1|  PREDICTED: coiled-coil domain-containing pro...    121   2e-26    
ref|XP_008947027.1|  PREDICTED: DNA-directed primase/polymerase p...    120   4e-26    
ref|XP_007422762.1|  PREDICTED: DNA-directed primase/polymerase p...    123   4e-26    
ref|XP_004696520.1|  PREDICTED: coiled-coil domain-containing pro...    121   5e-26    
ref|XP_005262871.1|  PREDICTED: coiled-coil domain-containing pro...    120   5e-26    
ref|XP_009983737.1|  PREDICTED: DNA-directed primase/polymerase p...    120   5e-26    
ref|XP_006834567.1|  PREDICTED: coiled-coil domain-containing pro...    121   6e-26    
ref|XP_009473095.1|  PREDICTED: DNA-directed primase/polymerase p...    122   6e-26    
gb|KFP24939.1|  Coiled-coil domain-containing protein 111               122   8e-26    
emb|CAG11521.1|  unnamed protein product                                120   1e-25    
ref|NP_001124651.1|  DNA-directed primase/polymerase protein            119   1e-25    
ref|XP_009077588.1|  PREDICTED: DNA-directed primase/polymerase p...    122   1e-25    
gb|EGV99684.1|  Coiled-coil domain-containing protein 111               117   1e-25    
ref|XP_007177931.1|  PREDICTED: DNA-directed primase/polymerase p...    120   1e-25    
emb|CEF66632.1|  DNA-directed primase/polymerase protein                121   2e-25    
gb|ELK08831.1|  Coiled-coil domain-containing protein 111               120   2e-25    
ref|XP_005630051.1|  PREDICTED: coiled-coil domain-containing pro...    119   3e-25    
ref|XP_005088093.1|  PREDICTED: coiled-coil domain-containing pro...    117   3e-25    
ref|XP_010951601.1|  PREDICTED: DNA-directed primase/polymerase p...    117   4e-25    
ref|XP_001083404.2|  PREDICTED: coiled-coil domain-containing pro...    119   4e-25    
ref|XP_010081204.1|  PREDICTED: DNA-directed primase/polymerase p...    120   4e-25    
gb|KGB39704.1|  Coiled-coil domain-containing protein 111               117   1e-24    
ref|XP_009982264.1|  PREDICTED: DNA-directed primase/polymerase p...    112   1e-24    
gb|KFZ53593.1|  Coiled-coil domain-containing protein 111               115   2e-24    
ref|XP_004350267.1|  hypothetical protein DFA_11324                     117   9e-24    
ref|XP_005906617.1|  PREDICTED: coiled-coil domain-containing pro...    112   9e-24    
ref|XP_008562526.1|  PREDICTED: DNA-directed primase/polymerase p...    112   1e-23    
gb|ELR48490.1|  hypothetical protein M91_10045                          111   1e-23    
gb|KFV17582.1|  Coiled-coil domain-containing protein 111               111   4e-23    
ref|XP_009912634.1|  PREDICTED: DNA-directed primase/polymerase p...    107   9e-23    
ref|XP_009699459.1|  PREDICTED: DNA-directed primase/polymerase p...    110   1e-22    
ref|XP_009912627.1|  PREDICTED: DNA-directed primase/polymerase p...    107   1e-22    
ref|XP_006109203.1|  PREDICTED: coiled-coil domain-containing pro...    107   1e-22    
gb|KDD76476.1|  hypothetical protein H632_c212p0                        105   2e-22    
ref|XP_009951376.1|  PREDICTED: DNA-directed primase/polymerase p...    105   3e-22    
emb|CEF70455.1|  DNA-directed primase/polymerase protein                111   5e-22    
ref|XP_005100740.1|  PREDICTED: uncharacterized protein LOC101846888    110   1e-21    
emb|CCD58334.1|  hypothetical protein Smp_199800                        107   1e-21    
gb|KHN85589.1|  Coiled-coil domain-containing protein -like protein     107   2e-21    
ref|XP_001619940.1|  hypothetical protein NEMVEDRAFT_v1g223652          104   3e-21    
ref|XP_008941035.1|  PREDICTED: DNA-directed primase/polymerase p...    102   3e-21    
ref|XP_002156811.2|  PREDICTED: coiled-coil domain-containing pro...    103   4e-21    
gb|EJK77317.1|  hypothetical protein THAOC_00856                        108   5e-21    
ref|XP_004085339.1|  PREDICTED: coiled-coil domain-containing pro...    103   7e-21    
emb|CEF70451.1|  DNA-directed primase/polymerase protein                107   8e-21    
ref|XP_008872655.1|  hypothetical protein, variant                    99.4    7e-19    
ref|XP_626834.1|  hypothetical protein                                99.8    1e-18    
gb|ERG86886.1|  hypothetical protein ASU_01489                        97.4    3e-18    
ref|XP_002141545.1|  herpesviridae UL52/UL70 DNA primase family p...  97.1    9e-18    
ref|XP_004334748.1|  herpesviridae ul52/ul70 dna primase              97.1    1e-17    
ref|XP_003138860.1|  hypothetical protein LOAG_03275                  93.6    3e-17    
ref|XP_001691725.1|  hypothetical protein CHLREDRAFT_145204           95.1    3e-17    
ref|XP_008884040.1|  herpesviridae ul52/ul70 dna primase              96.3    4e-17    



>ref|XP_009797262.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Nicotiana sylvestris]
Length=572

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/585 (69%), Positives = 472/585 (81%), Gaps = 14/585 (2%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLFECFKCG SPPQSAI ERK+GKRT K  D+ +K      L T +D +  ++NL
Sbjct  1     MDDVDRLFECFKCGISPPQSAIRERKKGKRTVKQSDTLEK------LSTPSDVELCLQNL  54

Query  199   GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQEIWAT  378
             G  K        G+QF PLVFYGSPHGVPPKRPA LLRLL+EIRVDL+EQ KL Q+IW+T
Sbjct  55    GVKK--------GRQFSPLVFYGSPHGVPPKRPARLLRLLNEIRVDLNEQNKLRQDIWST  106

Query  379   FPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQE  558
             FP+Q EAMKYA++  NARVFSYQDH+NG RRFLVSTY++FW+RY++MNPK RHHYEVIQE
Sbjct  107   FPRQDEAMKYAKEQSNARVFSYQDHVNGQRRFLVSTYKEFWRRYETMNPKFRHHYEVIQE  166

Query  559   GLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDK  738
             GLPCHLYFDLEFNK+ NA KNGDEMVDLLI  +FD + +KY LEG+ DW+VELDSS E+K
Sbjct  167   GLPCHLYFDLEFNKRENAAKNGDEMVDLLIQVIFDAVKEKYCLEGNDDWVVELDSSNEEK  226

Query  739   FSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLF  918
             FSRHLIIR P  AFKDN H GAF  E+CSRI S SETD RFR LFVSKDS S+ IP QLF
Sbjct  227   FSRHLIIRFPNAAFKDNLHAGAFVTEICSRISSLSETDGRFRNLFVSKDSSSIDIPCQLF  286

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLV  1098
             VD AVYSRNRCFRLALSSKAGKSSVL+PSGRFKCK+M+++E+FMASLICNIDADCE+LL+
Sbjct  287   VDKAVYSRNRCFRLALSSKAGKSSVLLPSGRFKCKDMTKEEVFMASLICNIDADCEKLLI  346

Query  1099  CKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEY  1278
             CKMD DCV+ L F+TE  +SFQ  S     F+LN   SDPSRTYLMGKSPFP +D FVE 
Sbjct  347   CKMDLDCVKALQFDTESTKSFQLHSGVSLDFDLNACTSDPSRTYLMGKSPFPSLDMFVES  406

Query  1279  IASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKC  1458
             +AS+G++PGKIRSWYWFSEY L+VYSMS+NRYCERIGR+HKSNHV+YVVDLRR  YYQKC
Sbjct  407   VASIGNIPGKIRSWYWFSEYALMVYSMSRNRYCERIGRQHKSNHVIYVVDLRRAVYYQKC  466

Query  1459  HDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKKEWWLEAI  1638
             HDPDC+GYRSPLRP+P NVI H S+S +L  +N       V +D +I  SCKKEWWLEAI
Sbjct  467   HDPDCRGYRSPLRPVPDNVIPHLSISVNLPGHNLDWGKPTVNSDESIFSSCKKEWWLEAI  526

Query  1639  RFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELAYLGK  1773
             R A+ +E + KAL+++      E+++WW A ER A Q+E +YLGK
Sbjct  527   RVADNIENVQKALDLTEQDRTCEEDEWWMAVERTAYQSEQSYLGK  571



>ref|XP_009797263.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Nicotiana sylvestris]
Length=571

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/585 (69%), Positives = 469/585 (80%), Gaps = 15/585 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLFECFKCG SPPQSAI ERK+GKRT K  D+ +K      L T +D +  ++NL
Sbjct  1     MDDVDRLFECFKCGISPPQSAIRERKKGKRTVKQSDTLEK------LSTPSDVELCLQNL  54

Query  199   GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQEIWAT  378
             G  K        G+QF PLVFYGSPHGVPPKRPA LLRLL+EIRVDL+EQ KL Q+IW+T
Sbjct  55    GVKK--------GRQFSPLVFYGSPHGVPPKRPARLLRLLNEIRVDLNEQNKLRQDIWST  106

Query  379   FPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQE  558
             FP+Q EAMKYA++  NARVFSYQDH+NG RRFLVSTY++FW+RY++MNPK RHHYEVIQE
Sbjct  107   FPRQDEAMKYAKEQSNARVFSYQDHVNGQRRFLVSTYKEFWRRYETMNPKFRHHYEVIQE  166

Query  559   GLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDK  738
             GLPCHLYFDLEFNK+ NA KNGDEMVDLLI  +FD + +KY LEG+ DW+VELDSS E+K
Sbjct  167   GLPCHLYFDLEFNKRENAAKNGDEMVDLLIQVIFDAVKEKYCLEGNDDWVVELDSSNEEK  226

Query  739   FSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLF  918
             FSRHLIIR P  AFKDN H GAF  E+CSRI S SETD RFR LFVSKDS S+ IP QLF
Sbjct  227   FSRHLIIRFPNAAFKDNLHAGAFVTEICSRISSLSETDGRFRNLFVSKDSSSIDIPCQLF  286

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLV  1098
             VD AVYSRNRCFRLALSSKAGKSSVL+PSGRFKCK+M+++E+FMASLICNIDADCE+LL+
Sbjct  287   VDKAVYSRNRCFRLALSSKAGKSSVLLPSGRFKCKDMTKEEVFMASLICNIDADCEKLLI  346

Query  1099  CKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEY  1278
             CKMD DCV+ L F+TE  +SFQ  S     F+LN   SDPSRTYLMGKSPFP +D FVE 
Sbjct  347   CKMDLDCVKALQFDTESTKSFQLHSGVSLDFDLNACTSDPSRTYLMGKSPFPSLDMFVES  406

Query  1279  IASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKC  1458
             +AS+G++PGKIRSWYWFSEY L+VYSMS+NRYCERIGR+HKSNHV+YVVDLRR  YYQKC
Sbjct  407   VASIGNIPGKIRSWYWFSEYALMVYSMSRNRYCERIGRQHKSNHVIYVVDLRRAVYYQKC  466

Query  1459  HDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKKEWWLEAI  1638
             HDPDC+GYRSPLRP+P NVI H S+S +L  +N       V +D +I  SCKKEWWLEAI
Sbjct  467   HDPDCRGYRSPLRPVPDNVIPHLSISVNLPGHNLDWGKPTVNSDESIFSSCKKEWWLEAI  526

Query  1639  RFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELAYLGK  1773
             R A+ +E + KA     +    E+++WW A ER A Q+E +YLGK
Sbjct  527   RVADNIENVQKA-LDLTEDRTCEEDEWWMAVERTAYQSEQSYLGK  570



>ref|XP_009599575.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Nicotiana tomentosiformis]
Length=591

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/595 (68%), Positives = 473/595 (79%), Gaps = 15/595 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTE----------KILQTT  168
             MDDVDRLFECFKCG SPPQSAI ERK+GK T K +D+ +K ST           K LQ  
Sbjct  1     MDDVDRLFECFKCGISPPQSAISERKKGKLTVKQDDTREKSSTPSDIFSSRSKGKSLQNA  60

Query  169   ADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQ  348
              D +  ++NLGSS  K +    G QF PLVFYGSPHGVPPKRPA LLRLL+EI VDL+EQ
Sbjct  61    TDVELCLQNLGSSTAKIRSVKKGWQFSPLVFYGSPHGVPPKRPARLLRLLNEICVDLNEQ  120

Query  349   KKLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPK  528
              KL Q+IWATFP+Q EAMKYA++  NARVFSYQDH+NG RRFLVSTY++FW+RY++MNPK
Sbjct  121   NKLRQDIWATFPRQDEAMKYAKEQSNARVFSYQDHVNGQRRFLVSTYKEFWRRYETMNPK  180

Query  529   RRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWI  708
              RHHYEVIQEGLPCHLYFDLEFNK+ NADKNGDEMVDLLI  +FD + + Y LEG+ DW+
Sbjct  181   FRHHYEVIQEGLPCHLYFDLEFNKRENADKNGDEMVDLLIQVIFDAVKENYCLEGNDDWV  240

Query  709   VELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDS  888
             VELDSS E+KFSRHLIIR PK AFKDN H GAF  E+CSRI S SE+D RF+KLFVSKDS
Sbjct  241   VELDSSNEEKFSRHLIIRFPKAAFKDNLHAGAFVTEICSRISSLSESDGRFKKLFVSKDS  300

Query  889   KSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICN  1068
              S+  P QLFVD AVYSRNRCFRLALSSKAGKSSVL+PSGRFKCK+M+++E+FMASLIC 
Sbjct  301   SSIDNPCQLFVDKAVYSRNRCFRLALSSKAGKSSVLLPSGRFKCKDMTKEEVFMASLICK  360

Query  1069  IDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
             IDADCE+LL+CKMD DCV+ L F+TE  +SFQ  S         +F SDPSRTYLMGKSP
Sbjct  361   IDADCEKLLICKMDLDCVKALQFDTESTESFQLHSGVSL-----DFTSDPSRTYLMGKSP  415

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP +D FVE +AS+G++PGKIRSWYWFSEY L+VYSMS+NRYCERIGR+HKSNHV+YVVD
Sbjct  416   FPSLDMFVESVASIGNIPGKIRSWYWFSEYALMVYSMSRNRYCERIGRQHKSNHVIYVVD  475

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDS  1608
             LRR  YYQKCHDPDC+GYRSPLRP+P NVI H S+S +L  +N   E   V +D +I  S
Sbjct  476   LRRAVYYQKCHDPDCRGYRSPLRPVPDNVIPHSSISVNLPGHNLDWEQPTVNSDESIFSS  535

Query  1609  CKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELAYLGK  1773
             CKKEWWLEAIR A+ VE + K L+++      E+++WW A ER A Q+E +YLGK
Sbjct  536   CKKEWWLEAIRVADSVENVQKTLDLTEQDRTCEEDEWWMAVERTAYQSEQSYLGK  590



>ref|XP_009599576.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Nicotiana tomentosiformis]
Length=590

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/595 (68%), Positives = 470/595 (79%), Gaps = 16/595 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTE----------KILQTT  168
             MDDVDRLFECFKCG SPPQSAI ERK+GK T K +D+ +K ST           K LQ  
Sbjct  1     MDDVDRLFECFKCGISPPQSAISERKKGKLTVKQDDTREKSSTPSDIFSSRSKGKSLQNA  60

Query  169   ADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQ  348
              D +  ++NLGSS  K +    G QF PLVFYGSPHGVPPKRPA LLRLL+EI VDL+EQ
Sbjct  61    TDVELCLQNLGSSTAKIRSVKKGWQFSPLVFYGSPHGVPPKRPARLLRLLNEICVDLNEQ  120

Query  349   KKLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPK  528
              KL Q+IWATFP+Q EAMKYA++  NARVFSYQDH+NG RRFLVSTY++FW+RY++MNPK
Sbjct  121   NKLRQDIWATFPRQDEAMKYAKEQSNARVFSYQDHVNGQRRFLVSTYKEFWRRYETMNPK  180

Query  529   RRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWI  708
              RHHYEVIQEGLPCHLYFDLEFNK+ NADKNGDEMVDLLI  +FD + + Y LEG+ DW+
Sbjct  181   FRHHYEVIQEGLPCHLYFDLEFNKRENADKNGDEMVDLLIQVIFDAVKENYCLEGNDDWV  240

Query  709   VELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDS  888
             VELDSS E+KFSRHLIIR PK AFKDN H GAF  E+CSRI S SE+D RF+KLFVSKDS
Sbjct  241   VELDSSNEEKFSRHLIIRFPKAAFKDNLHAGAFVTEICSRISSLSESDGRFKKLFVSKDS  300

Query  889   KSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICN  1068
              S+  P QLFVD AVYSRNRCFRLALSSKAGKSSVL+PSGRFKCK+M+++E+FMASLIC 
Sbjct  301   SSIDNPCQLFVDKAVYSRNRCFRLALSSKAGKSSVLLPSGRFKCKDMTKEEVFMASLICK  360

Query  1069  IDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
             IDADCE+LL+CKMD DCV+ L F+TE  +SFQ  S         +F SDPSRTYLMGKSP
Sbjct  361   IDADCEKLLICKMDLDCVKALQFDTESTESFQLHSGVSL-----DFTSDPSRTYLMGKSP  415

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP +D FVE +AS+G++PGKIRSWYWFSEY L+VYSMS+NRYCERIGR+HKSNHV+YVVD
Sbjct  416   FPSLDMFVESVASIGNIPGKIRSWYWFSEYALMVYSMSRNRYCERIGRQHKSNHVIYVVD  475

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDS  1608
             LRR  YYQKCHDPDC+GYRSPLRP+P NVI H S+S +L  +N   E   V +D +I  S
Sbjct  476   LRRAVYYQKCHDPDCRGYRSPLRPVPDNVIPHSSISVNLPGHNLDWEQPTVNSDESIFSS  535

Query  1609  CKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELAYLGK  1773
             CKKEWWLEAIR A+ VE + K      +    E+++WW A ER A Q+E +YLGK
Sbjct  536   CKKEWWLEAIRVADSVENVQKT-LDLTEDRTCEEDEWWMAVERTAYQSEQSYLGK  589



>ref|XP_006359463.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
isoform X1 [Solanum tuberosum]
Length=595

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/595 (67%), Positives = 472/595 (79%), Gaps = 11/595 (2%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKIL---------QTTA  171
             MDDVDRLFECFKCG SPPQSAI ERK+GK+T K  D+ +K ST   +         Q   
Sbjct  1     MDDVDRLFECFKCGISPPQSAIRERKKGKQTVKQNDTLEKLSTSSDIFSSRSKGKVQNAT  60

Query  172   DADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQK  351
             D +  ++N  SS  K +    G QF PLVF+GSPHGVPPKRPA LLRLL+EIRVD +EQ 
Sbjct  61    DVELCLQNTSSSTTKIQSLKKGSQFSPLVFFGSPHGVPPKRPARLLRLLNEIRVDFNEQN  120

Query  352   KLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKR  531
             KLSQ+IWATFP+Q EAMKYA++  +ARVFSYQDH+NG RRFLVSTY++FW+RYK+MNPK 
Sbjct  121   KLSQDIWATFPRQDEAMKYAKEQTDARVFSYQDHVNGQRRFLVSTYKEFWRRYKTMNPKF  180

Query  532   RHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
             RHHYEVIQEGLPCHLYFDLEFNK+ NADKN DEMVDLLI  +FD + +KYSLEG++DW+V
Sbjct  181   RHHYEVIQEGLPCHLYFDLEFNKRENADKNEDEMVDLLIQVIFDAVKEKYSLEGNNDWVV  240

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSK  891
             ELDSS  +KFSRHLIIR PK AFKDNSH GAF  E+CSRI S SE D RFRKLFVSKDS 
Sbjct  241   ELDSSNAEKFSRHLIIRFPKAAFKDNSHAGAFVTEICSRISSISEHDGRFRKLFVSKDSS  300

Query  892   SVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNI  1071
             S  IP QLFVD AVYSRNRCFRLALSSKAGKSSVL+PSGRFKCK+MSE+E+FMASLICN+
Sbjct  301   STDIPFQLFVDKAVYSRNRCFRLALSSKAGKSSVLLPSGRFKCKDMSEEEVFMASLICNM  360

Query  1072  DADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFES-DPSRTYLMGKSP  1248
             DAD E+LL+C +D DC++ L F+TE  +SFQQ S     F+LN   S DPS+TYL GKSP
Sbjct  361   DADLEKLLICTVDLDCMKALQFDTESTRSFQQHSAVSLNFDLNACTSDDPSKTYLTGKSP  420

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP +D FVE +AS+G++PG IRSWYWFSEY L+VYSMS+NR+CERIGR+HKSNHVMYVVD
Sbjct  421   FPYLDVFVESVASIGNIPGIIRSWYWFSEYALMVYSMSRNRFCERIGRQHKSNHVMYVVD  480

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDS  1608
             L+RG YYQKC+DPDC+GYRSPLRP+P NVI H S+SF+L  +N   E   V +D +I  S
Sbjct  481   LQRGVYYQKCYDPDCRGYRSPLRPVPDNVIPHSSISFNLPGHNMDEEQPTVTSDTSIFSS  540

Query  1609  CKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELAYLGK  1773
             CKKEWWLEA+R A+ +E + K      +GE  E+++WW A E  A QTEL+Y GK
Sbjct  541   CKKEWWLEAVRVADSIENVQKT-LDLTEGETCEEDEWWMAVEETAYQTELSYFGK  594



>ref|XP_010314290.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Solanum lycopersicum]
Length=595

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/595 (67%), Positives = 469/595 (79%), Gaps = 11/595 (2%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKIL---------QTTA  171
             MDDVDRLFECFKCG SPPQSAI ERK+GK+T K  D+ +K ST   +         Q   
Sbjct  1     MDDVDRLFECFKCGISPPQSAIRERKKGKQTVKQSDTLEKLSTSSDIFSSRSKGKVQNAT  60

Query  172   DADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQK  351
             D +  ++N  SS  K +      Q  PLVFYGSPHGVPPKRPA LLRLL+EIRVD +EQ 
Sbjct  61    DVELCLQNTSSSTTKIQSLKKASQLSPLVFYGSPHGVPPKRPARLLRLLNEIRVDFNEQH  120

Query  352   KLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKR  531
             KLSQ+IWATFP+Q EAMKYA++  +ARVFSYQDH+NG RRFLVSTY++FW+RYK+MNPK 
Sbjct  121   KLSQDIWATFPRQDEAMKYAKEKNDARVFSYQDHVNGQRRFLVSTYKEFWRRYKTMNPKF  180

Query  532   RHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
             RHHYEVIQEGLPCHLYFDLEFNK+ N DKN DEMVDLLI  +FD + +KYSLEG+ DW+V
Sbjct  181   RHHYEVIQEGLPCHLYFDLEFNKRENPDKNEDEMVDLLIQVIFDAVKEKYSLEGNDDWVV  240

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSK  891
             ELDSS  +KFSRHLIIR PK AFKDNSH GAF  E+CSRI S SE DER RKLF+SKDS 
Sbjct  241   ELDSSNAEKFSRHLIIRFPKAAFKDNSHAGAFVTEICSRIISISEHDERLRKLFISKDSS  300

Query  892   SVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNI  1071
             S  IP QLFVD AVYSRNRCFRLALSSKAGKSSVL+PSGRFKCK+MSE+E+FMASLICN+
Sbjct  301   STNIPFQLFVDKAVYSRNRCFRLALSSKAGKSSVLLPSGRFKCKDMSEEEVFMASLICNM  360

Query  1072  DADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFES-DPSRTYLMGKSP  1248
             DAD E+LL+CKMD DC++ L F+TE  +SFQ+ S     F+LN   S DPS+TYL GKSP
Sbjct  361   DADFEKLLICKMDLDCMKALQFDTESTRSFQRHSAVSSNFDLNACRSDDPSKTYLTGKSP  420

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP +D FVE +AS+G++PGKIRSWYWFSEY L+VYSMS+NR+CERIGR+HKSNHVMYVVD
Sbjct  421   FPYLDVFVESVASIGNIPGKIRSWYWFSEYALMVYSMSRNRFCERIGRQHKSNHVMYVVD  480

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDS  1608
             L+RG YYQKC+DPDC+GYRSPLRP+P NVI H S+SF+L  +N   E   V +D +I  S
Sbjct  481   LQRGAYYQKCYDPDCRGYRSPLRPVPDNVIPHSSISFNLPGHNMDEEQPTVTSDTSIFSS  540

Query  1609  CKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELAYLGK  1773
             CKKEWWLEA+R A+ +E + KA     + E  E+++WW A E  A Q EL+Y GK
Sbjct  541   CKKEWWLEAVRVADSIENVQKA-LDLTEEETCEEDEWWMAVEETAYQIELSYFGK  594



>ref|XP_011076097.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Sesamum indicum]
Length=571

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/586 (68%), Positives = 460/586 (78%), Gaps = 17/586 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLF+CFKCG SPPQSA+ E+++ KR  K E S Q Q++      T     SV + 
Sbjct  1     MDDVDRLFQCFKCGISPPQSAVREKRKEKRKLKQERSPQLQAS------TISEKKSVNS-  53

Query  199   GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQEIWAT  378
                       +NGKQF P+VFYGSPHGVPPKRPA LLRLLHEIRVDL+EQ KL +E+W+T
Sbjct  54    ---------KTNGKQFSPVVFYGSPHGVPPKRPARLLRLLHEIRVDLAEQNKLRKEVWST  104

Query  379   FPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQE  558
             FP+Q EAMK+A+Q +N RVFSYQDH+NG RRFLVSTY++FW+RYK MN K RHHYEVIQE
Sbjct  105   FPRQDEAMKFAKQHVNDRVFSYQDHMNGQRRFLVSTYKEFWQRYKEMNSKFRHHYEVIQE  164

Query  559   GLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDK  738
             G PCHLYFDLEFNKK N D+NGDEMVDLLIV +FD  L+KYS+ G+ D+IVELDSSTE+K
Sbjct  165   GRPCHLYFDLEFNKKGNIDRNGDEMVDLLIVVIFDAFLEKYSILGTEDYIVELDSSTEEK  224

Query  739   FSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLF  918
             FSRHLIIRLPK AFKDNSH GAF AE+C+RI S  E DERF KLFVSK S S     QLF
Sbjct  225   FSRHLIIRLPKTAFKDNSHAGAFVAEICARIQSYRERDERFEKLFVSKGSSSADSHCQLF  284

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLV  1098
             VD AVYSRNRCFRL LSSKAGKS+VL+PSGRFKCK+M E+E+FMASLICN+DAD E+LL+
Sbjct  285   VDTAVYSRNRCFRLPLSSKAGKSAVLLPSGRFKCKDMDEEEVFMASLICNMDADTEKLLI  344

Query  1099  CKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEY  1278
             CKMD +CV+ LHF TEI  + Q+    P+ F+LN   SD S  YLMGKSP+P +D FVE 
Sbjct  345   CKMDLECVKALHFETEITNNIQKYPGFPEKFDLNACTSDASTNYLMGKSPYPALDVFVEA  404

Query  1279  IASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKC  1458
             IAS G+VPGKIRSWYWFSEYGL+VYSMS+NRYCERIGREHKSNHV+YVVDLRR  YYQKC
Sbjct  405   IASSGNVPGKIRSWYWFSEYGLMVYSMSRNRYCERIGREHKSNHVIYVVDLRRAVYYQKC  464

Query  1459  HDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKKEWWLEAI  1638
             HDPDC+GYRSPLRP+P +VI   ++ F+LD +N   E T    D +  DSCKKEWW EAI
Sbjct  465   HDPDCQGYRSPLRPVPDDVIPDPALMFNLDGDNYSEEQTKPTVDGSFTDSCKKEWWHEAI  524

Query  1639  RFAEQVEGIPKAleisgdgel-eededWWKAAERIATQTELAYLGK  1773
             + AEQVE I KAL+++   E  EEDE WW A E  A QTELA+L K
Sbjct  525   KVAEQVEKIQKALDLTQMDETCEEDESWWMAVENTAHQTELAFLQK  570



>ref|XP_009797265.1| PREDICTED: DNA-directed primase/polymerase protein isoform X4 
[Nicotiana sylvestris]
Length=550

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/585 (66%), Positives = 455/585 (78%), Gaps = 36/585 (6%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLFECFKCG SPPQSAI ERK+GKRT K  D+ +K      L T +D +  ++NL
Sbjct  1     MDDVDRLFECFKCGISPPQSAIRERKKGKRTVKQSDTLEK------LSTPSDVELCLQNL  54

Query  199   GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQEIWAT  378
             G  K        G+QF PLVFYGSPHGVPPKRPA LLRLL+EIRVDL+EQ KL Q+IW+T
Sbjct  55    GVKK--------GRQFSPLVFYGSPHGVPPKRPARLLRLLNEIRVDLNEQNKLRQDIWST  106

Query  379   FPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQE  558
             FP+Q EAMKYA++  NARVFSYQDH+NG RRFLVSTY++FW+RY++MNPK RHHYEVIQE
Sbjct  107   FPRQDEAMKYAKEQSNARVFSYQDHVNGQRRFLVSTYKEFWRRYETMNPKFRHHYEVIQE  166

Query  559   GLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDK  738
             GLPCHLYFDLEFNK+ NA KNGDEMVDLLI  +FD + +KY LEG+ DW+VELDSS E  
Sbjct  167   GLPCHLYFDLEFNKRENAAKNGDEMVDLLIQVIFDAVKEKYCLEGNDDWVVELDSSNE--  224

Query  739   FSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLF  918
                                 GAF  E+CSRI S SETD RFR LFVSKDS S+ IP QLF
Sbjct  225   --------------------GAFVTEICSRISSLSETDGRFRNLFVSKDSSSIDIPCQLF  264

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLV  1098
             VD AVYSRNRCFRLALSSKAGKSSVL+PSGRFKCK+M+++E+FMASLICNIDADCE+LL+
Sbjct  265   VDKAVYSRNRCFRLALSSKAGKSSVLLPSGRFKCKDMTKEEVFMASLICNIDADCEKLLI  324

Query  1099  CKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEY  1278
             CKMD DCV+ L F+TE  +SFQ  S     F+LN   SDPSRTYLMGKSPFP +D FVE 
Sbjct  325   CKMDLDCVKALQFDTESTKSFQLHSGVSLDFDLNACTSDPSRTYLMGKSPFPSLDMFVES  384

Query  1279  IASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKC  1458
             +AS+G++PGKIRSWYWFSEY L+VYSMS+NRYCERIGR+HKSNHV+YVVDLRR  YYQKC
Sbjct  385   VASIGNIPGKIRSWYWFSEYALMVYSMSRNRYCERIGRQHKSNHVIYVVDLRRAVYYQKC  444

Query  1459  HDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKKEWWLEAI  1638
             HDPDC+GYRSPLRP+P NVI H S+S +L  +N       V +D +I  SCKKEWWLEAI
Sbjct  445   HDPDCRGYRSPLRPVPDNVIPHLSISVNLPGHNLDWGKPTVNSDESIFSSCKKEWWLEAI  504

Query  1639  RFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELAYLGK  1773
             R A+ +E + KAL+++      E+++WW A ER A Q+E +YLGK
Sbjct  505   RVADNIENVQKALDLTEQDRTCEEDEWWMAVERTAYQSEQSYLGK  549



>ref|XP_011076098.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Sesamum indicum]
Length=569

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/586 (67%), Positives = 459/586 (78%), Gaps = 19/586 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLF+CFKCG SPPQSA+ E+++ KR  K E S Q Q++      T     SV + 
Sbjct  1     MDDVDRLFQCFKCGISPPQSAVREKRKEKRKLKQERSPQLQAS------TISEKKSVNS-  53

Query  199   GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQEIWAT  378
                       +NGKQF P+VFYGSPHGVPPKRPA LLRLLHEIRVDL+EQ K  +E+W+T
Sbjct  54    ---------KTNGKQFSPVVFYGSPHGVPPKRPARLLRLLHEIRVDLAEQNK--KEVWST  102

Query  379   FPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQE  558
             FP+Q EAMK+A+Q +N RVFSYQDH+NG RRFLVSTY++FW+RYK MN K RHHYEVIQE
Sbjct  103   FPRQDEAMKFAKQHVNDRVFSYQDHMNGQRRFLVSTYKEFWQRYKEMNSKFRHHYEVIQE  162

Query  559   GLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDK  738
             G PCHLYFDLEFNKK N D+NGDEMVDLLIV +FD  L+KYS+ G+ D+IVELDSSTE+K
Sbjct  163   GRPCHLYFDLEFNKKGNIDRNGDEMVDLLIVVIFDAFLEKYSILGTEDYIVELDSSTEEK  222

Query  739   FSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLF  918
             FSRHLIIRLPK AFKDNSH GAF AE+C+RI S  E DERF KLFVSK S S     QLF
Sbjct  223   FSRHLIIRLPKTAFKDNSHAGAFVAEICARIQSYRERDERFEKLFVSKGSSSADSHCQLF  282

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLV  1098
             VD AVYSRNRCFRL LSSKAGKS+VL+PSGRFKCK+M E+E+FMASLICN+DAD E+LL+
Sbjct  283   VDTAVYSRNRCFRLPLSSKAGKSAVLLPSGRFKCKDMDEEEVFMASLICNMDADTEKLLI  342

Query  1099  CKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEY  1278
             CKMD +CV+ LHF TEI  + Q+    P+ F+LN   SD S  YLMGKSP+P +D FVE 
Sbjct  343   CKMDLECVKALHFETEITNNIQKYPGFPEKFDLNACTSDASTNYLMGKSPYPALDVFVEA  402

Query  1279  IASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKC  1458
             IAS G+VPGKIRSWYWFSEYGL+VYSMS+NRYCERIGREHKSNHV+YVVDLRR  YYQKC
Sbjct  403   IASSGNVPGKIRSWYWFSEYGLMVYSMSRNRYCERIGREHKSNHVIYVVDLRRAVYYQKC  462

Query  1459  HDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKKEWWLEAI  1638
             HDPDC+GYRSPLRP+P +VI   ++ F+LD +N   E T    D +  DSCKKEWW EAI
Sbjct  463   HDPDCQGYRSPLRPVPDDVIPDPALMFNLDGDNYSEEQTKPTVDGSFTDSCKKEWWHEAI  522

Query  1639  RFAEQVEGIPKAleisgdgel-eededWWKAAERIATQTELAYLGK  1773
             + AEQVE I KAL+++   E  EEDE WW A E  A QTELA+L K
Sbjct  523   KVAEQVEKIQKALDLTQMDETCEEDESWWMAVENTAHQTELAFLQK  568



>ref|XP_009797264.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Nicotiana sylvestris]
Length=551

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/585 (66%), Positives = 453/585 (77%), Gaps = 35/585 (6%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLFECFKCG SPPQSAI ERK+GKRT K  D+ +K      L T +D +  ++NL
Sbjct  1     MDDVDRLFECFKCGISPPQSAIRERKKGKRTVKQSDTLEK------LSTPSDVELCLQNL  54

Query  199   GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQEIWAT  378
             G  K        G+QF PLVFYGSPHGVPPKRPA LLRLL+EIRVDL+EQ KL Q+IW+T
Sbjct  55    GVKK--------GRQFSPLVFYGSPHGVPPKRPARLLRLLNEIRVDLNEQNKLRQDIWST  106

Query  379   FPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQE  558
             FP+Q EAMKYA++  NARVFSYQDH+NG RRFLVSTY++FW+RY++MNPK RHHYEVIQE
Sbjct  107   FPRQDEAMKYAKEQSNARVFSYQDHVNGQRRFLVSTYKEFWRRYETMNPKFRHHYEVIQE  166

Query  559   GLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDK  738
             GLPCHLYFDLEFNK+ NA KNGDEMVDLLI  +FD + +KY LEG+ DW+VELDSS E  
Sbjct  167   GLPCHLYFDLEFNKRENAAKNGDEMVDLLIQVIFDAVKEKYCLEGNDDWVVELDSSNE--  224

Query  739   FSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLF  918
                                V     ++CSRI S SETD RFR LFVSKDS S+ IP QLF
Sbjct  225   -------------------VLVAYYQICSRISSLSETDGRFRNLFVSKDSSSIDIPCQLF  265

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLV  1098
             VD AVYSRNRCFRLALSSKAGKSSVL+PSGRFKCK+M+++E+FMASLICNIDADCE+LL+
Sbjct  266   VDKAVYSRNRCFRLALSSKAGKSSVLLPSGRFKCKDMTKEEVFMASLICNIDADCEKLLI  325

Query  1099  CKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEY  1278
             CKMD DCV+ L F+TE  +SFQ  S     F+LN   SDPSRTYLMGKSPFP +D FVE 
Sbjct  326   CKMDLDCVKALQFDTESTKSFQLHSGVSLDFDLNACTSDPSRTYLMGKSPFPSLDMFVES  385

Query  1279  IASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKC  1458
             +AS+G++PGKIRSWYWFSEY L+VYSMS+NRYCERIGR+HKSNHV+YVVDLRR  YYQKC
Sbjct  386   VASIGNIPGKIRSWYWFSEYALMVYSMSRNRYCERIGRQHKSNHVIYVVDLRRAVYYQKC  445

Query  1459  HDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKKEWWLEAI  1638
             HDPDC+GYRSPLRP+P NVI H S+S +L  +N       V +D +I  SCKKEWWLEAI
Sbjct  446   HDPDCRGYRSPLRPVPDNVIPHLSISVNLPGHNLDWGKPTVNSDESIFSSCKKEWWLEAI  505

Query  1639  RFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELAYLGK  1773
             R A+ +E + KAL+++      E+++WW A ER A Q+E +YLGK
Sbjct  506   RVADNIENVQKALDLTEQDRTCEEDEWWMAVERTAYQSEQSYLGK  550



>ref|XP_009599577.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Nicotiana tomentosiformis]
Length=570

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/595 (65%), Positives = 453/595 (76%), Gaps = 36/595 (6%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTE----------KILQTT  168
             MDDVDRLFECFKCG SPPQSAI ERK+GK T K +D+ +K ST           K LQ  
Sbjct  1     MDDVDRLFECFKCGISPPQSAISERKKGKLTVKQDDTREKSSTPSDIFSSRSKGKSLQNA  60

Query  169   ADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQ  348
              D +  ++NLGSS  K +    G QF PLVFYGSPHGVPPKRPA LLRLL+EI VDL+EQ
Sbjct  61    TDVELCLQNLGSSTAKIRSVKKGWQFSPLVFYGSPHGVPPKRPARLLRLLNEICVDLNEQ  120

Query  349   KKLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPK  528
              KL Q+IWATFP+Q EAMKYA++  NARVFSYQDH+NG RRFLVSTY++FW+RY++MNPK
Sbjct  121   NKLRQDIWATFPRQDEAMKYAKEQSNARVFSYQDHVNGQRRFLVSTYKEFWRRYETMNPK  180

Query  529   RRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWI  708
              RHHYEVIQEGLPCHLYFDLEFNK+ NADKNGDEMVDLLI  +FD + + Y LEG+ DW+
Sbjct  181   FRHHYEVIQEGLPCHLYFDLEFNKRENADKNGDEMVDLLIQVIFDAVKENYCLEGNDDWV  240

Query  709   VELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDS  888
             VELDSS E                     V     ++CSRI S SE+D RF+KLFVSKDS
Sbjct  241   VELDSSNE---------------------VLVAYCQICSRISSLSESDGRFKKLFVSKDS  279

Query  889   KSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICN  1068
              S+  P QLFVD AVYSRNRCFRLALSSKAGKSSVL+PSGRFKCK+M+++E+FMASLIC 
Sbjct  280   SSIDNPCQLFVDKAVYSRNRCFRLALSSKAGKSSVLLPSGRFKCKDMTKEEVFMASLICK  339

Query  1069  IDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
             IDADCE+LL+CKMD DCV+ L F+TE  +SFQ  S         +F SDPSRTYLMGKSP
Sbjct  340   IDADCEKLLICKMDLDCVKALQFDTESTESFQLHSGVSL-----DFTSDPSRTYLMGKSP  394

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP +D FVE +AS+G++PGKIRSWYWFSEY L+VYSMS+NRYCERIGR+HKSNHV+YVVD
Sbjct  395   FPSLDMFVESVASIGNIPGKIRSWYWFSEYALMVYSMSRNRYCERIGRQHKSNHVIYVVD  454

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDS  1608
             LRR  YYQKCHDPDC+GYRSPLRP+P NVI H S+S +L  +N   E   V +D +I  S
Sbjct  455   LRRAVYYQKCHDPDCRGYRSPLRPVPDNVIPHSSISVNLPGHNLDWEQPTVNSDESIFSS  514

Query  1609  CKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELAYLGK  1773
             CKKEWWLEAIR A+ VE + K L+++      E+++WW A ER A Q+E +YLGK
Sbjct  515   CKKEWWLEAIRVADSVENVQKTLDLTEQDRTCEEDEWWMAVERTAYQSEQSYLGK  569



>ref|XP_006359464.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
isoform X2 [Solanum tuberosum]
Length=559

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/525 (70%), Positives = 429/525 (82%), Gaps = 2/525 (0%)
 Frame = +1

Query  202   SSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQEIWATF  381
             SS  K +    G QF PLVF+GSPHGVPPKRPA LLRLL+EIRVD +EQ KLSQ+IWATF
Sbjct  35    SSTTKIQSLKKGSQFSPLVFFGSPHGVPPKRPARLLRLLNEIRVDFNEQNKLSQDIWATF  94

Query  382   PKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEG  561
             P+Q EAMKYA++  +ARVFSYQDH+NG RRFLVSTY++FW+RYK+MNPK RHHYEVIQEG
Sbjct  95    PRQDEAMKYAKEQTDARVFSYQDHVNGQRRFLVSTYKEFWRRYKTMNPKFRHHYEVIQEG  154

Query  562   LPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKF  741
             LPCHLYFDLEFNK+ NADKN DEMVDLLI  +FD + +KYSLEG++DW+VELDSS  +KF
Sbjct  155   LPCHLYFDLEFNKRENADKNEDEMVDLLIQVIFDAVKEKYSLEGNNDWVVELDSSNAEKF  214

Query  742   SRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFV  921
             SRHLIIR PK AFKDNSH GAF  E+CSRI S SE D RFRKLFVSKDS S  IP QLFV
Sbjct  215   SRHLIIRFPKAAFKDNSHAGAFVTEICSRISSISEHDGRFRKLFVSKDSSSTDIPFQLFV  274

Query  922   DNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLVC  1101
             D AVYSRNRCFRLALSSKAGKSSVL+PSGRFKCK+MSE+E+FMASLICN+DAD E+LL+C
Sbjct  275   DKAVYSRNRCFRLALSSKAGKSSVLLPSGRFKCKDMSEEEVFMASLICNMDADLEKLLIC  334

Query  1102  KMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFES-DPSRTYLMGKSPFPPVDAFVEY  1278
              +D DC++ L F+TE  +SFQQ S     F+LN   S DPS+TYL GKSPFP +D FVE 
Sbjct  335   TVDLDCMKALQFDTESTRSFQQHSAVSLNFDLNACTSDDPSKTYLTGKSPFPYLDVFVES  394

Query  1279  IASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKC  1458
             +AS+G++PG IRSWYWFSEY L+VYSMS+NR+CERIGR+HKSNHVMYVVDL+RG YYQKC
Sbjct  395   VASIGNIPGIIRSWYWFSEYALMVYSMSRNRFCERIGRQHKSNHVMYVVDLQRGVYYQKC  454

Query  1459  HDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKKEWWLEAI  1638
             +DPDC+GYRSPLRP+P NVI H S+SF+L  +N   E   V +D +I  SCKKEWWLEA+
Sbjct  455   YDPDCRGYRSPLRPVPDNVIPHSSISFNLPGHNMDEEQPTVTSDTSIFSSCKKEWWLEAV  514

Query  1639  RFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELAYLGK  1773
             R A+ +E + K      +GE  E+++WW A E  A QTEL+Y GK
Sbjct  515   RVADSIENVQKT-LDLTEGETCEEDEWWMAVEETAYQTELSYFGK  558



>emb|CDP05135.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/610 (63%), Positives = 459/610 (75%), Gaps = 29/610 (5%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHS-----  186
             DDVDRLF+CFKCG SPPQSA  +RK+ K + K   SAQ  ST + + +++ A  S     
Sbjct  3     DDVDRLFQCFKCGVSPPQSAFRQRKKRKHSVKPNGSAQAASTSRSITSSSPAGESHRDSP  62

Query  187   -----VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQK  351
                  ++N   S       +  KQF P+VFYGSPHGVPPKRPA LLRLLHEIRVDLSE+ 
Sbjct  63    ETQPSIQNPFPSAAITTNLNTKKQFSPIVFYGSPHGVPPKRPARLLRLLHEIRVDLSEKN  122

Query  352   KLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKR  531
             KL ++IWATFP+Q EA+KYA +   + VF YQDH NG RR+LVSTY++FWKRYK MNPK 
Sbjct  123   KLREDIWATFPRQDEAIKYATEHRKSHVFCYQDHANGQRRYLVSTYQEFWKRYKQMNPKF  182

Query  532   RHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
             RHHYEVIQEGLPCHLYFDLEF+K+ N  K+GDEMVDLL+  VFD L + YS++ SHD IV
Sbjct  183   RHHYEVIQEGLPCHLYFDLEFSKRENVQKDGDEMVDLLLSIVFDALHENYSIDTSHDCIV  242

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSK  891
             ELDSSTE+KFSRHLI+RLPK AFKDNSH GAF AEVCS I+ S ET+ERF+ LFVSKDS 
Sbjct  243   ELDSSTEEKFSRHLIVRLPKTAFKDNSHAGAFVAEVCSHIHKSRETEERFKNLFVSKDSS  302

Query  892   SVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNM--------------  1029
                   QLFVDNAVYSRNRCFRL LSSKAGKSSVL+PSGRFKCK+M              
Sbjct  303   ETNCQCQLFVDNAVYSRNRCFRLPLSSKAGKSSVLLPSGRFKCKDMMPQMHVPVLLYLAL  362

Query  1030  ----SEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFEL  1197
                 SE+E+FMASLIC++D DCE+LL+CKMD+DCV++L F++E A  F + S   Q F+ 
Sbjct  363   DNSQSEEEVFMASLICSMDDDCEKLLICKMDTDCVKSLCFDSETANKFDKHSTLAQEFDW  422

Query  1198  NNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYC  1377
             N    D SRTY+MGKSPFP +D F+E +AS+G++ GKIRSWYWFSEYGL++YSMS+NRYC
Sbjct  423   NACTIDASRTYMMGKSPFPSLDVFIEDVASIGNISGKIRSWYWFSEYGLMIYSMSRNRYC  482

Query  1378  ERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNN  1557
             ERIGR+HKSNHVMYVVD+RRG+YYQKCHDPDC+GYRSPLRP+P  VI   +V   L    
Sbjct  483   ERIGRQHKSNHVMYVVDIRRGNYYQKCHDPDCRGYRSPLRPVPNGVIPDPAVFLHLSGQT  542

Query  1558  EGREHTPVATDANIVDSCKKEWWLEAIRFAEQVEGIPKAleisgdgel-eededWWKAAE  1734
             E    T   TD +++DSCKKEWW EAIR A+QVE I + L+++G  E  EED+DWW+A E
Sbjct  543   EVPVDTASTTDQSLMDSCKKEWWTEAIRLADQVESIQRTLDLTGMAEKWEEDDDWWRAVE  602

Query  1735  RIATQTELAY  1764
             R A+QTE  Y
Sbjct  603   RTASQTESKY  612



>gb|EYU25154.1| hypothetical protein MIMGU_mgv1a003719mg [Erythranthe guttata]
Length=568

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/587 (65%), Positives = 447/587 (76%), Gaps = 26/587 (4%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLF+CFKCG SPPQSAI E+++ KR  K E S Q+Q +            ++   
Sbjct  1     MDDVDRLFQCFKCGISPPQSAIREKRKEKRKLKQEHSPQQQKS------------TISES  48

Query  199   GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQEIWAT  378
                 PK     N KQF P++FYGSPHGVPPKRPA LLRLL EIRVDL+EQ KL +E+WAT
Sbjct  49    KCVNPK-----NAKQFSPMIFYGSPHGVPPKRPARLLRLLREIRVDLAEQNKLREEVWAT  103

Query  379   FPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQE  558
             FP+Q EA+K+ +Q  NARVFSYQDHING RRFLVSTYE+FW+RYK M  K RHHYEVIQE
Sbjct  104   FPRQDEALKFLKQHTNARVFSYQDHINGQRRFLVSTYEEFWRRYKEMTAKFRHHYEVIQE  163

Query  559   GLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDK  738
             GLPCHLYFDLEFNK+ NA KN DEMVDLLI  +FD LL+KYS++G+ D+IVELDSSTE+K
Sbjct  164   GLPCHLYFDLEFNKRENAGKNEDEMVDLLINVIFDALLEKYSIQGTEDFIVELDSSTEEK  223

Query  739   FSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLF  918
             FSRHLIIRLPK AFKDNSHVGAF AE+CSRI S  E DE + KL +SK S S     Q F
Sbjct  224   FSRHLIIRLPKTAFKDNSHVGAFVAEICSRIQSYRERDENYEKLLISKGSNSADSHCQTF  283

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLV  1098
             VD AVY+RNRCFRL  SSKAGKSSVL+PSGRFKCK M E E+FMASLICN+DAD E+LL+
Sbjct  284   VDTAVYTRNRCFRLPFSSKAGKSSVLLPSGRFKCKEMGEKEVFMASLICNMDADSEKLLI  343

Query  1099  CKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEY  1278
             CKMD DCV+ LHF TE    +      P+ F+L+ + SD S TYLMGKSP P +DAFVE 
Sbjct  344   CKMDLDCVKALHFETETRGGY------PENFDLDAWTSDSSTTYLMGKSPLPALDAFVEA  397

Query  1279  IASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKC  1458
             IAS G+V GKIRSWYWFSEYGL+VYSMS++RYCERIGREHKSNHV+YVVDLRR  YYQKC
Sbjct  398   IASKGNVSGKIRSWYWFSEYGLMVYSMSRSRYCERIGREHKSNHVIYVVDLRRAVYYQKC  457

Query  1459  HDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKKEWWLEAI  1638
             HDPDC+GYRSPLR +P +VI + +   +     + ++HT + +D +  DSCKKEWW EAI
Sbjct  458   HDPDCRGYRSPLRSVPDDVIPYPTFHINQSGETDSQKHTNL-SDQSFTDSCKKEWWHEAI  516

Query  1639  RFAEQVEGIPKAleisgdgelee--dedWWKAAERIATQTELAYLGK  1773
             + AEQVEGI K+L+++   E E   D +WW A E  A QTEL YL K
Sbjct  517   KVAEQVEGIQKSLDLTQMDENETCEDVNWWMAVESTALQTELTYLQK  563



>ref|XP_007038834.1| Coiled-coil domain-containing protein 111 isoform 1 [Theobroma 
cacao]
 gb|EOY23335.1| Coiled-coil domain-containing protein 111 isoform 1 [Theobroma 
cacao]
Length=620

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/616 (60%), Positives = 447/616 (73%), Gaps = 35/616 (6%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQK----------QSTEKILQ  162
             ++MDDVDRLFECFKCG SPPQSA+ ERKR K     E+SA+K           S E+  +
Sbjct  8     STMDDVDRLFECFKCGISPPQSAVRERKRRKSKLNQENSARKVSASPCTPSLGSAEQGKE  67

Query  163   TTADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLS  342
             T  +A  SV    S+  K    S GKQ  P++FYGSPHG+PPKRP SLLRLLHEIR+DLS
Sbjct  68    TPNNAQLSVGKRVSTMVKVGKFSRGKQISPVIFYGSPHGIPPKRPLSLLRLLHEIRIDLS  127

Query  343   EQKK--LSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKS  516
             EQ+K  L  E+WATFP+Q EA+K+A+   NARVFSYQDH +G RR+L STYE+FWKRYK 
Sbjct  128   EQEKSNLRTEVWATFPRQDEAVKFAKGHANARVFSYQDHYSGQRRYLASTYEEFWKRYKI  187

Query  517   MNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGS  696
             M+ K RHHYEVIQEG PCHLYFDLEFNK+ N  ++GDEMVDLLI  + + LL+KYS+ G+
Sbjct  188   MDSKLRHHYEVIQEGFPCHLYFDLEFNKRDNVGRDGDEMVDLLISVILEALLEKYSINGN  247

Query  697   HDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFV  876
              DW+VELDSSTE+KFSRHLI+R+PK AFKDNSHVGAF AE+CSRI S+ E D+RF  L+V
Sbjct  248   QDWVVELDSSTEEKFSRHLIMRIPKTAFKDNSHVGAFVAEICSRIASARERDKRFETLYV  307

Query  877   SKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMAS  1056
                S S   P QLFVD AVYSRNRCFRLALSSKAGK+S L+P+GRFKCK M E +MFMAS
Sbjct  308   KNASTSAESPGQLFVDTAVYSRNRCFRLALSSKAGKASFLLPTGRFKCKEMGEVDMFMAS  367

Query  1057  LICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLM  1236
             LICN++ DCE+ LVCKM+ DCV+TLHF TE+  +F +    PQ    N + SD S TYL 
Sbjct  368   LICNMEVDCEKFLVCKMELDCVKTLHFETEVTSNFGRYCGAPQE---NTYISDVSTTYLT  424

Query  1237  GKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
             GKSPFP +D F+E IAS  +  GKIRSWYWFSEYGLI+YSMS+NRYCERIGREHKSNHVM
Sbjct  425   GKSPFPSLDEFIESIASTRNASGKIRSWYWFSEYGLIIYSMSRNRYCERIGREHKSNHVM  484

Query  1417  YVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD------------------  1542
             YVVD+RR  YYQKC+DPDCKGYRSP+RPIP + I   S  FD                  
Sbjct  485   YVVDMRRAAYYQKCYDPDCKGYRSPMRPIPMDCIPDSSFFFDSRQIVDDNGLTSNDLEYQ  544

Query  1543  LDSNNEGREHTPVATDANIVDSCKKEWWLEAIRFAEQVEGIP-KAleisgdgeleededW  1719
               +NN GR     + +++I D  K  WWLEAI+ A+ ++G P + +    +   +ED+DW
Sbjct  545   FVNNNNGRVLL-YSNESDIDDCTKDSWWLEAIKVADNIDGKPERLMFNDMENMSDEDDDW  603

Query  1720  WKAAERIATQTELAYL  1767
             W A ER A+Q EL +L
Sbjct  604   WVAVERTASQAELKHL  619



>ref|XP_007218876.1| hypothetical protein PRUPE_ppa003300mg [Prunus persica]
 gb|EMJ20075.1| hypothetical protein PRUPE_ppa003300mg [Prunus persica]
Length=587

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/593 (62%), Positives = 446/593 (75%), Gaps = 17/593 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGK-----RTTKSEDSAQKQSTEKILQTTADADH  183
             MDDVDRLFECFKCG SPPQSA+ ERKR K     R+   E S+   + E+  +  ++   
Sbjct  1     MDDVDRLFECFKCGISPPQSALRERKRSKSNLKRRSKTQEVSSPGSAAEQTQKYASEIQL  60

Query  184   SVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPA-SLLRLLHEIRVDLSEQKKLS  360
             S E  GS   K    +  KQF P+VFYGSP+GVPPK+P+ SLLRLL EIRVDL+ QK+LS
Sbjct  61    SAEKSGSGTVKANNFNRAKQFSPVVFYGSPNGVPPKKPSRSLLRLLREIRVDLATQKRLS  120

Query  361   --QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRR  534
               +E+WATFP+Q EAM++A+   N  VFSYQDH +G RRFLVSTY+DFW+RY +MNPK R
Sbjct  121   SRKEVWATFPRQDEAMQFAKGNGNVHVFSYQDHYSGQRRFLVSTYDDFWRRYNNMNPKFR  180

Query  535   HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVE  714
             HHYEVIQEGLPCHLYFDLEFNK+ NA +NGDEMVD+LI  +F+ LL+KYS++G+ +WI+E
Sbjct  181   HHYEVIQEGLPCHLYFDLEFNKRDNAGRNGDEMVDVLISVIFEALLEKYSIQGNQEWILE  240

Query  715   LDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKS  894
             LDSSTE KFSRHLIIR+ K AFKDNSHVGAF  E+CSRI S+ E D RF   FV KDSKS
Sbjct  241   LDSSTEAKFSRHLIIRIEKTAFKDNSHVGAFVTEICSRISSAKERDGRFGNFFVRKDSKS  300

Query  895   VGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNM-SEDEMFMASLICNI  1071
                 +QLFVD AVY+RNRCFRLALSSKAGK+SVL+P+GRFK K+M SE+EMFMASLICN+
Sbjct  301   SNSASQLFVDTAVYTRNRCFRLALSSKAGKNSVLLPTGRFKAKDMQSEEEMFMASLICNL  360

Query  1072  DADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
             D DCE+LLVCK D DC++TLHF+TE+ ++F +    PQ F LN   +D S TY +GKSPF
Sbjct  361   DVDCEKLLVCKTDLDCIKTLHFDTEVNRNFGKCYSWPQEFALNGGTTDASATYFLGKSPF  420

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P +DAF+E +A+VG+V GKIRSWYWFSE+G +VYSMS+NRYCERIGR+HKSNHV+YV DL
Sbjct  421   PALDAFIESVATVGNVSGKIRSWYWFSEFGHMVYSMSRNRYCERIGRQHKSNHVIYVADL  480

Query  1432  RRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSC  1611
             RR  YYQKCHDPDC+GYRSP RPIP ++I      +  D      E  P   D N+  SC
Sbjct  481   RRAAYYQKCHDPDCRGYRSPSRPIPLDIIPEMVHEYRND-----HECVPYG-DENMTSSC  534

Query  1612  KKE-WWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELAYL  1767
               + WWLEAIR A+ VE   K    + +    ED++WW A E+ A+Q ELA+ 
Sbjct  535   ITDSWWLEAIRVADDVEN-KKIDISNMENIDLEDDNWWMAVEKTASQAELAHF  586



>emb|CBI22633.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/604 (61%), Positives = 448/604 (74%), Gaps = 21/604 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLF+CFKCG SPP+SAI ERKR K   K   S    ST   +Q+   A    +N 
Sbjct  1     MDDVDRLFQCFKCGVSPPKSAIRERKRNKEKLKQAGSTHVASTYSDVQSPGSAGERHQNA  60

Query  199   GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK--LSQEIW  372
              + +P  K   N     P++FYGSPHGVPPKRP+SLLRLL EIRV+LSEQ K  L +E+W
Sbjct  61    NNVQPCMKERFNC-HISPVIFYGSPHGVPPKRPSSLLRLLREIRVELSEQNKSDLREEVW  119

Query  373   ATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVI  552
             ATFP+Q E++K+A+   +  +FSYQDH+NG RRFLVSTY++FW+RYK+M+ K RHHYEVI
Sbjct  120   ATFPRQDESIKFAQGHADVHIFSYQDHLNGQRRFLVSTYKEFWQRYKNMDSKFRHHYEVI  179

Query  553   QEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTE  732
             QEG PCHLYFDLEFNKK NA+K+GDEMVDLLI  V + LL+KYS++ +  WIVELDSST 
Sbjct  180   QEGFPCHLYFDLEFNKKDNAEKDGDEMVDLLISVVSEALLEKYSIQVNEKWIVELDSSTG  239

Query  733   DKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQ  912
             +KFSRHLIIR+PKIAFKDNSH G F AE+CS+I S+ E D  F+KLF+SK S S   P Q
Sbjct  240   EKFSRHLIIRIPKIAFKDNSHAGVFVAEICSQISSAGEGDGNFKKLFISKGSTSAEFPCQ  299

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERL  1092
             LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M E+EMFMASLICNID DCE+ 
Sbjct  300   LFVDTAVYSRNRCFRLALSSKAGKNSVLLPTGRFKCKDMCEEEMFMASLICNIDVDCEKF  359

Query  1093  LVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFV  1272
             LVCKMD +CV+TLHF+ E   + ++ S +PQ F L+   S+ S T  MG SPFP +D FV
Sbjct  360   LVCKMDLNCVKTLHFDMEENHNCRKHSSSPQDFALSACTSNVSGTCFMGNSPFPALDIFV  419

Query  1273  EYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQ  1452
             E IAS+G+V GKIRSWYWFSEY L+VYSMS+NRYCERIGR+HKSNHV+YVVDLRR  +YQ
Sbjct  420   ESIASIGNVSGKIRSWYWFSEYRLMVYSMSRNRYCERIGRQHKSNHVIYVVDLRRAIFYQ  479

Query  1453  KCHDPDCKGYRSPLRPIPGNVIAHCSVSFD---------LDSNNEG-------REHTPVA  1584
             KCHDPDC+GYRSP RPIP +VI + +V  D           SN+ G       +E   + 
Sbjct  480   KCHDPDCRGYRSPSRPIPMDVIPNTAVLMDSVQTEHHVESTSNHLGYSLVENDQECVSLY  539

Query  1585  TDANIVDSCKKE-WWLEAIRFAEQVEGIPKAl-eisgdgeleededWWKAAERIATQTEL  1758
              D +I DSCKK+ WWLEAIRFA+ VE +         +   +ED+DWW AAER A+QTE 
Sbjct  540   NDKSITDSCKKDAWWLEAIRFADNVESVQHMRDLSDTENIDDEDDDWWMAAERTASQTEQ  599

Query  1759  AYLG  1770
              Y  
Sbjct  600   TYFN  603



>ref|XP_008234830.1| PREDICTED: DNA-directed primase/polymerase protein [Prunus mume]
Length=587

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/593 (62%), Positives = 442/593 (75%), Gaps = 17/593 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQST--EKILQTTADADH---  183
             MDDVDRLFECFKCG SPPQSA+ ERKR K   K     Q+ S+      QT  +A     
Sbjct  1     MDDVDRLFECFKCGISPPQSALRERKRSKSNLKRRSKTQEVSSPGSAAGQTQKNASEIQL  60

Query  184   SVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPA-SLLRLLHEIRVDLSEQKKLS  360
             S E  GS   K    +  KQF P+VFYGSP+GVPPK+P+ SLLRLL EIRVDL+ QK+LS
Sbjct  61    SAEKSGSGTVKANNFNRAKQFSPVVFYGSPNGVPPKKPSRSLLRLLREIRVDLATQKRLS  120

Query  361   --QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRR  534
               +E+WATFP+Q EAM++A+   N  VFSYQDH +G RRFLVSTY+DFW+RY +MNPK R
Sbjct  121   SRKEVWATFPRQDEAMQFAKGNGNVHVFSYQDHYSGQRRFLVSTYDDFWRRYNNMNPKFR  180

Query  535   HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVE  714
             HHYEVIQEGLPCHLYFDLEFNK+ NA +NGDEMVD+LI  +F+ LL+KYS++G+ +WI+E
Sbjct  181   HHYEVIQEGLPCHLYFDLEFNKRDNAGRNGDEMVDVLISVIFEALLEKYSIQGNKEWILE  240

Query  715   LDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKS  894
             LDSSTE KFSRHLIIR+ K AFKDNSH GAF  E+CSRI S+ E D RF   FV KDSKS
Sbjct  241   LDSSTEAKFSRHLIIRIKKTAFKDNSHAGAFVTEICSRISSAKERDGRFGNFFVRKDSKS  300

Query  895   VGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNM-SEDEMFMASLICNI  1071
                 +QLFVD AVY+RNRCFRLALSSKAGK+SVL+P+GRFK K+M SE+EMFMASLICN+
Sbjct  301   SNSASQLFVDTAVYTRNRCFRLALSSKAGKNSVLLPTGRFKAKDMQSEEEMFMASLICNL  360

Query  1072  DADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
             D DCE+LLVCK D DC++TLHF+TEI ++F +    PQ F LN   +D S TY +GKSPF
Sbjct  361   DVDCEKLLVCKTDLDCIKTLHFDTEINRNFGKCYSWPQEFALNGGTTDASATYFLGKSPF  420

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P +DAF+E +A+VG+V GKIRSWYWFSE+G +VYSMS+NRYCERIGR+HKSNHV+YV DL
Sbjct  421   PALDAFIESVATVGNVSGKIRSWYWFSEFGHMVYSMSRNRYCERIGRQHKSNHVIYVADL  480

Query  1432  RRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSC  1611
             RR  YYQKCHDPDC+GYRSP RPIP ++I      +  D      E  P   D N+  SC
Sbjct  481   RRAAYYQKCHDPDCRGYRSPSRPIPLDIIPEMVHEYRSD-----HECVPYG-DENMTSSC  534

Query  1612  KKE-WWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELAYL  1767
               + WWLEAIR A+ VE        + +    ED++WW A E+ A+Q ELA+ 
Sbjct  535   ITDSWWLEAIRVADDVEN-KNIDIRNMENIDSEDDNWWMAVEKTASQAELAHF  586



>ref|XP_010662672.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Vitis vinifera]
Length=615

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/612 (60%), Positives = 450/612 (74%), Gaps = 28/612 (5%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLF+CFKCG SPP+SAI ERKR K   K   S    ST   +Q+   A    +N 
Sbjct  1     MDDVDRLFQCFKCGVSPPKSAIRERKRNKEKLKQAGSTHVASTYSDVQSPGSAGERHQNA  60

Query  199   GSSKPKRKYHS----NGKQF----CPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK  354
              + +P  K         ++F     P++FYGSPHGVPPKRP+SLLRLL EIRV+LSEQ K
Sbjct  61    NNVQPCMKELGPRTVEAERFNCHISPVIFYGSPHGVPPKRPSSLLRLLREIRVELSEQNK  120

Query  355   --LSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPK  528
               L +E+WATFP+Q E++K+A+   +  +FSYQDH+NG RRFLVSTY++FW+RYK+M+ K
Sbjct  121   SDLREEVWATFPRQDESIKFAQGHADVHIFSYQDHLNGQRRFLVSTYKEFWQRYKNMDSK  180

Query  529   RRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWI  708
              RHHYEVIQEG PCHLYFDLEFNKK NA+K+GDEMVDLLI  V + LL+KYS++ +  WI
Sbjct  181   FRHHYEVIQEGFPCHLYFDLEFNKKDNAEKDGDEMVDLLISVVSEALLEKYSIQVNEKWI  240

Query  709   VELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDS  888
             VELDSST +KFSRHLIIR+PKIAFKDNSH G F AE+CS+I S+ E D  F+KLF+SK S
Sbjct  241   VELDSSTGEKFSRHLIIRIPKIAFKDNSHAGVFVAEICSQISSAGEGDGNFKKLFISKGS  300

Query  889   KSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICN  1068
              S   P QLFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M E+EMFMASLICN
Sbjct  301   TSAEFPCQLFVDTAVYSRNRCFRLALSSKAGKNSVLLPTGRFKCKDMCEEEMFMASLICN  360

Query  1069  IDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
             ID DCE+ LVCKMD +CV+TLHF+ E   + ++ S +PQ F L+   S+ S T  MG SP
Sbjct  361   IDVDCEKFLVCKMDLNCVKTLHFDMEENHNCRKHSSSPQDFALSACTSNVSGTCFMGNSP  420

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP +D FVE IAS+G+V GKIRSWYWFSEY L+VYSMS+NRYCERIGR+HKSNHV+YVVD
Sbjct  421   FPALDIFVESIASIGNVSGKIRSWYWFSEYRLMVYSMSRNRYCERIGRQHKSNHVIYVVD  480

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD---------LDSNNEG------  1563
             LRR  +YQKCHDPDC+GYRSP RPIP +VI + +V  D           SN+ G      
Sbjct  481   LRRAIFYQKCHDPDCRGYRSPSRPIPMDVIPNTAVLMDSVQTEHHVESTSNHLGYSLVEN  540

Query  1564  -REHTPVATDANIVDSCKKE-WWLEAIRFAEQVEGIPKAl-eisgdgeleededWWKAAE  1734
              +E   +  D +I DSCKK+ WWLEAIRFA+ VE +         +   +ED+DWW AAE
Sbjct  541   DQECVSLYNDKSITDSCKKDAWWLEAIRFADNVESVQHMRDLSDTENIDDEDDDWWMAAE  600

Query  1735  RIATQTELAYLG  1770
             R A+QTE  Y  
Sbjct  601   RTASQTEQTYFN  612



>ref|XP_011046040.1| PREDICTED: DNA-directed primase/polymerase protein [Populus euphratica]
Length=598

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/603 (59%), Positives = 449/603 (74%), Gaps = 34/603 (6%)
 Frame = +1

Query  16    SMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVEN  195
             +M+DVDRLFECFKCG SPPQSA+ ERKR K   K++  +  +++         A+   + 
Sbjct  10    TMEDVDRLFECFKCGISPPQSAVRERKRSKGKIKNQGISINEAS------PGSAEQPKKK  63

Query  196   LGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK--LSQEI  369
             + S+  +RK  S GKQ  P+VFYGSPHGVPPKRP SLLRLL EIR+DL+EQ+K  LS+E+
Sbjct  64    MASNAVERKNVSQGKQISPVVFYGSPHGVPPKRPISLLRLLREIRIDLAEQQKSHLSKEV  123

Query  370   WATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEV  549
             WATFP+Q EAM +A++  +  +FSYQDH NG RRFLVSTY +FW+RYK+M+ + RHHYEV
Sbjct  124   WATFPRQNEAMNFAKEHADVCIFSYQDHHNGQRRFLVSTYREFWRRYKNMDARFRHHYEV  183

Query  550   IQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSST  729
             IQEGLPCHLYFDLEF+++ NA++NGDEMVDLLI    + L +KYS++G+ DWIVELDSST
Sbjct  184   IQEGLPCHLYFDLEFSRRDNAERNGDEMVDLLISVTLEALFEKYSIQGNQDWIVELDSST  243

Query  730   EDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPA  909
              +KFSRHLIIR+PK AFKDN+H GAF +E+CSRI S+   DERF  LF+ KDS S G P+
Sbjct  244   AEKFSRHLIIRIPKTAFKDNTHAGAFVSEICSRILSARGRDERFENLFIRKDSSSAGSPS  303

Query  910   QLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCER  1089
             QLF+D AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M E++MFM+SLIC++D DC +
Sbjct  304   QLFIDAAVYSRNRCFRLALSSKAGKNSVLLPTGRFKCKDMCEEDMFMSSLICSMDVDCNK  363

Query  1090  LLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAF  1269
             LLVCKMD +C++TL F+TE+   +++   TP+ F LN   SD       G SPFP +D F
Sbjct  364   LLVCKMDMECMKTLQFDTEVNYDYRRHC-TPKEFPLNGVPSD------TGNSPFPALDKF  416

Query  1270  VEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYY  1449
             +E IAS+G++ GKIRSWYWFSEYGL+VYSMS+NRYCERIGREHKSNHVMYVVDLRR DYY
Sbjct  417   IESIASIGNISGKIRSWYWFSEYGLMVYSMSRNRYCERIGREHKSNHVMYVVDLRRADYY  476

Query  1450  QKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD-------LDSNNEGREHTPVATDANIV--  1602
             QKCHDPDC+GYRSPLRPIP NVI     S+D       + S N+  +   V+ +      
Sbjct  477   QKCHDPDCQGYRSPLRPIPWNVIPDPPYSYDSVQMVDQIGSANDNLKLQHVSNECEDFLL  536

Query  1603  -------DSCKKE-WWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTEL  1758
                    DSC K+ WWLEAI+ A+ +E   K      D   EED++WW A E  A+Q+EL
Sbjct  537   CDNKHDPDSCSKDSWWLEAIKVADDIEN--KQKTSVSDNNDEEDDNWWTAVEETASQSEL  594

Query  1759  AYL  1767
              Y 
Sbjct  595   IYF  597



>ref|XP_010261356.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Nelumbo nucifera]
 ref|XP_010261357.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Nelumbo nucifera]
Length=616

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/615 (59%), Positives = 444/615 (72%), Gaps = 30/615 (5%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQK----------QSTEKILQ  162
             + MDDVDRLFECFKCG SPPQSA+ ER+  +   K   S Q            S  +  Q
Sbjct  4     DPMDDVDRLFECFKCGVSPPQSAVRERRAHQDKLKKASSRQDVSALSSFASPSSARQKPQ  63

Query  163   TTADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLS  342
              TAD    +EN G++  K    S+GKQ  P++FYGSP+GVP KRP  LL+LL+EIR DL+
Sbjct  64    KTADL-LCMENPGTTMAKAIAFSSGKQLSPVIFYGSPYGVPAKRPYRLLKLLNEIREDLT  122

Query  343   EQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKS  516
              Q  L   +++WATFP+Q EA+K+A+    A VFSYQDH+NG RRFLVSTY +FW+RYK+
Sbjct  123   TQNSLQSREDVWATFPRQDEAIKFAKGHAYAHVFSYQDHLNGQRRFLVSTYAEFWRRYKN  182

Query  517   MNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGS  696
             M+PK RHHYEVIQEGLPCHLYFDLEFNK+AN  KNGDEMVDLLI  + D L  KYS++G+
Sbjct  183   MDPKFRHHYEVIQEGLPCHLYFDLEFNKRANDGKNGDEMVDLLISIILDALFDKYSIQGN  242

Query  697   HDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFV  876
              +WI+ELDSSTE+KFSRHLIIR+PK AFKDN H GAF AE+CSRI S+ E+D R  KLF+
Sbjct  243   QEWIIELDSSTEEKFSRHLIIRIPKTAFKDNLHAGAFVAEICSRICSARESDRRLDKLFI  302

Query  877   SKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMAS  1056
             SKD  S  IP QLFVD AVYSRNRCFRL LSSKAGK+SVL+P+GRFKCK+MSE+EMFMAS
Sbjct  303   SKDPSSDEIPCQLFVDTAVYSRNRCFRLFLSSKAGKNSVLLPTGRFKCKSMSEEEMFMAS  362

Query  1057  LICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLM  1236
             LICN+D DC++LL+CKM+ DCV+TL F++E+  +F Q S +      +    D   TY M
Sbjct  363   LICNMDTDCKKLLICKMEFDCVKTLCFDSEVNGNFGQHSGSSNELAWHACTKDVPTTYFM  422

Query  1237  GKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
             GKSPFP +DAFVE IAS+G+V G+IRSWYWFSEYGL+VYSMSKNRYCERIGR+HKSNHVM
Sbjct  423   GKSPFPTLDAFVESIASIGNVAGRIRSWYWFSEYGLMVYSMSKNRYCERIGRQHKSNHVM  482

Query  1417  YVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSF--------------DLDSN  1554
             Y+VDLRR  YYQKC+DPDCKGYRSPLRPIPG+V                      DL   
Sbjct  483   YIVDLRRAVYYQKCYDPDCKGYRSPLRPIPGDVFPDTMAVLKSLQMEHPGEMIYNDLHQG  542

Query  1555  -NEGREHTPVATDANIVDSCKKE-WWLEAIRFAEQVEGIPKAleisgdgeleededWWKA  1728
              +E        ++ N+ DSC K+ WWLEAIR A+ +E I +  E+      ++D +WW A
Sbjct  543   YDENNLELSSYSNKNVTDSCMKDGWWLEAIRMADDIESI-RTQELVDTKVDDDDSEWWMA  601

Query  1729  AERIATQTELAYLGK  1773
              ER A+Q E A + +
Sbjct  602   VERTASQAEQAQIQR  616



>ref|XP_004309176.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
[Fragaria vesca subsp. vesca]
Length=571

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/557 (63%), Positives = 428/557 (77%), Gaps = 16/557 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQK----QSTEKILQTTADADHS  186
             MDDVDRLFECFKCG SPPQSA+ ERKR K        AQ+    +S E+I +  +D   S
Sbjct  1     MDDVDRLFECFKCGISPPQSALRERKRIKSKPNQRSKAQEVDSPRSPEQIKKIASDLQLS  60

Query  187   VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLL-RLLHEIRVDLSEQKKLS-  360
              E  GS+  + K  +  KQ  P+VFYGSP+GVPPK+P+ LL R+L EIRVDL+ QK+LS 
Sbjct  61    AEKGGSATAEAKSVNRRKQLSPVVFYGSPNGVPPKQPSRLLLRVLREIRVDLTAQKRLSS  120

Query  361   -QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRH  537
              +E+WATFP+Q EAM++A++  N  VFSYQDH +G RRFLVS+Y++FW+RYK M+ K RH
Sbjct  121   RKEVWATFPRQEEAMQFAKRNENVHVFSYQDHFSGQRRFLVSSYDEFWRRYKFMDSKFRH  180

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
             HYEVIQEGLPCHLYFDLEFNKK N D+NGDEMVDLLI  VF+ LL+KYS++G+ +WI+EL
Sbjct  181   HYEVIQEGLPCHLYFDLEFNKKDNTDRNGDEMVDLLISVVFEALLEKYSIQGNMEWIIEL  240

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSV  897
             DSSTE KFSRHLI+R+ K AFKDNSH+G F  E+CSRI S+   D RF KLF++KDS S 
Sbjct  241   DSSTEAKFSRHLIVRIQKTAFKDNSHIGGFVTEICSRISSAKGRDGRFEKLFITKDSSSG  300

Query  898   GI-PAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKN-MSEDEMFMASLICNI  1071
              + P+ LFVD AVY+RNRCFRLALSSKAGK SVL+P+GRFK K+ MSE+EMFMASLICN+
Sbjct  301   DLEPSHLFVDTAVYTRNRCFRLALSSKAGKKSVLLPTGRFKAKDMMSEEEMFMASLICNL  360

Query  1072  DADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
             DADCE+LLVCK D DC++TLHF+TE+  SF +    PQ F L+   SD S TY MGKSPF
Sbjct  361   DADCEKLLVCKSDLDCIKTLHFDTEVNPSFGKSYSWPQEFALSGCTSDASATYFMGKSPF  420

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P +DAFVE++A++G+V GKIRSWYWFSE+GL+VYSMS+NRYCERIGR+HKSNHV+Y+ DL
Sbjct  421   PALDAFVEFVATIGNVSGKIRSWYWFSEFGLMVYSMSRNRYCERIGRQHKSNHVIYIADL  480

Query  1432  RRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDS-  1608
             RRG YYQKCHDPDC+GYRSP RPIP N++       DL    E      +  D N   S 
Sbjct  481   RRGVYYQKCHDPDCRGYRSPSRPIPWNIVR------DLVHECEKDHERVLFDDENTKSSG  534

Query  1609  CKKEWWLEAIRFAEQVE  1659
                 WWLEAI+ A++VE
Sbjct  535   VTDSWWLEAIKVADEVE  551



>ref|XP_010261354.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Nelumbo nucifera]
 ref|XP_010261355.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Nelumbo nucifera]
Length=629

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/582 (60%), Positives = 426/582 (73%), Gaps = 29/582 (5%)
 Frame = +1

Query  4     VQDNSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQK----------QSTEK  153
             +  + MDDVDRLFECFKCG SPPQSA+ ER+  +   K   S Q            S  +
Sbjct  1     MSSDPMDDVDRLFECFKCGVSPPQSAVRERRAHQDKLKKASSRQDVSALSSFASPSSARQ  60

Query  154   ILQTTADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRV  333
               Q TAD    +EN G++  K    S+GKQ  P++FYGSP+GVP KRP  LL+LL+EIR 
Sbjct  61    KPQKTADL-LCMENPGTTMAKAIAFSSGKQLSPVIFYGSPYGVPAKRPYRLLKLLNEIRE  119

Query  334   DLSEQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKR  507
             DL+ Q  L   +++WATFP+Q EA+K+A+    A VFSYQDH+NG RRFLVSTY +FW+R
Sbjct  120   DLTTQNSLQSREDVWATFPRQDEAIKFAKGHAYAHVFSYQDHLNGQRRFLVSTYAEFWRR  179

Query  508   YKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSL  687
             YK+M+PK RHHYEVIQEGLPCHLYFDLEFNK+AN  KNGDEMVDLLI  + D L  KYS+
Sbjct  180   YKNMDPKFRHHYEVIQEGLPCHLYFDLEFNKRANDGKNGDEMVDLLISIILDALFDKYSI  239

Query  688   EGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRK  867
             +G+ +WI+ELDSSTE+KFSRHLIIR+PK AFKDN H GAF AE+CSRI S+ E+D R  K
Sbjct  240   QGNQEWIIELDSSTEEKFSRHLIIRIPKTAFKDNLHAGAFVAEICSRICSARESDRRLDK  299

Query  868   LFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMF  1047
             LF+SKD  S  IP QLFVD AVYSRNRCFRL LSSKAGK+SVL+P+GRFKCK+MSE+EMF
Sbjct  300   LFISKDPSSDEIPCQLFVDTAVYSRNRCFRLFLSSKAGKNSVLLPTGRFKCKSMSEEEMF  359

Query  1048  MASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRT  1227
             MASLICN+D DC++LL+CKM+ DCV+TL F++E+  +F Q S +      +    D   T
Sbjct  360   MASLICNMDTDCKKLLICKMEFDCVKTLCFDSEVNGNFGQHSGSSNELAWHACTKDVPTT  419

Query  1228  YLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSN  1407
             Y MGKSPFP +DAFVE IAS+G+V G+IRSWYWFSEYGL+VYSMSKNRYCERIGR+HKSN
Sbjct  420   YFMGKSPFPTLDAFVESIASIGNVAGRIRSWYWFSEYGLMVYSMSKNRYCERIGRQHKSN  479

Query  1408  HVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSF--------------DL  1545
             HVMY+VDLRR  YYQKC+DPDCKGYRSPLRPIPG+V                      DL
Sbjct  480   HVMYIVDLRRAVYYQKCYDPDCKGYRSPLRPIPGDVFPDTMAVLKSLQMEHPGEMIYNDL  539

Query  1546  DSN-NEGREHTPVATDANIVDSCKKE-WWLEAIRFAEQVEGI  1665
                 +E        ++ N+ DSC K+ WWLEAIR A+ +E I
Sbjct  540   HQGYDENNLELSSYSNKNVTDSCMKDGWWLEAIRMADDIESI  581



>ref|XP_010261358.1| PREDICTED: DNA-directed primase/polymerase protein isoform X4 
[Nelumbo nucifera]
Length=610

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/582 (60%), Positives = 426/582 (73%), Gaps = 29/582 (5%)
 Frame = +1

Query  4     VQDNSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQK----------QSTEK  153
             +  + MDDVDRLFECFKCG SPPQSA+ ER+  +   K   S Q            S  +
Sbjct  1     MSSDPMDDVDRLFECFKCGVSPPQSAVRERRAHQDKLKKASSRQDVSALSSFASPSSARQ  60

Query  154   ILQTTADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRV  333
               Q TAD    +EN G++  K    S+GKQ  P++FYGSP+GVP KRP  LL+LL+EIR 
Sbjct  61    KPQKTADL-LCMENPGTTMAKAIAFSSGKQLSPVIFYGSPYGVPAKRPYRLLKLLNEIRE  119

Query  334   DLSEQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKR  507
             DL+ Q  L   +++WATFP+Q EA+K+A+    A VFSYQDH+NG RRFLVSTY +FW+R
Sbjct  120   DLTTQNSLQSREDVWATFPRQDEAIKFAKGHAYAHVFSYQDHLNGQRRFLVSTYAEFWRR  179

Query  508   YKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSL  687
             YK+M+PK RHHYEVIQEGLPCHLYFDLEFNK+AN  KNGDEMVDLLI  + D L  KYS+
Sbjct  180   YKNMDPKFRHHYEVIQEGLPCHLYFDLEFNKRANDGKNGDEMVDLLISIILDALFDKYSI  239

Query  688   EGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRK  867
             +G+ +WI+ELDSSTE+KFSRHLIIR+PK AFKDN H GAF AE+CSRI S+ E+D R  K
Sbjct  240   QGNQEWIIELDSSTEEKFSRHLIIRIPKTAFKDNLHAGAFVAEICSRICSARESDRRLDK  299

Query  868   LFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMF  1047
             LF+SKD  S  IP QLFVD AVYSRNRCFRL LSSKAGK+SVL+P+GRFKCK+MSE+EMF
Sbjct  300   LFISKDPSSDEIPCQLFVDTAVYSRNRCFRLFLSSKAGKNSVLLPTGRFKCKSMSEEEMF  359

Query  1048  MASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRT  1227
             MASLICN+D DC++LL+CKM+ DCV+TL F++E+  +F Q S +      +    D   T
Sbjct  360   MASLICNMDTDCKKLLICKMEFDCVKTLCFDSEVNGNFGQHSGSSNELAWHACTKDVPTT  419

Query  1228  YLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSN  1407
             Y MGKSPFP +DAFVE IAS+G+V G+IRSWYWFSEYGL+VYSMSKNRYCERIGR+HKSN
Sbjct  420   YFMGKSPFPTLDAFVESIASIGNVAGRIRSWYWFSEYGLMVYSMSKNRYCERIGRQHKSN  479

Query  1408  HVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSF--------------DL  1545
             HVMY+VDLRR  YYQKC+DPDCKGYRSPLRPIPG+V                      DL
Sbjct  480   HVMYIVDLRRAVYYQKCYDPDCKGYRSPLRPIPGDVFPDTMAVLKSLQMEHPGEMIYNDL  539

Query  1546  DSN-NEGREHTPVATDANIVDSCKKE-WWLEAIRFAEQVEGI  1665
                 +E        ++ N+ DSC K+ WWLEAIR A+ +E I
Sbjct  540   HQGYDENNLELSSYSNKNVTDSCMKDGWWLEAIRMADDIESI  581



>ref|XP_009797266.1| PREDICTED: DNA-directed primase/polymerase protein isoform X5 
[Nicotiana sylvestris]
Length=451

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/464 (72%), Positives = 385/464 (83%), Gaps = 14/464 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLFECFKCG SPPQSAI ERK+GKRT K  D+ +K      L T +D +  ++NL
Sbjct  1     MDDVDRLFECFKCGISPPQSAIRERKKGKRTVKQSDTLEK------LSTPSDVELCLQNL  54

Query  199   GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQEIWAT  378
             G  K        G+QF PLVFYGSPHGVPPKRPA LLRLL+EIRVDL+EQ KL Q+IW+T
Sbjct  55    GVKK--------GRQFSPLVFYGSPHGVPPKRPARLLRLLNEIRVDLNEQNKLRQDIWST  106

Query  379   FPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQE  558
             FP+Q EAMKYA++  NARVFSYQDH+NG RRFLVSTY++FW+RY++MNPK RHHYEVIQE
Sbjct  107   FPRQDEAMKYAKEQSNARVFSYQDHVNGQRRFLVSTYKEFWRRYETMNPKFRHHYEVIQE  166

Query  559   GLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDK  738
             GLPCHLYFDLEFNK+ NA KNGDEMVDLLI  +FD + +KY LEG+ DW+VELDSS E+K
Sbjct  167   GLPCHLYFDLEFNKRENAAKNGDEMVDLLIQVIFDAVKEKYCLEGNDDWVVELDSSNEEK  226

Query  739   FSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLF  918
             FSRHLIIR P  AFKDN H GAF  E+CSRI S SETD RFR LFVSKDS S+ IP QLF
Sbjct  227   FSRHLIIRFPNAAFKDNLHAGAFVTEICSRISSLSETDGRFRNLFVSKDSSSIDIPCQLF  286

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLV  1098
             VD AVYSRNRCFRLALSSKAGKSSVL+PSGRFKCK+M+++E+FMASLICNIDADCE+LL+
Sbjct  287   VDKAVYSRNRCFRLALSSKAGKSSVLLPSGRFKCKDMTKEEVFMASLICNIDADCEKLLI  346

Query  1099  CKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEY  1278
             CKMD DCV+ L F+TE  +SFQ  S     F+LN   SDPSRTYLMGKSPFP +D FVE 
Sbjct  347   CKMDLDCVKALQFDTESTKSFQLHSGVSLDFDLNACTSDPSRTYLMGKSPFPSLDMFVES  406

Query  1279  IASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNH  1410
             +AS+G++PGKIRSWYWFSEY L+VYSMS+NRYCERIGR+HKSNH
Sbjct  407   VASIGNIPGKIRSWYWFSEYALMVYSMSRNRYCERIGRQHKSNH  450



>ref|XP_009377568.1| PREDICTED: DNA-directed primase/polymerase protein-like [Pyrus 
x bretschneideri]
 ref|XP_009377592.1| PREDICTED: DNA-directed primase/polymerase protein-like [Pyrus 
x bretschneideri]
Length=588

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/593 (60%), Positives = 440/593 (74%), Gaps = 16/593 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGK----RTTKSEDSAQKQSTEKILQTTADADHS  186
             MDDVDRLFECFKCG SPPQSA+ ERKR K    R +K+ + +   S     +  ++   S
Sbjct  1     MDDVDRLFECFKCGISPPQSALRERKRSKSDLKRRSKTPEVSSPGSAGNTKKNASELQLS  60

Query  187   VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPA-SLLRLLHEIRVDLSEQKKLS-  360
              +  G +  K    +  K+F P+VFYGSPHGVPPK+P+ S LRLL EIR+DL+ QK+L+ 
Sbjct  61    ADKSGPTSVKPNKFNRQKEFSPVVFYGSPHGVPPKKPSRSFLRLLREIRIDLAAQKRLTS  120

Query  361   -QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRH  537
              +E+W TFP+Q EAM++A+   N  VFSYQDH +G RRFLVSTY DFW+RYK+MNPK RH
Sbjct  121   RKEVWTTFPRQDEAMQFAKGHENVHVFSYQDHYSGQRRFLVSTYNDFWRRYKNMNPKFRH  180

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
             HYEVIQEGLPCHLYFDLEF+++ NAD+NGDEMVDLLI A+++ LL+KYS+ G+ +WI+EL
Sbjct  181   HYEVIQEGLPCHLYFDLEFSRRDNADRNGDEMVDLLIAAIYEALLEKYSIIGNKEWILEL  240

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSV  897
             DSS E KFSRHLIIR+ K AFKDNSH GAF  E+CSRI S+ E D RF  LF+ KDS S 
Sbjct  241   DSSNEAKFSRHLIIRIEKTAFKDNSHAGAFVTEICSRISSAKERDGRFGNLFIRKDSSSS  300

Query  898   GIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMS-EDEMFMASLICNID  1074
               P++LFVD AVY+RNRCFRLALSSKAGK+SVL+P+GRFK K M  E+EMFMASLICN+D
Sbjct  301   DSPSKLFVDTAVYTRNRCFRLALSSKAGKNSVLLPTGRFKAKKMQCEEEMFMASLICNLD  360

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
              DCE+LLVCK D DC++TLHF+TE+ +   +    PQ + LN   S  S TY +GKSPFP
Sbjct  361   VDCEKLLVCKPDLDCIKTLHFDTEVNRGLGKCYSWPQEYALNGCTSGASATYFLGKSPFP  420

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              +DAFVE +A++G+V GKIRSWYW SE+ L+VYSMS+NRYCERIGR+HKSNHV+YV DLR
Sbjct  421   ALDAFVESVATIGNVSGKIRSWYWLSEFALMVYSMSRNRYCERIGRQHKSNHVIYVADLR  480

Query  1435  RGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCK  1614
             R  YYQKCHDPDC+GYRS  RPIP  +I       D+   N+    + +  D  +  SC 
Sbjct  481   RASYYQKCHDPDCRGYRSASRPIPWEIIP------DMVYENKNDPESVLYGDEKMSSSCV  534

Query  1615  KE-WWLEAIRFAEQVEGIPKAleisgdgel-eededWWKAAERIATQTELAYL  1767
              + WWLEAIR A+ VE    +L IS    +  +DEDWW A ER A+Q+ELA++
Sbjct  535   TDSWWLEAIRIADDVENKQNSLGISNMENIDSDDEDWWMAVERTASQSELAHV  587



>ref|XP_008362791.1| PREDICTED: DNA-directed primase/polymerase protein-like isoform 
X2 [Malus domestica]
Length=587

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/593 (59%), Positives = 436/593 (74%), Gaps = 15/593 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGK----RTTKSEDSAQKQSTEKILQTTADADHS  186
             MDDVDRLFECFKCG SPPQSA+ ERKR K    R +K+ + +   S E   + T++   S
Sbjct  1     MDDVDRLFECFKCGISPPQSALRERKRSKSDLKRRSKTPEVSSPGSAENTKKNTSELQLS  60

Query  187   VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPA-SLLRLLHEIRVDLSEQKKLS-  360
              +  G +  K    +  K+F P+VFYGSPHGVPPK+P+ S LRLL EIRVDL+ QK+L+ 
Sbjct  61    ADKSGPTSVKPNKFNRQKEFSPVVFYGSPHGVPPKKPSRSFLRLLREIRVDLAAQKRLTS  120

Query  361   -QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRH  537
              +E+W TFP+Q EAM++ +   N  VFSYQDH +G RRFLVSTY DFW+RYK+MNP+ RH
Sbjct  121   RKEVWTTFPRQDEAMQFVKGHENVHVFSYQDHYSGQRRFLVSTYNDFWRRYKNMNPRFRH  180

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
             HYEVIQEGLPCHLYFDLEF+++ NAD+NGDEMVDLLI A+F+ LL+KYS+ G+ +WI+EL
Sbjct  181   HYEVIQEGLPCHLYFDLEFSRRDNADRNGDEMVDLLISAIFEALLEKYSIIGNKEWILEL  240

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSV  897
             DSS E KFSRHLIIR+ K AFKDNSH GAF  E+CSRI S+ E D RF  LF+ KDS S 
Sbjct  241   DSSNEAKFSRHLIIRIEKTAFKDNSHAGAFVTEICSRISSAKERDGRFGNLFIRKDSSSS  300

Query  898   GIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDA  1077
               P++LFVD AVY+RNRCFRLALSSKAGK+SVL+P+GRFK   M E+EMFMASLICN+D 
Sbjct  301   DSPSKLFVDTAVYTRNRCFRLALSSKAGKNSVLLPTGRFKANKMCEEEMFMASLICNLDV  360

Query  1078  DCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPP  1257
             DCE+LLVCK D DC++TLHF+TE+ +   +    PQ + LN   S  S TY +GKSPFP 
Sbjct  361   DCEKLLVCKPDLDCIKTLHFDTEVNRGLGKCYSWPQEYALNGCTSGASATYFLGKSPFPA  420

Query  1258  VDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRR  1437
             +DAFVE +A++G+V GKIRSWYW SE+ L+VYSMS+NRYCERIGR+HKSNHV+YV DLRR
Sbjct  421   LDAFVESVATIGNVSGKIRSWYWLSEFALMVYSMSRNRYCERIGRQHKSNHVIYVADLRR  480

Query  1438  GDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKK  1617
               YYQKCHDPDC+GYRS  RPIP  +I      +  D        + +  D  +  SC  
Sbjct  481   ASYYQKCHDPDCRGYRSASRPIPWEIIPDMVYEYKNDP------ESVLYGDEKMSSSCVT  534

Query  1618  E-WWLEAIRFAEQVEGIPKAleisgdgel-eededWWKAAERIATQTELAYLG  1770
             + WW EAIR A+ VE    +L IS    +  +DEDWW A ER A+Q ELA++ 
Sbjct  535   DSWWREAIRVADDVENKQNSLGISNMENIDSDDEDWWMAVERTASQAELAHVN  587



>ref|XP_002513641.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49044.1| conserved hypothetical protein [Ricinus communis]
Length=601

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/608 (58%), Positives = 441/608 (73%), Gaps = 39/608 (6%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKR--------TTKSEDSAQKQSTEKILQTTAD  174
             MDDVDRLFECFKCG SPPQSA+ ERKR K         ++ S   +   +T+   +   D
Sbjct  1     MDDVDRLFECFKCGISPPQSAVRERKRNKSKLNQGNEVSSTSASPSPGSATQPKKKNAID  60

Query  175   ADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK  354
                S +N+ + K      S  K+  P+VFYGSPHGVPPKRP SLLRLL EIR+DL+E ++
Sbjct  61    PHLSADNVSTVKANN--FSRRKRISPIVFYGSPHGVPPKRPISLLRLLREIRIDLAEHQE  118

Query  355   --LSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPK  528
               L +E+WATFP+Q EA+ +A++ +N  VFSYQDH NG RRFLVS+Y +FW+RYK+M+ K
Sbjct  119   SNLRKEVWATFPRQNEALNFAKEHMNVHVFSYQDHHNGQRRFLVSSYGEFWRRYKNMDSK  178

Query  529   RRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWI  708
              RHHYEVIQE  PCHLYFDLEFNK+ NA+ NGDEMVDLLI  + + LL+KYS+EG+ +WI
Sbjct  179   FRHHYEVIQEDFPCHLYFDLEFNKRENAENNGDEMVDLLISLILEALLEKYSIEGNCEWI  238

Query  709   VELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDS  888
             VELDSST +KFSRHLI+R+PK AFKDNSH GAF +E+CSRI SS E D R++KLFV K S
Sbjct  239   VELDSSTAEKFSRHLILRIPKTAFKDNSHAGAFVSEICSRILSSREKDGRYKKLFVRKGS  298

Query  889   KSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICN  1068
              S    +Q F+D AVYSRNR FRLALSSKAGK+SVL+P+GRFKCK+M E++MFMASLICN
Sbjct  299   SSES-ASQPFIDTAVYSRNRVFRLALSSKAGKNSVLLPTGRFKCKDMCEEDMFMASLICN  357

Query  1069  IDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
             +DADCE+LLVCKMD DCV+TLHF+TE A  + +  FT Q       E+D S T   GKSP
Sbjct  358   MDADCEKLLVCKMDLDCVKTLHFDTE-ANYYSRRCFTTQ-------ENDASMTCTTGKSP  409

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP +D FVE IA+VGS+ GKIRSWYWFSEY L+VYSMS+NRYCERIGR+HKSNHV+YVVD
Sbjct  410   FPSLDKFVESIATVGSLSGKIRSWYWFSEYELMVYSMSRNRYCERIGRQHKSNHVIYVVD  469

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIP----------------GNVIAHCSVSFDLDSNNE  1560
             LRR  YYQKCHDPDC+GYRSPLRP+P                 N I   + + D  S N 
Sbjct  470   LRRAVYYQKCHDPDCQGYRSPLRPVPLYLIPDPSFSYASAQVANHIGLANGTLDYQSANN  529

Query  1561  GREHTPVATDANIVDSCKKE-WWLEAIRFAEQVEGIPKAleisgdgeleed-edWWKAAE  1734
               E   + ++   +DS  K+ WWLEA + A+ +E + K +E+S    + E+ ++WW A E
Sbjct  530   NHEGIMLFSEEYDIDSSSKDSWWLEAAKVADDIENMKKTMELSTLENIGEEDDNWWVAVE  589

Query  1735  RIATQTEL  1758
             R A+Q EL
Sbjct  590   RTASQAEL  597



>ref|XP_009375545.1| PREDICTED: DNA-directed primase/polymerase protein-like [Pyrus 
x bretschneideri]
Length=588

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/594 (59%), Positives = 438/594 (74%), Gaps = 16/594 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGK----RTTKSEDSAQKQSTEKILQTTADADHS  186
             MDDVDRLFECFKCG SPPQSA+ ERKR K    R +K+ + +   S E   + T++   S
Sbjct  1     MDDVDRLFECFKCGISPPQSALRERKRSKSDLKRRSKTPEVSSPGSAENTKKNTSELQRS  60

Query  187   VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPA-SLLRLLHEIRVDLSEQKKLS-  360
              +  G +  K    +  K+F P+VFYGSPHGVPPK+P+ S LRLL EIR+DL+ QK+L+ 
Sbjct  61    SDKSGPTSVKPNKFNRQKEFSPVVFYGSPHGVPPKKPSRSFLRLLREIRIDLAAQKRLTS  120

Query  361   -QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRH  537
              +E+W TFP+Q EAM++A+   N  VFSYQDH +G RRFLVSTY DFW+RYK+MNPK RH
Sbjct  121   RKEVWTTFPRQDEAMQFAKGHENVHVFSYQDHYSGQRRFLVSTYNDFWRRYKNMNPKFRH  180

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
             HYEVIQEGLPCHLYFDLEF+++ NAD+NGDEMVDLLI A+F+ LL+KYS+ G+ +WI+EL
Sbjct  181   HYEVIQEGLPCHLYFDLEFSRRDNADRNGDEMVDLLISAIFEALLEKYSIIGNKEWILEL  240

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSV  897
             DSS E KFSRHLII + K AFKDNSH GAF  E+CSRI S+ E D RF  LF+ KDS S 
Sbjct  241   DSSNEAKFSRHLIILIEKTAFKDNSHAGAFVTEICSRISSAKERDGRFGNLFIRKDSSSS  300

Query  898   GIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMS-EDEMFMASLICNID  1074
               P++LFVD AVY+RNRCFRLALSSKAGK+SVL+P+GRFK K M  E+EMFMASLICN+D
Sbjct  301   DSPSKLFVDTAVYTRNRCFRLALSSKAGKNSVLLPTGRFKAKKMQCEEEMFMASLICNLD  360

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
              DCE+LLVCK D DC++TLHF+TE+ +   +    PQ + LN   S  S TY +GKSPFP
Sbjct  361   VDCEKLLVCKPDLDCIKTLHFDTEVNRGLGKCYSWPQEYALNGCTSGASATYFLGKSPFP  420

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              +DAFVE +A++G+V GKIRSWYW SE+ L+VYSMS+NRYCERIGR+HKSNHV+YV DLR
Sbjct  421   ALDAFVESVATIGNVSGKIRSWYWLSEFALMVYSMSRNRYCERIGRQHKSNHVIYVADLR  480

Query  1435  RGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCK  1614
             R  YYQKCHDPDC+GYRS  RPIP  +I       D+   N+    + +  D  +  SC 
Sbjct  481   RASYYQKCHDPDCRGYRSASRPIPWEIIP------DMVYENKNDPESVLYGDEKMRSSCV  534

Query  1615  KE-WWLEAIRFAEQVEGIPKAleisgdgel-eededWWKAAERIATQTELAYLG  1770
              + WW EAI  A+ VE    +L IS    +  +DEDWW A ER A+Q ELA++ 
Sbjct  535   TDSWWREAIIVADDVENKQNSLGISNMENIDSDDEDWWMAVERTASQAELAHVN  588



>ref|XP_008362790.1| PREDICTED: DNA-directed primase/polymerase protein-like isoform 
X1 [Malus domestica]
Length=588

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/594 (59%), Positives = 436/594 (73%), Gaps = 16/594 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGK----RTTKSEDSAQKQSTEKILQTTADADHS  186
             MDDVDRLFECFKCG SPPQSA+ ERKR K    R +K+ + +   S E   + T++   S
Sbjct  1     MDDVDRLFECFKCGISPPQSALRERKRSKSDLKRRSKTPEVSSPGSAENTKKNTSELQLS  60

Query  187   VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPA-SLLRLLHEIRVDLSEQKKLS-  360
              +  G +  K    +  K+F P+VFYGSPHGVPPK+P+ S LRLL EIRVDL+ QK+L+ 
Sbjct  61    ADKSGPTSVKPNKFNRQKEFSPVVFYGSPHGVPPKKPSRSFLRLLREIRVDLAAQKRLTS  120

Query  361   -QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRH  537
              +E+W TFP+Q EAM++ +   N  VFSYQDH +G RRFLVSTY DFW+RYK+MNP+ RH
Sbjct  121   RKEVWTTFPRQDEAMQFVKGHENVHVFSYQDHYSGQRRFLVSTYNDFWRRYKNMNPRFRH  180

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
             HYEVIQEGLPCHLYFDLEF+++ NAD+NGDEMVDLLI A+F+ LL+KYS+ G+ +WI+EL
Sbjct  181   HYEVIQEGLPCHLYFDLEFSRRDNADRNGDEMVDLLISAIFEALLEKYSIIGNKEWILEL  240

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSV  897
             DSS E KFSRHLIIR+ K AFKDNSH GAF  E+CSRI S+ E D RF  LF+ KDS S 
Sbjct  241   DSSNEAKFSRHLIIRIEKTAFKDNSHAGAFVTEICSRISSAKERDGRFGNLFIRKDSSSS  300

Query  898   GIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMS-EDEMFMASLICNID  1074
               P++LFVD AVY+RNRCFRLALSSKAGK+SVL+P+GRFK   M  E+EMFMASLICN+D
Sbjct  301   DSPSKLFVDTAVYTRNRCFRLALSSKAGKNSVLLPTGRFKANKMQCEEEMFMASLICNLD  360

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
              DCE+LLVCK D DC++TLHF+TE+ +   +    PQ + LN   S  S TY +GKSPFP
Sbjct  361   VDCEKLLVCKPDLDCIKTLHFDTEVNRGLGKCYSWPQEYALNGCTSGASATYFLGKSPFP  420

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              +DAFVE +A++G+V GKIRSWYW SE+ L+VYSMS+NRYCERIGR+HKSNHV+YV DLR
Sbjct  421   ALDAFVESVATIGNVSGKIRSWYWLSEFALMVYSMSRNRYCERIGRQHKSNHVIYVADLR  480

Query  1435  RGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCK  1614
             R  YYQKCHDPDC+GYRS  RPIP  +I      +  D        + +  D  +  SC 
Sbjct  481   RASYYQKCHDPDCRGYRSASRPIPWEIIPDMVYEYKNDP------ESVLYGDEKMSSSCV  534

Query  1615  KE-WWLEAIRFAEQVEGIPKAleisgdgel-eededWWKAAERIATQTELAYLG  1770
              + WW EAIR A+ VE    +L IS    +  +DEDWW A ER A+Q ELA++ 
Sbjct  535   TDSWWREAIRVADDVENKQNSLGISNMENIDSDDEDWWMAVERTASQAELAHVN  588



>ref|XP_010314291.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Solanum lycopersicum]
Length=487

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/474 (70%), Positives = 383/474 (81%), Gaps = 10/474 (2%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKIL---------QTTA  171
             MDDVDRLFECFKCG SPPQSAI ERK+GK+T K  D+ +K ST   +         Q   
Sbjct  1     MDDVDRLFECFKCGISPPQSAIRERKKGKQTVKQSDTLEKLSTSSDIFSSRSKGKVQNAT  60

Query  172   DADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQK  351
             D +  ++N  SS  K +      Q  PLVFYGSPHGVPPKRPA LLRLL+EIRVD +EQ 
Sbjct  61    DVELCLQNTSSSTTKIQSLKKASQLSPLVFYGSPHGVPPKRPARLLRLLNEIRVDFNEQH  120

Query  352   KLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKR  531
             KLSQ+IWATFP+Q EAMKYA++  +ARVFSYQDH+NG RRFLVSTY++FW+RYK+MNPK 
Sbjct  121   KLSQDIWATFPRQDEAMKYAKEKNDARVFSYQDHVNGQRRFLVSTYKEFWRRYKTMNPKF  180

Query  532   RHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
             RHHYEVIQEGLPCHLYFDLEFNK+ N DKN DEMVDLLI  +FD + +KYSLEG+ DW+V
Sbjct  181   RHHYEVIQEGLPCHLYFDLEFNKRENPDKNEDEMVDLLIQVIFDAVKEKYSLEGNDDWVV  240

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSK  891
             ELDSS  +KFSRHLIIR PK AFKDNSH GAF  E+CSRI S SE DER RKLF+SKDS 
Sbjct  241   ELDSSNAEKFSRHLIIRFPKAAFKDNSHAGAFVTEICSRIISISEHDERLRKLFISKDSS  300

Query  892   SVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNI  1071
             S  IP QLFVD AVYSRNRCFRLALSSKAGKSSVL+PSGRFKCK+MSE+E+FMASLICN+
Sbjct  301   STNIPFQLFVDKAVYSRNRCFRLALSSKAGKSSVLLPSGRFKCKDMSEEEVFMASLICNM  360

Query  1072  DADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFES-DPSRTYLMGKSP  1248
             DAD E+LL+CKMD DC++ L F+TE  +SFQ+ S     F+LN   S DPS+TYL GKSP
Sbjct  361   DADFEKLLICKMDLDCMKALQFDTESTRSFQRHSAVSSNFDLNACRSDDPSKTYLTGKSP  420

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNH  1410
             FP +D FVE +AS+G++PGKIRSWYWFSEY L+VYSMS+NR+CERIGR+HKSNH
Sbjct  421   FPYLDVFVESVASIGNIPGKIRSWYWFSEYALMVYSMSRNRFCERIGRQHKSNH  474



>ref|XP_010671594.1| PREDICTED: DNA-directed primase/polymerase protein [Beta vulgaris 
subsp. vulgaris]
Length=604

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/593 (57%), Positives = 433/593 (73%), Gaps = 12/593 (2%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSA-----QKQSTEKILQTTADADH  183
             MDDVDRLFECFKCG SPPQSA  E+K      K ++S+        S  +  +   D   
Sbjct  1     MDDVDRLFECFKCGVSPPQSAFREKKTSASRLKQDNSSLNSTKSPSSAGQAKRICPDPCQ  60

Query  184   SVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLS-  360
              +++LGS   K      G+Q  P VFYGSPHGVPPKRP+SLLR+L EI +D + ++K + 
Sbjct  61    RLDSLGSVTNKTNKLIAGRQISPGVFYGSPHGVPPKRPSSLLRVLREIHLDHAGRRKSNS  120

Query  361   -QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRH  537
              +++WATFPKQ +AMK+A++  N R+FSYQDH +G RRFLVSTY++FW+RYK+M+   RH
Sbjct  121   RKQMWATFPKQDDAMKFAKEQANVRIFSYQDHFSGQRRFLVSTYQEFWRRYKNMDSTFRH  180

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
             HYEVIQEGLPCHLYFDLEFN+  N DK+G++MVDLL++ +F+   +KY ++G  DW+VEL
Sbjct  181   HYEVIQEGLPCHLYFDLEFNRLENTDKDGNQMVDLLLLVIFEAFYEKYQIQGEEDWVVEL  240

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSV  897
             DSSTE KFSRHL++R+PK AFKDN H GAF +E+CSRI+S+ E D RF ++F+SKDS S 
Sbjct  241   DSSTEAKFSRHLVLRIPKAAFKDNIHAGAFVSEICSRIHSAREKDARFEQIFISKDSSSA  300

Query  898   GIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDA  1077
             G   QLFVDNAVYSRNRCFRLALSSKAGK+SVL P+GRFKC++M E+++FMASLICNID 
Sbjct  301   GPSLQLFVDNAVYSRNRCFRLALSSKAGKTSVLRPTGRFKCRDMCEEDVFMASLICNIDD  360

Query  1078  DCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPP  1257
             DCE+LLVCKM+ DC++TL F+TE+  + ++ +   Q   L+   SD S+TYL G SPFP 
Sbjct  361   DCEKLLVCKMELDCIKTLQFDTEVNYTCRRPANILQELTLHTRGSDISQTYLTGASPFPA  420

Query  1258  VDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRR  1437
             +DAF+E +AS GSV GKIRSWYWFSEYGL+VYSMSK+RYC RIGREHKSNHVMYVVDL+ 
Sbjct  421   LDAFIESLASFGSVTGKIRSWYWFSEYGLLVYSMSKSRYCGRIGREHKSNHVMYVVDLQW  480

Query  1438  GDYYQKCHDPDCKGYRSPLRPIPGNVIAHC-----SVSFDLDSNNEGREHTPVATDANIV  1602
               YYQKC+DPDC+GYRSP RPIP ++I        + + D  ++ +     P   ++ I 
Sbjct  481   ALYYQKCYDPDCRGYRSPSRPIPNDLIPEIPSLGHTGTIDGSADIDQENLVPGGHESLID  540

Query  1603  DSCKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELA  1761
                   WW EA++ A+ VE +      S D   E+D++WW A ER A+Q EL 
Sbjct  541   GDSDDSWWHEAVKVADNVENMGDLFISSMDNATEDDDEWWIAVERTASQAELT  593



>gb|AES75632.2| DNA primase [Medicago truncatula]
Length=632

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/606 (57%), Positives = 432/606 (71%), Gaps = 26/606 (4%)
 Frame = +1

Query  25    DVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQ----------TTAD  174
             DVDRLF CFKCG SPP+SA+IERKR KR  ++   A +   +  +            T +
Sbjct  12    DVDRLFACFKCGISPPKSALIERKRRKRKLENNGFAAESPNQGSIGREEKTPLSRIKTTN  71

Query  175   ADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK  354
              + S+E L S+  K K  SN KQ  P+VFYGSPHGVPPK+P  L RLLHEIR+DLS++ K
Sbjct  72    LESSIEKLKSAIAKTKSCSNRKQISPVVFYGSPHGVPPKKPTRLWRLLHEIRIDLSQRNK  131

Query  355   --LSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPK  528
               + +E+W TFP+Q EA+ +A+   +  +FSYQ+H NG RRFLVSTY +FW+RYK+M+ K
Sbjct  132   QNIRKEVWFTFPRQDEAINFAKGQEDVHLFSYQNHFNGQRRFLVSTYTEFWRRYKNMDSK  191

Query  529   RRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWI  708
              RHHYEVIQEGLPCHLYFDLEFN+K N  KNGDEMVDLLI  V + L +KY + G HDWI
Sbjct  192   FRHHYEVIQEGLPCHLYFDLEFNRKVNVGKNGDEMVDLLISVVLEALHEKYEIHGDHDWI  251

Query  709   VELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDS  888
             VELDSSTEDKFSRHLIIR+PK AFKDNSH GAF +E+CSRI ++   D+ + KLF++KDS
Sbjct  252   VELDSSTEDKFSRHLIIRIPKAAFKDNSHAGAFVSEICSRILNARGKDKSYEKLFIAKDS  311

Query  889   KSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICN  1068
              +    +QLFVD AVY+RNRCFRL LSSKAGKSS+L+P+ RFKCKN+SE++MFMASLICN
Sbjct  312   STNESASQLFVDTAVYTRNRCFRLHLSSKAGKSSILLPTERFKCKNLSEEDMFMASLICN  371

Query  1069  IDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
             +DADC +LLVCK D DCV+TLHF+TE+  +      +   F LN   SD S TY MGKSP
Sbjct  372   MDADCGKLLVCKPDLDCVKTLHFDTELNGNVGHSVQSHTEFALNTCTSDVSTTYFMGKSP  431

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP ++ F+  +ASVG++PGKI SWY FSE+GL+VYSM KNRYCERIGR HKSN+V+YVVD
Sbjct  432   FPRLEEFILSVASVGNIPGKIHSWYLFSEFGLMVYSMIKNRYCERIGRPHKSNNVIYVVD  491

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSV------SFDLDSNNEGREHTPVATD  1590
             LR   YYQKCHDPDC+GYRS  RPIP +V+A+ SV        D   + + + H P    
Sbjct  492   LRMAVYYQKCHDPDCRGYRSSSRPIPVHVLANPSVVIGSSGMLDDKHSEDEQGHQPNDNK  551

Query  1591  ANIV-------DSCKKEWWLEAIRFAEQVEGIPKAlei-sgdgeleededWWKAAERIAT  1746
              N +       D+    WWLEAI+  E+VE    A E+ S +   + DE+WW A E  A+
Sbjct  552   PNFLQYEDTVEDNYSDSWWLEAIKVVEEVENKKTATELCSKEAIDDGDEEWWLAVESTAS  611

Query  1747  QTELAY  1764
             Q EL Y
Sbjct  612   QVELTY  617



>ref|XP_007038836.1| DNA primases isoform 3 [Theobroma cacao]
 gb|EOY23337.1| DNA primases isoform 3 [Theobroma cacao]
Length=506

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/500 (66%), Positives = 387/500 (77%), Gaps = 15/500 (3%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQK----------QSTEKILQ  162
             ++MDDVDRLFECFKCG SPPQSA+ ERKR K     E+SA+K           S E+  +
Sbjct  8     STMDDVDRLFECFKCGISPPQSAVRERKRRKSKLNQENSARKVSASPCTPSLGSAEQGKE  67

Query  163   TTADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLS  342
             T  +A  SV    S+  K    S GKQ  P++FYGSPHG+PPKRP SLLRLLHEIR+DLS
Sbjct  68    TPNNAQLSVGKRVSTMVKVGKFSRGKQISPVIFYGSPHGIPPKRPLSLLRLLHEIRIDLS  127

Query  343   EQKK--LSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKS  516
             EQ+K  L  E+WATFP+Q EA+K+A+   NARVFSYQDH +G RR+L STYE+FWKRYK 
Sbjct  128   EQEKSNLRTEVWATFPRQDEAVKFAKGHANARVFSYQDHYSGQRRYLASTYEEFWKRYKI  187

Query  517   MNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGS  696
             M+ K RHHYEVIQEG PCHLYFDLEFNK+ N  ++GDEMVDLLI  + + LL+KYS+ G+
Sbjct  188   MDSKLRHHYEVIQEGFPCHLYFDLEFNKRDNVGRDGDEMVDLLISVILEALLEKYSINGN  247

Query  697   HDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFV  876
              DW+VELDSSTE+KFSRHLI+R+PK AFKDNSHVGAF AE+CSRI S+ E D+RF  L+V
Sbjct  248   QDWVVELDSSTEEKFSRHLIMRIPKTAFKDNSHVGAFVAEICSRIASARERDKRFETLYV  307

Query  877   SKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMAS  1056
                S S   P QLFVD AVYSRNRCFRLALSSKAGK+S L+P+GRFKCK M E +MFMAS
Sbjct  308   KNASTSAESPGQLFVDTAVYSRNRCFRLALSSKAGKASFLLPTGRFKCKEMGEVDMFMAS  367

Query  1057  LICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLM  1236
             LICN++ DCE+ LVCKM+ DCV+TLHF TE+  +F +    PQ    N + SD S TYL 
Sbjct  368   LICNMEVDCEKFLVCKMELDCVKTLHFETEVTSNFGRYCGAPQE---NTYISDVSTTYLT  424

Query  1237  GKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
             GKSPFP +D F+E IAS  +  GKIRSWYWFSEYGLI+YSMS+NRYCERIGREHKSNHVM
Sbjct  425   GKSPFPSLDEFIESIASTRNASGKIRSWYWFSEYGLIIYSMSRNRYCERIGREHKSNHVM  484

Query  1417  YVVDLRRGDYYQKCHDPDCK  1476
             YVVD+RR  YYQKC+DPDCK
Sbjct  485   YVVDMRRAAYYQKCYDPDCK  504



>ref|XP_007038835.1| DNA primases isoform 2 [Theobroma cacao]
 gb|EOY23336.1| DNA primases isoform 2 [Theobroma cacao]
Length=538

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/534 (62%), Positives = 401/534 (75%), Gaps = 25/534 (5%)
 Frame = +1

Query  229   SNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK--LSQEIWATFPKQVEAM  402
             S GKQ  P++FYGSPHG+PPKRP SLLRLLHEIR+DLSEQ+K  L  E+WATFP+Q EA+
Sbjct  8     SRGKQISPVIFYGSPHGIPPKRPLSLLRLLHEIRIDLSEQEKSNLRTEVWATFPRQDEAV  67

Query  403   KYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYF  582
             K+A+   NARVFSYQDH +G RR+L STYE+FWKRYK M+ K RHHYEVIQEG PCHLYF
Sbjct  68    KFAKGHANARVFSYQDHYSGQRRYLASTYEEFWKRYKIMDSKLRHHYEVIQEGFPCHLYF  127

Query  583   DLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIR  762
             DLEFNK+ N  ++GDEMVDLLI  + + LL+KYS+ G+ DW+VELDSSTE+KFSRHLI+R
Sbjct  128   DLEFNKRDNVGRDGDEMVDLLISVILEALLEKYSINGNQDWVVELDSSTEEKFSRHLIMR  187

Query  763   LPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSR  942
             +PK AFKDNSHVGAF AE+CSRI S+ E D+RF  L+V   S S   P QLFVD AVYSR
Sbjct  188   IPKTAFKDNSHVGAFVAEICSRIASARERDKRFETLYVKNASTSAESPGQLFVDTAVYSR  247

Query  943   NRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLVCKMDSDCV  1122
             NRCFRLALSSKAGK+S L+P+GRFKCK M E +MFMASLICN++ DCE+ LVCKM+ DCV
Sbjct  248   NRCFRLALSSKAGKASFLLPTGRFKCKEMGEVDMFMASLICNMEVDCEKFLVCKMELDCV  307

Query  1123  RTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVP  1302
             +TLHF TE+  +F +    PQ    N + SD S TYL GKSPFP +D F+E IAS  +  
Sbjct  308   KTLHFETEVTSNFGRYCGAPQE---NTYISDVSTTYLTGKSPFPSLDEFIESIASTRNAS  364

Query  1303  GKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGY  1482
             GKIRSWYWFSEYGLI+YSMS+NRYCERIGREHKSNHVMYVVD+RR  YYQKC+DPDCKGY
Sbjct  365   GKIRSWYWFSEYGLIIYSMSRNRYCERIGREHKSNHVMYVVDMRRAAYYQKCYDPDCKGY  424

Query  1483  RSPLRPIPGNVIAHCSVSFD------------------LDSNNEGREHTPVATDANIVDS  1608
             RSP+RPIP + I   S  FD                    +NN GR     + +++I D 
Sbjct  425   RSPMRPIPMDCIPDSSFFFDSRQIVDDNGLTSNDLEYQFVNNNNGRV-LLYSNESDIDDC  483

Query  1609  CKKEWWLEAIRFAEQVEGIP-KAleisgdgeleededWWKAAERIATQTELAYL  1767
              K  WWLEAI+ A+ ++G P + +    +   +ED+DWW A ER A+Q EL +L
Sbjct  484   TKDSWWLEAIKVADNIDGKPERLMFNDMENMSDEDDDWWVAVERTASQAELKHL  537



>ref|XP_010537140.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Tarenaya hassleriana]
Length=571

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/579 (59%), Positives = 427/579 (74%), Gaps = 25/579 (4%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVE  192
             N+MDDVDRLF CFKCG SPP SA+ ERKR K+    E+   +       +  + A  S  
Sbjct  8     NAMDDVDRLFRCFKCGISPPPSAMRERKRSKKELNKENITPET------RKYSAASSSPG  61

Query  193   NLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLS-QEI  369
               G S  +    S GKQ  P+VFYGSP+GVPPKRP SLLRLLHEIR+DLSEQ + + + +
Sbjct  62    LGGESGSRTAKLSGGKQISPVVFYGSPNGVPPKRPLSLLRLLHEIRIDLSEQNESNFRGV  121

Query  370   WATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEV  549
             WATFP+Q EAMK+ +   N RVFSYQDH +G RRFLVSTY +FWKRY S++P+ RHHYEV
Sbjct  122   WATFPRQDEAMKFTKGHENVRVFSYQDHFSGQRRFLVSTYGEFWKRYNSIDPRHRHHYEV  181

Query  550   IQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSST  729
             IQEGLPCH+YFDLEF++K NA +N DEMVD+LI  + + L +KYS++G  DW+VELDSST
Sbjct  182   IQEGLPCHMYFDLEFSQKENAGRNVDEMVDILISVIMEALCEKYSIKGQEDWVVELDSST  241

Query  730   EDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPA  909
             +DKFSRHLIIR+PK+AFKDNSHVGAF  E+CSRI S+ E D R +KLFV K+S      +
Sbjct  242   KDKFSRHLIIRIPKVAFKDNSHVGAFVGEICSRILSTKEQDGRLQKLFVHKESNDSS--S  299

Query  910   QLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCER  1089
             QLFVD AVYSRNRCFRLALSSKAGK+SVL+P+ RFKCK+M ++++FM SLICN+ +DCE+
Sbjct  300   QLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTRRFKCKDMGDEDVFMTSLICNLGSDCEK  359

Query  1090  LLVCKMDSDCVRTLHFNTEIAQS-FQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDA  1266
             LLVCKM+ DC++TL F+TE+  S   +     Q F+++   +D S +Y  GKSPFP +D 
Sbjct  360   LLVCKMELDCMKTLRFDTEVNNSNLVRHQNVSQKFKVDACLNDMSASYCEGKSPFPLLDT  419

Query  1267  FVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDY  1446
             F+E IAS G+V GKIR WYWFSE+GLIVYSMS +RYCERIGREHKSNHVMY+VDLRRG Y
Sbjct  420   FIESIASTGNVTGKIRCWYWFSEHGLIVYSMSSSRYCERIGREHKSNHVMYIVDLRRGVY  479

Query  1447  YQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKKEWW  1626
             YQKC+DPDC+ YRSP+R +P + I             EG ++T   T+A +    K  WW
Sbjct  480   YQKCYDPDCRDYRSPIRSVPDSCIP------------EGEDYT--ETEAGLDSGSKGSWW  525

Query  1627  LEAIRFAEQVEGIPKAleisgdgeleed-edWWKAAERI  1740
             LEA++FA+ +E  PKAL++      EE+ +DWW  AE +
Sbjct  526   LEAVKFADDLENKPKALQLHSLEIHEEEDDDWWAQAEEL  564



>ref|XP_010537139.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Tarenaya hassleriana]
Length=572

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/580 (58%), Positives = 426/580 (73%), Gaps = 26/580 (4%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVE  192
             N+MDDVDRLF CFKCG SPP SA+ ERKR K+    E+   +       +  + A  S  
Sbjct  8     NAMDDVDRLFRCFKCGISPPPSAMRERKRSKKELNKENITPET------RKYSAASSSPG  61

Query  193   NLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK--LSQE  366
               G S  +    S GKQ  P+VFYGSP+GVPPKRP SLLRLLHEIR+DLSEQ +    + 
Sbjct  62    LGGESGSRTAKLSGGKQISPVVFYGSPNGVPPKRPLSLLRLLHEIRIDLSEQNESNFRRG  121

Query  367   IWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYE  546
             +WATFP+Q EAMK+ +   N RVFSYQDH +G RRFLVSTY +FWKRY S++P+ RHHYE
Sbjct  122   VWATFPRQDEAMKFTKGHENVRVFSYQDHFSGQRRFLVSTYGEFWKRYNSIDPRHRHHYE  181

Query  547   VIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSS  726
             VIQEGLPCH+YFDLEF++K NA +N DEMVD+LI  + + L +KYS++G  DW+VELDSS
Sbjct  182   VIQEGLPCHMYFDLEFSQKENAGRNVDEMVDILISVIMEALCEKYSIKGQEDWVVELDSS  241

Query  727   TEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIP  906
             T+DKFSRHLIIR+PK+AFKDNSHVGAF  E+CSRI S+ E D R +KLFV K+S      
Sbjct  242   TKDKFSRHLIIRIPKVAFKDNSHVGAFVGEICSRILSTKEQDGRLQKLFVHKESNDSS--  299

Query  907   AQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCE  1086
             +QLFVD AVYSRNRCFRLALSSKAGK+SVL+P+ RFKCK+M ++++FM SLICN+ +DCE
Sbjct  300   SQLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTRRFKCKDMGDEDVFMTSLICNLGSDCE  359

Query  1087  RLLVCKMDSDCVRTLHFNTEIAQS-FQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVD  1263
             +LLVCKM+ DC++TL F+TE+  S   +     Q F+++   +D S +Y  GKSPFP +D
Sbjct  360   KLLVCKMELDCMKTLRFDTEVNNSNLVRHQNVSQKFKVDACLNDMSASYCEGKSPFPLLD  419

Query  1264  AFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGD  1443
              F+E IAS G+V GKIR WYWFSE+GLIVYSMS +RYCERIGREHKSNHVMY+VDLRRG 
Sbjct  420   TFIESIASTGNVTGKIRCWYWFSEHGLIVYSMSSSRYCERIGREHKSNHVMYIVDLRRGV  479

Query  1444  YYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKKEW  1623
             YYQKC+DPDC+ YRSP+R +P + I             EG ++T   T+A +    K  W
Sbjct  480   YYQKCYDPDCRDYRSPIRSVPDSCIP------------EGEDYT--ETEAGLDSGSKGSW  525

Query  1624  WLEAIRFAEQVEGIPKAleisgdgeleed-edWWKAAERI  1740
             WLEA++FA+ +E  PKAL++      EE+ +DWW  AE +
Sbjct  526   WLEAVKFADDLENKPKALQLHSLEIHEEEDDDWWAQAEEL  565



>ref|XP_006422047.1| hypothetical protein CICLE_v10006841mg [Citrus clementina]
 ref|XP_006490622.1| PREDICTED: coiled-coil domain-containing protein 111-like [Citrus 
sinensis]
 gb|ESR35287.1| hypothetical protein CICLE_v10006841mg [Citrus clementina]
Length=607

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/614 (58%), Positives = 431/614 (70%), Gaps = 41/614 (7%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKIL----------QTT  168
             MDDVDRLF+CFKCG SPP SA+ ERKR K   K + S Q+ ++   L          ++ 
Sbjct  1     MDDVDRLFQCFKCGISPPPSALRERKRSKNRLKQDCSKQEVASSSGLFSPGSAGNGHKSA  60

Query  169   ADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQ  348
              D   S E LGSS  K K  ++GKQ  P+VFYG+PHGVPPKRP SLLRLL EIRVDLS++
Sbjct  61    TDVHFSSEKLGSSTVKAKGSNSGKQISPVVFYGTPHGVPPKRPLSLLRLLREIRVDLSKE  120

Query  349   --KKLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMN  522
                 L +EIWATFP+Q EA+ +A+   N R+FSYQDH NG RRFLVSTY++FW+RYK M+
Sbjct  121   DSSNLGKEIWATFPRQNEAIMFAKGHANVRIFSYQDHYNGQRRFLVSTYKEFWQRYKRMD  180

Query  523   PKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHD  702
              K RHHYEVIQEGLPCHLYFDLEFNK+ N + +GDEMVDLLI    + L  KYS++G  D
Sbjct  181   SKFRHHYEVIQEGLPCHLYFDLEFNKRVNPENHGDEMVDLLISVTLEALFDKYSIKGDED  240

Query  703   WIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSK  882
             WIVELDSSTE+KFSRHLIIR+PK AFKDNSH GAF AE+C+RI S+ E + +F  LFV K
Sbjct  241   WIVELDSSTEEKFSRHLIIRIPKTAFKDNSHAGAFVAEICARIKSAREREAKFESLFVMK  300

Query  883   DSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLI  1062
             DS S    ++LFVD AVYSRNRCFR+ALSSKAGK S L+PS RFKCK M E++MFMASLI
Sbjct  301   DSSSTESESELFVDTAVYSRNRCFRIALSSKAGKKSFLLPSERFKCKGMCEEDMFMASLI  360

Query  1063  CNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGK  1242
             CN+DADCE+LLVCKM+ DCV+TL F+TE+  +  +     Q   L+   S       +GK
Sbjct  361   CNMDADCEKLLVCKMELDCVKTLQFDTEVHDNLGKYCRASQECALSACSS-------VGK  413

Query  1243  SPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYV  1422
             SPFP +D FVE IAS G+ PGKIRSWYWFSEYGLIVYSMS+NRYCERIGREHKSNHVMYV
Sbjct  414   SPFPALDKFVECIASTGNDPGKIRSWYWFSEYGLIVYSMSRNRYCERIGREHKSNHVMYV  473

Query  1423  VDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVI------------------AHCSVSFDLD  1548
             VDLRR  YYQKCHDPDC+GYRSPLRPIP + I                  +H +  +   
Sbjct  474   VDLRRAVYYQKCHDPDCRGYRSPLRPIPMDPIPDLPFSSDSEHMVHHGGSSHNNTEYQFV  533

Query  1549  SNNEGREHTPVATDANIVDS-CKKEWWLEAIRFAEQVEGIP-KAleisgdgeleededWW  1722
              N+E  +H  +  D    +S CK  WW+EA++FA  VE         +     +ED++WW
Sbjct  534   KNDE--KHDLLYDDERDTESYCKDSWWIEAVKFANDVENKKMTCELGNLANNDDEDDNWW  591

Query  1723  KAAERIATQTELAY  1764
                E+ A+  EL Y
Sbjct  592   MVVEQTASHAELMY  605



>ref|NP_001154775.1| DNA primase [Arabidopsis thaliana]
 gb|AED96263.1| DNA primase [Arabidopsis thaliana]
Length=614

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/595 (57%), Positives = 429/595 (72%), Gaps = 22/595 (4%)
 Frame = +1

Query  4     VQDNSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSE-DSAQKQSTEKILQTTADAD  180
             +  NSMDDVDRLF+CFKCG SPP SA+ E+KR K+   SE DS       ++   +  + 
Sbjct  5     LSSNSMDDVDRLFQCFKCGISPPASAMREKKRSKKMLNSEYDSPVTCKKLQLSSLSRLSG  64

Query  181   HSVEN---------LGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRV  333
                E             S  +    S G+QF P+VFYGSP+GVPPK+P SLLRLL EIR+
Sbjct  65    KRGERNQIDGSVSVDSVSGSRDVKKSVGRQFSPIVFYGSPNGVPPKKPLSLLRLLREIRI  124

Query  334   DLSEQKKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKR  507
             DLSE++K    + +WATFP+Q EA+K+ ++  N R+FSYQDH +G RRFLVS+YE+FWKR
Sbjct  125   DLSEERKAISRKGVWATFPRQEEAIKFEKRHDNVRIFSYQDHFSGQRRFLVSSYEEFWKR  184

Query  508   YKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSL  687
             Y SM+P+ RHHYEVIQEGLPCH+YFDLEFN+K N  KN DEMVD+LI  + + L +KY++
Sbjct  185   YLSMDPRHRHHYEVIQEGLPCHMYFDLEFNQKENEGKNVDEMVDILISVILEALREKYAI  244

Query  688   EGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRK  867
             EG  DWIVELDSST+DKFSRH+I+ +PK+AFKDNSHVGAF  E+CSRI ++ ETDER RK
Sbjct  245   EGQEDWIVELDSSTKDKFSRHVIVIIPKVAFKDNSHVGAFVGELCSRIVNAKETDERLRK  304

Query  868   LFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMF  1047
             LFV K++      + LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M E ++F
Sbjct  305   LFVHKEANDSA--SLLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTGRFKCKDMGERDVF  362

Query  1048  MASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRT  1227
             M SLICN+++DCE+LLVCKM+SDC++TL F+TE+  +        Q F+LN   SD S +
Sbjct  363   MTSLICNVESDCEKLLVCKMESDCMKTLCFDTEVNSNNLVRDQNAQKFQLNASTSDMSTS  422

Query  1228  YLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSN  1407
             Y  GKSPFP +D F+E  AS G+VPGKIR WYWFSE GLIVYSM +NRYCERIGREHKSN
Sbjct  423   YFGGKSPFPQLDQFIESTASTGNVPGKIRCWYWFSEDGLIVYSMLRNRYCERIGREHKSN  482

Query  1408  HVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNN-------EGR  1566
             HVMY+VDLRRG YYQKC+DPDC+ YRSP+RP+P + +    V +   + N       EG 
Sbjct  483   HVMYIVDLRRGIYYQKCYDPDCRDYRSPIRPVPDSYLPEDMVYYQGATQNLCDNLYSEGE  542

Query  1567  EHTPVATDANIVDSCKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKAA  1731
              H     D +   S +  WWLEA++ A+ +E  PK LE       EED+DWW AA
Sbjct  543   CHVDKECDPDSAAS-RGSWWLEAVKVADDLESKPKTLEPLTWENYEEDDDWWVAA  596



>ref|XP_004515987.1| PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain-containing 
protein 111-like [Cicer arietinum]
Length=634

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/618 (56%), Positives = 424/618 (69%), Gaps = 40/618 (6%)
 Frame = +1

Query  25    DVDRLFECFKCGFSPPQSAI-------------------IERKRGKRTTKSEDSAQKQST  147
             DVDRLF CFKCG +PP+SA+                   +     +R+   E+     S 
Sbjct  12    DVDRLFACFKCGLTPPKSALNERKRRKRKLEKEISKNELVSESPNQRSIGREEKTPLSSC  71

Query  148   EKILQTTADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEI  327
               I  T  + + S+E L S+  K K   N KQF P+VFYGSPHGVPPK+P  L RLLHE+
Sbjct  72    --IKATNVELESSIEKLKSAIAKTKSCGNRKQFSPVVFYGSPHGVPPKKPTRLWRLLHEM  129

Query  328   RVDLSEQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFW  501
             R+DLS+Q KL+  +E+W TFP+Q EAMK+A+   +  +FSYQDH NG RRFLVSTY +FW
Sbjct  130   RIDLSQQNKLNRRKEVWFTFPRQEEAMKFAKGQEDVHLFSYQDHFNGQRRFLVSTYTEFW  189

Query  502   KRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKY  681
             +RYK+M+ K RHHYEVIQEGLPCHLYFDLEFNK+ N  KNGDEMVDLL   V   L +KY
Sbjct  190   RRYKNMDSKFRHHYEVIQEGLPCHLYFDLEFNKRVNIGKNGDEMVDLLTSVVLKALHEKY  249

Query  682   SLEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERF  861
              + G HDWIVELDSSTEDKFSRHLIIR+P +AFKDNSH GAF  E+C+RI +    D  F
Sbjct  250   EIHGDHDWIVELDSSTEDKFSRHLIIRIPTVAFKDNSHAGAFVTEICTRILNERGKDTNF  309

Query  862   RKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDE  1041
              KLF++KDS +     QLFVD AVY+RNRCFRL LSSKAGKSS+L+P+ RFKCKN+SE++
Sbjct  310   EKLFIAKDSSTNESADQLFVDTAVYTRNRCFRLHLSSKAGKSSILLPTERFKCKNLSEED  369

Query  1042  MFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPS  1221
             +FMASLICN+D DC +LLVCK D DCV+TLH++TE+  +          F LN   SD S
Sbjct  370   LFMASLICNMDVDCGKLLVCKPDLDCVKTLHYDTELNCNAGNSVHIHPEFTLNTCTSDVS  429

Query  1222  RTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHK  1401
              TY MG SPFP +D F+  +ASVG++PGKI SWY FSE+GL+VYSM+KNRYCERIGR+HK
Sbjct  430   TTYFMGNSPFPFLDEFILSVASVGNIPGKIHSWYLFSEFGLMVYSMTKNRYCERIGRQHK  489

Query  1402  SNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDL-----DSNNEGR  1566
             SN+V+YVVDLRR  YYQKCHDPDC+G+RS  R IP + +++ SV         D   EG 
Sbjct  490   SNNVIYVVDLRRAVYYQKCHDPDCRGFRSSDRLIPVHALSNRSVVIGSSGMLDDKQTEGD  549

Query  1567  E--HTPVATDA---------NIVDSCKKEWWLEAIRFAEQVEGIPKAleisgdgel-eed  1710
             E  H PV  +           + D+    WWLEAI+  E VE    A ++S   E+ + D
Sbjct  550   ECGHQPVDNNNKPNFLQYEDTVEDNSSDSWWLEAIKVVEDVENKKTATKLSTKEEIDDGD  609

Query  1711  edWWKAAERIATQTELAY  1764
             E+WW AAER A+Q EL Y
Sbjct  610   EEWWLAAERTASQAELTY  627



>ref|XP_003619414.1| Defensin/CCP-like protein [Medicago truncatula]
Length=687

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/580 (57%), Positives = 413/580 (71%), Gaps = 34/580 (6%)
 Frame = +1

Query  25    DVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQ----------TTAD  174
             DVDRLF CFKCG SPP+SA+IERKR KR  ++   A +   +  +            T +
Sbjct  12    DVDRLFACFKCGISPPKSALIERKRRKRKLENNGFAAESPNQGSIGREEKTPLSRIKTTN  71

Query  175   ADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK  354
              + S+E L S+  K K  SN KQ  P+VFYGSPHGVPPK+P  L RLLHEIR+DLS++ K
Sbjct  72    LESSIEKLKSAIAKTKSCSNRKQISPVVFYGSPHGVPPKKPTRLWRLLHEIRIDLSQRNK  131

Query  355   LS-----------QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFW  501
              +           +E+W TFP+Q EA+ +A+   +  +FSYQ+H NG RRFLVSTY +FW
Sbjct  132   QNIRCFSEADFYVKEVWFTFPRQDEAINFAKGQEDVHLFSYQNHFNGQRRFLVSTYTEFW  191

Query  502   KRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKY  681
             +RYK+M+ K RHHYEVIQEGLPCHLYFDLEFN+K N  KNGDEMVDLLI  V + L +KY
Sbjct  192   RRYKNMDSKFRHHYEVIQEGLPCHLYFDLEFNRKVNVGKNGDEMVDLLISVVLEALHEKY  251

Query  682   SLEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERF  861
              + G HDWIVELDSSTEDKFSRHLIIR+PK AFKDNSH GAF +E+CSRI ++   D+ +
Sbjct  252   EIHGDHDWIVELDSSTEDKFSRHLIIRIPKAAFKDNSHAGAFVSEICSRILNARGKDKSY  311

Query  862   RKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDE  1041
              KLF++KDS +    +QLFVD AVY+RNRCFRL LSSKAGKSS+L+P+ RFKCKN+SE++
Sbjct  312   EKLFIAKDSSTNESASQLFVDTAVYTRNRCFRLHLSSKAGKSSILLPTERFKCKNLSEED  371

Query  1042  MFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPS  1221
             MFMASLICN+DADC +LLVCK D DCV+TLHF+TE+  +      +   F LN   SD S
Sbjct  372   MFMASLICNMDADCGKLLVCKPDLDCVKTLHFDTELNGNVGHSVQSHTEFALNTCTSDVS  431

Query  1222  RTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHK  1401
              TY MGKSPFP ++ F+  +ASVG++PGKI SWY FSE+GL+VYSM KNRYCERIGR HK
Sbjct  432   TTYFMGKSPFPRLEEFILSVASVGNIPGKIHSWYLFSEFGLMVYSMIKNRYCERIGRPHK  491

Query  1402  SNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSV------SFDLDSNNEG  1563
             SN+V+YVVDLR   YYQKCHDPDC+GYRS  RPIP +V+A+ SV        D   + + 
Sbjct  492   SNNVIYVVDLRMAVYYQKCHDPDCRGYRSSSRPIPVHVLANPSVVIGSSGMLDDKHSEDE  551

Query  1564  REHTPVATDANIV-------DSCKKEWWLEAIRFAEQVEG  1662
             + H P     N +       D+    WWLEAI+  E+VE 
Sbjct  552   QGHQPNDNKPNFLQYEDTVEDNYSDSWWLEAIKVVEEVEN  591



>ref|XP_006372378.1| hypothetical protein POPTR_0017s01050g [Populus trichocarpa]
 gb|ERP50175.1| hypothetical protein POPTR_0017s01050g [Populus trichocarpa]
Length=538

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/603 (56%), Positives = 419/603 (69%), Gaps = 84/603 (14%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             M+DVDRLFECFKCG S                                            
Sbjct  1     MEDVDRLFECFKCGIS--------------------------------------------  16

Query  199   GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK--LSQEIW  372
                 P RK      Q  P+VFYGSPHGVPPKRP  LLRLL EIR+DL+EQ+K  LS+E+W
Sbjct  17    ----PPRK------QISPVVFYGSPHGVPPKRPIGLLRLLREIRIDLAEQQKSQLSKEVW  66

Query  373   ATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVI  552
             ATFP+Q EAM +A++  + R+FSYQDH NG RRFLVSTY +FW+RYK+M+ K RHHYEVI
Sbjct  67    ATFPRQNEAMNFAKEHADVRIFSYQDHHNGQRRFLVSTYREFWRRYKNMDAKFRHHYEVI  126

Query  553   QEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTE  732
             QEGLPCHLYFDLEF+++ NA++NGDEMVDLLI    + L +KYS++G+ DWIVELDSST 
Sbjct  127   QEGLPCHLYFDLEFSRRDNAERNGDEMVDLLISVTLEALFEKYSIQGNQDWIVELDSSTA  186

Query  733   DKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQ  912
             +KFSRHLIIR+PK AFKDN+H GAF +E+CSRI S+   DE F  +F+ KDS S   P+Q
Sbjct  187   EKFSRHLIIRIPKTAFKDNTHAGAFVSEICSRILSTRGRDEGFENMFIRKDSSSAEPPSQ  246

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERL  1092
             LF+D AVYSRNRCFRLALSSKAGK+SVL+P+ RFKCK+M E++MFM+SLIC++D DC +L
Sbjct  247   LFIDAAVYSRNRCFRLALSSKAGKNSVLLPTERFKCKDMCEEDMFMSSLICSMDVDCNKL  306

Query  1093  LVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFV  1272
             LVCKMD +C++TL F+TE+   +++   TP+ F LN   SD       G SPFP +D F+
Sbjct  307   LVCKMDMECMKTLQFDTEVNNDYRRHC-TPKEFPLNGVPSD------TGNSPFPALDKFI  359

Query  1273  EYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQ  1452
             E IAS+G++ GKIRSWYWFSEYGL+VYSMS+NRYCERIGREHKSNHVMYVVDLRR DYYQ
Sbjct  360   ESIASIGNISGKIRSWYWFSEYGLMVYSMSRNRYCERIGREHKSNHVMYVVDLRRADYYQ  419

Query  1453  KCHDPDCKGYRSPLRPIPGNVIAHCSVSFD-------LDSNNEGREHTPVATDANIV---  1602
             KCHDPDC+GYRSPLRPIP NVI+    S+D       + S N+  +   V+ +       
Sbjct  420   KCHDPDCQGYRSPLRPIPWNVISDPPYSYDSVQMVDQIGSTNDYLKLQHVSNECEDFLLC  479

Query  1603  ------DSCKKE-WWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTELA  1761
                   DSC K+ WWLEAI+ A+ +E   K      D   EED++WW A E  A+Q+EL 
Sbjct  480   DNKHDPDSCSKDSWWLEAIKVADDIENKQKT----SDSIDEEDDNWWTAVEETASQSELI  535

Query  1762  YLG  1770
             +  
Sbjct  536   HFS  538



>ref|XP_008439308.1| PREDICTED: DNA-directed primase/polymerase protein [Cucumis melo]
Length=602

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/574 (59%), Positives = 411/574 (72%), Gaps = 34/574 (6%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQS-----TEKILQTTADADHS  186
             DDVDRLFECFKCG SPPQSA+   K+ K   K E S   ++      E+  +  +    +
Sbjct  7     DDVDRLFECFKCGVSPPQSAVRREKKRKSKMKPECSVNSETPVSGPVEEREENASSVQDT  66

Query  187   VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQK--KLS  360
             VE +G +   +   S   +F P++FYGSP GVPPKRP+SL RLL EIRVDLSEQ   KLS
Sbjct  67    VEKIGLTSKDKGSRS---KFSPIIFYGSPRGVPPKRPSSLWRLLREIRVDLSEQSRFKLS  123

Query  361   QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +++WATFP+Q EA+K+A + I+  +FSYQDH NG RRFLVS+Y +FW RYKSM+ K RHH
Sbjct  124   KQVWATFPRQEEAIKFAREHIDVHIFSYQDHFNGQRRFLVSSYSEFWHRYKSMDAKCRHH  183

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVIQEG PCHLYFDLE++K+ N  KNGDEMVD LI  V   L +KYS++GS DW++ELD
Sbjct  184   YEVIQEGAPCHLYFDLEYSKRINMGKNGDEMVDSLISVVLQALNEKYSIQGSFDWVLELD  243

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVG  900
             SS E+KFSRHLIIR+PK+AFKDNSH GAF  E+CSRI   ++ + ++ +LF+ KDS S  
Sbjct  244   SSNEEKFSRHLIIRIPKVAFKDNSHAGAFVGEICSRI-CCAKVEGKYEELFIKKDSSSTE  302

Query  901   IPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDAD  1080
              P+ LFVDNAVYSRNRCFRLALSSKAGK+SVL+PSGR     M E++MFMASLICN+DA+
Sbjct  303   SPSHLFVDNAVYSRNRCFRLALSSKAGKTSVLLPSGRHAYTKMCEEDMFMASLICNVDAE  362

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSF-QQMSFTPQAFELNNFESDPSRTYLMGKSPFPP  1257
             CE+LLVCKMD DC++TL F TE   +F + +SFT +A  L     D S T  MGKSPFP 
Sbjct  363   CEKLLVCKMDLDCIKTLQFETEEKCNFGRNVSFTQEAV-LTGSMRDISATSCMGKSPFPD  421

Query  1258  VDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRR  1437
             VD FV+ +AS GSV GKIR WYWFSEYGLIVYSMS+NRYCERIGREHKSNHVMYVVDLR 
Sbjct  422   VDKFVQSVASTGSVAGKIRCWYWFSEYGLIVYSMSRNRYCERIGREHKSNHVMYVVDLRS  481

Query  1438  GDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD------------------LDSNNEG  1563
               YYQKCHDPDC+GYRSPLRPIP + I    VS D                    SN+E 
Sbjct  482   AAYYQKCHDPDCRGYRSPLRPIPIDAIPSPWVSTDSGQISNDMVSTDDCIDYQFPSNDEN  541

Query  1564  REHTPVATDANIVD-SCKKEWWLEAIRFAEQVEG  1662
                  + +D NI D S K  WWLE +R A+ VE 
Sbjct  542   --CLLLFSDKNITDSSVKDSWWLEVMRVADDVEN  573



>ref|XP_007152147.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
 gb|ESW24141.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
Length=625

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/608 (57%), Positives = 431/608 (71%), Gaps = 23/608 (4%)
 Frame = +1

Query  1     TVQDNSMDDVDRLFECFKCGFSPPQSA--IIERKRGKRTTKSEDSAQKQSTEKILQT---  165
             T   ++M+DVDRLF CFKCG +PP+SA  + +R RG+    S +S   +S  + L+T   
Sbjct  6     TTSGSNMNDVDRLFACFKCGLTPPKSATRVRKRSRGRMEQDSLESPGPESVGEELKTPLS  65

Query  166   ---TADADHSVENLGSSKPKRKYH-SNGKQFCPLVFYGSPHGVPPKRPASLL-RLLHEIR  330
                  + + S+E L S   K+      GKQF P+VFYGSPHGVPPKRP  +L RLL EI 
Sbjct  66    RIRKTNIESSMEKLKSVVAKKAQSIGRGKQFSPIVFYGSPHGVPPKRPTRMLWRLLREIC  125

Query  331   VDLSEQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWK  504
              DLS +K L+  +E+W TFPKQ EAM +++   +  VFSYQDH NG RRFLVSTY +FW+
Sbjct  126   PDLSPKKNLNVRKEVWMTFPKQDEAMNFSKGQADVHVFSYQDHFNGQRRFLVSTYTEFWQ  185

Query  505   RYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYS  684
             RYK+MNPK RHHYEVIQEGLPCHLYFDLEFNKK N +KNG+EMVDLLI  V + LL+KY+
Sbjct  186   RYKNMNPKFRHHYEVIQEGLPCHLYFDLEFNKKVNKEKNGEEMVDLLISMVLEALLEKYA  245

Query  685   LEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFR  864
             ++G HDW++ELDSSTEDKFSRH+I+ +PK AFKDNSH GAF +E+CSR+  +   D+ F 
Sbjct  246   IQGDHDWVLELDSSTEDKFSRHVIVCIPKAAFKDNSHAGAFVSEICSRVRKARAKDKSFD  305

Query  865   KLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEM  1044
             KLFV KDS S     QLFVD AVYSRNRCFRLALSSKAGKSSVL P+ RFKCK++ E++M
Sbjct  306   KLFVMKDSGSEESADQLFVDTAVYSRNRCFRLALSSKAGKSSVLQPTKRFKCKDLGEEDM  365

Query  1045  FMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSR  1224
             FMASLICNID DC+  LVCK D DCV+TLHF+TE + + +      Q F L+   SD S 
Sbjct  366   FMASLICNIDVDCQTYLVCKTDLDCVKTLHFDTEESSNVENSCQILQKFALDVGTSDVST  425

Query  1225  TYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKS  1404
             TY MGKSPFP +D F+  +ASVG++PG I SWY+FSE+GL+VYSM+KNRYCERIGR HKS
Sbjct  426   TYFMGKSPFPFLDKFILSVASVGNIPGNIHSWYFFSEFGLMVYSMTKNRYCERIGRHHKS  485

Query  1405  NHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD-----LDS---NNE  1560
             N+V+YVVDLR   YYQKCHDPDC+GYRSPLR IP +V ++ S   D     LD    +N+
Sbjct  486   NNVIYVVDLRMAVYYQKCHDPDCRGYRSPLRQIPVHVFSNPSDVIDSSFGLLDEHSVDNK  545

Query  1561  GREHTP--VATDANIVDSCKKEWWLEAIRFAEQVEG-IPKAleisgdgeleededWWKAA  1731
              R      +  +  + ++    WWLEA+R  E +E    K    + +   +EDE+WW A 
Sbjct  546   WRHQLDDFLQYEDTVEENSNDSWWLEAMRVVEDMENKQTKTEPSTMEVIGDEDEEWWLAV  605

Query  1732  ERIATQTE  1755
             E  A+Q E
Sbjct  606   ESTASQAE  613



>ref|XP_010060340.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Eucalyptus grandis]
Length=603

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/564 (60%), Positives = 414/564 (73%), Gaps = 18/564 (3%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKIL---------QTTA  171
             MDDVDRLF+CFKCG SPP+SA+ ERKR KR  +   S  + S    L             
Sbjct  1     MDDVDRLFKCFKCGISPPESALRERKRSKRKCQEGSSVHEGSASSALSPGSSGLRRNEAT  60

Query  172   DADHSVENLGSSKPK-RKY-HSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSE  345
             D     E LGS+  + RK+    G    P+VFYGSP+GVPPKRP+SLLRLL+EIRVDL+ 
Sbjct  61    DVQLCTEKLGSTTIRARKFSQKRGVHISPVVFYGSPNGVPPKRPSSLLRLLNEIRVDLAA  120

Query  346   QK--KLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSM  519
             Q   KL +EIW TFP+Q EAMK+A+     RVFSYQDH NG RRFLVS+Y++FWKRY +M
Sbjct  121   QNSSKLRKEIWTTFPRQDEAMKFAKAHPEVRVFSYQDHCNGQRRFLVSSYQEFWKRYNNM  180

Query  520   NPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSH  699
             +PK RHHYEVIQEGLPCH+YFDLEFNK+ N DKNG+EMVDLLI+ V + LL KYS++G+ 
Sbjct  181   DPKLRHHYEVIQEGLPCHVYFDLEFNKRENVDKNGEEMVDLLILVVLEVLLDKYSIQGNE  240

Query  700   DWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVS  879
             +W+VELDSSTE+KFS HLI+R+PK AFKDNSHVGAF +EVCSRI S+ ETD+R+ KLFV 
Sbjct  241   EWVVELDSSTEEKFSCHLILRIPKTAFKDNSHVGAFVSEVCSRISSARETDKRYEKLFVK  300

Query  880   KDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASL  1059
             KDS +     Q+FVD AVYSRNRCFRLALSSKAGKSSVL+P+GRFKCK+M E+++FMASL
Sbjct  301   KDSSTST--CQIFVDTAVYSRNRCFRLALSSKAGKSSVLLPTGRFKCKDMCEEDVFMASL  358

Query  1060  ICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMG  1239
             ICN+D +CE+LLVCKM+ DC +TL F TE+     + +   Q    N+  SD S  Y + 
Sbjct  359   ICNMDVNCEKLLVCKMELDCAKTLQFETEVNADIGRYNLALQERNFNSLPSDNSANYFID  418

Query  1240  KSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMY  1419
             KSPFP +D F+E +AS+G+V GKIRSWYWFSE+GL+VY+M +NR+CERIGREHKSNHV+Y
Sbjct  419   KSPFPMLDKFIESVASIGTVSGKIRSWYWFSEHGLMVYNMLRNRFCERIGREHKSNHVIY  478

Query  1420  VVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD--LDSNNEGREHTPVATDA  1593
             VVDL    YYQKCHDPDCKGYRSPLR IP + +   S  FD    +N     +  +  D 
Sbjct  479   VVDLNWAAYYQKCHDPDCKGYRSPLRLIPEDSVPDLSAFFDSVQMANPPDVTNNVLDNDE  538

Query  1594  NIVD-SCKKEWWLEAIRFAEQVEG  1662
             N  + S    WWLEAIR A  VE 
Sbjct  539   NTANCSPMDAWWLEAIRVANAVEN  562



>ref|XP_007152150.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
 gb|ESW24144.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
Length=626

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/609 (56%), Positives = 429/609 (70%), Gaps = 24/609 (4%)
 Frame = +1

Query  1     TVQDNSMDDVDRLFECFKCGFSPPQSA--IIERKRGKRTTKSEDSAQKQSTEKILQT---  165
             T   ++M+DVDRLF CFKCG +PP+SA  + +R RG+    S +S   +S  + L+T   
Sbjct  6     TTSGSNMNDVDRLFACFKCGLTPPKSATRVRKRSRGRMEQDSLESPGPESVGEELKTPLS  65

Query  166   ---TADADHSVENLGSSKPKRKYH-SNGKQFCPLVFYGSPHGVPPKRPASLL-RLLHEIR  330
                  + + S+E L S   K+      GKQF P+VFYGSPHGVPPKRP  +L RLL EI 
Sbjct  66    RIRKTNIESSMEKLKSVVAKKAQSIGRGKQFSPIVFYGSPHGVPPKRPTRMLWRLLREIC  125

Query  331   VDLSEQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWK  504
              DLS +K L+  +E+W TFPKQ EAM +++   +  VFSYQDH NG RRFLVSTY +FW+
Sbjct  126   PDLSPKKNLNVRKEVWMTFPKQDEAMNFSKGQADVHVFSYQDHFNGQRRFLVSTYTEFWQ  185

Query  505   RYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYS  684
             RYK+MNPK RHHYEVIQEGLPCHLYFDLEFNKK N +KNG+EMVDLLI  V + LL+KY+
Sbjct  186   RYKNMNPKFRHHYEVIQEGLPCHLYFDLEFNKKVNKEKNGEEMVDLLISMVLEALLEKYA  245

Query  685   LEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFR  864
             ++G HDW++ELDSSTEDKFSRH+I+ +PK AFKDNSH GAF +E+CSR+  +   D+ F 
Sbjct  246   IQGDHDWVLELDSSTEDKFSRHVIVCIPKAAFKDNSHAGAFVSEICSRVRKARAKDKSFD  305

Query  865   KLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEM  1044
             KLFV KDS S     QLFVD AVYSRNRCFRLALSSKAGKSSVL P+ RFKCK++ E++M
Sbjct  306   KLFVMKDSGSEESADQLFVDTAVYSRNRCFRLALSSKAGKSSVLQPTKRFKCKDLGEEDM  365

Query  1045  FMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSR  1224
             FMASLICNID DC+  LVCK D DCV+TLHF+TE + + +      Q F L+   SD S 
Sbjct  366   FMASLICNIDVDCQTYLVCKTDLDCVKTLHFDTEESSNVENSCQILQKFALDVGTSDVST  425

Query  1225  TYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKS  1404
             TY MGKSPFP +D F+  +ASVG++PG I SWY+FSE+GL+VYSM+KNRYCERIGR HKS
Sbjct  426   TYFMGKSPFPFLDKFILSVASVGNIPGNIHSWYFFSEFGLMVYSMTKNRYCERIGRHHKS  485

Query  1405  NHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD-----LDS---NNE  1560
             N+V+YVVDLR   YYQKCHDPDC+GYRSPLR IP +V ++ S   D     LD    +N+
Sbjct  486   NNVIYVVDLRMAVYYQKCHDPDCRGYRSPLRQIPVHVFSNPSDVIDSSFGLLDEHSVDNK  545

Query  1561  GREHTP--VATDANIVDSCKKEWWLEAIRFAEQVEG--IPKAleisgdgeleededWWKA  1728
              R      +  +  + ++    WWLEA+R  E +E            +   +EDE+WW A
Sbjct  546   WRHQLDDFLQYEDTVEENSNDSWWLEAMRVVEDMENKQTKTEPSTMQEVIGDEDEEWWLA  605

Query  1729  AERIATQTE  1755
              E  A+Q E
Sbjct  606   VESTASQAE  614



>gb|KGN57418.1| hypothetical protein Csa_3G184000 [Cucumis sativus]
Length=603

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/573 (60%), Positives = 411/573 (72%), Gaps = 31/573 (5%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQS-----TEKILQTTADADHS  186
             DDVDRLFECFKCG SPPQSA+  +K+ K   K E S   ++      EK  +  +    +
Sbjct  7     DDVDRLFECFKCGVSPPQSAVRRKKKRKSKVKPECSVNFETPVSGPVEKAEENASSIQDT  66

Query  187   VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQK--KLS  360
             VE +G +   +   S   +F P+VFYGSP GVPPKRP+SL RLL EIRVDLSEQ   KLS
Sbjct  67    VEKIGLTSKDKGSRS---KFSPIVFYGSPRGVPPKRPSSLWRLLREIRVDLSEQSRFKLS  123

Query  361   QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +++WATFP+Q EA+K++ +  +  +FSYQDH NG RRFLVS+Y +FW RYKSM+ K RHH
Sbjct  124   KQVWATFPRQEEAIKFSREHTDVHIFSYQDHFNGQRRFLVSSYSEFWHRYKSMDAKCRHH  183

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVIQEG PCHLYFDLE++K+ N  KNGDEMVD LI  V   L +KYS++GS DW++ELD
Sbjct  184   YEVIQEGAPCHLYFDLEYSKRINTGKNGDEMVDSLISVVLQALNEKYSIQGSFDWVLELD  243

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVG  900
             SS E+KFSRHLIIR+PK+AFKDNSH GAF  E+CSRI  S++ + R+ +LF+ KDS S  
Sbjct  244   SSNEEKFSRHLIIRVPKVAFKDNSHAGAFVGEICSRI-CSAKVEGRYEELFIKKDSSSTE  302

Query  901   IPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDAD  1080
              P+ LFVDNAVYSRNRCFRLALSSKAGK+SVL+P+GR  C  M E++MFMASLICN+DAD
Sbjct  303   RPSHLFVDNAVYSRNRCFRLALSSKAGKTSVLLPTGRHACTKMCEEDMFMASLICNVDAD  362

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSF-QQMSFTPQAFELNNFESDPSRTYLMGKSPFPP  1257
             CE+LLVCKMD DC++TL F  E   +F    SFT +A  L     D S T  MGKSPFP 
Sbjct  363   CEKLLVCKMDLDCIKTLQFEMEEKCNFGHNFSFTKEAV-LTGSMRDFSATSCMGKSPFPD  421

Query  1258  VDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRR  1437
             VD FV+ +AS G+V GKIR WYWFSE+GLIVYSMS NRYCERIGREHKSNHVMYVVDLRR
Sbjct  422   VDKFVQSVASTGNVAGKIRCWYWFSEFGLIVYSMSSNRYCERIGREHKSNHVMYVVDLRR  481

Query  1438  GDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLD--SNNEGREHTPVA---------  1584
               YYQKCHDPDC+GYRSPLRPIP + I    +S D    SN+    H  +          
Sbjct  482   AAYYQKCHDPDCRGYRSPLRPIPIDAIPSPWISTDSGQISNDMVSTHDCIDYHQSPSNDE  541

Query  1585  ------TDANIVDSCKKE-WWLEAIRFAEQVEG  1662
                   +D NI DS  K+ WWLE +R A+ VE 
Sbjct  542   NCLLLFSDKNITDSSVKDSWWLEVMRVADDVEN  574



>ref|XP_010445265.1| PREDICTED: DNA-directed primase/polymerase protein [Camelina 
sativa]
Length=616

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/578 (56%), Positives = 418/578 (72%), Gaps = 30/578 (5%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVE  192
             N+MDDVDRLF+CFKCG SPP SA+ E+KR K+    E+ +   + +K+  ++     S +
Sbjct  9     NAMDDVDRLFQCFKCGISPPASAMREKKRSKKMLNQENESSPGTCKKLQLSSLSRKLSGK  68

Query  193   NL----------------GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHE  324
              L                G SK  +K  S G+QF P+VFYGSP+GVPPK+P SLLRLL E
Sbjct  69    GLRNQIDEGGVSLDDSVSGGSKNVKK--SVGRQFSPIVFYGSPNGVPPKKPLSLLRLLRE  126

Query  325   IRVDLSEQKKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDF  498
             IR+DL+E++K    + +WATFP+Q EA+K+ ++  + R+FSYQDH +G RRFLVS+YE+F
Sbjct  127   IRIDLTEERKAISRKGVWATFPRQDEAIKFGKRHDDVRIFSYQDHFSGQRRFLVSSYEEF  186

Query  499   WKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQK  678
             WKRY SM+PK RHHYEVIQEGLPCH+YFDLEF++K N  K+ DEMVD+LI  + + L +K
Sbjct  187   WKRYTSMDPKHRHHYEVIQEGLPCHMYFDLEFSQKENEGKDVDEMVDILISVILEALHEK  246

Query  679   YSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDER  858
             Y++EG  DWIVELDSST+DKFSRHLI+ +PK+AFKDN HVGAF  E+C+RI ++ E DER
Sbjct  247   YAIEGHEDWIVELDSSTKDKFSRHLIVIIPKVAFKDNIHVGAFVGELCTRIVNAKEKDER  306

Query  859   FRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSED  1038
              RKLFV K+S      + LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKC  M E 
Sbjct  307   LRKLFVHKESNDSA--SLLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTGRFKCMIMGEQ  364

Query  1039  EMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDP  1218
             ++FMASLICN+++DCE+LLVCKM+SDC++TL F+TE+  +        Q F+L    ++ 
Sbjct  365   DIFMASLICNVESDCEKLLVCKMESDCMKTLCFDTEVNNNNLVRGLNAQKFQLEARTNEM  424

Query  1219  SRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREH  1398
             S +Y  GKSPFP +D F+E IAS G   GKIR WYWFSE  LIVYSM +NRYCERIGREH
Sbjct  425   STSYFEGKSPFPHLDQFIESIASTGDASGKIRCWYWFSEDSLIVYSMLRNRYCERIGREH  484

Query  1399  KSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSN-------N  1557
             KSNHVMY+VD+RRG YYQKC+DPDC+ YRSP+RP+P +V+   +V    D+        +
Sbjct  485   KSNHVMYIVDVRRGIYYQKCYDPDCRDYRSPIRPVPDSVLPEDTVYHQEDTQTLCDNLYS  544

Query  1558  EGREHTPVATDANIVDSCKKEWWLEAIRFAEQVEGIPK  1671
             EG  +     D +   S +  WWLEA++ A+ +E  PK
Sbjct  545   EGECYIDNECDPDSAAS-RSSWWLEAVKVADDLESKPK  581



>emb|CDX96153.1| BnaC02g14980D [Brassica napus]
Length=601

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/590 (58%), Positives = 436/590 (74%), Gaps = 25/590 (4%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTA--------D  174
             MDDVDRLF+CFKCG SPP SA+ ERKR K+    +++   + T K LQT++        D
Sbjct  1     MDDVDRLFQCFKCGISPPASAMRERKRRKKMLNPDNNTSPE-TCKSLQTSSLSGKRNQID  59

Query  175   ADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK  354
             A  S+E+L  S   +K  + G+QF P+VFYGSP+GVPPKRP SLLRLL EIR+DL+E++K
Sbjct  60    ASPSLESLSGSSNVKK--TIGRQFSPVVFYGSPNGVPPKRPLSLLRLLREIRIDLTEERK  117

Query  355   L--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPK  528
                 +++WATFP+Q EA+K+ ++  NARVFSYQDH +G RRFLVSTYEDFW RYKSM+P+
Sbjct  118   AISRKQVWATFPRQDEAVKFVKRHENARVFSYQDHFSGQRRFLVSTYEDFWNRYKSMDPR  177

Query  529   RRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWI  708
             RRHHYEVIQEGLPCH+YFDLEFN+K N  K+ D+MVD+LI  + + L +KY++EG  +W+
Sbjct  178   RRHHYEVIQEGLPCHMYFDLEFNQKVNEGKDVDQMVDILISVILEALHEKYAIEGQEEWM  237

Query  709   VELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDS  888
             VELDSST+DKFSRHLI+ +PK+AFKDN HVGAF  E+CSRI S+ E DER RKLFV K++
Sbjct  238   VELDSSTKDKFSRHLILIIPKVAFKDNLHVGAFVGELCSRIVSTKEKDERLRKLFVHKEA  297

Query  889   KSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICN  1068
                   + LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+MSE ++FM+SLICN
Sbjct  298   NDSA--SLLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTGRFKCKDMSEQDVFMSSLICN  355

Query  1069  IDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
             + +DCE+LLVCKM+SDC++TL F+TE+  +          F+++   SD S +Y  GKSP
Sbjct  356   VTSDCEKLLVCKMESDCMKTLCFDTEVNNNSIVRDQRAHKFQVDACTSDMSTSYFGGKSP  415

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP VD FVE IAS G V GKIR WYWFSE  LIVYSM +NRYCERIGREHKSNHVMY+VD
Sbjct  416   FPLVDQFVESIASTGIVSGKIRCWYWFSEDSLIVYSMLRNRYCERIGREHKSNHVMYIVD  475

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLD-----SNN---EGREHTPVA  1584
             +RRG YYQKC+DPDC+ YRSP+RP+P + +    + +D       SNN   EG  +    
Sbjct  476   IRRGIYYQKCYDPDCRDYRSPIRPVPDSYLPE-DIVYDQGEAQNVSNNLYLEGESYIDNE  534

Query  1585  TDANIVDSCKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAE  1734
              + +   S +  WWLEA + A+ +E  PK LE       EED+DWW A E
Sbjct  535   REPDSASS-RGSWWLEAAKIADDLESKPKTLEPHTLESFEEDDDWWIAVE  583



>ref|XP_007152149.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
 gb|ESW24143.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
Length=630

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/613 (56%), Positives = 431/613 (70%), Gaps = 28/613 (5%)
 Frame = +1

Query  1     TVQDNSMDDVDRLFECFKCGFSPPQSA--IIERKRGKRTTKSEDSAQKQSTEKILQT---  165
             T   ++M+DVDRLF CFKCG +PP+SA  + +R RG+    S +S   +S  + L+T   
Sbjct  6     TTSGSNMNDVDRLFACFKCGLTPPKSATRVRKRSRGRMEQDSLESPGPESVGEELKTPLS  65

Query  166   ---TADADHSVENLGSSKPKRKYH-SNGKQFCPLVFYGSPHGVPPKRPASLL-RLLHEIR  330
                  + + S+E L S   K+      GKQF P+VFYGSPHGVPPKRP  +L RLL EI 
Sbjct  66    RIRKTNIESSMEKLKSVVAKKAQSIGRGKQFSPIVFYGSPHGVPPKRPTRMLWRLLREIC  125

Query  331   VDLSEQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWK  504
              DLS +K L+  +E+W TFPKQ EAM +++   +  VFSYQDH NG RRFLVSTY +FW+
Sbjct  126   PDLSPKKNLNVRKEVWMTFPKQDEAMNFSKGQADVHVFSYQDHFNGQRRFLVSTYTEFWQ  185

Query  505   RYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYS  684
             RYK+MNPK RHHYEVIQEGLPCHLYFDLEFNKK N +KNG+EMVDLLI  V + LL+KY+
Sbjct  186   RYKNMNPKFRHHYEVIQEGLPCHLYFDLEFNKKVNKEKNGEEMVDLLISMVLEALLEKYA  245

Query  685   LEGSHDWIVELDSSTE-----DKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSET  849
             ++G HDW++ELDSSTE     DKFSRH+I+ +PK AFKDNSH GAF +E+CSR+  +   
Sbjct  246   IQGDHDWVLELDSSTEVFAFADKFSRHVIVCIPKAAFKDNSHAGAFVSEICSRVRKARAK  305

Query  850   DERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNM  1029
             D+ F KLFV KDS S     QLFVD AVYSRNRCFRLALSSKAGKSSVL P+ RFKCK++
Sbjct  306   DKSFDKLFVMKDSGSEESADQLFVDTAVYSRNRCFRLALSSKAGKSSVLQPTKRFKCKDL  365

Query  1030  SEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFE  1209
              E++MFMASLICNID DC+  LVCK D DCV+TLHF+TE + + +      Q F L+   
Sbjct  366   GEEDMFMASLICNIDVDCQTYLVCKTDLDCVKTLHFDTEESSNVENSCQILQKFALDVGT  425

Query  1210  SDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIG  1389
             SD S TY MGKSPFP +D F+  +ASVG++PG I SWY+FSE+GL+VYSM+KNRYCERIG
Sbjct  426   SDVSTTYFMGKSPFPFLDKFILSVASVGNIPGNIHSWYFFSEFGLMVYSMTKNRYCERIG  485

Query  1390  REHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD-----LDS-  1551
             R HKSN+V+YVVDLR   YYQKCHDPDC+GYRSPLR IP +V ++ S   D     LD  
Sbjct  486   RHHKSNNVIYVVDLRMAVYYQKCHDPDCRGYRSPLRQIPVHVFSNPSDVIDSSFGLLDEH  545

Query  1552  --NNEGREHTP--VATDANIVDSCKKEWWLEAIRFAEQVEGI-PKAleisgdgeleeded  1716
               +N+ R      +  +  + ++    WWLEA+R  E +E    K    + +   +EDE+
Sbjct  546   SVDNKWRHQLDDFLQYEDTVEENSNDSWWLEAMRVVEDMENKQTKTEPSTMEVIGDEDEE  605

Query  1717  WWKAAERIATQTE  1755
             WW A E  A+Q E
Sbjct  606   WWLAVESTASQAE  618



>emb|CDY27048.1| BnaA02g10680D [Brassica napus]
Length=601

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/590 (58%), Positives = 436/590 (74%), Gaps = 25/590 (4%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTA--------D  174
             MDDVDRLF+CFKCG SPP SA+ E+KR K+ + + D+     T K LQTT+        D
Sbjct  1     MDDVDRLFQCFKCGISPPASAMREKKRSKKMS-NPDNNTPPGTRKSLQTTSLSGKRNQID  59

Query  175   ADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK  354
             A  S+++L  S   +K  + G+QF P+VFYGSP+GVPPKRP SLLRLL EIR+DL+E++K
Sbjct  60    ASPSLDSLSGSSNVKK--TIGRQFSPVVFYGSPNGVPPKRPLSLLRLLREIRIDLTEERK  117

Query  355   L--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPK  528
                 +++WATFP+Q EA+K+ ++  NARVFSYQDH +G RRFLVSTYE+FW RYKSM+P+
Sbjct  118   AISRKQVWATFPRQDEAVKFVKRHENARVFSYQDHFSGQRRFLVSTYEEFWNRYKSMDPR  177

Query  529   RRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWI  708
             RRHHYEVIQEGLPCH+YFDLEF++K N  K+ DEMVD+LI  + + L +KY++EG  +WI
Sbjct  178   RRHHYEVIQEGLPCHMYFDLEFSQKENEGKDVDEMVDILISVILEALHEKYAIEGQEEWI  237

Query  709   VELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDS  888
             VELDSST+DKFSRHLI+ +PK+AFKDN HVGAF  E+CSRI S+ E DER RKLFV K++
Sbjct  238   VELDSSTKDKFSRHLIVIIPKVAFKDNLHVGAFVGELCSRIVSTKEKDERLRKLFVHKEA  297

Query  889   KSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICN  1068
                   + LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M+E ++FM+SLICN
Sbjct  298   NDSA--SLLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTGRFKCKDMTEQDVFMSSLICN  355

Query  1069  IDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
             + +DCE+LLVCKM+SDC++TL F+TE+  +          F+++   SD S +Y  GKSP
Sbjct  356   VTSDCEKLLVCKMESDCMKTLCFDTEVNNNSIVRDQRAHKFQVDACTSDMSTSYFGGKSP  415

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP VD FVE  AS G V GKIR WYWFSE  LIVYSM +NRYCERIGREHKSNHVMY+VD
Sbjct  416   FPLVDQFVESTASTGDVSGKIRCWYWFSEDSLIVYSMLRNRYCERIGREHKSNHVMYIVD  475

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLD-----SNN---EGREHTPVA  1584
             +RRG YYQKC+DPDC+ YRSP+RP+P + +    + +D       SNN   EG  +    
Sbjct  476   IRRGIYYQKCYDPDCRDYRSPIRPVPDSYLPE-DIVYDQGEAQNVSNNLYLEGESYIDNE  534

Query  1585  TDANIVDSCKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAE  1734
              + +   S +  WWLEA + A+ +E  PKALE       EED+DWW A E
Sbjct  535   REPDSASS-RDSWWLEAAKIADDLESKPKALEPHTLENFEEDDDWWIAVE  583



>gb|KCW90617.1| hypothetical protein EUGRSUZ_A02722 [Eucalyptus grandis]
Length=589

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/561 (60%), Positives = 411/561 (73%), Gaps = 26/561 (5%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLF+CFKCG SPP+SA+ ERKR KR  +   S  + S    L             
Sbjct  1     MDDVDRLFKCFKCGISPPESALRERKRSKRKCQEGSSVHEGSASSALSP-----------  49

Query  199   GSSKPKRKYHSN--------GKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQK-  351
             GSS  +R   ++        G    P+VFYGSP+GVPPKRP+SLLRLL+EIRVDL+ Q  
Sbjct  50    GSSGLRRNEATDVQLCTEKRGVHISPVVFYGSPNGVPPKRPSSLLRLLNEIRVDLAAQNS  109

Query  352   -KLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPK  528
              KL +EIW TFP+Q EAMK+A+     RVFSYQDH NG RRFLVS+Y++FWKRY +M+PK
Sbjct  110   SKLRKEIWTTFPRQDEAMKFAKAHPEVRVFSYQDHCNGQRRFLVSSYQEFWKRYNNMDPK  169

Query  529   RRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWI  708
              RHHYEVIQEGLPCH+YFDLEFNK+ N DKNG+EMVDLLI+ V + LL KYS++G+ +W+
Sbjct  170   LRHHYEVIQEGLPCHVYFDLEFNKRENVDKNGEEMVDLLILVVLEVLLDKYSIQGNEEWV  229

Query  709   VELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDS  888
             VELDSSTE+KFS HLI+R+PK AFKDNSHVGAF +EVCSRI S+ ETD+R+ KLFV KDS
Sbjct  230   VELDSSTEEKFSCHLILRIPKTAFKDNSHVGAFVSEVCSRISSARETDKRYEKLFVKKDS  289

Query  889   KSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICN  1068
              +     Q+FVD AVYSRNRCFRLALSSKAGKSSVL+P+GRFKCK+M E+++FMASLICN
Sbjct  290   STST--CQIFVDTAVYSRNRCFRLALSSKAGKSSVLLPTGRFKCKDMCEEDVFMASLICN  347

Query  1069  IDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
             +D +CE+LLVCKM+ DC +TL F TE+     + +   Q    N+  SD S  Y + KSP
Sbjct  348   MDVNCEKLLVCKMELDCAKTLQFETEVNADIGRYNLALQERNFNSLPSDNSANYFIDKSP  407

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP +D F+E +AS+G+V GKIRSWYWFSE+GL+VY+M +NR+CERIGREHKSNHV+YVVD
Sbjct  408   FPMLDKFIESVASIGTVSGKIRSWYWFSEHGLMVYNMLRNRFCERIGREHKSNHVIYVVD  467

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD--LDSNNEGREHTPVATDANIV  1602
             L    YYQKCHDPDCKGYRSPLR IP + +   S  FD    +N     +  +  D N  
Sbjct  468   LNWAAYYQKCHDPDCKGYRSPLRLIPEDSVPDLSAFFDSVQMANPPDVTNNVLDNDENTA  527

Query  1603  D-SCKKEWWLEAIRFAEQVEG  1662
             + S    WWLEAIR A  VE 
Sbjct  528   NCSPMDAWWLEAIRVANAVEN  548



>ref|XP_009127215.1| PREDICTED: DNA-directed primase/polymerase protein [Brassica 
rapa]
Length=611

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/591 (58%), Positives = 434/591 (73%), Gaps = 23/591 (4%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTA-------  171
              +MDDVDRLF+CFKCG SPP SA+ E+KR K+ + + D+     T K LQTT+       
Sbjct  9     TTMDDVDRLFQCFKCGISPPASAMREKKRSKKMS-NPDNNTPPGTRKSLQTTSLSGKRNQ  67

Query  172   -DADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQ  348
              DA  S+++L  S   +K  + G+QF P+VFYGSP+GVPPKRP SLLRLL EIR+DL+E+
Sbjct  68    IDASPSLDSLSGSSNVQK--TIGRQFSPVVFYGSPNGVPPKRPLSLLRLLREIRIDLTEE  125

Query  349   KKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMN  522
             +K    +++WATFP+Q EA+K+ ++  +ARVFSYQDH +G RRFLVSTYE+FW RYKSM+
Sbjct  126   RKAISRKQVWATFPRQDEAVKFVKRHESARVFSYQDHFSGQRRFLVSTYEEFWNRYKSMD  185

Query  523   PKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHD  702
             P+RRHHYEVIQEGLPCH+YFDLEF++K N  K+ DEMVD+LI  + + L +KY++EG  +
Sbjct  186   PRRRHHYEVIQEGLPCHMYFDLEFSQKENEGKDVDEMVDILISVILEALHEKYAIEGQEE  245

Query  703   WIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSK  882
             WIVELDSST+DKFSRHLI+ +PK+AFKDN HVGAF  E+CSRI S+ E DER RKLFV K
Sbjct  246   WIVELDSSTKDKFSRHLIVIIPKVAFKDNLHVGAFVGELCSRIVSTKEKDERLRKLFVHK  305

Query  883   DSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLI  1062
             ++      + LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M+E ++FM+SLI
Sbjct  306   EANDSA--SLLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTGRFKCKDMTEQDVFMSSLI  363

Query  1063  CNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGK  1242
             CN+ +DCE+LLVCKM+SDC++TL F+TE+  +          F+++   SD S +Y  GK
Sbjct  364   CNVTSDCEKLLVCKMESDCMKTLCFDTEVNNNSIVRDQRAHKFQVDACTSDMSTSYFGGK  423

Query  1243  SPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYV  1422
             SPFP VD FVE  AS G V GKIR WYWFSE  LIVYSM +NRYCERIGREHKSNHVMY+
Sbjct  424   SPFPLVDQFVESTASTGDVSGKIRCWYWFSEDSLIVYSMLRNRYCERIGREHKSNHVMYI  483

Query  1423  VDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLD-----SNNEGREHTPVAT  1587
             VD+RRG YYQKC+DPDC+ YRSP+RP+P + +    + +D       SNN   E      
Sbjct  484   VDIRRGIYYQKCYDPDCRDYRSPIRPVPDSCLPE-DIVYDQGEAQNVSNNLYLEGESYID  542

Query  1588  DANIVDSC--KKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAE  1734
             D    DS   +  WWLEA + A+ +E  PK LE       EED+DWW A E
Sbjct  543   DEREPDSASSRDSWWLEAAKIADDLESKPKTLEPHTLESFEEDDDWWIAVE  593



>ref|XP_007152152.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
 gb|ESW24146.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
Length=631

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/614 (56%), Positives = 429/614 (70%), Gaps = 29/614 (5%)
 Frame = +1

Query  1     TVQDNSMDDVDRLFECFKCGFSPPQSA--IIERKRGKRTTKSEDSAQKQSTEKILQT---  165
             T   ++M+DVDRLF CFKCG +PP+SA  + +R RG+    S +S   +S  + L+T   
Sbjct  6     TTSGSNMNDVDRLFACFKCGLTPPKSATRVRKRSRGRMEQDSLESPGPESVGEELKTPLS  65

Query  166   ---TADADHSVENLGSSKPKRKYH-SNGKQFCPLVFYGSPHGVPPKRPASLL-RLLHEIR  330
                  + + S+E L S   K+      GKQF P+VFYGSPHGVPPKRP  +L RLL EI 
Sbjct  66    RIRKTNIESSMEKLKSVVAKKAQSIGRGKQFSPIVFYGSPHGVPPKRPTRMLWRLLREIC  125

Query  331   VDLSEQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWK  504
              DLS +K L+  +E+W TFPKQ EAM +++   +  VFSYQDH NG RRFLVSTY +FW+
Sbjct  126   PDLSPKKNLNVRKEVWMTFPKQDEAMNFSKGQADVHVFSYQDHFNGQRRFLVSTYTEFWQ  185

Query  505   RYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYS  684
             RYK+MNPK RHHYEVIQEGLPCHLYFDLEFNKK N +KNG+EMVDLLI  V + LL+KY+
Sbjct  186   RYKNMNPKFRHHYEVIQEGLPCHLYFDLEFNKKVNKEKNGEEMVDLLISMVLEALLEKYA  245

Query  685   LEGSHDWIVELDSSTE-----DKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSET  849
             ++G HDW++ELDSSTE     DKFSRH+I+ +PK AFKDNSH GAF +E+CSR+  +   
Sbjct  246   IQGDHDWVLELDSSTEVFAFADKFSRHVIVCIPKAAFKDNSHAGAFVSEICSRVRKARAK  305

Query  850   DERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNM  1029
             D+ F KLFV KDS S     QLFVD AVYSRNRCFRLALSSKAGKSSVL P+ RFKCK++
Sbjct  306   DKSFDKLFVMKDSGSEESADQLFVDTAVYSRNRCFRLALSSKAGKSSVLQPTKRFKCKDL  365

Query  1030  SEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFE  1209
              E++MFMASLICNID DC+  LVCK D DCV+TLHF+TE + + +      Q F L+   
Sbjct  366   GEEDMFMASLICNIDVDCQTYLVCKTDLDCVKTLHFDTEESSNVENSCQILQKFALDVGT  425

Query  1210  SDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIG  1389
             SD S TY MGKSPFP +D F+  +ASVG++PG I SWY+FSE+GL+VYSM+KNRYCERIG
Sbjct  426   SDVSTTYFMGKSPFPFLDKFILSVASVGNIPGNIHSWYFFSEFGLMVYSMTKNRYCERIG  485

Query  1390  REHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD-----LDS-  1551
             R HKSN+V+YVVDLR   YYQKCHDPDC+GYRSPLR IP +V ++ S   D     LD  
Sbjct  486   RHHKSNNVIYVVDLRMAVYYQKCHDPDCRGYRSPLRQIPVHVFSNPSDVIDSSFGLLDEH  545

Query  1552  --NNEGREHTP--VATDANIVDSCKKEWWLEAIRFAEQVEG--IPKAleisgdgeleede  1713
               +N+ R      +  +  + ++    WWLEA+R  E +E            +   +EDE
Sbjct  546   SVDNKWRHQLDDFLQYEDTVEENSNDSWWLEAMRVVEDMENKQTKTEPSTMQEVIGDEDE  605

Query  1714  dWWKAAERIATQTE  1755
             +WW A E  A+Q E
Sbjct  606   EWWLAVESTASQAE  619



>ref|XP_006401781.1| hypothetical protein EUTSA_v10012991mg [Eutrema salsugineum]
 gb|ESQ43234.1| hypothetical protein EUTSA_v10012991mg [Eutrema salsugineum]
Length=613

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/595 (58%), Positives = 440/595 (74%), Gaps = 28/595 (5%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTA-------  171
             N+MDDVDRLF+CFKCG SPP SA+ ERKR KRT   E+S+   +T K LQ  +       
Sbjct  8     NTMDDVDRLFQCFKCGISPPASAVRERKRSKRTLNPENSSP--ATCKNLQQPSSLSGKGQ  65

Query  172   ----DADHS-VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVD  336
                 D   S V+++  S+  +K  S G+QF P+VFYGSP+GVPPKRP SLLRLL EIR+D
Sbjct  66    RNQIDGSLSLVDSISGSRNVKK--SVGRQFSPIVFYGSPNGVPPKRPLSLLRLLREIRID  123

Query  337   LSEQKKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRY  510
             LSE++K    + +WATFP+Q EA+K+ ++  N RVFSYQDH +G RRFLVSTYE+FWKRY
Sbjct  124   LSEERKAISRKGVWATFPRQDEAIKFEKRHENVRVFSYQDHFSGQRRFLVSTYEEFWKRY  183

Query  511   KSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLE  690
             KSM+P+ RHHYEVIQEGLPCH+YFDLEF++K N  +N DEMVD+LI  + + L +KY++E
Sbjct  184   KSMDPRHRHHYEVIQEGLPCHMYFDLEFSQKENEGRNVDEMVDILISVILEALHEKYAIE  243

Query  691   GSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKL  870
             G  DWI+ELDSST++KFSRH+I+ +PK+AFKDNSHVGAF  E+CSRI S+ E DER  KL
Sbjct  244   GQDDWIIELDSSTKEKFSRHVIVIIPKVAFKDNSHVGAFVGELCSRIVSAKEKDERLGKL  303

Query  871   FVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFM  1050
             FV K++      + LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M E+++FM
Sbjct  304   FVHKEANDSA--SLLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTGRFKCKDMGEEDVFM  361

Query  1051  ASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTY  1230
              SLICN+ +DCE+LLVCKM+SDC++TL F+TE+  +          F+L+   SD S +Y
Sbjct  362   TSLICNVASDCEKLLVCKMESDCMKTLCFDTEVNNNSIVRDQRAHRFQLDACTSDMSTSY  421

Query  1231  LMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNH  1410
               GKSPFP VD F+E IAS G+V GKIR WYWFSE  LIVYSMS+NRYCERIGREHKSNH
Sbjct  422   FGGKSPFPLVDQFIESIASTGNVSGKIRCWYWFSEDSLIVYSMSRNRYCERIGREHKSNH  481

Query  1411  VMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPG-----NVIAHCSVSFDL--DSNNEGRE  1569
             VMY+VD+ RG YYQKC+DPDC+ YRSP+RP+P      +V+ H   + +L  + N EG  
Sbjct  482   VMYIVDIIRGIYYQKCYDPDCRDYRSPIRPVPDSYLPEDVVYHQGEAHNLCDNLNPEGEC  541

Query  1570  HTPVATDANIVDSCKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAE  1734
             +T    + + V S +  WWLEA + A+ +E  PK LE       EED+DWW AAE
Sbjct  542   YTDNECEPDSVSS-RGSWWLEAAKVADDLESKPKILEPHILENYEEDDDWWIAAE  595



>gb|KHN42464.1| Coiled-coil domain-containing protein 111 like [Glycine soja]
Length=631

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/611 (55%), Positives = 424/611 (69%), Gaps = 36/611 (6%)
 Frame = +1

Query  25    DVDRLFECFKCGFSPPQSAIIERKRGKRTTKS--------EDSAQKQSTEKILQT-----  165
             DVDRLF  FKCG +PP+SA  ERKR KR  +          +S   +S E+ L+T     
Sbjct  15    DVDRLFASFKCGLTPPKSATRERKRSKRRLEQVSSNLETPSESPGPRSPEEELRTPLSRI  74

Query  166   -TADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLL-RLLHEIRVDL  339
                + + S+E L S+  + +    GKQF P+VFYGSP G+PPK+P  +L R+L EI  ++
Sbjct  75    RKTNIESSIEKLKSAVTRAQSIGCGKQFSPIVFYGSPCGIPPKKPTRMLWRMLREICPNV  134

Query  340   SEQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYK  513
             S+Q  LS  +E+W TFP+Q EAMK+A+   +  VFSYQDH NG RRFLVSTY +FW+RY 
Sbjct  135   SQQNILSIRKEVWMTFPRQDEAMKFAKGQEDVHVFSYQDHFNGQRRFLVSTYTEFWRRYN  194

Query  514   SMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEG  693
             +MNPK RHHYEVIQ GLPCHLYFDLEFNKK N  KNG+EMVDLLI  V +   +KY+++G
Sbjct  195   NMNPKFRHHYEVIQAGLPCHLYFDLEFNKKVNTGKNGEEMVDLLISVVLEAFHEKYAIQG  254

Query  694   SHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLF  873
              HDW+VELDSS EDKFSRH+I+R+PK AFKDNSH GAF +E+CSRI ++ E D+ F KLF
Sbjct  255   DHDWVVELDSSNEDKFSRHIIVRIPKTAFKDNSHAGAFVSEICSRILNAREKDKSFEKLF  314

Query  874   VSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMA  1053
             V KDS +     QLFVD AVYSRNRCFRL LSSKAGK SVL+P+ RFKCK++ E+++FMA
Sbjct  315   VMKDSSNNESAGQLFVDTAVYSRNRCFRLPLSSKAGKRSVLLPTKRFKCKDLGEEDIFMA  374

Query  1054  SLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYL  1233
             SLICN+D DC+  LVCK D DCV+TLHF+TE   +    +  P  F L    SD S TY 
Sbjct  375   SLICNMDVDCKTYLVCKTDLDCVKTLHFDTEENSNVSNSTQIPPEFTLGTSTSDVSTTYF  434

Query  1234  MGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHV  1413
             MGKSPFP +D F+  +ASVG++PG I SWY+FSE+GL+VYSM+KNRYCERIGR+HKSN+V
Sbjct  435   MGKSPFPFLDKFILSVASVGNIPGNIHSWYYFSEFGLMVYSMTKNRYCERIGRQHKSNNV  494

Query  1414  MYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCS---VSFDLDSN----------  1554
             +YVVDLR   YYQKCHDPDC+GYRSP R IP +V ++ S    SF L  +          
Sbjct  495   IYVVDLRMAVYYQKCHDPDCRGYRSPSRQIPVHVFSNPSDVIGSFGLLDDEQPVDDKLRH  554

Query  1555  --NEGREHTPVATDANIVDSCKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKA  1728
               ++ +E   +     + D+    WWLEAIR  E++E      +   +  ++EDE+WW+A
Sbjct  555   QLDDNKEQNLLQFKDTVEDNSNDSWWLEAIRVVEEMEN----KQTKTEEVIDEDEEWWQA  610

Query  1729  AERIATQTELA  1761
              E  A+Q EL 
Sbjct  611   VESTASQVELT  621



>ref|XP_003533145.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
isoform X1 [Glycine max]
Length=634

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/611 (55%), Positives = 422/611 (69%), Gaps = 35/611 (6%)
 Frame = +1

Query  25    DVDRLFECFKCGFSPPQSAIIERKRGKRTTKS--------EDSAQKQSTEKILQT-----  165
             DVDRLF  FKCG +PP+SA  ERKR KR  +          +S   +S E+ L+T     
Sbjct  17    DVDRLFASFKCGLTPPKSATRERKRSKRRLEQVSSNHETPSESPGPRSPEEELRTPLSRI  76

Query  166   -TADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLL-RLLHEIRVDL  339
                + + S+E L S+  + +    GKQF P+VFYGSP G+PPK+P  +L R+L EI  ++
Sbjct  77    RKTNIESSIEKLKSAVTRAQSIGCGKQFSPIVFYGSPCGIPPKKPTRMLWRMLREICPNV  136

Query  340   SEQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYK  513
             S+Q  LS  +E+W TFP+Q EAMK+A+   +  VFSYQDH NG RRFLVSTY +FW+RY 
Sbjct  137   SQQNILSIRKEVWMTFPRQDEAMKFAKGQEDVHVFSYQDHFNGQRRFLVSTYTEFWRRYN  196

Query  514   SMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEG  693
             +MNPK RHHYEVIQ GLPCHLYFDLEFNKK N  KNG+EMVDLLI  V +   +KY+++G
Sbjct  197   NMNPKFRHHYEVIQAGLPCHLYFDLEFNKKVNTGKNGEEMVDLLISVVLEAFHEKYAIQG  256

Query  694   SHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLF  873
              HDW+VELDSS EDKFSRH+I+R+PK AFKDNSH GAF +E+CSRI ++ E D+ F KLF
Sbjct  257   DHDWVVELDSSNEDKFSRHIIVRIPKTAFKDNSHAGAFVSEICSRILNAREKDKSFEKLF  316

Query  874   VSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMA  1053
             V KDS +     QLFVD AVYSRNRCFRL LSSKAGK SVL+P+ RFKCK++ E+++FMA
Sbjct  317   VMKDSSNNESAGQLFVDTAVYSRNRCFRLPLSSKAGKRSVLLPTKRFKCKDLGEEDIFMA  376

Query  1054  SLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYL  1233
             SLICN+D DC+  LVCK D DCV+TLHF+TE   +    +  P  F L    SD S TY 
Sbjct  377   SLICNMDVDCKTYLVCKTDLDCVKTLHFDTEENSNVSNSTQIPPEFTLGTSTSDVSTTYF  436

Query  1234  MGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHV  1413
             MGKSPFP +D F+  +ASVG++PG I SWY+FSE+GL+VYSM+KNRYCERIGR+HKSN+V
Sbjct  437   MGKSPFPFLDKFILSVASVGNIPGNIHSWYYFSEFGLMVYSMTKNRYCERIGRQHKSNNV  496

Query  1414  MYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCS---VSFDLDSN----------  1554
             +YVVDLR   YYQKCHDPDC+GYRSP R IP +V ++ S    SF L  +          
Sbjct  497   IYVVDLRMAVYYQKCHDPDCRGYRSPSRQIPVHVFSNPSDVIGSFGLLDDEQPVDDKLRH  556

Query  1555  --NEGREHTPVATDANIVDSCKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKA  1728
               ++ +E   +     + D+    WWLEAIR  E +E        +    ++EDE+WW+A
Sbjct  557   QLDDNKEQNLLQFKDTVEDNSNDSWWLEAIRVVEDMEN---KQTKTEQEVIDEDEEWWQA  613

Query  1729  AERIATQTELA  1761
              E  A+Q EL 
Sbjct  614   VESTASQVELT  624



>ref|XP_006587267.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
isoform X2 [Glycine max]
Length=633

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/611 (55%), Positives = 423/611 (69%), Gaps = 36/611 (6%)
 Frame = +1

Query  25    DVDRLFECFKCGFSPPQSAIIERKRGKRTTKS--------EDSAQKQSTEKILQT-----  165
             DVDRLF  FKCG +PP+SA  ERKR KR  +          +S   +S E+ L+T     
Sbjct  17    DVDRLFASFKCGLTPPKSATRERKRSKRRLEQVSSNHETPSESPGPRSPEEELRTPLSRI  76

Query  166   -TADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLL-RLLHEIRVDL  339
                + + S+E L S+  + +    GKQF P+VFYGSP G+PPK+P  +L R+L EI  ++
Sbjct  77    RKTNIESSIEKLKSAVTRAQSIGCGKQFSPIVFYGSPCGIPPKKPTRMLWRMLREICPNV  136

Query  340   SEQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYK  513
             S+Q  LS  +E+W TFP+Q EAMK+A+   +  VFSYQDH NG RRFLVSTY +FW+RY 
Sbjct  137   SQQNILSIRKEVWMTFPRQDEAMKFAKGQEDVHVFSYQDHFNGQRRFLVSTYTEFWRRYN  196

Query  514   SMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEG  693
             +MNPK RHHYEVIQ GLPCHLYFDLEFNKK N  KNG+EMVDLLI  V +   +KY+++G
Sbjct  197   NMNPKFRHHYEVIQAGLPCHLYFDLEFNKKVNTGKNGEEMVDLLISVVLEAFHEKYAIQG  256

Query  694   SHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLF  873
              HDW+VELDSS EDKFSRH+I+R+PK AFKDNSH GAF +E+CSRI ++ E D+ F KLF
Sbjct  257   DHDWVVELDSSNEDKFSRHIIVRIPKTAFKDNSHAGAFVSEICSRILNAREKDKSFEKLF  316

Query  874   VSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMA  1053
             V KDS +     QLFVD AVYSRNRCFRL LSSKAGK SVL+P+ RFKCK++ E+++FMA
Sbjct  317   VMKDSSNNESAGQLFVDTAVYSRNRCFRLPLSSKAGKRSVLLPTKRFKCKDLGEEDIFMA  376

Query  1054  SLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYL  1233
             SLICN+D DC+  LVCK D DCV+TLHF+TE   +    +  P  F L    SD S TY 
Sbjct  377   SLICNMDVDCKTYLVCKTDLDCVKTLHFDTEENSNVSNSTQIPPEFTLGTSTSDVSTTYF  436

Query  1234  MGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHV  1413
             MGKSPFP +D F+  +ASVG++PG I SWY+FSE+GL+VYSM+KNRYCERIGR+HKSN+V
Sbjct  437   MGKSPFPFLDKFILSVASVGNIPGNIHSWYYFSEFGLMVYSMTKNRYCERIGRQHKSNNV  496

Query  1414  MYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCS---VSFDLDSN----------  1554
             +YVVDLR   YYQKCHDPDC+GYRSP R IP +V ++ S    SF L  +          
Sbjct  497   IYVVDLRMAVYYQKCHDPDCRGYRSPSRQIPVHVFSNPSDVIGSFGLLDDEQPVDDKLRH  556

Query  1555  --NEGREHTPVATDANIVDSCKKEWWLEAIRFAEQVEGIPKAleisgdgeleededWWKA  1728
               ++ +E   +     + D+    WWLEAIR  E +E      +   +  ++EDE+WW+A
Sbjct  557   QLDDNKEQNLLQFKDTVEDNSNDSWWLEAIRVVEDMEN----KQTKTEEVIDEDEEWWQA  612

Query  1729  AERIATQTELA  1761
              E  A+Q EL 
Sbjct  613   VESTASQVELT  623



>ref|XP_010482657.1| PREDICTED: DNA-directed primase/polymerase protein-like isoform 
X1 [Camelina sativa]
Length=612

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/601 (56%), Positives = 427/601 (71%), Gaps = 24/601 (4%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQST----------EKILQ  162
             N+MDDVDRLF+CFKCG SPP SA+ E+KR K+    E+      T           K LQ
Sbjct  9     NTMDDVDRLFQCFKCGISPPASAMREKKRSKKMLNQENDDSSPGTCKKLQLSSLSRKQLQ  68

Query  163   TTADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLS  342
                D   S++   S   K    S G+QF P+VFYGSP+GVPPKRP SLLRLL EIR+DLS
Sbjct  69    NQIDGGVSLDGSVSGGSKNVKKSVGRQFSPIVFYGSPNGVPPKRPLSLLRLLREIRIDLS  128

Query  343   EQKKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKS  516
             E++K    + +WATFP+Q EA+K+ ++  N R+FSYQDH +G RRFLVS+YE+FWKRY S
Sbjct  129   EERKAISRKGVWATFPRQDEAIKFGKRHDNVRIFSYQDHFSGQRRFLVSSYEEFWKRYTS  188

Query  517   MNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGS  696
             M+P+ RHHYEVIQEGLPCH+YFDLEF++K N  K+ DEMVD+LI  + + L +KY++EG 
Sbjct  189   MDPRHRHHYEVIQEGLPCHMYFDLEFSQKENEGKDVDEMVDILISVILEALHEKYAIEGH  248

Query  697   HDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFV  876
              DWIVELDSST+DKFSRHLI+ +PK+AFKDN HVGAF  E+C+RI ++ E DER RKLFV
Sbjct  249   EDWIVELDSSTKDKFSRHLIVIIPKVAFKDNIHVGAFVGELCTRIVNAKEKDERLRKLFV  308

Query  877   SKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMAS  1056
              K++      + LFVD AVYSRNRCFRLA SSKAGK+SVL+P+GRFKCKNM E+++FM S
Sbjct  309   HKEANDSA--SLLFVDTAVYSRNRCFRLAQSSKAGKTSVLLPTGRFKCKNMGEEDIFMTS  366

Query  1057  LICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLM  1236
             LICN+++DCE+LLVCKM+SDC++TL F TE+  +    +   Q  +L+   SD S +Y  
Sbjct  367   LICNVESDCEKLLVCKMESDCMKTLCFETEVNNNNLVRNLNAQKIQLDASTSDMSTSYFG  426

Query  1237  GKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
             GKSPFP +D F+E IAS G   GKIR WYWFSE  LIVYSM +NRYCERIGREHKSNHVM
Sbjct  427   GKSPFPHLDQFIESIASTGDASGKIRCWYWFSEDSLIVYSMLRNRYCERIGREHKSNHVM  486

Query  1417  YVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDS----NN---EGREHT  1575
             Y+VD+RRG YYQKC+DPDC+ YRSP+RP+P +V+   +V    D+    NN   EG  + 
Sbjct  487   YIVDVRRGIYYQKCYDPDCRDYRSPIRPVPDSVLPEDTVYHQEDTQTLCNNLYPEGECYI  546

Query  1576  PVATDANIVDSCKKEWWLEAIRFAEQVEGIPKAlei--sgdgeleededWWKAAERIATQ  1749
                 D +   S +  WWLEA++ A+ +E  PK        +   E+D++WW AAE    Q
Sbjct  547   DNECDPDSAAS-RSSWWLEAVKVADDLESKPKKTLEPHPLENYDEDDDEWWVAAEESLKQ  605

Query  1750  T  1752
              
Sbjct  606   V  606



>ref|XP_006281914.1| hypothetical protein CARUB_v10028119mg [Capsella rubella]
 gb|EOA14812.1| hypothetical protein CARUB_v10028119mg [Capsella rubella]
Length=615

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/601 (56%), Positives = 430/601 (72%), Gaps = 26/601 (4%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTE-----------KIL  159
             N+MDDVDRLF+CFKCG SPP SA+ E+KR K+    E+ +     +           K  
Sbjct  8     NAMDDVDRLFQCFKCGISPPSSAMREKKRSKKMLNPENDSPGTCKKLQLSSLSRLSGKGQ  67

Query  160   QTTADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDL  339
             +   D   S++++  S+  +K  S G+QF P+VFYGSP+GVPPKRP SLLRLL EIR+DL
Sbjct  68    RNQIDGGDSLDSVSGSRNVKK--SIGRQFSPIVFYGSPNGVPPKRPLSLLRLLREIRIDL  125

Query  340   SEQKKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYK  513
             SE++K    + +WATFP+Q EAMK+ ++  N R+FSYQDH +G RRFLVS+YE+FWKRY 
Sbjct  126   SEERKAISRKGVWATFPRQDEAMKFGKKHDNVRIFSYQDHFSGQRRFLVSSYEEFWKRYT  185

Query  514   SMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEG  693
             SM+P+ RHHYEVIQEGLPCH+YFDLEF+ K N  KN DEMVD+LI  + + L +KY++EG
Sbjct  186   SMDPRHRHHYEVIQEGLPCHMYFDLEFSLKENEGKNVDEMVDILISVILEALHEKYAIEG  245

Query  694   SHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLF  873
               DWIVELDSST+DKFSRHL++ +PK+AFKDN HVGAF  E+C+RI ++ E DER  KLF
Sbjct  246   QEDWIVELDSSTKDKFSRHLVVIIPKVAFKDNLHVGAFVGELCTRIVNAKEKDERLHKLF  305

Query  874   VSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMA  1053
             V K++      + LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCKNM E ++FM 
Sbjct  306   VHKEANDSA--SLLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTGRFKCKNMGEQDIFMT  363

Query  1054  SLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYL  1233
             SLICN+++DCE+LLVCKM+SDC++TL F+TE+  +        Q F+L+   SD S +Y 
Sbjct  364   SLICNVESDCEKLLVCKMESDCMKTLCFDTEVNNNNLVRDQNAQQFQLDTCTSDMSTSYF  423

Query  1234  MGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHV  1413
              GKSPFP +D F+  IAS G V GKIR WYWFSE  LIVYSM +NRYCERIGREHKSNHV
Sbjct  424   GGKSPFPHLDQFIVSIASTGDVSGKIRCWYWFSEDSLIVYSMLRNRYCERIGREHKSNHV  483

Query  1414  MYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNN-------EGREH  1572
             MY+VDLRRG YYQKC+DPDC+ YRSP+RP+P +V+   +V    D+ N       EG  +
Sbjct  484   MYIVDLRRGIYYQKCYDPDCRDYRSPIRPVPDSVLPEDTVYHQEDTTNHCDTLYSEGECY  543

Query  1573  TPVATDANIVDSCKKEWWLEAIRFAEQVEGIPKAleisg-dgeleededWWKAAERIATQ  1749
                  D +   S +  WWLEA + A+ +E  PK LE    +   E+D++WW AAE    Q
Sbjct  544   IDNECDPDSAAS-RGSWWLEAAKVADDLESKPKTLEPHPWENCEEDDDEWWIAAEESLIQ  602

Query  1750  T  1752
              
Sbjct  603   V  603



>ref|XP_010662673.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Vitis vinifera]
Length=576

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/612 (56%), Positives = 418/612 (68%), Gaps = 67/612 (11%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLF+CFKCG SPP+SAI ERKR K   K   S    ST   +Q+   A    +N 
Sbjct  1     MDDVDRLFQCFKCGVSPPKSAIRERKRNKEKLKQAGSTHVASTYSDVQSPGSAGERHQNA  60

Query  199   GSSKPKRKYHS----NGKQF----CPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK  354
              + +P  K         ++F     P++FYGSPHGVPPKRP+SLLRLL EIRV+LSEQ K
Sbjct  61    NNVQPCMKELGPRTVEAERFNCHISPVIFYGSPHGVPPKRPSSLLRLLREIRVELSEQNK  120

Query  355   --LSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPK  528
               L +E+WATFP+Q E++K+A+   +  +FSYQDH+NG RRFLVSTY++FW+RYK+M+ K
Sbjct  121   SDLREEVWATFPRQDESIKFAQGHADVHIFSYQDHLNGQRRFLVSTYKEFWQRYKNMDSK  180

Query  529   RRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWI  708
              RHHYEVIQEG PCHLYFDLEFNKK NA+K+GDEMVDLLI  V + LL+KYS++ +  WI
Sbjct  181   FRHHYEVIQEGFPCHLYFDLEFNKKDNAEKDGDEMVDLLISVVSEALLEKYSIQVNEKWI  240

Query  709   VELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDS  888
             VELDSST +KFSRHLIIR+PKIAFKDNSH G F AE+CS+I S+ E D  F+KLF+SK S
Sbjct  241   VELDSSTGEKFSRHLIIRIPKIAFKDNSHAGVFVAEICSQISSAGEGDGNFKKLFISKGS  300

Query  889   KSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICN  1068
              S   P QLFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M             
Sbjct  301   TSAEFPCQLFVDTAVYSRNRCFRLALSSKAGKNSVLLPTGRFKCKDME------------  348

Query  1069  IDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
                          + +C              ++ S +PQ F L+   S+ S T  MG SP
Sbjct  349   -------------NHNC--------------RKHSSSPQDFALSACTSNVSGTCFMGNSP  381

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP +D FVE IAS+G+V GKIRSWYWFSEY L+VYSMS+NRYCERIGR+HKSNHV+YVVD
Sbjct  382   FPALDIFVESIASIGNVSGKIRSWYWFSEYRLMVYSMSRNRYCERIGRQHKSNHVIYVVD  441

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD---------LDSNNEG------  1563
             LRR  +YQKCHDPDC+GYRSP RPIP +VI + +V  D           SN+ G      
Sbjct  442   LRRAIFYQKCHDPDCRGYRSPSRPIPMDVIPNTAVLMDSVQTEHHVESTSNHLGYSLVEN  501

Query  1564  -REHTPVATDANIVDSCKKE-WWLEAIRFAEQVEGIPKAl-eisgdgeleededWWKAAE  1734
              +E   +  D +I DSCKK+ WWLEAIRFA+ VE +         +   +ED+DWW AAE
Sbjct  502   DQECVSLYNDKSITDSCKKDAWWLEAIRFADNVESVQHMRDLSDTENIDDEDDDWWMAAE  561

Query  1735  RIATQTELAYLG  1770
             R A+QTE  Y  
Sbjct  562   RTASQTEQTYFN  573



>ref|XP_009400728.1| PREDICTED: DNA-directed primase/polymerase protein [Musa acuminata 
subsp. malaccensis]
Length=611

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/606 (54%), Positives = 414/606 (68%), Gaps = 33/606 (5%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSV----  189
             DDVDRLF CFKCG S P+SAI E++    T+K     + +++  +   T+          
Sbjct  7     DDVDRLFACFKCGISTPESAIKEKRLHPETSKKAGLVRGKASTVVGIATSSLSEQFGQDS  66

Query  190   ---ENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKL-  357
                E LG+         +GKQ  P+VFYGSPHG P KRP+ LLRLLHEIR+DL E   L 
Sbjct  67    TGKEKLGACTSVAIKLKSGKQISPIVFYGSPHGAPIKRPSRLLRLLHEIRIDLKEDNDLI  126

Query  358   -SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRR  534
               +E+W TFP+Q EA+++ +    A++FSYQDH++G RRFLVSTY +FW+RY+ M+PK R
Sbjct  127   VREELWTTFPRQEEAIRFLKAHAQAKLFSYQDHLSGQRRFLVSTYSEFWRRYRCMDPKLR  186

Query  535   HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVE  714
             HHYEVI+EGLPCHLYFDLEF+K  NADKN D+MVD+L+   FD L  KY++E +  WI+E
Sbjct  187   HHYEVIKEGLPCHLYFDLEFDKTVNADKNVDDMVDILMSVTFDILFDKYAIEANDGWIIE  246

Query  715   LDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKS  894
             LDSST  KFSRH+IIR+PK+AFKDNSHVGAF +EVCSRI S   +D +  KL+V KDS S
Sbjct  247   LDSSTTKKFSRHVIIRIPKVAFKDNSHVGAFVSEVCSRITSQRGSDPQLDKLYVRKDSSS  306

Query  895   VGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNID  1074
                  QLF+D+AVYSRNRCFRL  SSKAGK+S L+P+ RFKCK+M+E E+FM SLIC +D
Sbjct  307   SDF--QLFLDSAVYSRNRCFRLVFSSKAGKNSFLLPTRRFKCKDMTEQEVFMESLICRMD  364

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
             +DC +LL C++D DC +TL+F+ E+    QQ S   Q   LN + SD   TY  GKSPFP
Sbjct  365   SDCNKLLKCQIDIDCKKTLYFDFEVQ---QQTSDALQHTALNAYRSDFPTTYSSGKSPFP  421

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              +DAFVE+IAS G+V GKIRSWYWFS +GLI+YSM +NRYCERIGREHKSNHVMY+ DL 
Sbjct  422   ALDAFVEFIASSGNVLGKIRSWYWFSAHGLIIYSMLRNRYCERIGREHKSNHVMYIADLH  481

Query  1435  RGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSF----------DLDSN------NEGR  1566
             R  YYQKC+DPDCKGYRSPLRP+P +VI    + F          DLD+N          
Sbjct  482   RAIYYQKCYDPDCKGYRSPLRPLPHDVIPSDILLFDSTQRINYREDLDTNFGLEHDGSHM  541

Query  1567  EHTPVATDANIVDSCKKE--WWLEAIRFAEQVEGIPKAleisgdgeleede-dWWKAAER  1737
             EH     D  + DSC  E  WW EA+ +A+++E +  A E     E    +  WW   E+
Sbjct  542   EHYSCDGDELVTDSCNMESSWWQEAMTYADRIENMKNAPEFKILNEENVVDCSWWMDVEK  601

Query  1738  IATQTE  1755
             +A+Q E
Sbjct  602   LASQVE  607



>gb|KFK26881.1| hypothetical protein AALP_AA8G305600 [Arabis alpina]
Length=595

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/573 (57%), Positives = 418/573 (73%), Gaps = 26/573 (5%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTA-------  171
             N+MDDVDRLF+CFKCG SPP SA+ E+KR K+    E+++    T K LQ ++       
Sbjct  8     NAMDDVDRLFQCFKCGISPPASAVREKKRSKKMLNPENNSP--GTSKNLQPSSLSGKGQR  65

Query  172   ---DADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLS  342
                D   S++++  S   +K  + G+QF P+VFYGSP+GVPPKRP SLLRLL EIR+DLS
Sbjct  66    NQIDGGFSLDSVSGSSNVKK--TIGRQFSPVVFYGSPNGVPPKRPLSLLRLLREIRIDLS  123

Query  343   EQKKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKS  516
             E++K    + +WATFP+Q EA+K+ ++  N R+FSYQDH +G RRFLVSTYE+ WKRYKS
Sbjct  124   EERKAISRKGVWATFPRQEEAIKFEKRHDNVRIFSYQDHFSGQRRFLVSTYEELWKRYKS  183

Query  517   MNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGS  696
             M+P+ RHHYEVIQEGLPCH+YFDLEFN K N  KN DEMVD+LI  + + L +KY++EG 
Sbjct  184   MDPRHRHHYEVIQEGLPCHMYFDLEFNLKINEGKNVDEMVDILISVILEALHEKYAIEGQ  243

Query  697   HDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFV  876
              DWIVELDSST+DKFSRHLI+ +PK+AFKDN HVGAF  E+CSRI ++ E DER  KLFV
Sbjct  244   EDWIVELDSSTKDKFSRHLIVIIPKVAFKDNLHVGAFVGELCSRIVNAKEKDERLCKLFV  303

Query  877   SKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMAS  1056
              K++      + LFVD AVYSRNRCFRLALSSKAGK+SVL+PSGRFKCK+M E ++FM S
Sbjct  304   HKEANDSA--SLLFVDTAVYSRNRCFRLALSSKAGKTSVLLPSGRFKCKDMGEQDVFMTS  361

Query  1057  LICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLM  1236
             LICN+ +DCE+LLVCKM+SDC++TL F+TE+  +          F+++   SD S +Y  
Sbjct  362   LICNVASDCEKLLVCKMESDCMKTLCFDTEVNNNSLVRHQKAPNFQVDACPSDMSTSYFG  421

Query  1237  GKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
             GKSPFP +D F+E IAS G+V GKIR WYWFSE  LIVYSMS+NRYCERIGREHKSNHVM
Sbjct  422   GKSPFPLLDQFIESIASTGNVSGKIRCWYWFSEESLIVYSMSRNRYCERIGREHKSNHVM  481

Query  1417  YVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDAN  1596
             Y+VDLRRG YYQKC+DPDC+ YRSP+RP+P + +   +V    ++ N      P   +  
Sbjct  482   YIVDLRRGIYYQKCYDPDCRDYRSPIRPVPDSCLPEDTVYQQGEAQNLCDNLYP-EEECY  540

Query  1597  IVDSC-------KKEWWLEAIRFAEQVEGIPKA  1674
             I   C       +  WWLEA++ A+ +E  PK 
Sbjct  541   IDKECDPDSASSRSSWWLEAVKVADDLESKPKT  573



>dbj|BAB10428.1| unnamed protein product [Arabidopsis thaliana]
Length=618

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/613 (54%), Positives = 416/613 (68%), Gaps = 64/613 (10%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSE-DSAQKQSTEKILQTTADADHSVEN  195
             MDDVDRLF+CFKCG SPP SA+ E+KR K+   SE DS       ++   +  +    E 
Sbjct  1     MDDVDRLFQCFKCGISPPASAMREKKRSKKMLNSEYDSPVTCKKLQLSSLSRLSGKRGER  60

Query  196   ---------LGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQ  348
                         S  +    S G+QF P+VFYGSP+GVPPK+P SLLRLL EIR+DLSE+
Sbjct  61    NQIDGSVSVDSVSGSRDVKKSVGRQFSPIVFYGSPNGVPPKKPLSLLRLLREIRIDLSEE  120

Query  349   KKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMN  522
             +K    + +WATFP+Q EA+K+ ++  N R+FSYQDH +G RRFLVS+YE+FWKRY SM+
Sbjct  121   RKAISRKGVWATFPRQEEAIKFEKRHDNVRIFSYQDHFSGQRRFLVSSYEEFWKRYLSMD  180

Query  523   PKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHD  702
             P+ RHHYEVIQEGLPCH+YFDLEFN+K N  KN DEMVD+LI  + + L +KY++EG  D
Sbjct  181   PRHRHHYEVIQEGLPCHMYFDLEFNQKENEGKNVDEMVDILISVILEALREKYAIEGQED  240

Query  703   WIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSK  882
             WIVELDSST+DKFSRH+I+ +PK+AFKDNSHVGAF  E+CSRI ++ ETDER RKLFV K
Sbjct  241   WIVELDSSTKDKFSRHVIVIIPKVAFKDNSHVGAFVGELCSRIVNAKETDERLRKLFVHK  300

Query  883   DSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLI  1062
             ++      + LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M E ++FM SLI
Sbjct  301   EANDSA--SLLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTGRFKCKDMGERDVFMTSLI  358

Query  1063  CNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGK  1242
             CN+++DCE+LLVCKM+SDC++TL F+TE+  +        Q F+LN   SD S +Y  GK
Sbjct  359   CNVESDCEKLLVCKMESDCMKTLCFDTEVNSNNLVRDQNAQKFQLNASTSDMSTSYFGGK  418

Query  1243  SPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNH----  1410
             SPFP +D F+E  AS G+VPGKIR WYWFSE GLIVYSM +NRYCERIGREHKSNH    
Sbjct  419   SPFPQLDQFIESTASTGNVPGKIRCWYWFSEDGLIVYSMLRNRYCERIGREHKSNHGTIC  478

Query  1411  ----------VMYVVDLRRGDYYQKCHDPDCKG---------------------------  1479
                       +MY+VDLRRG YYQKC+DPDC+G                           
Sbjct  479   SQPIYDIRVSMMYIVDLRRGIYYQKCYDPDCRGVYTILTHCLGKQYESKILFLKKPTLSA  538

Query  1480  -YRSPLRPIPGNVIAHCSVSFDLDSNN-------EGREHTPVATDANIVDSCKKEWWLEA  1635
              YRSP+RP+P + +    V +   + N       EG  H     D +   S +  WWLEA
Sbjct  539   DYRSPIRPVPDSYLPEDMVYYQGATQNLCDNLYSEGECHVDKECDPDSAAS-RGSWWLEA  597

Query  1636  IRFAEQVEGIPKA  1674
             ++ A+ +E  PK 
Sbjct  598   VKVADDLESKPKT  610



>ref|XP_008805582.1| PREDICTED: DNA-directed primase/polymerase protein [Phoenix dactylifera]
Length=612

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/606 (55%), Positives = 421/606 (69%), Gaps = 32/606 (5%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQST---EKILQTTADADHSV-  189
             +DVDRLF CFKCG S P+SA+ ERK     +K+   A++ ++   E +  T++  D  V 
Sbjct  7     NDVDRLFACFKCGISTPESALKERKSWLERSKTASLAKRGASPVAELVTPTSSRQDEQVS  66

Query  190   ----ENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKL  357
                 E + S+    K  +  KQ  P+VFYGSPHG P KRP+ LLRLL EI VDL EQ  L
Sbjct  67    PNKEEPVVSTSVAIK-SNKSKQISPIVFYGSPHGAPVKRPSQLLRLLREIHVDLREQNSL  125

Query  358   --SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKR  531
                +E+WATFP+Q EAM++     +A VFSYQDH++G RRFLVSTY++FW+RYK+M+ K 
Sbjct  126   IPRKEVWATFPRQDEAMRFCNTHAHANVFSYQDHLSGQRRFLVSTYDEFWRRYKNMDSKL  185

Query  532   RHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
             RHHYEVIQEG+PCHLYFDLEF+KK N D+N DEMVD LI   +  L +KY ++G+ +W+V
Sbjct  186   RHHYEVIQEGVPCHLYFDLEFDKKINNDRNVDEMVDTLIFITYKVLFEKYFIQGNEEWVV  245

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSK  891
             ELDSST++KFSRHLIIR+PK AFKDNSH GAF +EVCSRI S   +D +  KL+  KD+ 
Sbjct  246   ELDSSTKEKFSRHLIIRIPKTAFKDNSHAGAFVSEVCSRIASLRGSDPQSDKLYTRKDTS  305

Query  892   SVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNI  1071
                   QLF+D AVYSRNRCFRLA SSKAGK+S L+P+GRFKC+NMS+ ++FM SLIC +
Sbjct  306   CPESLCQLFLDTAVYSRNRCFRLAFSSKAGKTSFLMPTGRFKCRNMSKQQVFMESLICRM  365

Query  1072  DADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
             D DCE+LL CKMD DC + L F+ E   + +  S  PQ    N + SD   TY  GKSPF
Sbjct  366   DVDCEKLLKCKMDLDCNKILFFDFE---AHETNSNAPQTVLFNAYRSDFPSTYFSGKSPF  422

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P +DAFVE IAS+G+VPG+IRSWYWFS  GL+VYSMSK+RYCERIGREHKSNHVMY++D 
Sbjct  423   PALDAFVESIASIGNVPGRIRSWYWFSACGLMVYSMSKSRYCERIGREHKSNHVMYIIDF  482

Query  1432  RRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVA---------  1584
             +R  YYQKC+DPDC+GYRSPLRP+P +VI      F   +    RE   +          
Sbjct  483   QRAGYYQKCYDPDCRGYRSPLRPVPWDVIPDSKALFSSVNTENCREIMDIGFNTQFDGNN  542

Query  1585  TDAN-------IVDSCKKE--WWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAER  1737
             T++N       I DSCKK+  WW EA+R+A+ +E +  A E+S   ++ ED +WW  AER
Sbjct  543   TESNSCDNGKWITDSCKKDSSWWQEAMRYADCIEKMRNAAELSKLEDMGEDCEWWLDAER  602

Query  1738  IATQTE  1755
                Q E
Sbjct  603   FINQVE  608



>ref|XP_004140828.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
[Cucumis sativus]
Length=648

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/618 (55%), Positives = 414/618 (67%), Gaps = 76/618 (12%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQS-----TEKILQTTADADHS  186
             DDVDRLFECFKCG SPPQSA+  +K+ K   K E S   ++      EK  +  +    +
Sbjct  7     DDVDRLFECFKCGVSPPQSAVRRKKKRKSKVKPECSVNFETPVSGPVEKAEENASSIQDT  66

Query  187   VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQK--KLS  360
             VE +G +   +   S   +F P+VFYGSP GVPPKRP+SL RLL EIRVDLSEQ   KLS
Sbjct  67    VEKIGLTSKDKGSRS---KFSPIVFYGSPRGVPPKRPSSLWRLLREIRVDLSEQSRFKLS  123

Query  361   QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +++WATFP+Q EA+K++ +  +  +FSYQDH NG RRFLVS+Y +FW RYKSM+ K RHH
Sbjct  124   KQVWATFPRQEEAIKFSREHTDVHIFSYQDHFNGQRRFLVSSYSEFWHRYKSMDAKCRHH  183

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVIQEG PCHLYFDLE++K+ N  KNGDEMVD LI  V   L +KYS++GS DW++ELD
Sbjct  184   YEVIQEGAPCHLYFDLEYSKRINTGKNGDEMVDSLISVVLQALNEKYSIQGSFDWVLELD  243

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVG  900
             SS E+KFSRHLIIR+PK+AFKDNSH GAF  E+CSRI  S++ + R+ +LF+ KDS S  
Sbjct  244   SSNEEKFSRHLIIRVPKVAFKDNSHAGAFVGEICSRI-CSAKVEGRYEELFIKKDSSSTE  302

Query  901   IPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDAD  1080
              P+ LFVDNAVYSRNRCFRLALSSKAGK+SVL+P+GR  C  M E++MFMASLICN+DAD
Sbjct  303   RPSHLFVDNAVYSRNRCFRLALSSKAGKTSVLLPTGRHACTKMCEEDMFMASLICNVDAD  362

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQ-------------SFQ------------QMSFTPQ  1185
             CE+LLVCKMD DC++TL F  E++              +F+              SFT +
Sbjct  363   CEKLLVCKMDLDCIKTLQFEMEVSSIPLCLILIIHDLFTFEFLLLQEKCNFGHNFSFTKE  422

Query  1186  AFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVP---------------------  1302
             A  L     D S T  MGKSPFP VD FV+ +AS G+V                      
Sbjct  423   AV-LTGSMRDFSATSCMGKSPFPDVDKFVQSVASTGNVAGKLPVFTMRQLLVINLAAAFS  481

Query  1303  GKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGY  1482
             GKIR WYWFSE+GLIVYSMS NRYCERIGREHKSNHVMYVVDLRR  YYQKCHDPDC+GY
Sbjct  482   GKIRCWYWFSEFGLIVYSMSSNRYCERIGREHKSNHVMYVVDLRRAAYYQKCHDPDCRGY  541

Query  1483  RSPLRPIPGNVIAHCSVSFDLD--SNNEGREHTPVA---------------TDANIVDSC  1611
             RSPLRPIP + I    +S D    SN+    H  +                +D NI DS 
Sbjct  542   RSPLRPIPIDAIPSPWISTDSGQISNDMVSTHDCIDYHQSPSNDENCLLLFSDKNITDSS  601

Query  1612  KKE-WWLEAIRFAEQVEG  1662
              K+ WWLE +R A+ VE 
Sbjct  602   VKDSWWLEVMRVADDVEN  619



>ref|XP_007152145.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
 ref|XP_007152146.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
 gb|ESW24139.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
 gb|ESW24140.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
Length=510

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/505 (61%), Positives = 380/505 (75%), Gaps = 12/505 (2%)
 Frame = +1

Query  1     TVQDNSMDDVDRLFECFKCGFSPPQSA--IIERKRGKRTTKSEDSAQKQSTEKILQT---  165
             T   ++M+DVDRLF CFKCG +PP+SA  + +R RG+    S +S   +S  + L+T   
Sbjct  6     TTSGSNMNDVDRLFACFKCGLTPPKSATRVRKRSRGRMEQDSLESPGPESVGEELKTPLS  65

Query  166   ---TADADHSVENLGSSKPKRKYH-SNGKQFCPLVFYGSPHGVPPKRPASLL-RLLHEIR  330
                  + + S+E L S   K+      GKQF P+VFYGSPHGVPPKRP  +L RLL EI 
Sbjct  66    RIRKTNIESSMEKLKSVVAKKAQSIGRGKQFSPIVFYGSPHGVPPKRPTRMLWRLLREIC  125

Query  331   VDLSEQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWK  504
              DLS +K L+  +E+W TFPKQ EAM +++   +  VFSYQDH NG RRFLVSTY +FW+
Sbjct  126   PDLSPKKNLNVRKEVWMTFPKQDEAMNFSKGQADVHVFSYQDHFNGQRRFLVSTYTEFWQ  185

Query  505   RYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYS  684
             RYK+MNPK RHHYEVIQEGLPCHLYFDLEFNKK N +KNG+EMVDLLI  V + LL+KY+
Sbjct  186   RYKNMNPKFRHHYEVIQEGLPCHLYFDLEFNKKVNKEKNGEEMVDLLISMVLEALLEKYA  245

Query  685   LEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFR  864
             ++G HDW++ELDSSTEDKFSRH+I+ +PK AFKDNSH GAF +E+CSR+  +   D+ F 
Sbjct  246   IQGDHDWVLELDSSTEDKFSRHVIVCIPKAAFKDNSHAGAFVSEICSRVRKARAKDKSFD  305

Query  865   KLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEM  1044
             KLFV KDS S     QLFVD AVYSRNRCFRLALSSKAGKSSVL P+ RFKCK++ E++M
Sbjct  306   KLFVMKDSGSEESADQLFVDTAVYSRNRCFRLALSSKAGKSSVLQPTKRFKCKDLGEEDM  365

Query  1045  FMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSR  1224
             FMASLICNID DC+  LVCK D DCV+TLHF+TE + + +      Q F L+   SD S 
Sbjct  366   FMASLICNIDVDCQTYLVCKTDLDCVKTLHFDTEESSNVENSCQILQKFALDVGTSDVST  425

Query  1225  TYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKS  1404
             TY MGKSPFP +D F+  +ASVG++PG I SWY+FSE+GL+VYSM+KNRYCERIGR HKS
Sbjct  426   TYFMGKSPFPFLDKFILSVASVGNIPGNIHSWYFFSEFGLMVYSMTKNRYCERIGRHHKS  485

Query  1405  NHVMYVVDLRRGDYYQKCHDPDCKG  1479
             N+V+YVVDLR   YYQKCHDPDC+G
Sbjct  486   NNVIYVVDLRMAVYYQKCHDPDCRG  510



>ref|XP_010919130.1| PREDICTED: DNA-directed primase/polymerase protein [Elaeis guineensis]
Length=613

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/608 (54%), Positives = 413/608 (68%), Gaps = 35/608 (6%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIERK----RGKRTTKSEDSAQKQSTEKILQTTADADHSV  189
             DDVDRLF CFKCG S P+SA+ ERK    R KR +  E  A      K+++ T+      
Sbjct  7     DDVDRLFACFKCGISTPESALKERKSRLERSKRASLVEGGASL--VAKVVRPTSSRQEER  64

Query  190   ENLGSSKP----KRKYHSN-GKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK  354
              +    +P         SN  KQ  P+VFYGSPHG P K+P+ LLRLL EI VDL EQ  
Sbjct  65    VSPNKEEPVVSTSVAIKSNKSKQISPIVFYGSPHGAPVKKPSQLLRLLREIHVDLREQNS  124

Query  355   L--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPK  528
             L   +E+WATFP+Q EAM++ +   +A VFSYQDH++G RRFLVSTY++ W RYK+M+ K
Sbjct  125   LIPRKEVWATFPRQDEAMRFWKTHAHASVFSYQDHLSGQRRFLVSTYDELWGRYKNMDSK  184

Query  529   RRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWI  708
               HHYEVIQEG PCHLYFDLEF+KK N D+N DEMVD LI   +  L  KYS++G+ +W+
Sbjct  185   LHHHYEVIQEGAPCHLYFDLEFDKKINNDRNVDEMVDTLIFVTYKVLFDKYSIQGNEEWV  244

Query  709   VELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDS  888
             VELDSST++KFSRHLIIR+PK AFKDNSHVGAF +EVCS I S   +D +  KL++ KD+
Sbjct  245   VELDSSTKEKFSRHLIIRIPKTAFKDNSHVGAFVSEVCSHIASLRGSDPQLDKLYIRKDT  304

Query  889   KSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICN  1068
                    QLF+DNAVYSRNRCFRLA SSKAGK+S L+P+GRFKCKNMSE ++FM SLIC 
Sbjct  305   SCPESSCQLFLDNAVYSRNRCFRLAFSSKAGKTSFLMPTGRFKCKNMSEQQVFMESLICR  364

Query  1069  IDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
             +D DCE+LL CKMD DC + L+F++E  ++    S   Q    N + SD   TY  GKSP
Sbjct  365   MDVDCEKLLKCKMDLDCNKILYFDSEARET---NSNPQQTVLFNTYRSDFPSTYFSGKSP  421

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             FP +DAFVE IAS+G+VPG+IRSWYWFS  GL+VY+MSK+RYCERIGREHKSNHVMY+VD
Sbjct  422   FPALDAFVESIASIGNVPGRIRSWYWFSVCGLMVYNMSKSRYCERIGREHKSNHVMYIVD  481

Query  1429  LRRGDYYQKCHDPDCKGYRSPLRPIPGNVIA------------HC----SVSFDLDSNNE  1560
              +R  YYQKC+DPDC+GYRSPLRP+P ++I             +C     + FD   +  
Sbjct  482   FQRPGYYQKCYDPDCRGYRSPLRPVPWDLIPDSRALFSSVNTENCREIMDIGFDTQFDGN  541

Query  1561  GREHTPVATDANIVDSCKKE--WWLEAIRFAEQVEGIPKAleisgdgeleede-dWWKAA  1731
               E+        I DSCKK+  WW EA+R A+ +E    A E+S   E   ++ +WW  A
Sbjct  542   NMENNSCDNGELITDSCKKDSSWWQEAMRHADCIEKTRNAAELSKLEEDTVEDCEWWSDA  601

Query  1732  ERIATQTE  1755
             ER   Q E
Sbjct  602   ERFINQVE  609



>ref|XP_007152148.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
 ref|XP_007152151.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
 gb|ESW24142.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
 gb|ESW24145.1| hypothetical protein PHAVU_004G106200g [Phaseolus vulgaris]
Length=515

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/510 (61%), Positives = 380/510 (75%), Gaps = 17/510 (3%)
 Frame = +1

Query  1     TVQDNSMDDVDRLFECFKCGFSPPQSA--IIERKRGKRTTKSEDSAQKQSTEKILQT---  165
             T   ++M+DVDRLF CFKCG +PP+SA  + +R RG+    S +S   +S  + L+T   
Sbjct  6     TTSGSNMNDVDRLFACFKCGLTPPKSATRVRKRSRGRMEQDSLESPGPESVGEELKTPLS  65

Query  166   ---TADADHSVENLGSSKPKRKYH-SNGKQFCPLVFYGSPHGVPPKRPASLL-RLLHEIR  330
                  + + S+E L S   K+      GKQF P+VFYGSPHGVPPKRP  +L RLL EI 
Sbjct  66    RIRKTNIESSMEKLKSVVAKKAQSIGRGKQFSPIVFYGSPHGVPPKRPTRMLWRLLREIC  125

Query  331   VDLSEQKKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWK  504
              DLS +K L+  +E+W TFPKQ EAM +++   +  VFSYQDH NG RRFLVSTY +FW+
Sbjct  126   PDLSPKKNLNVRKEVWMTFPKQDEAMNFSKGQADVHVFSYQDHFNGQRRFLVSTYTEFWQ  185

Query  505   RYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYS  684
             RYK+MNPK RHHYEVIQEGLPCHLYFDLEFNKK N +KNG+EMVDLLI  V + LL+KY+
Sbjct  186   RYKNMNPKFRHHYEVIQEGLPCHLYFDLEFNKKVNKEKNGEEMVDLLISMVLEALLEKYA  245

Query  685   LEGSHDWIVELDSSTE-----DKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSET  849
             ++G HDW++ELDSSTE     DKFSRH+I+ +PK AFKDNSH GAF +E+CSR+  +   
Sbjct  246   IQGDHDWVLELDSSTEVFAFADKFSRHVIVCIPKAAFKDNSHAGAFVSEICSRVRKARAK  305

Query  850   DERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNM  1029
             D+ F KLFV KDS S     QLFVD AVYSRNRCFRLALSSKAGKSSVL P+ RFKCK++
Sbjct  306   DKSFDKLFVMKDSGSEESADQLFVDTAVYSRNRCFRLALSSKAGKSSVLQPTKRFKCKDL  365

Query  1030  SEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFE  1209
              E++MFMASLICNID DC+  LVCK D DCV+TLHF+TE + + +      Q F L+   
Sbjct  366   GEEDMFMASLICNIDVDCQTYLVCKTDLDCVKTLHFDTEESSNVENSCQILQKFALDVGT  425

Query  1210  SDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIG  1389
             SD S TY MGKSPFP +D F+  +ASVG++PG I SWY+FSE+GL+VYSM+KNRYCERIG
Sbjct  426   SDVSTTYFMGKSPFPFLDKFILSVASVGNIPGNIHSWYFFSEFGLMVYSMTKNRYCERIG  485

Query  1390  REHKSNHVMYVVDLRRGDYYQKCHDPDCKG  1479
             R HKSN+V+YVVDLR   YYQKCHDPDC+G
Sbjct  486   RHHKSNNVIYVVDLRMAVYYQKCHDPDCRG  515



>ref|XP_010105736.1| Coiled-coil domain-containing protein 111-like protein [Morus 
notabilis]
 gb|EXC05956.1| Coiled-coil domain-containing protein 111-like protein [Morus 
notabilis]
Length=584

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/597 (55%), Positives = 410/597 (69%), Gaps = 57/597 (10%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTE-KIL---------QTT  168
             MDD+DRLFECFKCG SPP+SA+ ERKR +   K   S+   S E +IL         + T
Sbjct  1     MDDIDRLFECFKCGISPPESAVRERKRSRSKLKQASSSHDVSAESEILSPGSAARKHEKT  60

Query  169   ADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLL-HEIRVDLSE  345
             A+   S++  GS   K    ++GKQ  P+VFYGSP GVPPKRP+ LL  L +EIR DL+E
Sbjct  61    ANIQPSLDKSGSKTVKANNFNSGKQISPVVFYGSPQGVPPKRPSRLLLRLLYEIRADLTE  120

Query  346   QKK--LSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSM  519
             Q K  LS+EIW+TFP+Q EAMK+A+   NARVFSYQDH NG RR            YK++
Sbjct  121   QSKSSLSEEIWSTFPRQDEAMKFAKGHENARVFSYQDHYNGQRR------------YKNV  168

Query  520   NPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSH  699
             + K RHHYEVIQEGLPCHLYFDLEF+++ NA+++GDEMVDLLI  + + L  KYS++G+H
Sbjct  169   DSKFRHHYEVIQEGLPCHLYFDLEFSRRENAERDGDEMVDLLISVILEALHDKYSIQGNH  228

Query  700   DWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVS  879
             +WI+ELDSST+ KFSRHLIIR+PK AFKDNSH GAF  E+CSRI +  E + +F KLFV 
Sbjct  229   EWILELDSSTDVKFSRHLIIRIPKSAFKDNSHAGAFVNEICSRIINGREKNGQFEKLFVR  288

Query  880   KDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASL  1059
             K+S SV  P QLFVD AVYSRNRCFRLALSSKAGKSSVL+P+GR+K K+M EDEMFMASL
Sbjct  289   KESTSVDSPGQLFVDTAVYSRNRCFRLALSSKAGKSSVLLPTGRYKAKDMCEDEMFMASL  348

Query  1060  ICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMG  1239
             ICN+D DC++LLVCKMD  C++TL F+TE+  S  +   +PQ   L+    D S TY MG
Sbjct  349   ICNMDVDCDKLLVCKMDVLCMKTLQFDTEVNHSSGRRYCSPQELTLDGCRVDASTTYFMG  408

Query  1240  KSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMY  1419
             KSPFP +DAF+E +AS+G+ PGKIRSWY FSEYGL+VYSMS+NRYCERIGREHKS     
Sbjct  409   KSPFPALDAFIESVASIGNTPGKIRSWYLFSEYGLMVYSMSRNRYCERIGREHKS-----  463

Query  1420  VVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANI  1599
                                 YRSPLRPIP ++I        +     G  +     D N 
Sbjct  464   --------------------YRSPLRPIPWDIIPET-----VHHEGSGVHNLEQYNDENT  498

Query  1600  VDSCKKE-WWLEAIRFAEQVEGIPK-AleisgdgeleededWWKAAERIATQTELAY  1764
              +S   + WWLEA+RFA+ VE +P  +     +   +EDE+WW A ER  +QTEL++
Sbjct  499   ANSSTPDSWWLEAMRFADNVERMPDLSELSKMENISDEDENWWLAVERAVSQTELSH  555



>ref|XP_003563145.1| PREDICTED: DNA-directed primase/polymerase protein [Brachypodium 
distachyon]
Length=606

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/597 (52%), Positives = 398/597 (67%), Gaps = 22/597 (4%)
 Frame = +1

Query  16    SMDDVDRLFECFKCGFSPPQSAIIER--KRGKRTTKSEDSAQKQSTEKILQTTADADHSV  189
             S DDVDRLF CFKCG SPPQSA  ER  ++GK+   +  +            T DA    
Sbjct  4     SKDDVDRLFACFKCGISPPQSAFRERPSRQGKKLRVASAAESDGGGSSSSAPTRDAGEKH  63

Query  190   ENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQE-  366
                 S+  K +   + KQ  P+VFYGSP GVP K+P SLLRLL EIR+DL++Q  L    
Sbjct  64    TEPYSAAMKFR---SRKQMSPIVFYGSPQGVPVKKPRSLLRLLREIRIDLNKQTDLISRD  120

Query  367   -IWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHY  543
              +WATFP+Q EA++++++  +  VFSYQDH++G RRFLVSTY +FW+RY +M+P+ RHHY
Sbjct  121   VVWATFPRQEEAIRFSKEHAHTNVFSYQDHLSGQRRFLVSTYNEFWRRYNNMDPQIRHHY  180

Query  544   EVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDS  723
             EVI EG PCH+YFDLEFN K N  ++ DEMVD+L+ A F  L  KYS+EG  +WI+ELDS
Sbjct  181   EVILEGSPCHIYFDLEFNAKLNKKRDADEMVDILVAATFSALHDKYSIEGQEEWIIELDS  240

Query  724   STEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGI  903
             S E+KFSRHLIIR+PK AFKDNSHVGAF +E+CSRI +    +    KL++ KDS     
Sbjct  241   SNEEKFSRHLIIRIPKTAFKDNSHVGAFISEICSRIAAQRAANPNLDKLYIRKDSSCAES  300

Query  904   PAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADC  1083
               QLF+D AVYSRNRCFRLA SSK+GK S L+ +GRFKC+NM+  E+FM SLIC +D DC
Sbjct  301   VDQLFMDTAVYSRNRCFRLAFSSKSGKKSFLVATGRFKCQNMNNKELFMESLICRLDDDC  360

Query  1084  ERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVD  1263
             ++LL+CK+D DC + LHF++E + +  +      A  +  + SD    Y  G+SPFP +D
Sbjct  361   DKLLICKLDLDCKKALHFDSEASITRIERRTCKDA--IGTYRSDFPHAYTYGRSPFPALD  418

Query  1264  AFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGD  1443
              F+E IAS G+V GKIRSWYWFSEYGL++YSMSK+RYCE IGREHKSNHVMY+VD +R  
Sbjct  419   GFIESIASFGNVSGKIRSWYWFSEYGLMIYSMSKSRYCEHIGREHKSNHVMYIVDFQRAA  478

Query  1444  YYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD----------LDSNNEGREHTPVATDA  1593
             YYQKC+DPDC+ YRSPLR +P +VI   S   D          ++ N EG       +D 
Sbjct  479   YYQKCYDPDCRDYRSPLRAVPLDVIPELSSIADSAQREYQGKVVEVNIEGSSRNEFLSDG  538

Query  1594  NIVDSCKKE---WWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTE  1755
             N V    +E   WW EA+ +A+ VE    A  +    +  +D DWW  AER   Q E
Sbjct  539   NSVVENGEEDPSWWEEAVIYADSVENADHAPGLCNLEDDCDDADWWMDAERFMVQME  595



>ref|XP_008362792.1| PREDICTED: DNA-directed primase/polymerase protein-like isoform 
X3 [Malus domestica]
Length=483

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/472 (63%), Positives = 366/472 (78%), Gaps = 8/472 (2%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGK----RTTKSEDSAQKQSTEKILQTTADADHS  186
             MDDVDRLFECFKCG SPPQSA+ ERKR K    R +K+ + +   S E   + T++   S
Sbjct  1     MDDVDRLFECFKCGISPPQSALRERKRSKSDLKRRSKTPEVSSPGSAENTKKNTSELQLS  60

Query  187   VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPA-SLLRLLHEIRVDLSEQKKLS-  360
              +  G +  K    +  K+F P+VFYGSPHGVPPK+P+ S LRLL EIRVDL+ QK+L+ 
Sbjct  61    ADKSGPTSVKPNKFNRQKEFSPVVFYGSPHGVPPKKPSRSFLRLLREIRVDLAAQKRLTS  120

Query  361   -QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRH  537
              +E+W TFP+Q EAM++ +   N  VFSYQDH +G RRFLVSTY DFW+RYK+MNP+ RH
Sbjct  121   RKEVWTTFPRQDEAMQFVKGHENVHVFSYQDHYSGQRRFLVSTYNDFWRRYKNMNPRFRH  180

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
             HYEVIQEGLPCHLYFDLEF+++ NAD+NGDEMVDLLI A+F+ LL+KYS+ G+ +WI+EL
Sbjct  181   HYEVIQEGLPCHLYFDLEFSRRDNADRNGDEMVDLLISAIFEALLEKYSIIGNKEWILEL  240

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSV  897
             DSS E KFSRHLIIR+ K AFKDNSH GAF  E+CSRI S+ E D RF  LF+ KDS S 
Sbjct  241   DSSNEAKFSRHLIIRIEKTAFKDNSHAGAFVTEICSRISSAKERDGRFGNLFIRKDSSSS  300

Query  898   GIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMS-EDEMFMASLICNID  1074
               P++LFVD AVY+RNRCFRLALSSKAGK+SVL+P+GRFK   M  E+EMFMASLICN+D
Sbjct  301   DSPSKLFVDTAVYTRNRCFRLALSSKAGKNSVLLPTGRFKANKMQCEEEMFMASLICNLD  360

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
              DCE+LLVCK D DC++TLHF+TE+ +   +    PQ + LN   S  S TY +GKSPFP
Sbjct  361   VDCEKLLVCKPDLDCIKTLHFDTEVNRGLGKCYSWPQEYALNGCTSGASATYFLGKSPFP  420

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNH  1410
              +DAFVE +A++G+V GKIRSWYW SE+ L+VYSMS+NRYCERIGR+HKSNH
Sbjct  421   ALDAFVESVATIGNVSGKIRSWYWLSEFALMVYSMSRNRYCERIGRQHKSNH  472



>dbj|BAJ91837.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/599 (52%), Positives = 400/599 (67%), Gaps = 21/599 (4%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSA--IIERKRGK--RTTKSEDSAQKQSTEKILQTTADAD  180
             +S DDVDRLF CFKCG SPPQSA  +  R++GK  R T S +     S+     T    +
Sbjct  3     SSKDDVDRLFACFKCGISPPQSAFRVRPRRQGKKLRVTPSAEGDGGGSSSSSALTRKVGE  62

Query  181   HSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLS  360
             ++ E+   S    K+  N KQ  P+VFYGSP GVP K+P SLLRLL EI +DL +Q  L 
Sbjct  63    NASEHREPSSAAIKFR-NRKQMSPVVFYGSPQGVPVKKPMSLLRLLREIHIDLKKQTDLI  121

Query  361   QE--IWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRR  534
                 +WATFP+Q EA++++++    +VFSYQDH++G RRFLVSTY +FW+RY +M+P+ R
Sbjct  122   SRDVVWATFPRQDEAIRFSKEHACTKVFSYQDHLSGQRRFLVSTYNEFWRRYNNMDPQIR  181

Query  535   HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVE  714
             HHYEVIQEG PCH+YFDLEFN K N  ++ DEMVD L+   F  L  KYS+EG  +WI+E
Sbjct  182   HHYEVIQEGSPCHIYFDLEFNAKLNQKRDADEMVDTLVSVTFSALQDKYSIEGQEEWIIE  241

Query  715   LDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKS  894
             LDSS E+KFSRHLIIR+PKIAFKDNSHVGAF +E+CSRI +    +    KL+++KDS  
Sbjct  242   LDSSNEEKFSRHLIIRIPKIAFKDNSHVGAFISEICSRIAAQRAANPNLDKLYITKDSSG  301

Query  895   VGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNID  1074
                  QLFVD AVYSRNRCFRLA SSK+GK S L+ +GRFKCKNM++ E+FM SLIC +D
Sbjct  302   AQPVDQLFVDTAVYSRNRCFRLAFSSKSGKKSFLVATGRFKCKNMNDKELFMESLICRLD  361

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
              DC++LL+CK+D +C + LHF+TE   S  ++        ++ + +D  + Y  G+SPFP
Sbjct  362   DDCDKLLICKLDLECKKVLHFDTE--ASITRIQGKNYRVAIDTYRNDFPQAYTYGRSPFP  419

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              +D F+E IAS GSV GKIR WYWFS+ GL++YSMS++RYCE IGREHKSNHVMY+VD +
Sbjct  420   ALDGFIESIASFGSVSGKIRCWYWFSQDGLMIYSMSRSRYCEHIGREHKSNHVMYIVDFQ  479

Query  1435  RGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSF------DLDSNNEGREHTPVATDAN  1596
             R  YYQKC+DPDC GYRSPLR +P +VI   + S       D   N           D N
Sbjct  480   RAAYYQKCYDPDCHGYRSPLRAVPLDVIPELTASIAGLAQRDYQGNVVEINMEGSRMDGN  539

Query  1597  IVDSCKKE-----WWLEAIRFAEQVEGIPKAlei-sgdgeleededWWKAAERIATQTE  1755
              V +   E     WW EA++FA+ VE +  A    + +    +D DWW   ER   Q E
Sbjct  540   SVMASGDEEEDPGWWEEAVKFADSVENVDHAPASCNLEDGDCDDADWWMDVERFVVQME  598



>ref|XP_010442824.1| PREDICTED: DNA-directed primase/polymerase protein-like [Camelina 
sativa]
 ref|XP_010442825.1| PREDICTED: DNA-directed primase/polymerase protein-like [Camelina 
sativa]
Length=686

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/557 (56%), Positives = 404/557 (73%), Gaps = 18/557 (3%)
 Frame = +1

Query  127   SAQKQSTEKILQTTADADH---SVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRP  297
             S  ++ + K+L+   D      S+++  S   K    S G+QF P+VFYGSP+GVPPKRP
Sbjct  127   SLSRRLSGKVLRNQIDGGGLSVSLDDSISGGSKNVKKSVGRQFSPIVFYGSPNGVPPKRP  186

Query  298   ASLLRLLHEIRVDLSEQKKL---SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYR  468
              SLLRLL EI +DLSE++K     + +WATFP+Q EA+K+ ++  N R+FSYQDH +G R
Sbjct  187   LSLLRLLREIHIDLSEERKAISSRKGVWATFPRQDEAIKFGKRHDNVRIFSYQDHFSGQR  246

Query  469   RFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLI  648
             RFLVS+YE+FWKRY SM+PK RHHYEVIQEGLPCH+YFDLEF++K N  K+ DEMVD+LI
Sbjct  247   RFLVSSYEEFWKRYTSMDPKHRHHYEVIQEGLPCHMYFDLEFSQKENEGKDVDEMVDILI  306

Query  649   VAVFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSR  828
               + + L +KY++EG  DWIVELDSST+DKFSRHLI+ +PK+AFKDNSHVGAF  E+C+R
Sbjct  307   SVILEALHEKYAMEGHDDWIVELDSSTKDKFSRHLIVIIPKVAFKDNSHVGAFVGELCTR  366

Query  829   IYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSG  1008
             I ++ E DER RKLFV K++      + LFVD AVYSRNRCFRLA SSKAGK+SVL+P+G
Sbjct  367   IVNAKEKDERLRKLFVHKEANDSA--SLLFVDTAVYSRNRCFRLAQSSKAGKTSVLLPTG  424

Query  1009  RFKCKNMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQA  1188
             RFKCKNM E ++FM SLICN+++DCE+LLVCKM+SDC++TL F+TE+  +    +   Q 
Sbjct  425   RFKCKNMGEKDIFMTSLICNVESDCEKLLVCKMESDCMKTLCFDTEVNNNNLVRNQNAQK  484

Query  1189  FELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKN  1368
             F+L+   SD S +Y  GKSPFP +D F+E +AS G   GKIR WYWFSE  LIVYSM +N
Sbjct  485   FQLDARTSDMSTSYFGGKSPFPHLDQFIESLASTGDASGKIRCWYWFSEDSLIVYSMLRN  544

Query  1369  RYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLD  1548
             RYCERIGREHKSNHVMY+VD+RRG YYQKC+DPDC+ YRSP+RP+P +V+   +V    D
Sbjct  545   RYCERIGREHKSNHVMYIVDVRRGIYYQKCYDPDCRDYRSPIRPVPDSVLPEDTVYHQED  604

Query  1549  S-------NNEGREHTPVATDANIVDSCKKEWWLEAIRFAEQVEGIPKAlei--sgdgel  1701
             +       N+EG  +     D +   S +  WWLEA++FA+ +E  PK        +   
Sbjct  605   TQTLCDNLNSEGDCYIDNECDPDSAAS-RSSWWLEAVKFADDLESKPKKTLEPHPLENYD  663

Query  1702  eededWWKAAERIATQT  1752
             E+D++WW AAE    Q 
Sbjct  664   EDDDEWWVAAEESLKQV  680



>dbj|BAD31083.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG93719.1| unnamed protein product [Oryza sativa Japonica Group]
Length=612

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/600 (51%), Positives = 401/600 (67%), Gaps = 26/600 (4%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIERKR--GKRT--TKSEDSAQKQSTEKILQTTADADHSV  189
             DDVDRLF CFKCG SPPQSA  ER R  GKR+    + D            +T   D + 
Sbjct  8     DDVDRLFACFKCGVSPPQSAFRERPRRAGKRSRVASTADGGGGGGGGSSSSSTPTPDAAE  67

Query  190   ENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKL--SQ  363
             ++   S    K+ +  KQ  P+VFYGSP GVP K+P SLLRLL EIR+DL +Q  L  S 
Sbjct  68    KHEAPSSAVIKF-TGRKQMSPVVFYGSPQGVPVKKPLSLLRLLREIRIDLKKQTDLVPSA  126

Query  364   EIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHY  543
              +WATFP+Q EA+++ +      VFSYQDH++G RRFLVSTY++FWKRY +M+P+ RHHY
Sbjct  127   GVWATFPRQEEAIRFCKAHAYTNVFSYQDHLSGQRRFLVSTYDEFWKRYNNMDPQIRHHY  186

Query  544   EVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDS  723
             EVIQ+G PCH+YFDLEF+ + N  ++ DEMVD+L+ A F  L  KYS+EG  +WI+ELDS
Sbjct  187   EVIQDGSPCHIYFDLEFDPRLNKMRDADEMVDILVAATFSALHDKYSIEGQEEWIIELDS  246

Query  724   STEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGI  903
             STE+KFSRHLIIR+PK AFKDNSHVGAF +E+CSRI S    +  F KL+++KDS   G 
Sbjct  247   STEEKFSRHLIIRIPKTAFKDNSHVGAFISEICSRIASQRAANPNFDKLYITKDSSCTGH  306

Query  904   PAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADC  1083
                LF+D AVYSRNRCFRLA SSK+GK S L+ + RFK KNMS+ E+FM SLIC +D DC
Sbjct  307   ADHLFMDIAVYSRNRCFRLAFSSKSGKKSFLVATERFKHKNMSDKELFMESLICRLDDDC  366

Query  1084  ERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVD  1263
              +LL CK+D DC +TLHF++E +    Q   +  +  +  + +D   +   G SPFP +D
Sbjct  367   HKLLTCKLDLDCKKTLHFDSEASMIRIQGRNSKDS--IGTYRNDFPVSNTYGISPFPALD  424

Query  1264  AFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGD  1443
              F+E IAS G+V GKIR WYWFS YGL++YSMS++RYCE IGREHKSNHVMY+V+ +R  
Sbjct  425   VFIESIASFGNVSGKIRCWYWFSHYGLMIYSMSRSRYCEHIGREHKSNHVMYIVEFQRAA  484

Query  1444  YYQKCHDPDCKGYRSPLRPIPGNVIAHCS--------------VSFDLDSNNEGREHTPV  1581
             YYQKC+DPDC+GYRSPLRP+P +VI   S              V  +++  N   E+   
Sbjct  485   YYQKCYDPDCQGYRSPLRPVPWDVIPELSSISDSAQREYQGEVVEINIEGRNRNDEYLCN  544

Query  1582  ATDANIVDSCKKE--WWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTE  1755
              T + + +S + +  WW EA++FA+ +E      +     +  +D DWW  AERI  Q E
Sbjct  545   GTKS-VTESGEDDPSWWEEAVKFADSIENTDHGPDTRDQDKDCDDADWWMDAERIMVQIE  603



>gb|EEC81996.1| hypothetical protein OsI_25931 [Oryza sativa Indica Group]
Length=609

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/599 (51%), Positives = 401/599 (67%), Gaps = 27/599 (5%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIERKR--GKRTTKSEDSAQKQSTEKILQTTADADHSVEN  195
             DDVDRLF CFKCG SPPQSA  ER R  GKR+  +  +     +      T DA    E 
Sbjct  8     DDVDRLFACFKCGVSPPQSAFRERPRRAGKRSRVASAADGGGGSSSSSTPTPDAAEKHEA  67

Query  196   LGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKL--SQEI  369
               S+  K    +  KQ  P+VFYGSP GVP K+P SLLRLL EIR+DL +Q  L  S  +
Sbjct  68    PSSAVIK---FTGRKQMSPVVFYGSPQGVPVKKPLSLLRLLWEIRIDLKKQTDLVPSAGV  124

Query  370   WATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEV  549
             WATFP+Q EA+++ +      VFSYQDH+ G RRFLVSTY++FWKRY +M+P+ RHHYEV
Sbjct  125   WATFPRQEEAIRFCKAHAYTNVFSYQDHLTGQRRFLVSTYDEFWKRYNNMDPQIRHHYEV  184

Query  550   IQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSST  729
             IQ+G PCH+YFDLEF+ + N  ++ DEMVD+L+   F  L  KYS+EG  +WI+ELDSST
Sbjct  185   IQDGSPCHIYFDLEFDPRLNKMRDADEMVDILVAVTFSALHDKYSIEGQEEWIIELDSST  244

Query  730   EDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPA  909
             E+KFSRHLIIR+PK AFKDNSHVGAF +E+CSRI S    +  F KL+++KDS   G   
Sbjct  245   EEKFSRHLIIRIPKTAFKDNSHVGAFISEICSRIASQRAANPNFDKLYITKDSSCTGRAD  304

Query  910   QLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCER  1089
              LF+D AVYSRNRCFRLA SSK+GK S L+ + RFK KNMS  E+FM SLIC +D DC++
Sbjct  305   HLFMDTAVYSRNRCFRLAFSSKSGKKSFLVATERFKHKNMSGKELFMESLICRLDDDCDK  364

Query  1090  LLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAF  1269
             LL CK+D DC +TLHF++E +    Q   +  +  +  +++D   +   G SPFP +D F
Sbjct  365   LLTCKLDLDCKKTLHFDSEASMIRIQGRNSKDS--IGTYQNDFPVSNTYGISPFPALDVF  422

Query  1270  VEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYY  1449
             +E IAS G+V GKIR WYWFS YGL++YSMS++RYCE IGREHKSNHVMY+V+ +R  YY
Sbjct  423   IESIASFGNVSGKIRCWYWFSHYGLMIYSMSRSRYCEHIGREHKSNHVMYIVEFQRAAYY  482

Query  1450  QKCHDPDCKGYRSPLRPIPGNVIAHCS--------------VSFDLDSNNEGREHTPVAT  1587
             QKC+DPDC+GYRSPLRP+P +VI   S              V  +++ +N   E+    T
Sbjct  483   QKCYDPDCQGYRSPLRPVPWDVIPELSSISDSAQREYQGEVVEINIEGSNRNDEYLCNGT  542

Query  1588  DANIVDSCKKE--WWLEAIRFAEQVEGIPKAleisgdgele-ededWWKAAERIATQTE  1755
               ++ +S + +  WW EA++FA+ +E      +     + + +D DWW  AERI  Q E
Sbjct  543   -KSVTESGEDDPSWWEEAVKFADSIENTDHGPDTRDQEDKDCDDADWWMDAERIMVQIE  600



>ref|XP_004957651.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
[Setaria italica]
Length=607

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/595 (50%), Positives = 403/595 (68%), Gaps = 21/595 (4%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIER--KRGKRTTKSEDSAQKQSTEKILQTTADADHSVEN  195
             DDVDRLF CFKCG SPPQSA  ER  +RGKR+  S  +    S           D   + 
Sbjct  8     DDVDRLFACFKCGVSPPQSAFRERPLRRGKRSRVSPAAGTAGSGGGSSSYDPTPDAGADK  67

Query  196   LGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKL--SQEI  369
              G+        +  KQ  P+VFYGSP GVP K+P SLLRLL EIR+DL +Q        +
Sbjct  68    HGAPSSGAIKFTGRKQMSPIVFYGSPQGVPVKKPLSLLRLLREIRIDLKKQTDSIPRDVV  127

Query  370   WATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEV  549
             WATFP+Q EA+++++   +  VFSYQDH  G RRFLVSTY++FW+RY  M+ K RHHYEV
Sbjct  128   WATFPRQEEAIRFSKAHTHTNVFSYQDHRTGTRRFLVSTYDEFWRRYNDMDSKIRHHYEV  187

Query  550   IQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSST  729
             IQEG PCH+YFDLEF+ + N  ++ DEMVD+L+  +F  L  KYS+E   +WI ELDSST
Sbjct  188   IQEGSPCHIYFDLEFDTRLNKKRDADEMVDILVAVIFSALHDKYSIEAQEEWITELDSST  247

Query  730   EDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPA  909
             E+KFSRHLIIR+P  AFKDNSHVGAF +EVCS+I +    +    KL+++K+S S G   
Sbjct  248   EEKFSRHLIIRIPNTAFKDNSHVGAFVSEVCSQIAAQRAANPNLDKLYITKESSSTGPVD  307

Query  910   QLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCER  1089
             QLF+D AVYSRNRCFRLA SSK+GK+S L+PS RFKCK M++ ++FM SLIC +D +C++
Sbjct  308   QLFMDTAVYSRNRCFRLAFSSKSGKNSFLVPSRRFKCKEMNDKDVFMESLICRLDDNCDK  367

Query  1090  LLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAF  1269
             LL+CK+D +C +TLHF++E   S  Q+    +   ++ + SD  +    GKSPFP +D F
Sbjct  368   LLICKLDLECKKTLHFDSEF--SMPQIHGRSKN-SISTYRSDFPQESTYGKSPFPALDGF  424

Query  1270  VEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYY  1449
             +E IAS G+V GKIRSWYWFS+YGL++YSM ++RYCE IGREHKSNHVMY+VD +R  YY
Sbjct  425   IESIASFGNVSGKIRSWYWFSQYGLMIYSMLRSRYCENIGREHKSNHVMYIVDFQRAAYY  484

Query  1450  QKCHDPDCKGYRSPLRPIPGNVIAHCSV------------SFDLDSNNEGREHTPVATDA  1593
             QKC+DPDC+GYRSPLRP+P +V+   S               +++ ++  R    ++   
Sbjct  485   QKCYDPDCQGYRSPLRPVPWDVMPELSSVAESAQAEYQGEVVEINFDDSSRNGCYLSGGK  544

Query  1594  NIVDSCKK-EWWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTE  1755
             ++++S +  +WW EA++FA+ +E I +A +     + ++ + W K AERI  Q E
Sbjct  545   SVMESYEDPDWWEEAVKFADSIENIERASDPFNLEDDDDADFWMK-AERIMEQIE  598



>gb|AAU44590.1| hypothetical protein AT5G52800 [Arabidopsis thaliana]
Length=506

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/481 (60%), Positives = 362/481 (75%), Gaps = 14/481 (3%)
 Frame = +1

Query  4     VQDNSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSE-DSAQKQSTEKILQTTADAD  180
             +  NSMDDVDRLF+CFKCG SPP SA+ E+KR K+   SE DS       ++   +  + 
Sbjct  5     LSSNSMDDVDRLFQCFKCGISPPASAMREKKRSKKMLNSEYDSPVTCKKLQLSSLSRLSG  64

Query  181   HSVEN---------LGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRV  333
                E             S  +    S G+QF P+VFYGSP+GVPPK+P SLLRLL EIR+
Sbjct  65    KRGERNQIDGSVSVDSVSGSRDVKKSVGRQFSPIVFYGSPNGVPPKKPLSLLRLLREIRI  124

Query  334   DLSEQKKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKR  507
             DLSE++K    + +WATFP+Q EA+K+ ++  N R+FSYQDH +G RRFLVS+YE+FWKR
Sbjct  125   DLSEERKAISRKGVWATFPRQEEAIKFEKRHDNVRIFSYQDHFSGQRRFLVSSYEEFWKR  184

Query  508   YKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSL  687
             Y SM+P+ RHHYEVIQEGLPCH+YFDLEFN+K N  KN DEMVD+LI  + + L +KY++
Sbjct  185   YLSMDPRHRHHYEVIQEGLPCHMYFDLEFNQKENEGKNVDEMVDILISVILEALREKYAI  244

Query  688   EGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRK  867
             EG  DWIVELDSST+DKFSRH+I+ +PK+AFKDNSHVGAF  E+CSRI ++ ETDER RK
Sbjct  245   EGQEDWIVELDSSTKDKFSRHVIVIIPKVAFKDNSHVGAFVGELCSRIVNAKETDERLRK  304

Query  868   LFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMF  1047
             LFV K++      + LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M E ++F
Sbjct  305   LFVHKEANDSA--SLLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTGRFKCKDMGERDVF  362

Query  1048  MASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRT  1227
             M SLICN+++DCE+LLVCKM+SDC++TL F+TE+  +        Q F+LN   SD S +
Sbjct  363   MTSLICNVESDCEKLLVCKMESDCMKTLCFDTEVNSNNLVRDQNAQKFQLNASTSDMSTS  422

Query  1228  YLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSN  1407
             Y  GKSPFP +D F+E  AS G+VPGKIR WYWFSE GLIVYSM +NRYCERIGREHKSN
Sbjct  423   YFGGKSPFPQLDQFIESTASTGNVPGKIRCWYWFSEDGLIVYSMLRNRYCERIGREHKSN  482

Query  1408  H  1410
             H
Sbjct  483   H  483



>ref|NP_200092.2| DNA primase [Arabidopsis thaliana]
 gb|AED96261.1| DNA primase [Arabidopsis thaliana]
Length=506

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/481 (60%), Positives = 362/481 (75%), Gaps = 14/481 (3%)
 Frame = +1

Query  4     VQDNSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSE-DSAQKQSTEKILQTTADAD  180
             +  NSMDDVDRLF+CFKCG SPP SA+ E+KR K+   SE DS       ++   +  + 
Sbjct  5     LSSNSMDDVDRLFQCFKCGISPPASAMREKKRSKKMLNSEYDSPVTCKKLQLSSLSRLSG  64

Query  181   HSVEN---------LGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRV  333
                E             S  +    S G+QF P+VFYGSP+GVPPK+P SLLRLL EIR+
Sbjct  65    KRGERNQIDGSVSVDSVSGSRDVKKSVGRQFSPIVFYGSPNGVPPKKPLSLLRLLREIRI  124

Query  334   DLSEQKKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKR  507
             DLSE++K    + +WATFP+Q EA+K+ ++  N R+FSYQDH +G RRFLVS+YE+FWKR
Sbjct  125   DLSEERKAISRKGVWATFPRQEEAIKFEKRHDNVRIFSYQDHFSGQRRFLVSSYEEFWKR  184

Query  508   YKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSL  687
             Y SM+P+ RHHYEVIQEGLPCH+YFDLEFN+K N  KN DEMVD+LI  + + L +KY++
Sbjct  185   YLSMDPRHRHHYEVIQEGLPCHMYFDLEFNQKENEGKNVDEMVDILISVILEALREKYAI  244

Query  688   EGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRK  867
             EG  DWIVELDSST+DKFSRH+I+ +PK+AFKDNSHVGAF  E+CSRI ++ ETDER RK
Sbjct  245   EGQEDWIVELDSSTKDKFSRHVIVIIPKVAFKDNSHVGAFVGELCSRIVNAKETDERLRK  304

Query  868   LFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMF  1047
             LFV K++      + LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M E ++F
Sbjct  305   LFVHKEANDSA--SLLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTGRFKCKDMGERDVF  362

Query  1048  MASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRT  1227
             M SLICN+++DCE+LLVCKM+SDC++TL F+TE+  +        Q F+LN   SD S +
Sbjct  363   MTSLICNVESDCEKLLVCKMESDCMKTLCFDTEVNSNNLVRDQNAQKFQLNASTSDMSTS  422

Query  1228  YLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSN  1407
             Y  GKSPFP +D F+E  AS G+VPGKIR WYWFSE GLIVYSM +NRYCERIGREHKSN
Sbjct  423   YFGGKSPFPQLDQFIESTASTGNVPGKIRCWYWFSEDGLIVYSMLRNRYCERIGREHKSN  482

Query  1408  H  1410
             H
Sbjct  483   H  483



>ref|XP_010482658.1| PREDICTED: DNA-directed primase/polymerase protein-like isoform 
X2 [Camelina sativa]
Length=586

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/601 (53%), Positives = 404/601 (67%), Gaps = 50/601 (8%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQST----------EKILQ  162
             N+MDDVDRLF+CFKCG SPP SA+ E+KR K+    E+      T           K LQ
Sbjct  9     NTMDDVDRLFQCFKCGISPPASAMREKKRSKKMLNQENDDSSPGTCKKLQLSSLSRKQLQ  68

Query  163   TTADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLS  342
                D   S++   S   K    S G+QF P+VFYGSP+GVPPKRP SLLRLL EIR+DLS
Sbjct  69    NQIDGGVSLDGSVSGGSKNVKKSVGRQFSPIVFYGSPNGVPPKRPLSLLRLLREIRIDLS  128

Query  343   EQKKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKS  516
             E++K    + +WATFP+Q EA+K+ ++  N R+FSYQDH +G RRFLVS+YE+FWKRY S
Sbjct  129   EERKAISRKGVWATFPRQDEAIKFGKRHDNVRIFSYQDHFSGQRRFLVSSYEEFWKRYTS  188

Query  517   MNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGS  696
             M+P+ RHHYEVIQEGLPCH+YFDLEF++K N  K+ DEMVD+LI  + + L +KY++EG 
Sbjct  189   MDPRHRHHYEVIQEGLPCHMYFDLEFSQKENEGKDVDEMVDILISVILEALHEKYAIEGH  248

Query  697   HDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFV  876
              DWIVELDSST+                           E+C+RI ++ E DER RKLFV
Sbjct  249   EDWIVELDSSTK--------------------------GELCTRIVNAKEKDERLRKLFV  282

Query  877   SKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMAS  1056
              K++      + LFVD AVYSRNRCFRLA SSKAGK+SVL+P+GRFKCKNM E+++FM S
Sbjct  283   HKEANDSA--SLLFVDTAVYSRNRCFRLAQSSKAGKTSVLLPTGRFKCKNMGEEDIFMTS  340

Query  1057  LICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLM  1236
             LICN+++DCE+LLVCKM+SDC++TL F TE+  +    +   Q  +L+   SD S +Y  
Sbjct  341   LICNVESDCEKLLVCKMESDCMKTLCFETEVNNNNLVRNLNAQKIQLDASTSDMSTSYFG  400

Query  1237  GKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
             GKSPFP +D F+E IAS G   GKIR WYWFSE  LIVYSM +NRYCERIGREHKSNHVM
Sbjct  401   GKSPFPHLDQFIESIASTGDASGKIRCWYWFSEDSLIVYSMLRNRYCERIGREHKSNHVM  460

Query  1417  YVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDS----NN---EGREHT  1575
             Y+VD+RRG YYQKC+DPDC+ YRSP+RP+P +V+   +V    D+    NN   EG  + 
Sbjct  461   YIVDVRRGIYYQKCYDPDCRDYRSPIRPVPDSVLPEDTVYHQEDTQTLCNNLYPEGECYI  520

Query  1576  PVATDANIVDSCKKEWWLEAIRFAEQVEGIPKAlei--sgdgeleededWWKAAERIATQ  1749
                 D +   S +  WWLEA++ A+ +E  PK        +   E+D++WW AAE    Q
Sbjct  521   DNECDPDSAAS-RSSWWLEAVKVADDLESKPKKTLEPHPLENYDEDDDEWWVAAEESLKQ  579

Query  1750  T  1752
              
Sbjct  580   V  580



>ref|XP_004157215.1| PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain-containing 
protein 111 homolog [Cucumis sativus]
Length=489

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/498 (59%), Positives = 363/498 (73%), Gaps = 24/498 (5%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQS-----TEKILQTTADADHS  186
             DDVDRLFECFKCG SPPQSA+  +K+ K   K E S   ++      E+  +  +    +
Sbjct  7     DDVDRLFECFKCGVSPPQSAVRRKKKRKSKVKPECSVNFETPVSGPVEETEENASSIQDT  66

Query  187   VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQK--KLS  360
             VE +  +   +   S   +F P+VFYGSP GVPPKRP+SL RLL EIRVDLSEQ   KLS
Sbjct  67    VEKIALTSKDKGSRS---KFSPIVFYGSPRGVPPKRPSSLWRLLREIRVDLSEQSRFKLS  123

Query  361   QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +++WATFP+Q EA+K++ +  +  +FSYQDH NG RRFLVS+Y +FW RYKSM+ K RHH
Sbjct  124   KQVWATFPRQEEAIKFSREHTDVHIFSYQDHFNGQRRFLVSSYSEFWHRYKSMDAKCRHH  183

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVIQEG PCHLYFDLE++K+ N  KNGDEMVD LI  V   L +KYS++GS DW++ELD
Sbjct  184   YEVIQEGAPCHLYFDLEYSKRINTGKNGDEMVDSLISVVLQALNEKYSIQGSFDWVLELD  243

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVG  900
             SS E+KFSRHLIIR+PK+AFKDNSH GAF  E+CSRI  S++ + R+ +LF+ K S S  
Sbjct  244   SSNEEKFSRHLIIRVPKVAFKDNSHAGAFVGEICSRI-CSAKVEGRYEELFIKKIS-STE  301

Query  901   IPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDAD  1080
              P+ LFVDNAVYSRNRCFRLALSSKAGK+SVL+P+GR  C  M E++MFMASLICN+DAD
Sbjct  302   RPSHLFVDNAVYSRNRCFRLALSSKAGKTSVLLPTGRHACTKMCEEDMFMASLICNVDAD  361

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
             CE+LLVCKMD DC++TL F  E++ +  +             +S  S   + GK P   +
Sbjct  362   CEKLLVCKMDLDCIKTLQFEMEVSSNVDKF-----------VQSVASNGNVAGKLPVFTM  410

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
                +  I    +  GKIR WYWFSE+GLIVYSMS NRYCERIGREHKSNHVMYVVDLRR 
Sbjct  411   RQLL-VINLAAAFSGKIRCWYWFSEFGLIVYSMSSNRYCERIGREHKSNHVMYVVDLRRA  469

Query  1441  DYYQKCHDPDCKGYRSPL  1494
              YYQKCHDPDC+GYRSPL
Sbjct  470   AYYQKCHDPDCRGYRSPL  487



>ref|XP_010060347.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Eucalyptus grandis]
Length=564

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/564 (57%), Positives = 388/564 (69%), Gaps = 57/564 (10%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKIL---------QTTA  171
             MDDVDRLF+CFKCG SPP+SA+ ERKR KR  +   S  + S    L             
Sbjct  1     MDDVDRLFKCFKCGISPPESALRERKRSKRKCQEGSSVHEGSASSALSPGSSGLRRNEAT  60

Query  172   DADHSVENLGSSKPK-RKY-HSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSE  345
             D     E LGS+  + RK+    G    P+VFYGSP+GVPPKRP+SLLRLL+EIRVDL+ 
Sbjct  61    DVQLCTEKLGSTTIRARKFSQKRGVHISPVVFYGSPNGVPPKRPSSLLRLLNEIRVDLAA  120

Query  346   QK--KLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSM  519
             Q   KL +EIW TFP+Q EAMK+A+     RVFSYQDH NG RRFLVS+Y++FWKRY +M
Sbjct  121   QNSSKLRKEIWTTFPRQDEAMKFAKAHPEVRVFSYQDHCNGQRRFLVSSYQEFWKRYNNM  180

Query  520   NPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSH  699
             +PK RHHYEVIQEGLPCH+YFDLEFNK+ N DKNG+EMVDLLI+ V + LL KYS++G+ 
Sbjct  181   DPKLRHHYEVIQEGLPCHVYFDLEFNKRENVDKNGEEMVDLLILVVLEVLLDKYSIQGNE  240

Query  700   DWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVS  879
             +W+VELDSSTE+KFS HLI+R+PK AFKDNSHVGAF +EVCSRI S+ ETD+R+ KLFV 
Sbjct  241   EWVVELDSSTEEKFSCHLILRIPKTAFKDNSHVGAFVSEVCSRISSARETDKRYEKLFVK  300

Query  880   KDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASL  1059
             KDS +     Q+FVD AVYSRNRCFRLALSSKAGKSSVL+P+GRFKCK+M          
Sbjct  301   KDSSTST--CQIFVDTAVYSRNRCFRLALSSKAGKSSVLLPTGRFKCKDM----------  348

Query  1060  ICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMG  1239
                ++AD  R  +                   + Q+ +F       N+  SD S  Y + 
Sbjct  349   ---VNADIGRYNL-------------------ALQERNF-------NSLPSDNSANYFID  379

Query  1240  KSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMY  1419
             KSPFP +D F+E +AS+G+V GKIRSWYWFSE+GL+VY+M +NR+CERIGREHKSNHV+Y
Sbjct  380   KSPFPMLDKFIESVASIGTVSGKIRSWYWFSEHGLMVYNMLRNRFCERIGREHKSNHVIY  439

Query  1420  VVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD--LDSNNEGREHTPVATDA  1593
             VVDL    YYQKCHDPDCKGYRSPLR IP + +   S  FD    +N     +  +  D 
Sbjct  440   VVDLNWAAYYQKCHDPDCKGYRSPLRLIPEDSVPDLSAFFDSVQMANPPDVTNNVLDNDE  499

Query  1594  NIVD-SCKKEWWLEAIRFAEQVEG  1662
             N  + S    WWLEAIR A  VE 
Sbjct  500   NTANCSPMDAWWLEAIRVANAVEN  523



>ref|XP_002864194.1| hypothetical protein ARALYDRAFT_495344 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40453.1| hypothetical protein ARALYDRAFT_495344 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/480 (61%), Positives = 368/480 (77%), Gaps = 18/480 (4%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSA------------QKQSTEKI  156
             N+MDDVDRLF+CFKCG SPP SA+ E+KR K+    E+ +             + S +K 
Sbjct  8     NAMDDVDRLFQCFKCGISPPASAMREKKRSKKMVNPENDSPGTCKKLQLSSLSRLSGKKG  67

Query  157   LQTTADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVD  336
              +   D   S++++  S+  +K  S G+QF P+VFYGSP+GVPPKRP SLLRLL EIR+D
Sbjct  68    QRNQIDGGVSLDSVSGSRNVKK--SVGRQFSPIVFYGSPNGVPPKRPLSLLRLLREIRID  125

Query  337   LSEQKKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRY  510
             LSE++K    + +WATFP+Q EA+K+ ++  N R+FSYQDH +G RRFLVSTYE+FW RY
Sbjct  126   LSEERKAISRKGVWATFPRQDEAIKFGKRHDNVRIFSYQDHFSGQRRFLVSTYEEFWNRY  185

Query  511   KSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLE  690
             KSM+P+ RHHYEVIQEGLPCH+YFDLEFN+K N  KN DEMVD+L+  + + L +KY++E
Sbjct  186   KSMDPRHRHHYEVIQEGLPCHMYFDLEFNQKENEGKNVDEMVDILVSVILEALHEKYAIE  245

Query  691   GSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKL  870
             G  DWIVELDSST+DKFSRH+I+ +PK+AFKDNSHVGAF  E+CSRI ++ ETDER RKL
Sbjct  246   GQEDWIVELDSSTKDKFSRHVIVIIPKVAFKDNSHVGAFVGELCSRIVNAKETDERLRKL  305

Query  871   FVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFM  1050
             FV K++      + LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M E ++FM
Sbjct  306   FVHKEANDSA--SLLFVDTAVYSRNRCFRLALSSKAGKASVLLPTGRFKCKDMGEPDVFM  363

Query  1051  ASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTY  1230
              SLICNI++DCE+LLVCKM+SDC++TL F+TE+  +        Q F+L+   SD S +Y
Sbjct  364   TSLICNIESDCEKLLVCKMESDCMKTLCFDTEVNSNNLVRDQNAQRFQLDACTSDMSTSY  423

Query  1231  LMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNH  1410
               GKSPFP +D FVE  AS G+VPGKIR WYWFSE GLIVYSM +NRYCERIGREHKSNH
Sbjct  424   FGGKSPFPQLDQFVESTASTGNVPGKIRCWYWFSEDGLIVYSMLRNRYCERIGREHKSNH  483



>ref|XP_006657679.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
[Oryza brachyantha]
Length=613

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/603 (51%), Positives = 393/603 (65%), Gaps = 33/603 (5%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIERKR--GKRTTKSEDSAQKQSTEKILQTTADADHSVEN  195
             DDVDRLF CFKCG SPPQSA  ER R  GKR+ +   +A          +T   D + E 
Sbjct  10    DDVDRLFACFKCGVSPPQSAFRERPRRAGKRS-RVASAADCSGGGGCSSSTPTPDSAAEK  68

Query  196   LGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKL--SQEI  369
              G+        +  +Q  P+VFYGSP GVP KRP SLLRLL EIR+DL +Q  L  S  +
Sbjct  69    YGAPSSAAIKFTGRRQMSPVVFYGSPQGVPVKRPLSLLRLLREIRIDLKKQTDLVPSAGV  128

Query  370   WATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEV  549
             WATFP+Q EA+++ +      VFSYQDH++G RRFLVSTY++FWKRY +M+P+ RHHYEV
Sbjct  129   WATFPRQEEAIRFCKAHEYTNVFSYQDHLSGQRRFLVSTYDEFWKRYNNMDPQIRHHYEV  188

Query  550   IQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSST  729
             IQ+G PCH+YFDLEF+ + N  ++ DEMVD+L+   F  L  KYS+EG  +WI+ELDSST
Sbjct  189   IQDGSPCHIYFDLEFDPRLNKMRDPDEMVDILVAVTFSALHDKYSIEGQEEWIIELDSST  248

Query  730   EDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPA  909
             E+KFSRHLIIR+PK AFKDNSHVGAF +E+CSRI +    +  F KL+++KD    G   
Sbjct  249   EEKFSRHLIIRIPKTAFKDNSHVGAFISEICSRIAAQRAANPNFEKLYITKDRSCTGPSD  308

Query  910   QLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCER  1089
              LF+D AVYSRNRCFRLA SSK+GK S L+ +GRFK KNM++ E+FM SLIC +D DC++
Sbjct  309   HLFMDTAVYSRNRCFRLAFSSKSGKKSFLVATGRFKYKNMNDKELFMKSLICRLDDDCDK  368

Query  1090  LLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAF  1269
             LL CK+D DC +TL F++E +    Q         +  + SD   +   G SPFP +D F
Sbjct  369   LLTCKLDLDCKKTLQFDSEASMIRIQGR---NKDSIGTYRSDFPVSNTYGISPFPALDGF  425

Query  1270  VEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYY  1449
             +E IAS G+V GKIR WYWFS YGL++YSMS++RYCE IGREHKSNHVMY+V+ +R  YY
Sbjct  426   IESIASFGNVSGKIRCWYWFSHYGLMIYSMSRSRYCEHIGREHKSNHVMYIVEFQRAAYY  485

Query  1450  QKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKKE---  1620
             QKC+DPDC+GYRSPLR +P +VI   S      S++  RE+       NI  S + E   
Sbjct  486   QKCYDPDCQGYRSPLRAVPWDVIPELSSI----SDSAQREYQGEVVAINIEGSNRNEYIS  541

Query  1621  ---------------WWLEAIRFAEQVEGIPKAleisgd---geleededWWKAAERIAT  1746
                            WW EA++FA+ +E    A    G        +D DWW  AERI  
Sbjct  542   NGTKSVFGSGEDDPSWWEEAVKFADSIENTDHADHAPGSCDQENDSDDADWWMDAERIMV  601

Query  1747  QTE  1755
             Q E
Sbjct  602   QIE  604



>ref|NP_001141209.1| hypothetical protein [Zea mays]
 gb|ACF85719.1| unknown [Zea mays]
 tpg|DAA62549.1| TPA: hypothetical protein ZEAMMB73_381074 [Zea mays]
Length=631

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/567 (51%), Positives = 379/567 (67%), Gaps = 33/567 (6%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIER-----KRGKRTTKSEDSAQKQSTEKILQTTADADHS  186
             DDVDRLF CFKCG SPP+SA  ER     K+ + +  SE +     +   + TT DA   
Sbjct  8     DDVDRLFACFKCGVSPPKSAFRERPLPQAKKSRGSPVSETAGSGGRSSSDVSTTPDAAAD  67

Query  187   VENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQE  366
                   + P     +  K   P VFYGSP GV  KRP S LRLLH IR+DL +Q   +  
Sbjct  68    ----KRAAPSSAKSTGRKHMSPFVFYGSPRGVQVKRPQSFLRLLHVIRIDLKKQTDFNPR  123

Query  367   --IWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
               +WATFP+Q EA+++++   +  VF YQ+H++G RRFLVSTY++FWKRY  M+ K RHH
Sbjct  124   DVVWATFPRQDEAIRFSKAYAHTNVFCYQEHMSGTRRFLVSTYDEFWKRYNDMDSKIRHH  183

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVIQE  PCH+YFDLEF+ + N  ++ DEMVD+LI  VF  L  KYS+EG  +WI ELD
Sbjct  184   YEVIQEASPCHIYFDLEFDTRLNKKRDTDEMVDILIAVVFSALRDKYSIEGHEEWITELD  243

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVG  900
             SSTE+KFSRHLIIR+PKIAFKDNSHVGAF  EVCS+I +   T+    KL+++K+  S G
Sbjct  244   SSTEEKFSRHLIIRIPKIAFKDNSHVGAFVCEVCSQIAAQRTTNHDLDKLYITKEISS-G  302

Query  901   IPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDAD  1080
                +LF+D AVYSRNRCFRL  SSK+GK S L+P+ RFKC+ +++ ++FM SLIC +D +
Sbjct  303   PVDRLFMDTAVYSRNRCFRLVFSSKSGKKSFLVPTKRFKCQELNDKDVFMESLICRLDDN  362

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
             CE+LL+CK+D +C +TLHF++EI+ S  Q+        +  +++D S  Y  GKSPFPP+
Sbjct  363   CEKLLICKLDLECKKTLHFDSEISMS--QIQGRSYRHRIATYQNDFSHAYTCGKSPFPPL  420

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D F+E IAS G+V GKIRSW+WFS+  LI+Y+M ++RYCE IGREHK NHV Y+VD +R 
Sbjct  421   DGFIESIASFGNVSGKIRSWFWFSQESLIIYNMLRSRYCENIGREHKGNHVFYIVDFQRA  480

Query  1441  DYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKK-  1617
              YYQKCHDPDC+GYRSPLRP+P +VI     S  +       E+   A + NI +S    
Sbjct  481   AYYQKCHDPDCRGYRSPLRPVPWDVIPELVESDQI-------EYQGHAMETNIENSSMSG  533

Query  1618  -----------EWWLEAIRFAEQVEGI  1665
                        EWW + + FA+ +E +
Sbjct  534   KSITGAGAEDPEWWEQVVEFADSIENM  560



>gb|EMT07272.1| Coiled-coil domain-containing 111-like protein [Aegilops tauschii]
Length=638

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/650 (45%), Positives = 398/650 (61%), Gaps = 88/650 (14%)
 Frame = +1

Query  13    NSMDDVDRLFECFKCGFSPPQSA--IIERKRGK--RTTKSEDSAQKQSTEKILQTTADAD  180
             +S DDVDRLF CFKCG SPPQSA  +  R++GK  R T S +     S+     T    +
Sbjct  3     SSKDDVDRLFACFKCGVSPPQSAFRVRPRQQGKKLRVTPSAEGDGGGSSSSSASTRKAGE  62

Query  181   HSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLS  360
             ++ E+   S    K+  N KQ  P+VFYGSP GVP K+P SLLRLL EI +DL +Q  L 
Sbjct  63    NASEHREPSSAAIKFR-NRKQMSPVVFYGSPQGVPVKKPMSLLRLLREIHIDLKKQTDLI  121

Query  361   QE--IWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRR  534
                 +WATFP+Q EA++++++  + +VFSYQDH++G RRFLVST+++FW+RY +M+P+ R
Sbjct  122   SRDVVWATFPRQDEAIRFSKEHAHTKVFSYQDHLSGQRRFLVSTHDEFWRRYNNMDPQIR  181

Query  535   HHYEVIQE----------------------------------------------GLPCHL  576
             HHYEVIQE                                              G PCH+
Sbjct  182   HHYEVIQEASLHIFVLKMVTNYMLHGSLHRKFCISPYFHVLVPCYDGEDVRKESGSPCHI  241

Query  577   YFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHLI  756
             YFDLEFN K N  ++ DEMVD L+   F  L  KYS+EG  +WI+ELDSS E+KFSRHLI
Sbjct  242   YFDLEFNAKLNQKRDADEMVDTLVAVTFSALQDKYSIEGQEEWIIELDSSNEEKFSRHLI  301

Query  757   IRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVY  936
             IR+PK AFKDNSHVGAF +E+CSRI +    +    KL+++KDS +  +  QLFVD AVY
Sbjct  302   IRIPKTAFKDNSHVGAFISEICSRIAAQRAANPNLDKLYITKDSGAEPVD-QLFVDTAVY  360

Query  937   SRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLVCKMDSD  1116
             SRNRCFRLA SSK+GK S L+ +GRFKCKNM++ E+FM SLIC +D DC++LL+CK+D +
Sbjct  361   SRNRCFRLAFSSKSGKKSFLVATGRFKCKNMNDKELFMESLICRLDDDCDKLLICKLDLE  420

Query  1117  CVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGS  1296
             C + LHF+TE   S  ++        ++ + SD  + Y  G+SPFP +D F+E IAS GS
Sbjct  421   CKKALHFDTE--ASVTRIQGKNCRVTIDTYRSDFPQAYTYGRSPFPALDGFIESIASFGS  478

Query  1297  VPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCK  1476
             V GKIR WYWFS+ GL++YSMS++RY             MY+VD +R  YYQKC+DPDC+
Sbjct  479   VSGKIRCWYWFSQDGLMIYSMSRSRY------------FMYIVDFQRAAYYQKCYDPDCR  526

Query  1477  GYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDAN----------IVDSCKKE--  1620
             GYRSPLR +P +VI   + S    + +  R++     + N          ++ S ++E  
Sbjct  527   GYRSPLRAVPLDVIPELTTSI---AGSARRDYQGNVVEINMEGGGNYGNSVMGSGEEEEE  583

Query  1621  ---WWLEAIRFAEQVEGIPKA--leisgdgeleededWWKAAERIATQTE  1755
                WW EA++FA+ VE +  A     + +    +D DWW   ER   Q E
Sbjct  584   DPGWWEEAVKFADSVENVGHAPPASCNLEDGGCDDADWWTDVERFMVQME  633



>ref|XP_010261360.1| PREDICTED: DNA-directed primase/polymerase protein isoform X5 
[Nelumbo nucifera]
Length=558

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/577 (50%), Positives = 357/577 (62%), Gaps = 100/577 (17%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQK----------QSTEKILQTT  168
             MDDVDRLFECFKCG SPPQSA+ ER+  +   K   S Q            S  +  Q T
Sbjct  6     MDDVDRLFECFKCGVSPPQSAVRERRAHQDKLKKASSRQDVSALSSFASPSSARQKPQKT  65

Query  169   ADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQ  348
             AD    +EN G++  K    S+GKQ  P++FYGSP+GVP KRP  LL+LL+EIR DL+ Q
Sbjct  66    ADL-LCMENPGTTMAKAIAFSSGKQLSPVIFYGSPYGVPAKRPYRLLKLLNEIREDLTTQ  124

Query  349   KKLS--QEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMN  522
               L   +++WATFP+Q EA+K+A+    A VFSYQDH+NG RRFLVSTY +FW+RYK+M+
Sbjct  125   NSLQSREDVWATFPRQDEAIKFAKGHAYAHVFSYQDHLNGQRRFLVSTYAEFWRRYKNMD  184

Query  523   PKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHD  702
             PK RHHYEVIQEGLPCHLYFDLEFNK+AN  KNGDEMVDLLI  + D L  KYS++G+ +
Sbjct  185   PKFRHHYEVIQEGLPCHLYFDLEFNKRANDGKNGDEMVDLLISIILDALFDKYSIQGNQE  244

Query  703   WIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSK  882
             WI+ELDSSTE                                        E+F +  +  
Sbjct  245   WIIELDSSTE----------------------------------------EKFSRHLI--  262

Query  883   DSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLI  1062
                 + IP   F DN                       + +G F  +  SE+EMFMASLI
Sbjct  263   ----IRIPKTAFKDN-----------------------LHAGAFVAE--SEEEMFMASLI  293

Query  1063  CNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGK  1242
             CN+D DC++LL+CKM+ DCV+TL F++E+  +F Q S +      +    D   TY MGK
Sbjct  294   CNMDTDCKKLLICKMEFDCVKTLCFDSEVNGNFGQHSGSSNELAWHACTKDVPTTYFMGK  353

Query  1243  SPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYV  1422
             SPFP +DAFVE IAS+G+V G+IRSWYWFSEYGL+VYSMSKNRYCERIGR+HKSNHVMY+
Sbjct  354   SPFPTLDAFVESIASIGNVAGRIRSWYWFSEYGLMVYSMSKNRYCERIGRQHKSNHVMYI  413

Query  1423  VDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSF--------------DLDSN-N  1557
             VDLRR  YYQKC+DPDCKGYRSPLRPIPG+V                      DL    +
Sbjct  414   VDLRRAVYYQKCYDPDCKGYRSPLRPIPGDVFPDTMAVLKSLQMEHPGEMIYNDLHQGYD  473

Query  1558  EGREHTPVATDANIVDSCKKE-WWLEAIRFAEQVEGI  1665
             E        ++ N+ DSC K+ WWLEAIR A+ +E I
Sbjct  474   ENNLELSSYSNKNVTDSCMKDGWWLEAIRMADDIESI  510



>ref|XP_006829019.1| hypothetical protein AMTR_s00001p00249650 [Amborella trichopoda]
 gb|ERM96435.1| hypothetical protein AMTR_s00001p00249650 [Amborella trichopoda]
Length=572

 Score =   536 bits (1380),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 278/569 (49%), Positives = 365/569 (64%), Gaps = 52/569 (9%)
 Frame = +1

Query  52    KCGFSPPQSAIIERKR-----GKRTTKSEDS------AQKQSTEKILQTTADADHSVENL  198
             K G   P+  +  RK+     G+ +++ ++       A   S  K  QT  +   S+E +
Sbjct  20    KLGLDLPEPMMKARKKSCELIGQTSSRCQEPSGYAEFASPGSPTKRQQTMLNKQLSIEKV  79

Query  199   GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQEIWAT  378
              +        +  KQ  P +FYGS HG P KR   +LRLL +I  DL E   L +EIWAT
Sbjct  80    NTPV------TAHKQISPGIFYGSAHGAPAKRQHQVLRLLRDICEDLKEHSDLRKEIWAT  133

Query  379   FPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQE  558
             FP+Q +AM++AE      +FS+QDH +G RRFLVSTYE+FW+RYK+M  K RHHYEVI+E
Sbjct  134   FPRQDQAMRFAESHGQVPIFSFQDHFSGQRRFLVSTYEEFWRRYKNMASKFRHHYEVIKE  193

Query  559   GLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDK  738
             G+PCHLYFDLEFN   NA++NGDEMVDLLI  +FD + +KYS++G  +WI+ELDSST +K
Sbjct  194   GMPCHLYFDLEFNTLLNAERNGDEMVDLLISVIFDAISEKYSIQGKLEWILELDSSTTEK  253

Query  739   FSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLF  918
             FSRHLII +P +AFKDN HVGAF  E+CSRI S+ + D R   L+V KD +++  P QLF
Sbjct  254   FSRHLIIHIPNVAFKDNLHVGAFVTELCSRISSTRDGDSRLSLLYVMKD-ENIESPQQLF  312

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLV  1098
             +D AVYSRNRCFRL LSSKAGK SVL+P+GRFKCKN++E ++F+ SLIC +D DC R ++
Sbjct  313   IDTAVYSRNRCFRLVLSSKAGKKSVLLPTGRFKCKNLNEQDIFLESLICRMDLDC-RTML  371

Query  1099  CKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEY  1278
             C                  S   +S  P+A       S  +  Y    SPF  +DAF+E 
Sbjct  372   CD----------------DSQVNISDIPRATMPRTCTSHITGQYFSAASPFAKLDAFIES  415

Query  1279  IASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKC  1458
             +A VG+VPG+IRSWYWFSE+GL++Y++  NR+CERIGREHKSNHVMYVVD R+  YYQKC
Sbjct  416   VACVGNVPGRIRSWYWFSEHGLMIYNIIGNRFCERIGREHKSNHVMYVVDFRKAGYYQKC  475

Query  1459  HDPDCKGYRSPLRPIPGNVIAHCSVSFD---LDSN------------NEGREHTPVATDA  1593
             +DPDC+G+RSPLRPIP   I   S  +D   L+ N            NEG  +  +  + 
Sbjct  476   YDPDCRGFRSPLRPIPWGFIPDDSGIYDSIPLEKNERTVDIDFNLQLNEGNGNPLLHDNL  535

Query  1594  NIVDSCKKE--WWLEAIRFAEQVEGIPKA  1674
              I +S K +  WW E +R A  +E   K 
Sbjct  536   KICESSKTDSRWWKEVLRTAIDIESTRKT  564



>ref|NP_001032064.1| DNA primase [Arabidopsis thaliana]
 gb|AAU44591.1| hypothetical protein AT5G52800 [Arabidopsis thaliana]
 gb|AED96262.1| DNA primase [Arabidopsis thaliana]
Length=450

 Score =   530 bits (1366),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 261/448 (58%), Positives = 331/448 (74%), Gaps = 14/448 (3%)
 Frame = +1

Query  4     VQDNSMDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSE-DSAQKQSTEKILQTTADAD  180
             +  NSMDDVDRLF+CFKCG SPP SA+ E+KR K+   SE DS       ++   +  + 
Sbjct  5     LSSNSMDDVDRLFQCFKCGISPPASAMREKKRSKKMLNSEYDSPVTCKKLQLSSLSRLSG  64

Query  181   HSVEN---------LGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRV  333
                E             S  +    S G+QF P+VFYGSP+GVPPK+P SLLRLL EIR+
Sbjct  65    KRGERNQIDGSVSVDSVSGSRDVKKSVGRQFSPIVFYGSPNGVPPKKPLSLLRLLREIRI  124

Query  334   DLSEQKKL--SQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKR  507
             DLSE++K    + +WATFP+Q EA+K+ ++  N R+FSYQDH +G RRFLVS+YE+FWKR
Sbjct  125   DLSEERKAISRKGVWATFPRQEEAIKFEKRHDNVRIFSYQDHFSGQRRFLVSSYEEFWKR  184

Query  508   YKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSL  687
             Y SM+P+ RHHYEVIQEGLPCH+YFDLEFN+K N  KN DEMVD+LI  + + L +KY++
Sbjct  185   YLSMDPRHRHHYEVIQEGLPCHMYFDLEFNQKENEGKNVDEMVDILISVILEALREKYAI  244

Query  688   EGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRK  867
             EG  DWIVELDSST+DKFSRH+I+ +PK+AFKDNSHVGAF  E+CSRI ++ ETDER RK
Sbjct  245   EGQEDWIVELDSSTKDKFSRHVIVIIPKVAFKDNSHVGAFVGELCSRIVNAKETDERLRK  304

Query  868   LFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMF  1047
             LFV K++      + LFVD AVYSRNRCFRLALSSKAGK+SVL+P+GRFKCK+M E ++F
Sbjct  305   LFVHKEANDSA--SLLFVDTAVYSRNRCFRLALSSKAGKTSVLLPTGRFKCKDMGERDVF  362

Query  1048  MASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRT  1227
             M SLICN+++DCE+LLVCKM+SDC++TL F+TE+  +        Q F+LN   SD S +
Sbjct  363   MTSLICNVESDCEKLLVCKMESDCMKTLCFDTEVNSNNLVRDQNAQKFQLNASTSDMSTS  422

Query  1228  YLMGKSPFPPVDAFVEYIASVGSVPGKI  1311
             Y  GKSPFP +D F+E  AS G+VPG I
Sbjct  423   YFGGKSPFPQLDQFIESTASTGNVPGCI  450



>gb|AES75633.2| DNA primase [Medicago truncatula]
Length=665

 Score =   530 bits (1365),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 251/396 (63%), Positives = 308/396 (78%), Gaps = 2/396 (1%)
 Frame = +1

Query  352   KLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKR  531
             K  +E+W TF KQ EA+K+A+   +  +F YQDH+NGYRRFLV+TY +FW+RYK+M+ K 
Sbjct  239   KEGKEVWFTFSKQNEAIKFAKGQEDVHLFCYQDHLNGYRRFLVTTYTEFWQRYKTMDSKT  298

Query  532   RHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
             RH YEVIQEGLPCHLYFDLEFN+K N  KNGDEMV+LLI  V + L +KY + G  DWIV
Sbjct  299   RHFYEVIQEGLPCHLYFDLEFNRKVNVGKNGDEMVNLLISTVLEALHEKYEILGDQDWIV  358

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSK  891
             ELDSSTEDKFSRHLIIR+PK AFKDNSH GAF +E+CSRI ++   D+ + KLF++KDS 
Sbjct  359   ELDSSTEDKFSRHLIIRIPKAAFKDNSHAGAFVSEICSRILNARGKDKSYEKLFIAKDSI  418

Query  892   SVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNM--SEDEMFMASLIC  1065
             +     QLFVDNAVYSRNRCFRL LSSKA K+S+L+P+ RFKCKN+  SE+++FMASLIC
Sbjct  419   TNESVGQLFVDNAVYSRNRCFRLHLSSKAEKTSILLPTERFKCKNLGQSEEDIFMASLIC  478

Query  1066  NIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKS  1245
             N+D DC  LLV K DSDCV+T HF+T++  +      +   F LN   SD S TY  GKS
Sbjct  479   NMDVDCGELLVGKPDSDCVKTQHFDTKLNCNVGNSVQSHPEFTLNTCTSDVSTTYYKGKS  538

Query  1246  PFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVV  1425
             PFP +D F+  +AS+G++PGKI SWY +SE G +VY+M+KNRYCERIGR HKSN+VMYVV
Sbjct  539   PFPSLDEFILSVASMGNIPGKIHSWYLYSESGFMVYNMTKNRYCERIGRHHKSNNVMYVV  598

Query  1426  DLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSV  1533
             DLRR  YYQKCHDPDCKGYRS  RPIP +V ++ SV
Sbjct  599   DLRREVYYQKCHDPDCKGYRSSSRPIPVHVFSNSSV  634



>gb|EPS68297.1| hypothetical protein M569_06472, partial [Genlisea aurea]
Length=444

 Score =   519 bits (1337),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 272/470 (58%), Positives = 328/470 (70%), Gaps = 32/470 (7%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKILQTTADADHSVENL  198
             MDDVDRLFECFKCG SPPQSA  E++  KR      S Q +  +             +N 
Sbjct  1     MDDVDRLFECFKCGISPPQSATGEKRAEKRKVMQRCSYQLEEDDD------------DNR  48

Query  199   GSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLH-EIRVDLSEQKKLSQEIWA  375
               ++ KR     G      VFYGSP+GVPPKRPA  L  L  EIRVDL+E+K    +IW+
Sbjct  49    NLNRKKRPSFPAG------VFYGSPNGVPPKRPARRLLRLLREIRVDLAEEKNFRDKIWS  102

Query  376   TFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKR---YKSMNPKRRHHYE  546
             TFPKQ EA+K  +Q  NA VF YQDH  G RRFLVSTY++FW R   YK M+ + RHHYE
Sbjct  103   TFPKQDEAIKLVKQHPNAHVFCYQDHRTGQRRFLVSTYKEFWLRKALYKEMDSRFRHHYE  162

Query  547   VIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSS  726
             VIQEGLPCHLYFDLEFNKK N  +NGDEMVDLLI  VF  L+ KYS+    D ++ELDSS
Sbjct  163   VIQEGLPCHLYFDLEFNKKENTGRNGDEMVDLLITVVFHALVDKYSITADEDCLIELDSS  222

Query  727   TEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIP  906
             TE+KFSRHLIIRLP +AFKDNSHVGAF  E+CSRI    + D+++  LFV+K +      
Sbjct  223   TEEKFSRHLIIRLPNVAFKDNSHVGAFVDEICSRIRKCRDEDDKYATLFVTKSTSCADGT  282

Query  907   AQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKN-MSEDEMFMASLICNI-DAD  1080
             + LFVD AVY+RNRCFRLA SSKAGKSS L+PSGRF+ K  M E+E+FMASLICNI +A+
Sbjct  283   SHLFVDPAVYTRNRCFRLAFSSKAGKSSFLLPSGRFQVKEIMKEEEVFMASLICNIEEAN  342

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
              ++LL+CKMDS+CV+TLHF TE      +    P  F        P+ T   G+SPFP +
Sbjct  343   TDKLLICKMDSECVKTLHFETENTSDSLKHPCRPLNFA-------PA-TCSSGRSPFPSL  394

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNH  1410
             D F+E +AS G+V G+IR+WYWFSE  L+VYSMS+NRYCERIGREHKSNH
Sbjct  395   DLFIEAVASSGNVSGRIRAWYWFSEDALVVYSMSRNRYCERIGREHKSNH  444



>ref|XP_003619415.1| Coiled-coil domain-containing protein [Medicago truncatula]
Length=705

 Score =   521 bits (1343),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 254/436 (58%), Positives = 312/436 (72%), Gaps = 42/436 (10%)
 Frame = +1

Query  352   KLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKR  531
             K  +E+W TF KQ EA+K+A+   +  +F YQDH+NGYRRFLV+TY +FW+RYK+M+ K 
Sbjct  239   KEGKEVWFTFSKQNEAIKFAKGQEDVHLFCYQDHLNGYRRFLVTTYTEFWQRYKTMDSKT  298

Query  532   RHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
             RH YEVIQEGLPCHLYFDLEFN+K N  KNGDEMV+LLI  V + L +KY + G  DWIV
Sbjct  299   RHFYEVIQEGLPCHLYFDLEFNRKVNVGKNGDEMVNLLISTVLEALHEKYEILGDQDWIV  358

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSK  891
             ELDSSTEDKFSRHLIIR+PK AFKDNSH GAF +E+CSRI ++   D+ + KLF++KDS 
Sbjct  359   ELDSSTEDKFSRHLIIRIPKAAFKDNSHAGAFVSEICSRILNARGKDKSYEKLFIAKDSI  418

Query  892   SVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNM--SEDEMFMASLIC  1065
             +     QLFVDNAVYSRNRCFRL LSSKA K+S+L+P+ RFKCKN+  SE+++FMASLIC
Sbjct  419   TNESVGQLFVDNAVYSRNRCFRLHLSSKAEKTSILLPTERFKCKNLGQSEEDIFMASLIC  478

Query  1066  NIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSF-----------------------  1176
             N+D DC  LLV K DSDCV+T HF+T++   F+ +SF                       
Sbjct  479   NMDVDCGELLVGKPDSDCVKTQHFDTKVILGFKIISFHCIKFIVKKRTTRCSKAPAYVES  538

Query  1177  -----------------TPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPG  1305
                              +   F LN   SD S TY  GKSPFP +D F+  +AS+G++PG
Sbjct  539   RKGSHHLLNCNVGNSVQSHPEFTLNTCTSDVSTTYYKGKSPFPSLDEFILSVASMGNIPG  598

Query  1306  KIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYR  1485
             KI SWY +SE G +VY+M+KNRYCERIGR HKSN+VMYVVDLRR  YYQKCHDPDCKGYR
Sbjct  599   KIHSWYLYSESGFMVYNMTKNRYCERIGRHHKSNNVMYVVDLRREVYYQKCHDPDCKGYR  658

Query  1486  SPLRPIPGNVIAHCSV  1533
             S  RPIP +V ++ SV
Sbjct  659   SSSRPIPVHVFSNSSV  674



>gb|EEE67132.1| hypothetical protein OsJ_24177 [Oryza sativa Japonica Group]
Length=587

 Score =   515 bits (1326),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 278/600 (46%), Positives = 368/600 (61%), Gaps = 51/600 (9%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIERKR--GKRT--TKSEDSAQKQSTEKILQTTADADHSV  189
             DDVDRLF CFKCG SPPQSA  ER R  GKR+    + D            +T   D + 
Sbjct  8     DDVDRLFACFKCGVSPPQSAFRERPRRAGKRSRVASTADGGGGGGGGSSSSSTPTPDAAE  67

Query  190   ENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKL--SQ  363
             ++   S    K+ +  KQ  P+VFYGSP GVP K+P SLLRLL EIR+DL +Q  L  S 
Sbjct  68    KHEAPSSAVIKF-TGRKQMSPVVFYGSPQGVPVKKPLSLLRLLREIRIDLKKQTDLVPSA  126

Query  364   EIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHY  543
              +WATFP+Q EA+++ +      VFSYQDH++G RRFLVSTY++FWKRY +M+P+ RHHY
Sbjct  127   GVWATFPRQEEAIRFCKAHAYTNVFSYQDHLSGQRRFLVSTYDEFWKRYNNMDPQIRHHY  186

Query  544   EVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDS  723
             EVIQ+G PCH+YFDLEF+ + N  ++ DEMVD+L+ A F  L  KYS+EG  +WI+ELDS
Sbjct  187   EVIQDGSPCHIYFDLEFDPRLNKMRDADEMVDILVAATFSALHDKYSIEGQEEWIIELDS  246

Query  724   STEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGI  903
             STE+KFSRHLIIR+PK AFKDNSHVGAF +E+CSRI S    +  F KL+++KDS   G 
Sbjct  247   STEEKFSRHLIIRIPKTAFKDNSHVGAFISEICSRIASQRAANPNFDKLYITKDSSCTGH  306

Query  904   PAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADC  1083
                LF+D AVYSRNRCFRLA SSK+GK S L+ + RFK KNMS+ E+FM SLIC +D DC
Sbjct  307   ADHLFMDIAVYSRNRCFRLAFSSKSGKKSFLVATERFKHKNMSDKELFMESLICRLDDDC  366

Query  1084  ERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVD  1263
              +LL CK+D DC +TLHF++E +    Q   +  +  +  + +D   +   G SPFP +D
Sbjct  367   HKLLTCKLDLDCKKTLHFDSEASMIRIQGRNSKDS--IGTYRNDFPVSNTYGISPFPALD  424

Query  1264  AFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGD  1443
              F+E IAS G+V                         C+  G +  S     +  + R  
Sbjct  425   VFIESIASFGNV-----------------------SVCQ--GVDTVSILEENIKAIMRAA  459

Query  1444  YYQKCHDPDCKGYRSPLRPIPGNVIAHCS--------------VSFDLDSNNEGREHTPV  1581
             YYQKC+DPDC+GYRSPLRP+P +VI   S              V  +++  N   E+   
Sbjct  460   YYQKCYDPDCQGYRSPLRPVPWDVIPELSSISDSAQREYQGEVVEINIEGRNRNDEYLCN  519

Query  1582  ATDANIVDSCKKE--WWLEAIRFAEQVEGIPKAleisgdgeleededWWKAAERIATQTE  1755
              T + + +S + +  WW EA++FA+ +E      +     +  +D DWW  AERI  Q E
Sbjct  520   GTKS-VTESGEDDPSWWEEAVKFADSIENTDHGPDTRDQDKDCDDADWWMDAERIMVQIE  578



>gb|KDO56812.1| hypothetical protein CISIN_1g008891mg [Citrus sinensis]
Length=549

 Score =   513 bits (1322),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 268/441 (61%), Positives = 323/441 (73%), Gaps = 19/441 (4%)
 Frame = +1

Query  19    MDDVDRLFECFKCGFSPPQSAIIERKRGKRTTKSEDSAQKQSTEKIL----------QTT  168
             MDDVDRLF+CFKCG SPP SA+ ERKR K   K + S Q+ ++   L          ++ 
Sbjct  1     MDDVDRLFQCFKCGISPPPSALRERKRSKNRLKQDCSKQEVASSSGLFSPGSAGNGHKSA  60

Query  169   ADADHSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQ  348
              D   S E LGSS  K K  ++GKQ  P+VFYG+PHGVPPKRP SLLRLL EIRVDLS++
Sbjct  61    TDVHFSSEKLGSSTVKAKGSNSGKQISPVVFYGTPHGVPPKRPLSLLRLLREIRVDLSKE  120

Query  349   --KKLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMN  522
                 L +EIWATFP+Q EA+ +A+   N R+FSYQDH NG RRFLVSTY++FW+RYK M+
Sbjct  121   DSSNLGKEIWATFPRQNEAIMFAKGHANVRIFSYQDHYNGQRRFLVSTYKEFWQRYKRMD  180

Query  523   PKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHD  702
              K RHHYEVIQEGLPCHLYFDLEFNK+ N + +GDEMVDLLI    + L  KYS++G  D
Sbjct  181   SKFRHHYEVIQEGLPCHLYFDLEFNKRVNPENHGDEMVDLLISVTLEALFDKYSIKGDED  240

Query  703   WIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSK  882
             WIVELDSSTE+KFSRHLIIR+PK AFKDNSH GAF AE+C+RI S+ E + +F  LFV K
Sbjct  241   WIVELDSSTEEKFSRHLIIRIPKTAFKDNSHAGAFVAEICARIKSAREREAKFESLFVMK  300

Query  883   DSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLI  1062
             DS S    ++LFVD AVYSRNRCFR+ALSSKAGK S L+PS RFKCK M E++MFMASLI
Sbjct  301   DSSSTESESELFVDTAVYSRNRCFRIALSSKAGKKSFLLPSERFKCKGMCEEDMFMASLI  360

Query  1063  CNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGK  1242
             CN+DADCE+LLVCKM+ DCV+TL F+TE+  +  +     Q   L+   S       +GK
Sbjct  361   CNMDADCEKLLVCKMELDCVKTLQFDTEVHDNLGKYCRASQECALSACSS-------VGK  413

Query  1243  SPFPPVDAFVEYIASVGSVPG  1305
             SPFP +D FVE IAS G+ PG
Sbjct  414   SPFPALDKFVECIASTGNDPG  434



>gb|KDP22216.1| hypothetical protein JCGZ_26047 [Jatropha curcas]
Length=386

 Score =   459 bits (1180),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 235/397 (59%), Positives = 284/397 (72%), Gaps = 28/397 (7%)
 Frame = +1

Query  631   MVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFT  810
             MVDLLI  + +  L+KYS++G+H+WIVELDSST +KFSRHLIIR+PK  FKDNSH GAF 
Sbjct  1     MVDLLISVILEAFLEKYSIQGNHEWIVELDSSTAEKFSRHLIIRIPKAGFKDNSHAGAFV  60

Query  811   AEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSS  990
             +E+CSRI S+ E D RF KLF+ KDS S     Q+F+D AVYSRNR FR+ALSSKAGKS+
Sbjct  61    SEICSRILSARERDGRFEKLFIRKDS-SAESTMQIFIDTAVYSRNRVFRVALSSKAGKSA  119

Query  991   VLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQM  1170
             +L+P+GRFKCK+M E++MFMASLICN+D DCE+LLVCKMD DCV+TLHF+TE    + + 
Sbjct  120   ILLPTGRFKCKDMCEEDMFMASLICNMDTDCEKLLVCKMDLDCVKTLHFDTE-ENCYSRR  178

Query  1171  SFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIV  1350
               T Q         + S TY MGKSPFP +D FVE IAS GS+ GKIRSWYWFSEYGLIV
Sbjct  179   YDTSQV--------NLSTTYTMGKSPFPFLDNFVESIASAGSLSGKIRSWYWFSEYGLIV  230

Query  1351  YSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVI----  1518
             YSMS+NRYCERIGR+HKSNHV+YV+DLRR  YYQKCHDPDC+GYRSPLRPIP N+I    
Sbjct  231   YSMSRNRYCERIGRQHKSNHVIYVIDLRRAVYYQKCHDPDCQGYRSPLRPIPINLIPDPS  290

Query  1519  -AHCSVSF-----------DLDSNNEGREHTPVATDANIVDSCKKE-WWLEAIRFAEQVE  1659
               H SV             D  S N G E   +  D +  DSC K+ WWLEA + A+ +E
Sbjct  291   FVHDSVQIANHMGLTSDTPDYQSVNSGCEGILLYNDEHDTDSCAKDSWWLEAAKVADDIE  350

Query  1660  GIPKAleisgdgeleededWWKAAERIATQTELAYLG  1770
                K L       + ED++WW A ER A+Q EL +  
Sbjct  351   SKQK-LVELSTLNVNEDDNWWMAVERTASQAELMHFS  386



>gb|ACN33809.1| unknown [Zea mays]
 tpg|DAA62550.1| TPA: hypothetical protein ZEAMMB73_381074 [Zea mays]
Length=571

 Score =   428 bits (1100),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 235/569 (41%), Positives = 322/569 (57%), Gaps = 97/569 (17%)
 Frame = +1

Query  22    DDVDRLFECFKCGFSPPQSAIIER-------KRGKRTTKSEDSAQKQSTEKILQTTADAD  180
             DDVDRLF CFKCG SPP+SA  ER        RG   +++  S  + S++      A AD
Sbjct  8     DDVDRLFACFKCGVSPPKSAFRERPLPQAKKSRGSPVSETAGSGGRSSSDVSTTPDAAAD  67

Query  181   HSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLS  360
                    +    RK+ S      P VFYGSP GV  KRP S LRLLH IR+DL +Q   +
Sbjct  68    KRAAPSSAKSTGRKHMS------PFVFYGSPRGVQVKRPQSFLRLLHVIRIDLKKQTDFN  121

Query  361   QE--IWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRR  534
                 +WATFP+Q EA+++++   +  VF YQ+H                     M+  RR
Sbjct  122   PRDVVWATFPRQDEAIRFSKAYAHTNVFCYQEH---------------------MSGTRR  160

Query  535   HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVE  714
                                                  +V+ +D   ++Y+     D  + 
Sbjct  161   ------------------------------------FLVSTYDEFWKRYN---DMDSKIR  181

Query  715   LDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKS  894
                    +FSRHLIIR+PKIAFKDNSHVGAF  EVCS+I +   T+    KL+++K+  S
Sbjct  182   HHYEVIQEFSRHLIIRIPKIAFKDNSHVGAFVCEVCSQIAAQRTTNHDLDKLYITKEISS  241

Query  895   VGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNID  1074
              G   +LF+D AVYSRNRCFRL  SSK+GK S L+P+ RFKC+ +++ ++FM SLIC +D
Sbjct  242   -GPVDRLFMDTAVYSRNRCFRLVFSSKSGKKSFLVPTKRFKCQELNDKDVFMESLICRLD  300

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
              +CE+LL+CK+D +C +TLHF++EI+ S  Q+        +  +++D S  Y  GKSPFP
Sbjct  301   DNCEKLLICKLDLECKKTLHFDSEISMS--QIQGRSYRHRIATYQNDFSHAYTCGKSPFP  358

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
             P+D F+E IAS G+V GKIRSW+WFS+  LI+Y+M ++RYCE IGREHK NHV Y+VD +
Sbjct  359   PLDGFIESIASFGNVSGKIRSWFWFSQESLIIYNMLRSRYCENIGREHKGNHVFYIVDFQ  418

Query  1435  RGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCK  1614
             R  YYQKCHDPDC+GYRSPLRP+P +VI     S  +       E+   A + NI +S  
Sbjct  419   RAAYYQKCHDPDCRGYRSPLRPVPWDVIPELVESDQI-------EYQGHAMETNIENSSM  471

Query  1615  K------------EWWLEAIRFAEQVEGI  1665
                          EWW + + FA+ +E +
Sbjct  472   SGKSITGAGAEDPEWWEQVVEFADSIENM  500



>ref|XP_008343839.1| PREDICTED: LOW QUALITY PROTEIN: DNA-directed primase/polymerase 
protein-like, partial [Malus domestica]
Length=388

 Score =   386 bits (992),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/359 (55%), Positives = 245/359 (68%), Gaps = 14/359 (4%)
 Frame = +1

Query  703   WIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSK  882
             WI+ELDSS E KFSRH II + K AFKDNSH GAF  E+CSRI S+ E D RF  LF  K
Sbjct  10    WILELDSSHEAKFSRHPIIHIEKTAFKDNSHAGAFVTEICSRISSARERDGRFGNLFXRK  69

Query  883   DSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLI  1062
             DS S   P++LFVD AVY+ NRCF LALSS+A K+SVL+P+GRFK   M E+EMFMASLI
Sbjct  70    DSSSCDYPSKLFVDTAVYTXNRCFXLALSSRAXKNSVLLPTGRFKANKMCEEEMFMASLI  129

Query  1063  CNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGK  1242
             CN+D DCE+LLVCK D DC++TLHF+TE+  S ++    PQ + LN   S  S TY  GK
Sbjct  130   CNLDVDCEKLLVCKPDLDCIKTLHFDTEVNSSLRKCYSWPQEYALNGSTSGASATYFQGK  189

Query  1243  SPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYV  1422
             SPFP +DAFVE +A++G+V GKIRSWYW SE+ L+VYSMS+NRY ERIGR+HKSN V+  
Sbjct  190   SPFPALDAFVESVATIGNVSGKIRSWYWLSEFALMVYSMSRNRYRERIGRQHKSNXVI--  247

Query  1423  VDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIV  1602
                 R  YYQKCHDPDC+GYRSP RPIP  +I       D+   ++    +    D N+ 
Sbjct  248   ----RAAYYQKCHDPDCRGYRSPSRPIPWEIIP------DMVHEHKNDPESVSYGDENMT  297

Query  1603  DSCKKE-WWLEAIRFAEQVEGIPKAl-eisgdgeleededWWKAAERIATQTELAYLGK  1773
               C  + WWLEAIR A+  E    +L   + +    +DE+WW A ER A+Q E  ++ +
Sbjct  298   SGCVTDSWWLEAIRVADDAENKQNSLWISNMEDIDSDDENWWMAVERTASQAEFMHVNR  356



>dbj|BAJ95285.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   359 bits (922),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/352 (51%), Positives = 231/352 (66%), Gaps = 14/352 (4%)
 Frame = +1

Query  736   KFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQL  915
             KFSRHLIIR+PKIAFKDNSHVGAF +E+CSRI +    +    KL+++KDS       QL
Sbjct  5     KFSRHLIIRIPKIAFKDNSHVGAFISEICSRIAAQRAANPNLDKLYITKDSSGAQPVDQL  64

Query  916   FVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLL  1095
             FVD AVYSRNRCFRLA SSK+GK S L+ +GRFKCKNM++ E+FM SLIC +D DC++LL
Sbjct  65    FVDTAVYSRNRCFRLAFSSKSGKKSFLVATGRFKCKNMNDKELFMESLICRLDDDCDKLL  124

Query  1096  VCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVE  1275
             +CK+D +C + LHF+TE   S  ++        ++ + +D  + Y  G+SPFP +D F+E
Sbjct  125   ICKLDLECKKVLHFDTE--ASITRIQGKNYRVAIDTYRNDFPQAYTYGRSPFPALDGFIE  182

Query  1276  YIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQK  1455
              IAS GSV GKIR WYWFS+ GL++YSMS++RYCE IGREHKSNHVMY+VD +R  YYQK
Sbjct  183   SIASFGSVSGKIRCWYWFSQDGLMIYSMSRSRYCEHIGREHKSNHVMYIVDFQRAAYYQK  242

Query  1456  CHDPDCKGYRSPLRPIPGNVIAHCSVSF------DLDSNNEGREHTPVATDANIVDSCKK  1617
             C+DPDC GYRSPLR +P +VI   + S       D   N           D N V +   
Sbjct  243   CYDPDCHGYRSPLRAVPLDVIPELTASIAGLAQRDYQGNVVEINMEGSRMDGNSVMASGD  302

Query  1618  E-----WWLEAIRFAEQVEGIPKA-leisgdgeleededWWKAAERIATQTE  1755
             E     WW EA++FA+ VE +  A    + +    +D DWW   ER   Q E
Sbjct  303   EEEDPGWWEEAVKFADSVENVDHAPASCNLEDGDCDDADWWMDVERFVVQME  354



>ref|XP_002994070.1| hypothetical protein SELMODRAFT_236910 [Selaginella moellendorffii]
 gb|EFJ04857.1| hypothetical protein SELMODRAFT_236910 [Selaginella moellendorffii]
Length=404

 Score =   357 bits (916),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 181/396 (46%), Positives = 253/396 (64%), Gaps = 28/396 (7%)
 Frame = +1

Query  238   KQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKK--LSQEIWATFPKQVEAMKYA  411
             ++    +FYG+P G   ++P  LL LL +IR DL ++     + + WATF +Q +A++YA
Sbjct  11    REIAAGIFYGAPRGGGHQQPPRLLHLLRDIRSDLGQESTPIAAGDAWATFARQEQALQYA  70

Query  412   E-QCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDL  588
             +       VF+YQDH  G RRFLV+++ +FW+RY+ M+   RHHYE+I+E  PC+LYFDL
Sbjct  71    DCHRHGLAVFTYQDHTTGQRRFLVTSHLEFWRRYEKMHGSLRHHYEIIRENTPCNLYFDL  130

Query  589   EFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLP  768
             EFN+  N   +GD MVDLL+  +  TL + +S+  +  W +ELDSST DKFSRHLI+R+P
Sbjct  131   EFNRHTNQGADGDAMVDLLLQLLASTLYEAFSIRYNMAWTLELDSSTADKFSRHLILRIP  190

Query  769   KIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNR  948
               AF+DNSH G F A +CSRI+     D+   +L+V  D  S     +LFVD AVYSRNR
Sbjct  191   NTAFRDNSHAGEFVAHLCSRIHVLRGRDKHLEELYVITDHSST---PRLFVDQAVYSRNR  247

Query  949   CFRLALSSKAGKSSVLIPSGRFKCKN---MSEDEMFMASLICNIDADCERLLVCKMDSDC  1119
             CFRL  S+KAGK+++L+P+ RF   +   M +   FM +L+CN+DA+CE LL        
Sbjct  248   CFRLVFSAKAGKTAILVPTYRFASSSEVVMDDITTFMQALVCNVDANCETLLTFDRGVGL  307

Query  1120  VRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSV  1299
                 H               P++  L+N +  P  +     SPF  VDAFVE I+S G+ 
Sbjct  308   AAGKH---------------PKS--LSNIQ--PQHSVASEASPFGAVDAFVESISSFGNT  348

Query  1300  PGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSN  1407
             PGKIR+W+WFSE G+IVY++S NR+CER+GR+HKSN
Sbjct  349   PGKIRNWFWFSELGIIVYNISGNRFCERVGRQHKSN  384



>ref|XP_008651088.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=545

 Score =   293 bits (751),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 141/296 (48%), Positives = 197/296 (67%), Gaps = 22/296 (7%)
 Frame = +1

Query  814   EVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSV  993
             EVCS+I +   T+    KL+++K+  S G   +LF+D AVYSRNRCFRL  SSK+GK S 
Sbjct  189   EVCSQIAAQRTTNHDLDKLYITKEISS-GPVDRLFMDTAVYSRNRCFRLVFSSKSGKKSF  247

Query  994   LIPSGRFKCKNMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMS  1173
             L+P+ RFKC+ +++ ++FM SLIC +D +CE+LL+CK+D +C +TLHF++EI+ S  Q+ 
Sbjct  248   LVPTKRFKCQELNDKDVFMESLICRLDDNCEKLLICKLDLECKKTLHFDSEISMS--QIQ  305

Query  1174  FTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVY  1353
                    +  +++D S  Y  GKSPFPP+D F+E IAS G+V GKIRSW+WFS+  LI+Y
Sbjct  306   GRSYRHRIATYQNDFSHAYTCGKSPFPPLDGFIESIASFGNVSGKIRSWFWFSQESLIIY  365

Query  1354  SMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSV  1533
             +M ++RYCE IGREHK NHV Y+VD +R  YYQKCHDPDC+GYRSPLRP+P +VI     
Sbjct  366   NMLRSRYCENIGREHKGNHVFYIVDFQRAAYYQKCHDPDCRGYRSPLRPVPWDVIPELVE  425

Query  1534  SFDLDSNNEGREHTPVATDANIVDSCKK------------EWWLEAIRFAEQVEGI  1665
             S  +       E+   A + NI +S               EWW + + FA+ +E +
Sbjct  426   SDQI-------EYQGHAMETNIENSSMSGKSITGAGAEDPEWWEQVVEFADSIENM  474


 Score =   171 bits (433),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 116/188 (62%), Gaps = 15/188 (8%)
 Frame = +1

Query  22   DDVDRLFECFKCGFSPPQSAIIER-------KRGKRTTKSEDSAQKQSTEKILQTTADAD  180
            DDVDRLF CFKCG SPP+SA  ER        RG   +++  S  + S++      A AD
Sbjct  8    DDVDRLFACFKCGVSPPKSAFRERPLPQAKKSRGSPVSETAGSGGRSSSDVSTTPDAAAD  67

Query  181  HSVENLGSSKPKRKYHSNGKQFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLS  360
                   +    RK+ S      P VFYGSP GV  KRP S LRLLH IR+DL +Q   +
Sbjct  68   KRAAPSSAKSTGRKHMS------PFVFYGSPRGVQVKRPQSFLRLLHVIRIDLKKQTDFN  121

Query  361  QE--IWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRR  534
                +WATFP+Q EA+++++   +  VF YQ+H++G RRFLVSTY++FWKRY  M+ K R
Sbjct  122  PRDVVWATFPRQDEAIRFSKAYAHTNVFCYQEHMSGTRRFLVSTYDEFWKRYNDMDSKIR  181

Query  535  HHYEVIQE  558
            HHYEVIQE
Sbjct  182  HHYEVIQE  189



>ref|XP_005848262.1| hypothetical protein CHLNCDRAFT_51806 [Chlorella variabilis]
 gb|EFN56160.1| hypothetical protein CHLNCDRAFT_51806 [Chlorella variabilis]
Length=633

 Score =   295 bits (754),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/385 (40%), Positives = 217/385 (56%), Gaps = 13/385 (3%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYE  546
              W  FP Q  A   A+      VFS +   +G RRF+ ++  +FW+RY  M P+ RH+YE
Sbjct  95    TWQVFPSQQPAFDLADSQPGLEVFSVEYGQDGKRRFIATSRAEFWRRYLDMLPQHRHYYE  154

Query  547   VIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSS  726
             +I++G PCHLYFDLEF ++ N   +G   VD L+  V + L   + L+    W++ELDSS
Sbjct  155   IIRQGAPCHLYFDLEFQREHNPGLDGGAAVDALLELVREQLRGSFQLDMQDSWVLELDSS  214

Query  727   TEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIP  906
             T+ KFSRHL+IR+P +AF  N+H GA   ++C+        D R   L V K     G  
Sbjct  215   TDTKFSRHLVIRIPGVAFASNAHAGALVLQLCAGARERRGQDSRCELLIVKKK----GGE  270

Query  907   AQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCE  1086
               LFVD AVY+RNR FRL LSSKAGK +VL  +GRF    ++  E F A+L+ N+ +   
Sbjct  271   EALFVDPAVYTRNRAFRLYLSSKAGKQAVLQNTGRFGGAGLTMQECFDAALVTNVPSGV-  329

Query  1087  RLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDA  1266
             RLL C  +S     +   T  A   Q     P            +     G  P P ++A
Sbjct  330   RLLRCFEES--AEEVAALTARASRQQARGVVPGGLVPGG-----AGQVCYGPCPHPELEA  382

Query  1267  FVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDY  1446
             F+  +   G   G++RSW    E GL++++M  NRYC  +GR+HKSN V YV DL+ G +
Sbjct  383   FITSMCCEGGSQGRVRSWVEL-EPGLLLFNMRDNRYCGNVGRQHKSNGVFYVADLKGGSW  441

Query  1447  YQKCHDPDCKGYRSPLRPIPGNVIA  1521
              Q+C+D +C+ YRSPL P+P +++A
Sbjct  442   CQRCYDSECRNYRSPLMPLPAHLLA  466



>gb|KFM28761.1| Coiled-coil domain-containing protein 111-like protein [Auxenochlorella 
protothecoides]
Length=413

 Score =   268 bits (684),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/372 (41%), Positives = 209/372 (56%), Gaps = 16/372 (4%)
 Frame = +1

Query  457   NGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMV  636
             +G RRFLVST  +F++RY  M P  RH+YE+I+EG PCH+YFDLEF++  N DK+G   +
Sbjct  6     DGKRRFLVSTVTNFYRRYSDMLPHHRHYYEIIREGQPCHIYFDLEFSRALNPDKDGPAAI  65

Query  637   DLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAE  816
               L+ A+   L ++  +      +VELDSST  KFSRHLI+R+P  AF  N+HVGA   +
Sbjct  66    QSLLEALSCLLQEELGMSLDIADVVELDSSTPSKFSRHLILRIPGHAFASNAHVGALVRQ  125

Query  817   VCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVL  996
             +C+R             L +  DS  +     L VD AVYSRNR FRL LSSKAGK + L
Sbjct  126   LCARARERGPDG----PLAIVADSPHLNGGLPLLVDEAVYSRNRAFRLLLSSKAGKEATL  181

Query  997   IPSGRFKCKNMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSF  1176
               SGR+    ++  E+FMASLIC  D +   LL  + D           +  QS +  S 
Sbjct  182   QCSGRYGGSQLTAQELFMASLICVDDPNVT-LLTWQADE--------LDDGGQSNRTSSH  232

Query  1177  TPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASV-GSVP-GKIRSWYWFSEYGLIV  1350
                    +   +  +     G  PFP + AF+  + S  G+ P   IRSW    +  L++
Sbjct  233   PGSGRHGSRASTTGNLRMHHGPCPFPELAAFITAVCSQDGAWPRAGIRSWAMQEDASLVL  292

Query  1351  YSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCS  1530
             Y++   RYC  +GREH+SN V YVVDL+ G + Q+C+DP C+GYRSP+  +P  V+A C 
Sbjct  293   YNIRGCRYCGNLGREHRSNGVFYVVDLQGGGWTQRCYDPACRGYRSPVTALPEAVLATCQ  352

Query  1531  V-SFDLDSNNEG  1563
               +  L S   G
Sbjct  353   ARAHGLGSGGAG  364



>ref|XP_002505865.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67123.1| predicted protein [Micromonas sp. RCC299]
Length=636

 Score =   263 bits (673),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 148/388 (38%), Positives = 215/388 (55%), Gaps = 36/388 (9%)
 Frame = +1

Query  430   RVFSYQDHINGYRRFLVSTYEDFWKRYKSMNP-KRRHHYEVIQEGLPCHLYFDLEFNKKA  606
             R FS +DH  G R+F+ STYE+FW+RY +     +RHHYE+I+E  PCHLYFDLE+   A
Sbjct  185   RFFSAEDHSTGRRKFIASTYEEFWRRYSAPELFGKRHHYELIREARPCHLYFDLEYALGA  244

Query  607   NADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDW-------IVELDSSTEDKFSRHLIIRL  765
             NAD NG    D L+  V + L  +  + G+          ++EL S++  KFSRHL+ R 
Sbjct  245   NADVNGTAATDALVELVLEDLATREGVVGADGAPLRPAQCVMELQSTSATKFSRHLVFRT  304

Query  766   PKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKD-------SKSVGIPAQLFVD  924
             P +AF + +H G F   +  RI    ETD R    FV K+       +    IP   FVD
Sbjct  305   PGVAFANAAHAGHFVRRLFDRILKDRETDPRCEACFVRKEDDDGVKGASERDIP---FVD  361

Query  925   NAVYSRNRCFRLALSSKAGKSSVLIPSGRF-------KCKNMSEDEMFMASLICNIDADC  1083
               VY+RNR FRL LSSK+GK+  L+P+ R            M+++ MF +SL+CN++   
Sbjct  362   LGVYTRNRAFRLYLSSKSGKNVRLLPTHRLWRPPGVTVPATMADETMFYSSLVCNVERGA  421

Query  1084  ERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVD  1263
              RL+    +    ++ +      Q +  ++    A + N    D  R    G  P P   
Sbjct  422   -RLI--SYEGVGQQSSYIGGRQLQGYGVIT----AEQANVNRGDCPRGITDGVMPCPETA  474

Query  1264  AFV----EYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             AFV    +  +  G    ++R+W  F ++G++V +M KNR+CE + R HKSN+VM+VVD 
Sbjct  475   AFVCRDFDEWSPAGCSGAEVRTWCAFPDHGVVVMNMQKNRFCENVERPHKSNNVMFVVDF  534

Query  1432  RRGDYYQKCHDPDCKGYRSPLRPIPGNV  1515
             R G YYQ+CHDP+C+G+R  LRP+P  +
Sbjct  535   REGAYYQRCHDPECRGHRGCLRPLPSEL  562



>ref|XP_009375541.1| PREDICTED: DNA-directed primase/polymerase protein-like isoform 
X2 [Pyrus x bretschneideri]
Length=199

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 149/199 (75%), Gaps = 0/199 (0%)
 Frame = +1

Query  631   MVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFT  810
             MVDLLI A+F+ LL+KYS+ G+ +WI+ELDSS E KFSRHLIIR+ K AFKDNSH GAF 
Sbjct  1     MVDLLISAIFEALLEKYSIIGNKEWILELDSSNEAKFSRHLIIRIEKTAFKDNSHAGAFV  60

Query  811   AEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSS  990
              E CSRI S+ E D RF  LF+ KDS S   P++LFVD AVY+RNRCF LALSSKAGK+S
Sbjct  61    TETCSRISSAKERDGRFGNLFIRKDSSSSDSPSKLFVDTAVYTRNRCFCLALSSKAGKNS  120

Query  991   VLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQM  1170
             VL+P+GRFK   M E+EMFMASLICN+D  CE+LL+CK D DC+R LHF+TE+ +   + 
Sbjct  121   VLLPTGRFKANRMGEEEMFMASLICNLDVGCEKLLLCKPDLDCIRALHFDTEVNRGLGKC  180

Query  1171  SFTPQAFELNNFESDPSRT  1227
                PQ + LN   S  S T
Sbjct  181   YSWPQEYALNGCTSGASAT  199



>ref|XP_009375540.1| PREDICTED: DNA-directed primase/polymerase protein-like isoform 
X1 [Pyrus x bretschneideri]
Length=200

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 149/200 (75%), Gaps = 1/200 (1%)
 Frame = +1

Query  631   MVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFT  810
             MVDLLI A+F+ LL+KYS+ G+ +WI+ELDSS E KFSRHLIIR+ K AFKDNSH GAF 
Sbjct  1     MVDLLISAIFEALLEKYSIIGNKEWILELDSSNEAKFSRHLIIRIEKTAFKDNSHAGAFV  60

Query  811   AEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSS  990
              E CSRI S+ E D RF  LF+ KDS S   P++LFVD AVY+RNRCF LALSSKAGK+S
Sbjct  61    TETCSRISSAKERDGRFGNLFIRKDSSSSDSPSKLFVDTAVYTRNRCFCLALSSKAGKNS  120

Query  991   VLIPSGRFKCKNM-SEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQ  1167
             VL+P+GRFK   M  E+EMFMASLICN+D  CE+LL+CK D DC+R LHF+TE+ +   +
Sbjct  121   VLLPTGRFKANRMQGEEEMFMASLICNLDVGCEKLLLCKPDLDCIRALHFDTEVNRGLGK  180

Query  1168  MSFTPQAFELNNFESDPSRT  1227
                 PQ + LN   S  S T
Sbjct  181   CYSWPQEYALNGCTSGASAT  200



>ref|XP_005646844.1| hypothetical protein COCSUDRAFT_42641 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22300.1| hypothetical protein COCSUDRAFT_42641 [Coccomyxa subellipsoidea 
C-169]
Length=392

 Score =   243 bits (621),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 135/368 (37%), Positives = 210/368 (57%), Gaps = 24/368 (7%)
 Frame = +1

Query  304   LLRLLHEIRVDLSEQKKLSQEIWATFPKQVEAMKYAEQCINA---RVFSYQDHINGYRRF  474
             +LRLL  +R  L      + + +  FP Q  A ++A+   +A   R+FS +    G R F
Sbjct  31    VLRLLAAVRQKLHGG---ASDPYKVFPLQEPAFQWADNHPDAPDVRIFSSERGPEGKRSF  87

Query  475   LVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVA  654
             + +T E FWKRY+ M P+ RH YE+I++G PCHLYFDLE+ K  NA  +GD +V +++  
Sbjct  88    IATTLEGFWKRYRDMLPQHRHCYEIIRQGYPCHLYFDLEYQKDFNAGVDGDSLVGIVLKL  147

Query  655   VFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY  834
               + L +K+ LE    W++E+DSS+  KFSRH+I+++P  AF++N HVGAF  ++C+   
Sbjct  148   CAEQLQEKFQLEMEDSWVLEMDSSSPHKFSRHVIVKIPGAAFQNNFHVGAFVKDMCA-AQ  206

Query  835   SSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRF  1014
               ++ +   ++L ++KD+        LF+D  VY+RNR FRL LSSKAGK  +L P+ RF
Sbjct  207   EGTDPESPVQQLLINKDADG---SRTLFIDGGVYTRNRAFRLFLSSKAGKQWILQPTARF  263

Query  1015  KCKNMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFE  1194
             +   +S  + F ASLICN+   C RLL C  ++D V            F           
Sbjct  264   QGAKLSHRDTFFASLICNVSEGC-RLLRCYEEADGV-----------PFSWARHGQVGGR  311

Query  1195  LNNFESDPSRTYL--MGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKN  1368
             L + E+   R     +G S  P ++ F+  + ++G V G++RSW  + E GL++ +M +N
Sbjct  312   LIDSEAAIGRCAQPRIGPSRHPDIELFITSVCNMGGVQGEVRSWVEWPEAGLLLLNMKRN  371

Query  1369  RYCERIGR  1392
             R+  R  R
Sbjct  372   RWRARGTR  379



>ref|XP_003452338.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
isoform X1 [Oreochromis niloticus]
 ref|XP_005457074.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
isoform X2 [Oreochromis niloticus]
Length=521

 Score =   240 bits (613),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 155/447 (35%), Positives = 233/447 (52%), Gaps = 52/447 (12%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQDH--INGYRRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  FP+Q  A+ +A+ C  A  VF+ +    + G R +LV++Y + W  Y++      H
Sbjct  39    VWKLFPRQCMAISFAQSCKEAVHVFALEKEKEVVGQRIYLVTSYSELWFYYRTYTQSLMH  98

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LY DLEF+K +N   +G  MV LLI  V D LL+ Y +E S   ++ L
Sbjct  99    CYEVIPEGAVCKLYLDLEFHKPSNKGSDGKTMVSLLIQYVCDKLLEVYGIECSVKNVLNL  158

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY----------------SSSET  849
             DSSTE+KFSRHLI  L + AFKDN HVG F   +   +                 + + +
Sbjct  159   DSSTEEKFSRHLIFCLQQAAFKDNIHVGRFIHAILQPVLNKPKNGSHLDNGVETRTQAAS  218

Query  850   DERFRKLFVSKDSKSVGIPAQ-----LFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRF  1014
              E  R+    +D   + +  +     LFVD  VY++NR FRL  SSKAGK++    +   
Sbjct  219   PEMKRRKAEGRDLSFLQVKNKDGRDSLFVDLGVYTKNRNFRLYKSSKAGKNAAFTVAEDN  278

Query  1015  KC-----KNMS-EDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSF  1176
             +C     K  S E+ +F+ASL+CN+    +R+L   +            +I+ S  Q   
Sbjct  279   QCIAKPEKGTSLEESIFLASLVCNVSFTGQRILTWDVPESS------EPKISPSKCQQGS  332

Query  1177  TPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYS  1356
                +  L+ F S          SP   VD FV  +     + G +R W +F+   L+VY 
Sbjct  333   GSDSGALSGFLS----------SPHQEVDNFVLTVVRKDGIQGSLRRWNYFAAEQLLVYD  382

Query  1357  MSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVS  1536
             ++K R+CE +GR HKSN++M VVDL+   +YQKCHDPDC+ +RS   P+P  +     +S
Sbjct  383   IAKYRWCENVGRFHKSNNIMIVVDLKEEVWYQKCHDPDCRNFRSSSYPLPQEIC----IS  438

Query  1537  FDLDSNNEGREHTPVATDANIVDSCKK  1617
             + L  + E + +  +  DA  ++S +K
Sbjct  439   YILTLDEEDQVY--LMDDAGNIESSQK  463



>ref|XP_008409885.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Poecilia reticulata]
 ref|XP_008409893.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Poecilia reticulata]
 ref|XP_008409901.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Poecilia reticulata]
Length=525

 Score =   240 bits (613),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 152/434 (35%), Positives = 219/434 (50%), Gaps = 60/434 (14%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  FP+Q  A+ +A  C  A  VF+ +      G R +LV++Y + W  Y+       H
Sbjct  39    VWKLFPRQNLAISFAHSCKEAVHVFALEKEKASLGQRIYLVTSYSELWHYYRVYPQSLMH  98

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LYFDLEF+K +N   +G  MV LLI  V D L++ Y +E S   ++ L
Sbjct  99    CYEVIPEGAVCKLYFDLEFHKPSNKGSDGKSMVSLLIQYVCDMLVEVYGIECSVKNVLNL  158

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVS-KDSKS  894
             DSSTE+KFSRHLI  L    FKDN HVG F   +   + S  ++D R  K  +S  D++ 
Sbjct  159   DSSTEEKFSRHLIFMLQDAVFKDNIHVGRFIHAILQPVMSKLKSDSRLHKGDISLTDNRH  218

Query  895   VGIPAQ------------------------------LFVDNAVYSRNRCFRLALSSKAGK  984
               I ++                              LFVD  VY++NR FRL  SSK G+
Sbjct  219   TNIDSELTQSPDTKRQKQEVRDLSFLLVKNKDGRDGLFVDLGVYTKNRNFRLYKSSKVGR  278

Query  985   SSVLIPS--GRFKC----KNMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTE  1146
             ++    +   +F      +  +E+ +F+ASL+CN+    +R+L      D   T    + 
Sbjct  279   NAAFAVAEDNQFTAEPAKEKSAEENVFLASLVCNVSFTGQRILTW----DAPETKEVKSP  334

Query  1147  IAQSFQQMSFTPQAFELNNFESDPSRTYLMG--KSPFPPVDAFVEYIASVGSVPGKIRSW  1320
              AQS Q +              D ++    G   SP+  VD FV  +     V G IR W
Sbjct  335   TAQSQQGL--------------DSNQDTFSGCLSSPYKEVDNFVFTLVRKDGVQGSIRRW  380

Query  1321  YWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRP  1500
              +FS   L+VY ++K R+CE + R HKSN++M VVDL+   +YQKCHDPDC+ +RS   P
Sbjct  381   NYFSADQLLVYDIAKYRWCENVSRFHKSNNIMIVVDLKEEVWYQKCHDPDCRNFRSSSFP  440

Query  1501  IPGNVIAHCSVSFD  1542
             +P  +     ++ D
Sbjct  441   LPQEICVRYILTLD  454



>ref|XP_002604053.1| hypothetical protein BRAFLDRAFT_119781 [Branchiostoma floridae]
 gb|EEN60064.1| hypothetical protein BRAFLDRAFT_119781 [Branchiostoma floridae]
Length=1324

 Score =   250 bits (638),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 161/448 (36%), Positives = 237/448 (53%), Gaps = 69/448 (15%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQ---DHINGYRRFLVSTYEDFWKRYKSMNPKRR  534
             +W  FP+Q  A  +A  C  +  VF+ +   +  NG R++LV+TYE FW  Y  ++P   
Sbjct  557   VWRLFPRQKLAFDFARCCKQDVHVFACEVEGESENGQRKYLVTTYEQFWDMYSVLHPNMD  616

Query  535   HH-YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI EG  CHLYFDLEF+K  N   +G  MV  LI  V   L +KY+L  + + ++
Sbjct  617   GHFYEVIPEGATCHLYFDLEFSKVVNPGSDGVAMVQTLIRCVCWFLKKKYNLTCTEEHVL  676

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSET------DERFRKL-  870
             +L+SSTE+KFS HLI  LP  AF+DN H G F  ++C ++Y  +E       D   ++L 
Sbjct  677   DLESSTEEKFSHHLIFHLPGAAFQDNIHAGNFVHQMCEKLYLCTEQQSPLAGDAELQELR  736

Query  871   ----------FVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLI--PSGRF  1014
                         +KD   V     LF+D  VY++NR FRL  S+K G+ + ++  P  ++
Sbjct  737   EAVPGLDQLVMKNKDGDRV-----LFIDAGVYTKNRNFRLYQSTKLGRRAPMLVSPQCKY  791

Query  1015  KCKNMS------------------EDEMFMASLICNIDADCE-RLLVCKMDSDCVRTLHF  1137
             K +  S                  + ++F+ SL+ N+    E R+L C+  +     +  
Sbjct  792   KLREGSKASWEGSKACWEGSKACWDQQVFLESLVSNVRFSPELRVLRCEEGNSSSGRVST  851

Query  1138  NTEIA-QSFQQMSFTPQAF-ELNNFESDP---------------SRTYLMG--KSPFPPV  1260
             + E    S  + S T +A  +L+   S P               +   L G   SP+P V
Sbjct  852   SRETGDNSTGRDSTTREATDQLSGCSSSPYPEVDAYVVLQASREATDQLSGCSSSPYPEV  911

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             DA+V   AS G V G IR W +FS+  +++Y ++ NR+CE IGR H+SNHVM+V DL+R 
Sbjct  912   DAYVILQASSGGVYGGIRQWTYFSQGEVLMYDIAHNRWCENIGRAHRSNHVMFVADLKRQ  971

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNVI  1518
               YQKCHDP C+   Y+SP RP+P  V+
Sbjct  972   VLYQKCHDPVCRAQNYKSPERPLPAEVL  999



>ref|XP_007510266.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18611.1| predicted protein [Bathycoccus prasinos]
Length=514

 Score =   238 bits (608),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 148/419 (35%), Positives = 223/419 (53%), Gaps = 43/419 (10%)
 Frame = +1

Query  466   RRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLL  645
             R+F  +T E FW+ Y  +    RHHYE+I+E  PCHLYFDLEFN+ ANAD +G +  D L
Sbjct  116   RKFCAATREKFWEYYSILKENERHHYEIIREMEPCHLYFDLEFNRDANADVDGVKSTDAL  175

Query  646   IVAVFDTLLQKYSLE-GSHDWIVELDS--------STED------KFSRHLIIRLPKIAF  780
             +  + + L +K+++E   ++ +VEL+S        STE+      KFSRH+IIRLP  AF
Sbjct  176   LDLIKEELYEKHNIEIALNEHVVELESKITESIKASTEEGQNTNRKFSRHVIIRLPGAAF  235

Query  781   KDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRL  960
             K N HVG F  +  + +     +D+R  KLF+ K+         + +D  VY+RNR FRL
Sbjct  236   KSNIHVGKFVKDFWNSVRERRASDDRCEKLFIRKEQSETERENSI-IDLGVYTRNRAFRL  294

Query  961   ALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFN  1140
              LSSKA K  VL  +GRF   ++ + E+F  SL+ NID D  + L+   D     +   N
Sbjct  295   FLSSKAKKKEVLRCTGRF-WTHLKQREIFYRSLVTNIDKDQRKKLIEYEDVTVSLSQKSN  353

Query  1141  TEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYI-------ASVGSV  1299
             +  A +F    +   +   N+ +          + P PP    V+++       +     
Sbjct  354   S-CANAFSGYGYRRDSLSQNSSKH---------RIPPPPCAELVDFVLNDFDGWSDAKMN  403

Query  1300  PGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKG  1479
                +RSW  F ++  ++ ++  NRYCE I R+HKSN+VM ++D +RG Y+QKCHDPDCKG
Sbjct  404   KAAVRSWVAFPDHDTLILNLVGNRYCENIKRQHKSNNVMLIMDFQRGVYHQKCHDPDCKG  463

Query  1480  YRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDANIVDSCKKEWWLEAIRFAEQV  1656
                 LR +P +++     S        GR   P   +    +S  +E+W  A   AE++
Sbjct  464   MNPQLRELPVDMLQSAIKS--------GRA-LPFEREEPRCESDDEEFWQRAASAAEKL  513



>ref|XP_005942086.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
isoform X1 [Haplochromis burtoni]
 ref|XP_005942087.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
isoform X2 [Haplochromis burtoni]
Length=521

 Score =   238 bits (608),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 148/422 (35%), Positives = 219/422 (52%), Gaps = 46/422 (11%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  FP+Q  A+ +A+ C  A  VF+ +      G R +LV++Y + W  Y++      H
Sbjct  39    VWKLFPRQSMAISFAQSCKEAVHVFALEKEKESMGQRIYLVTSYSELWFYYRTYTQSLMH  98

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LY DLEF+K +N   +G  MV LLI  V D LL+ Y +E S   ++ L
Sbjct  99    CYEVIPEGAVCKLYLDLEFHKPSNKGSDGKTMVSLLIQYVCDKLLEVYGIECSAKNVLNL  158

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY----------------SSSET  849
             DSSTE+KFSRHLI  L + AFKDN HVG F   +   +                 + + +
Sbjct  159   DSSTEEKFSRHLIFCLQQAAFKDNIHVGRFIHAILQPVLNKPKNGSHLDNGVETRTQAAS  218

Query  850   DERFRKLFVSKDSKSVGIPAQ-----LFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRF  1014
              E  R+    +D   + +  +     LFVD  VY++NR FRL  SSKAGK++    +   
Sbjct  219   PEMKRRKEEGRDLSFLRVKNKDGRDSLFVDLGVYTKNRNFRLYKSSKAGKNAAFTVAEDN  278

Query  1015  KC-----KNMS-EDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSF  1176
             +C     K  S E+ +F+ASL+CN+    +R+L   +            +I+ S  Q   
Sbjct  279   QCIAKPEKGTSLEESIFLASLVCNVSFTGQRILTWDVPESS------EPKISPSKSQQGS  332

Query  1177  TPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYS  1356
                +  L+ F S          SP   VD FV  +     + G +R W +F+   L+VY 
Sbjct  333   DSDSGALSGFLS----------SPHQEVDNFVLTVVRKDGIQGSLRRWNYFAAEQLLVYD  382

Query  1357  MSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVS  1536
             ++K R+CE +GR HKSN++M VVDL+   +YQKCHDP+C+ +RS   P+P  +     ++
Sbjct  383   IAKYRWCENVGRFHKSNNIMIVVDLKEDVWYQKCHDPECRNFRSSSYPLPQEICISYVLT  442

Query  1537  FD  1542
              D
Sbjct  443   LD  444



>ref|XP_007551815.1| PREDICTED: DNA-directed primase/polymerase protein [Poecilia 
formosa]
Length=525

 Score =   238 bits (608),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 152/434 (35%), Positives = 219/434 (50%), Gaps = 60/434 (14%)
 Frame = +1

Query  367   IWATFPKQVEAMKYA---EQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  FP+Q  A+ +A   ++ ++      +    G R +LV++Y + W  Y+       H
Sbjct  39    VWKLFPRQNLAISFAHSFKEAVHVFALEKEKASLGQRIYLVTSYSELWHYYRVYPQSLMH  98

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LYFDLEF+K +N   +G  MV LLI  V D L++ Y +E S   ++ L
Sbjct  99    CYEVIPEGAVCKLYFDLEFHKPSNKGSDGKSMVSLLIQYVCDKLVEVYGVECSVKNVLNL  158

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVS-KDSKS  894
             DSSTE+KFSRHLI  L   AFKDN HVG F   +   I S  ++D R  +  +S  D + 
Sbjct  159   DSSTEEKFSRHLIFMLQNAAFKDNIHVGRFIHAILQPIISKLKSDSRLHEGDISLTDDRH  218

Query  895   VGI---PAQ---------------------------LFVDNAVYSRNRCFRLALSSKAGK  984
               I   PAQ                           LFVD  VY++NR FRL  SSK G+
Sbjct  219   TNIDSAPAQSPERKRQKQEVRDLSFLLVKNKEGRDGLFVDLGVYTKNRNFRLYKSSKVGR  278

Query  985   SSVLIPS--GRFKCK----NMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTE  1146
             ++    +   +F  K      +E+ +F+ASL+CN+    +R+L      D   T    + 
Sbjct  279   NAAFTVAEDNQFTAKPAKEKSAEENVFLASLVCNVSFTGQRILTW----DAPETKEVKSP  334

Query  1147  IAQSFQQMSFTPQAFELNNFESDPSRTYLMG--KSPFPPVDAFVEYIASVGSVPGKIRSW  1320
              AQS Q +              D ++    G   SP+  VD FV  +     V G IR W
Sbjct  335   TAQSQQGL--------------DSNQGTFSGCLSSPYKEVDNFVFTLVRKDGVQGSIRRW  380

Query  1321  YWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRP  1500
              +F+   L+VY ++K R+CE + R HKSN++M VVDL+   +YQKCHDPDC+ +RS   P
Sbjct  381   NYFAVDQLLVYDIAKYRWCENVSRFHKSNNIMIVVDLKEEVWYQKCHDPDCRNFRSSSFP  440

Query  1501  IPGNVIAHCSVSFD  1542
             +P  +     ++ D
Sbjct  441   LPQEICVSYILTLD  454



>ref|XP_005726854.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
[Pundamilia nyererei]
Length=521

 Score =   238 bits (607),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 148/422 (35%), Positives = 219/422 (52%), Gaps = 46/422 (11%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  FP+Q  A+ +A+ C  A  VF+ +      G R +LV++Y + W  Y++      H
Sbjct  39    VWKLFPRQSMAISFAQSCKEAVHVFALEKEKESMGQRIYLVTSYSELWFYYRTYTQSLMH  98

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LY DLEF+K +N   +G  MV LLI  V D LL+ Y +E S   ++ L
Sbjct  99    CYEVIPEGAVCKLYLDLEFHKPSNKGSDGKTMVSLLIQYVCDKLLEVYGIECSAKNVLNL  158

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY----------------SSSET  849
             DSSTE+KFSRHLI  L + AFKDN HVG F   +   +                 + + +
Sbjct  159   DSSTEEKFSRHLIFCLQQAAFKDNIHVGRFIHAILQPVLNKPKNGSHLDNGVETRTQAAS  218

Query  850   DERFRKLFVSKDSKSVGIPAQ-----LFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRF  1014
              E  R+    +D   + +  +     LFVD  VY++NR FRL  SSKAGK++    +   
Sbjct  219   PEMKRRKEEGRDLSFLRVKNKDGRDSLFVDLGVYTKNRNFRLYKSSKAGKNAAFTVAEDN  278

Query  1015  KC-----KNMS-EDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSF  1176
             +C     K  S E+ +F+ASL+CN+    +R+L   +            +I+ S  Q   
Sbjct  279   QCIAKPEKGTSLEESIFLASLVCNVSFTGQRILTWDVPESS------EPKISPSKSQQGS  332

Query  1177  TPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYS  1356
                +  L+ F S          SP   VD FV  +     + G +R W +F+   L+VY 
Sbjct  333   DSDSGALSGFLS----------SPHQEVDNFVLTVVRKDGIQGSLRRWNYFAAEQLLVYD  382

Query  1357  MSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVS  1536
             ++K R+CE +GR HKSN++M VVDL+   +YQKCHDP+C+ +RS   P+P  +     ++
Sbjct  383   IAKYRWCENVGRFHKSNNIMIVVDLKEDVWYQKCHDPECRNFRSSSYPLPQEICISYVLT  442

Query  1537  FD  1542
              D
Sbjct  443   LD  444



>ref|XP_005807233.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
[Xiphophorus maculatus]
Length=501

 Score =   237 bits (605),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 149/416 (36%), Positives = 217/416 (52%), Gaps = 48/416 (12%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  FP+Q  A+ +A  C  A  VF+ +      G R +LV++Y + W  Y+       H
Sbjct  39    VWKLFPRQNLAISFAHSCKEAVHVFALEKEKASLGQRIYLVTSYSELWHYYRVYPQSLMH  98

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LYFDLEF+K +N   +G+ MV L I  V + L++ Y +E S   ++ L
Sbjct  99    CYEVIPEGAVCKLYFDLEFHKPSNKGSDGNSMVSLFIKYVCNKLVEVYGIECSVKNVLNL  158

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETD-------ERFRK---  867
             DSSTE+KFSRHLI  L   AFKDN HVG F   +   + S  ++D       +R ++   
Sbjct  159   DSSTEEKFSRHLIFMLQSAAFKDNIHVGRFIHAILQPVISKLKSDSPQSPDAKRQKQEVR  218

Query  868   -----LFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPS--GRFKCK-  1023
                  L  +KD +S      LFVD  VY++NR FRL  SSK G+++    +   +F  K 
Sbjct  219   DLSFLLVKNKDGRS-----GLFVDLGVYTKNRNFRLYKSSKVGRNAAFTVAEDNQFTAKP  273

Query  1024  ---NMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFE  1194
                  +E+ +F+ASL+CN+    +R+L      D   T    +  AQS Q +        
Sbjct  274   DKEKSAEENVFLASLVCNVSFTGQRILTW----DAPETKDVKSPTAQSQQGLD-------  322

Query  1195  LNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRY  1374
                     S       SP+  VD FV  +     V G IR W +F+   L+VY ++K R+
Sbjct  323   --------SNQGNAKSSPYKEVDNFVFALVRKDGVQGSIRRWNYFAADQLLVYDIAKYRW  374

Query  1375  CERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD  1542
             CE + R HKSN++M +VDL+   +YQKCHDPDC+ +RS   P+P  +     ++ D
Sbjct  375   CENVSRFHKSNNIMIIVDLKEEVWYQKCHDPDCRNFRSSSFPLPQEICVSYILTLD  430



>ref|XP_008285051.1| PREDICTED: DNA-directed primase/polymerase protein [Stegastes 
partitus]
Length=541

 Score =   238 bits (607),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 152/443 (34%), Positives = 223/443 (50%), Gaps = 67/443 (15%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRH  537
             IW  FP+Q  A+ +A+ C  A  VF+ +      G R +LV++Y + W  Y++      H
Sbjct  39    IWKLFPRQSLAISFAQSCKEAVHVFALEKEKTSMGQRIYLVTSYSELWHYYRTYTQSLMH  98

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LYFDLEF+K +N   +G  MV L I  V + L++ Y +E S   I+ L
Sbjct  99    CYEVIPEGAVCKLYFDLEFHKPSNKGSDGKNMVSLFIQYVCEKLMEVYGIECSAKNILNL  158

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--------------SSETDE  855
             DSSTEDKFSRHLI  L   AFKDN HVG F   +   + +              +++  +
Sbjct  159   DSSTEDKFSRHLIFSLQNAAFKDNIHVGRFIHAILQPVLNKAKGGSCVDDGINPTADNKQ  218

Query  856   RFRKLFVS--KDSKSVGIPAQ--------------------------LFVDNAVYSRNRC  951
                 L VS  K +K+ G+                             LFVD  VY++NR 
Sbjct  219   TGGTLAVSEGKPAKAGGMTESPQTKRRKQEERDLSFLQVKNKDGKDCLFVDLGVYTKNRN  278

Query  952   FRLALSSKAGKSSVLIPS--GRFKCK----NMSEDEMFMASLICNIDADCERLLVCKMDS  1113
             FRL  SSKAGK++    +   +F  K    + +E+ +F+ASL+CN+    +R+L      
Sbjct  279   FRLYKSSKAGKNAAFTVAEDNKFIAKPKKGSSAEESVFLASLVCNVSFTGQRVLTW----  334

Query  1114  DCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVG  1293
                       +I ++ +  +  P   + +   SD     L   SP   VD FV  +    
Sbjct  335   ----------DIPETNETKTSMPHCQQGSASTSDALSGCL--SSPHQEVDTFVLTVVRKD  382

Query  1294  SVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDC  1473
              + G IR W +F+   L+VY ++K R+CE +GR HKSN++M VVDL+   +YQKCHDPDC
Sbjct  383   GLQGSIRRWNYFAAEQLLVYDIAKYRWCENVGRFHKSNNIMIVVDLKEEVWYQKCHDPDC  442

Query  1474  KGYRSPLRPIPGNVIAHCSVSFD  1542
             + +RS   P+P  +     ++ D
Sbjct  443   RNFRSSSYPLPQEICVSYIITLD  465



>gb|KHJ46087.1| herpesviridae UL52/UL70 DNA primase [Trichuris suis]
Length=459

 Score =   236 bits (601),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 166/445 (37%), Positives = 224/445 (50%), Gaps = 59/445 (13%)
 Frame = +1

Query  256   VFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQE----------IWATFPKQVEAMK  405
             VFYGS       RP S L+L  E R+  +++  L +           +W  F  Q +AMK
Sbjct  10    VFYGSN----STRPKSSLQLSIEERIIYNQEHPLFEPHRYSLIDDRCVWRAFRCQADAMK  65

Query  406   YAEQCI---NARVFSYQDHIN-GYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCH  573
             Y E  I     ++FS++ H++ G R FLV   E FW  YK +    RH YE+I+EG PC 
Sbjct  66    YLETRIVQDKLKIFSFESHLSSGGRTFLVVAAEHFWSVYKQLPNNMRHCYEMIREGQPCR  125

Query  574   LYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHL  753
             LYFDLEF    N D NG+  V   +    +   +   +E S D I++LDS+TE+KFSRHL
Sbjct  126   LYFDLEFYFCTNPDMNGELCVKSFVAYFREKASELLGIEISTDCILDLDSTTEEKFSRHL  185

Query  754   IIRLPK-IAFKDNSHVGAFTAEVCSRIYSSSETDERFRKL----FVSKDSKSVGIPAQLF  918
             I+ LP    FKDN   G F  ++CS + S SE   R R L     ++K+ K       L 
Sbjct  186   IVHLPNGTVFKDNKEAGNFVKDMCSALRSLSEEQRRERCLSCLFVLTKEGKET-----LL  240

Query  919   VDNAVYSRNRCFRLALSSKAGKSS--VLIPSGRF---KCKNMSEDEMFMASLICNIDADC  1083
              D  VY+RNR FRL LSSK  + +   L  S  F   K +  SE+++F  SLI  +    
Sbjct  241   CDEGVYTRNRTFRLYLSSKLKQHNPLTLASSCNFYSSKGRVPSEEDIFFDSLIEAM----  296

Query  1084  ERLLVCKMDSDCVRTLHFNTEIAQSFQQM--SFTPQAFELNNFESDPSRTYLMGKSPFPP  1257
                           T  F T+ A +F  +   FT  +  +N               PFP 
Sbjct  297   ------SYKHSISYTPQFCTQFAVNFSNLREQFTDVSEGIN------------CPLPFPG  338

Query  1258  VDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRR  1437
             ++ F E   S      +IR W      GL++  ++  RYC RIGREHKSNH+MY+VDLRR
Sbjct  339   LNRFFEDYLSQQKAQARIRRWIHVKSAGLLILDIANYRYCHRIGREHKSNHIMYIVDLRR  398

Query  1438  GDYYQKCHDPDCK--GYRSPLRPIP  1506
               +YQKCHD +C+  GYRS   P P
Sbjct  399   CLFYQKCHDQECRLMGYRSNDFPFP  423



>ref|XP_004549536.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
isoform X1 [Maylandia zebra]
 ref|XP_004549537.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
isoform X2 [Maylandia zebra]
Length=521

 Score =   237 bits (604),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 153/427 (36%), Positives = 219/427 (51%), Gaps = 56/427 (13%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  FP+Q  A+ +A+ C  A  VF+ +      G R +LV++Y + W  Y++      H
Sbjct  39    VWKLFPRQSMAISFAQSCKEAVHVFALEKEKESMGQRIYLVTSYSELWFYYRTYTQSLMH  98

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LY DLEF+K +N   +G  MV LLI  V D LL+ Y +E S   ++ L
Sbjct  99    CYEVIPEGAVCKLYLDLEFHKPSNKGSDGKTMVSLLIQYVCDKLLEVYGIECSAKNVLNL  158

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVC----------SRIYSSSET------  849
             DSSTE+KFSRHLI  L + AFKDN HVG F   +           S + +  ET      
Sbjct  159   DSSTEEKFSRHLIFCLQQAAFKDNIHVGRFIHAILQPVLNKPKNGSHLDNGVETRTQAAS  218

Query  850   ------DERFRKL----FVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLI  999
                    E  R L      SKD +       LFVD  VY++NR FRL  SSKAGK++   
Sbjct  219   PEMKRCKEEGRDLSFLQVKSKDGRD-----SLFVDLGVYTKNRNFRLYKSSKAGKNAAFT  273

Query  1000  PSGRFKC-----KNMS-EDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSF  1161
              +   +C     K  S E+ +F+ASL+CN+    +R+L   +            +++ S 
Sbjct  274   VAEDNQCIAKPEKGTSLEESIFLASLVCNVSFTGQRILTWDVPESS------EPKVSPSK  327

Query  1162  QQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYG  1341
              Q      +  L+ F S          SP   VD FV  +     + G +R W +F+   
Sbjct  328   SQQGSDSDSGALSGFLS----------SPHQEVDNFVLTVVRKDGIQGSLRRWNYFAAEQ  377

Query  1342  LIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIA  1521
             L+VY ++K R+CE +GR HKSN++M VVDL+   +YQKCHDP+C+ +RS   P+P  +  
Sbjct  378   LLVYDIAKYRWCENVGRFHKSNNIMIVVDLKEDVWYQKCHDPECRNFRSSSYPLPQEICI  437

Query  1522  HCSVSFD  1542
                ++ D
Sbjct  438   SYVLTLD  444



>gb|KFD59083.1| hypothetical protein M513_00246 [Trichuris suis]
 gb|KFD67844.1| hypothetical protein M514_00246 [Trichuris suis]
Length=459

 Score =   234 bits (598),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 166/445 (37%), Positives = 223/445 (50%), Gaps = 59/445 (13%)
 Frame = +1

Query  256   VFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQE----------IWATFPKQVEAMK  405
             VFYGS       RP S L+L  E R+  +++  L +           +W  F  Q +AMK
Sbjct  10    VFYGSN----STRPKSSLQLSIEERIIYNQEHPLFEPHRYSLIDDRCVWRAFRCQADAMK  65

Query  406   YAEQCI---NARVFSYQDHIN-GYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCH  573
             Y E  I     ++FS++ H++ G R FLV   E FW  YK +    RH YE+I+EG PC 
Sbjct  66    YLETRIVQDKLKIFSFESHLSSGGRTFLVVAAEHFWSVYKQLPNNMRHCYEMIREGQPCR  125

Query  574   LYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHL  753
             LYFDLEF    N D NG+  V   +    +   +   +E S D I++LDS+TE+KFSRHL
Sbjct  126   LYFDLEFYFCTNPDMNGELCVKSFVAYFREKASELLGIEISTDCILDLDSTTEEKFSRHL  185

Query  754   IIRLPK-IAFKDNSHVGAFTAEVCSRIYSSSETDERFRKL----FVSKDSKSVGIPAQLF  918
             I+ LP    FKDN   G F  ++CS + S SE   R R L     ++K+ K       L 
Sbjct  186   IVHLPNGTVFKDNKEAGNFVKDMCSALRSLSEEQRRERCLSCLFVLTKEGKET-----LL  240

Query  919   VDNAVYSRNRCFRLALSSKAGKSS--VLIPSGRF---KCKNMSEDEMFMASLICNIDADC  1083
              D  VY+RNR FRL LSSK  + +   L  S  F   K +  SE+++F  SLI  +    
Sbjct  241   CDEGVYTRNRTFRLYLSSKLKQHNPLTLASSCNFYSSKGRVPSEEDIFFDSLIEAMS---  297

Query  1084  ERLLVCKMDSDCVRTLHFNTEIAQSFQQM--SFTPQAFELNNFESDPSRTYLMGKSPFPP  1257
                           T  F T+ A +F  +   FT  +  +N               PFP 
Sbjct  298   -------YKHSISYTPQFCTQFAVNFSNLREQFTDVSEGIN------------CPLPFPG  338

Query  1258  VDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRR  1437
             ++ F E   S      +IR W      GL++  ++  RYC RIGREHKSNH+MY+VDLRR
Sbjct  339   LNRFFEDYLSQQKAQARIRRWIHVKSAGLLILDIANYRYCHRIGREHKSNHIMYIVDLRR  398

Query  1438  GDYYQKCHDPDCK--GYRSPLRPIP  1506
               +YQKCHD  C+  GYRS   P P
Sbjct  399   CLFYQKCHDQGCRLMGYRSNDFPFP  423



>ref|XP_006787198.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
[Neolamprologus brichardi]
Length=521

 Score =   234 bits (598),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 147/422 (35%), Positives = 217/422 (51%), Gaps = 46/422 (11%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  FP+Q  A  +A+ C  A  VF+ +      G R +LV++Y + W  Y++      H
Sbjct  39    VWKLFPRQSMATSFAQSCKEAVHVFALEKEKESMGQRIYLVTSYSELWFYYRTYTQSLMH  98

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LY DLEF+K +N   +G  MV LLI  V D LL+ Y +E S   ++ L
Sbjct  99    CYEVIPEGAVCKLYLDLEFHKPSNKGSDGKTMVSLLIQYVCDKLLEVYGIECSAKNVLNL  158

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY----------------SSSET  849
             DSSTE+KFSRHLI  L + AFKDN HVG F   +   +                 + + +
Sbjct  159   DSSTEEKFSRHLIFCLQQAAFKDNIHVGRFIHAILQPVLNKPKNGSHLDNGVETRTQAAS  218

Query  850   DERFRKLFVSKDSKSVGIPAQ-----LFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRF  1014
              E  R+     D + + +  +     LFVD  VY++NR FRL  SSKAGK++    +   
Sbjct  219   PEMKRRKEEGGDLRFLQVKNKDGRDSLFVDLGVYTKNRNFRLYKSSKAGKNAAFTVAEDN  278

Query  1015  KC-----KNMS-EDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSF  1176
             +C     K  S E+ +F+ASL+CN+    +R+L   +            +I+    Q   
Sbjct  279   QCIAKPEKGTSLEESIFLASLVCNVSFTGQRILTWDIPESS------EPKISPFKSQQGS  332

Query  1177  TPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYS  1356
                +  L+ F S          SP   VD FV  +     + G +R W +F+   L+VY 
Sbjct  333   DSDSGALSGFLS----------SPHQEVDNFVLTVVRKDGIQGSLRRWNYFAAEQLLVYD  382

Query  1357  MSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVS  1536
             ++K R+CE +GR HKSN++M VVDL+   +YQKCHDP+C+ +RS   P+P  +     ++
Sbjct  383   IAKYRWCENVGRFHKSNNIMIVVDLKEEVWYQKCHDPECRNFRSSSYPLPQEICISYVLT  442

Query  1537  FD  1542
              D
Sbjct  443   LD  444



>ref|XP_002604042.1| hypothetical protein BRAFLDRAFT_71668 [Branchiostoma floridae]
 gb|EEN60053.1| hypothetical protein BRAFLDRAFT_71668 [Branchiostoma floridae]
Length=764

 Score =   239 bits (609),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 162/464 (35%), Positives = 235/464 (51%), Gaps = 85/464 (18%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQC-INARVFSYQ---DHINGYRRFLVSTYEDFWKRYKSMNPKRR  534
             +W  FP+Q  A  +A  C  +  VF+ +   +  NG R++LV+TYE FW  Y  ++P   
Sbjct  58    VWRLFPRQKLAFDFARCCKQDVHVFACEVEGESENGQRKYLVTTYEQFWDMYSVLHPNMD  117

Query  535   HH-YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI EG  CHLYFDLEF+K  N   +G  MV  LI  V   L +KY+L  + + ++
Sbjct  118   GHFYEVIPEGATCHLYFDLEFSKVVNPGSDGVAMVQTLIRCVCWFLKKKYNLSCTEEHVL  177

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSET------DERFRKL-  870
             +L+SSTE+KFS HLI  LP  AF+DN H G F  ++C +++  +E       D   ++L 
Sbjct  178   DLESSTEEKFSHHLIFHLPGAAFQDNIHAGNFVHQMCEKLHLCTEQQSPLAGDAELQELR  237

Query  871   ----------FVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLI--PSGRF  1014
                         SKD + V     LF+D  VY++NR FRL  S+K G+ + L+  P  ++
Sbjct  238   EAVPGLDQLVVKSKDGERV-----LFIDAGVYTKNRNFRLYQSTKLGRRAPLLVAPQCKY  292

Query  1015  KCKNMS-----------EDEMFMASLICNIDADCE-RLLVCKMDSDCV------RTLHFN  1140
             K +  S           + ++F+ SL+ N+    E R+L C+  +         R    N
Sbjct  293   KLREGSKACLEGSKACWDKQVFLDSLVSNVRFSPEMRVLRCEEGNSSSGRFRPGREAGDN  352

Query  1141  T--------EIAQSFQQMSFTP----------QAFELNNFESDPSRTY------------  1230
             +        E+       S +P          QA   +      S  Y            
Sbjct  353   SRGRDSTSREVTDQLLGCSSSPYPEVDAYVVLQASREDQLSGCSSSPYPEVDAYVVLQAW  412

Query  1231  ----LMGKS--PFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGR  1392
                 L G S  P+P VDA+V   AS   V G IR W +FS+  +++Y ++ NR+CE IGR
Sbjct  413   REDQLSGCSSSPYPEVDAYVVLQASREGVHGGIRQWTYFSQGEVLMYDIAHNRWCENIGR  472

Query  1393  EHKSNHVMYVVDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNVI  1518
              H+SNHVM+V DL+R   YQKCHDP C+   Y+SP RP+P  V+
Sbjct  473   AHRSNHVMFVADLKRQVLYQKCHDPVCRAQNYKSPERPLPAEVL  516



>ref|XP_004084349.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
[Oryzias latipes]
Length=541

 Score =   233 bits (593),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 156/451 (35%), Positives = 227/451 (50%), Gaps = 71/451 (16%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  FP+Q  A+ +   C     VF+ +      G R FLV++Y + W  YK+      H
Sbjct  41    VWRLFPRQSMAVSFVRSCKETVHVFALEKERESLGQRIFLVTSYSELWHYYKTYPQSLMH  100

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LYFDLEF+K +N   +G+ MV LLI  V + LL  Y +E S   ++ L
Sbjct  101   CYEVIPEGAVCKLYFDLEFHKPSNRGSDGESMVLLLIKYVCEKLLDVYGIECSEKNVLNL  160

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAF-------------------------TAEVC  822
             DSSTE+KFSRHLI  L   AFKDN HVG F                         ++E C
Sbjct  161   DSSTEEKFSRHLIFLLQHAAFKDNIHVGKFVGAILQPALNQLKRDRGKGVKSSARSSETC  220

Query  823   SR------------IYSSSETDERFRKLFVSKDSKSVGIPAQ-----LFVDNAVYSRNRC  951
             ++            +   +E+    R+  + +D   + I  +     LFVD  VY++NR 
Sbjct  221   AQSGTHVSERKAAEVDGGAESPPIKRRKALERDLSFLLIKNKEGKDGLFVDLGVYTKNRN  280

Query  952   FRLALSSKAGKSSVLIPSGRFKC-----KNMS-EDEMFMASLICNIDADCERLLVCKMDS  1113
             FRL  SSK GK++    +   K      K +S E  +F+ASL+CN+    + +L   +  
Sbjct  281   FRLYKSSKVGKNAAFTVAEDNKFIPQPEKGISAEQSIFLASLVCNLSFTGQTILTWNVPE  340

Query  1114  DCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVG  1293
                     +T+I++S  Q             +S P        SP+P VD FV  +    
Sbjct  341   TS------DTKISRSSCQ----------QGSDSVPGPFSGCSVSPYPEVDTFVLNVVKKE  384

Query  1294  SVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDC  1473
             S+ G IR W +F+   L+VY ++K R+CE +GR HKSN++M VVDL+   +YQKCHDPDC
Sbjct  385   SIQGSIRRWNYFAAEQLLVYDIAKYRWCENVGRFHKSNNIMIVVDLKEEVWYQKCHDPDC  444

Query  1474  KGYRSPLRPIPGNVIAHCSVSFDLDSNNEGR  1566
             + +RS   P+P  +     +S+ L+ + E R
Sbjct  445   RNFRSSSYPLPQEIC----ISYILNLDEEDR  471



>ref|XP_010743226.1| PREDICTED: DNA-directed primase/polymerase protein [Larimichthys 
crocea]
Length=520

 Score =   231 bits (590),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 143/425 (34%), Positives = 220/425 (52%), Gaps = 49/425 (12%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQDHINGY--RRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  FP+Q  A+ +A+ C  A  VF+ +    G   R +LV++Y + W  Y++      H
Sbjct  39    VWKLFPRQSMAIGFAQSCREAVHVFALEKEKAGLGQRIYLVTSYSELWHYYRTYTQSLMH  98

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LYFDLEF+K +N   +G  MV  LI  V D L++ Y ++ +   ++ L
Sbjct  99    CYEVIPEGAVCKLYFDLEFHKPSNRGADGKTMVSSLIQYVCDKLMEVYGIKCTSKNVLNL  158

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSS------------------  843
             DSSTE+KFSRHLI  L   AFKDN HVG F  E+   I S+S                  
Sbjct  159   DSSTEEKFSRHLIFNLQNAAFKDNIHVGRFIHEILQPILSTSKSVGMAETRGEPAKAGEM  218

Query  844   -ETDERFRKLFVSKDSKSVGIPAQ-----LFVDNAVYSRNRCFRLALSSKAGKSSVLIPS  1005
              E+ +  R+     D + + +  +     LFVD  VY++NR FRL  SSK GK++    +
Sbjct  219   SESPQTKRRKQGDADLRFLQVKKKDGQDSLFVDLGVYTKNRNFRLYKSSKVGKNAAFTVA  278

Query  1006  --GRFKCKN----MSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQ  1167
                 F  K      +E+ +F+ASL+CN+    +R+L                ++ ++ + 
Sbjct  279   DDNEFTAKPEKGISAEESVFLASLVCNLSFTGQRILTW--------------DVPETKEA  324

Query  1168  MSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLI  1347
              +  P   + +   ++     L+  SP   VD FV  +     + G IR W +F+   L+
Sbjct  325   KTSRPHCQQGSATNTETLSGCLL--SPHQEVDNFVLTLVEKDGIRGSIRRWNYFASEQLL  382

Query  1348  VYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHC  1527
             VY ++K R+CE + R HKSN++M VVDL+   +YQKCHDP+C+ +RS   P+P  +    
Sbjct  383   VYDIAKYRWCENVKRFHKSNNIMIVVDLKEEVWYQKCHDPECRNFRSSSYPLPQEICVSY  442

Query  1528  SVSFD  1542
              ++ D
Sbjct  443   IMTLD  447



>emb|CDW59956.1| Herpes UL52 domain containing protein [Trichuris trichiura]
Length=461

 Score =   227 bits (579),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 152/396 (38%), Positives = 205/396 (52%), Gaps = 41/396 (10%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA---RVFSYQDHIN-GYRRFLVSTYEDFWKRYKSMNPKRR  534
             +W  F  QV AMKY E  I+    ++FS++ H + G R FLV   E FW  YK +    R
Sbjct  53    VWRAFRCQVSAMKYLETRISQEKLKIFSFESHFSSGGRTFLVVAVEHFWSVYKQLPNNMR  112

Query  535   HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVE  714
             H YE+I+EG PC LYFDLEF    N D +G+  V   +    +   +   +E S D I++
Sbjct  113   HCYEMIREGEPCRLYFDLEFYFCTNPDMDGELCVKRFVGYFLEKANELLGIEISTDCILD  172

Query  715   LDSSTEDKFSRHLIIRLPK-IAFKDNSHVGAFTAEVCSRIYSSSETDERFRKL----FVS  879
             LDS+TE+KFSRHLI+ LP    FK+N+  G F  ++CS + S S    R R L     ++
Sbjct  173   LDSTTEEKFSRHLIVHLPNGTVFKNNNEAGNFVKDMCSALKSLSVEQRRERCLSCLFVLT  232

Query  880   KDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSS--VLIPSGRF---KCKNMSEDEM  1044
             K+ K       L  D  VY+RNR FRL LSSK  + +   L  S  F   K +  SE ++
Sbjct  233   KEGKET-----LLCDEGVYTRNRTFRLYLSSKLKQQNPLTLASSCSFYSNKRRMESERDI  287

Query  1045  FMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSR  1224
             F  SLI   +A   +  +      C    HF         Q +   + F      S P  
Sbjct  288   FFDSLI---EATSYKHSISYAPQFCS---HFAVHFPNLRVQFTHVSEGF------SCPL-  334

Query  1225  TYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKS  1404
                    PFP ++ F E   S   V  +IR W+     GL++  ++  RYC RIGREHKS
Sbjct  335   -------PFPGLNRFFEDYLSQRKVQARIRRWFHLESAGLLILDIANYRYCHRIGREHKS  387

Query  1405  NHVMYVVDLRRGDYYQKCHDPDCK--GYRSPLRPIP  1506
             NH+MY+VDLRR  +YQKCHD +C+  GYRS   P P
Sbjct  388   NHIMYIVDLRRCLFYQKCHDEECRLMGYRSNDFPFP  423



>ref|XP_009206218.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Papio anubis]
Length=510

 Score =   226 bits (576),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 151/401 (38%), Positives = 216/401 (54%), Gaps = 42/401 (10%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIKYVCKALRELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS-------RIYSSSETDERFRKLFVS  879
             SST++KFSRHLI +L  +AFKDN HV   T E  +       R+ S+ ++      L V 
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVEKATGESWTLNSEELERLGSAEQSSPDLSFLVVK  219

Query  880   KDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVL-IPSGR----FKCKNMSED-E  1041
              +   VG    LFVD  VY+RNR FRL  SSK GKS  L +P        + K +S++ +
Sbjct  220   NN---VG-EKHLFVDLGVYTRNRNFRLYKSSKIGKSVALEVPEDNAFFPVRPKGVSDEYQ  275

Query  1042  MFMASLICNID-ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDP  1218
              F++SL+ N+  +D  R+L C    +  + + +   I  S + +      F+        
Sbjct  276   CFLSSLVSNVRFSDTLRILTCDPSQNKQKGVGYFNSIGTSVETIG----GFQC-------  324

Query  1219  SRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREH  1398
                     SP+P VD FV  + +   + G IR W +F    L+VY + K R+CE IGR H
Sbjct  325   --------SPYPEVDHFVLSLVNKDGIRGGIRRWNYFFPEELLVYDICKYRWCENIGRAH  376

Query  1399  KSNHVMYVVDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             KSN++M +VDL+   +YQKCHDP CK   ++S   P+P  V
Sbjct  377   KSNNIMILVDLKNEVWYQKCHDPVCKAENFKSDCFPLPAEV  417



>ref|XP_006026671.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X4 [Alligator sinensis]
Length=565

 Score =   226 bits (577),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 161/449 (36%), Positives = 224/449 (50%), Gaps = 88/449 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +W  FP+Q +A  Y + C     VF+ + +  +G R +LV+TY + W  YK       H 
Sbjct  41    VWKIFPRQAQAFDYVKTCKEEVHVFALEKNTEDGQRFYLVTTYIELWFYYKGQKSSLFHC  100

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEF K  N   +G  MV  LI      L ++Y ++ S + ++ LD
Sbjct  101   YEVICEKAVCKLYFDLEFYKPVNPGADGKMMVAQLIELFCKNLEERYGVKCSANDVLNLD  160

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAF-------------------------------  807
             SST++KFS HLI  L K AFKDN HVG F                               
Sbjct  161   SSTDEKFSHHLIFLLHKTAFKDNIHVGNFVRRVLQPALRLTKTKAAAVIPEEEIGHVFQS  220

Query  808   ---TAEV-------------------CSRIYSSSETDERFRK---LFVSKDSKSVGIPAQ  912
                TAE+                   C R    +ET ++  K    F+  + K  G  +Q
Sbjct  221   SKATAELNGSPVNAVAVTNASGSWQSCMRKTLDTETSQQKEKSEFSFLVVNDKDGG--SQ  278

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRFKCK---NMS-EDEMFMASLICNI-  1071
             LFVD  VY++NR FRL  SSK+G+  +L      +F  K   N+S E++ F++SL+CNI 
Sbjct  279   LFVDMGVYTKNRNFRLYKSSKSGRRVILEIAEDNKFVPKLKENISIEEQYFLSSLVCNIR  338

Query  1072  DADCERLLVC-KMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
              +D E++L C   D     ++H N+ I++        P         +DP   Y    SP
Sbjct  339   SSDIEKILTCDNPDGKRGTSMHLNSNISR-------CPSVL------TDPIEGYHY--SP  383

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             +P VD FV  + +   V G IR W +FS   L+VY +S+ R+CE IGR HKSN++M ++D
Sbjct  384   YPEVDRFVLSLVNKDGVQGGIRHWNYFSLEELLVYDISRYRWCENIGRAHKSNNIMILID  443

Query  1429  LRRGDYYQKCHDPDC-----KGYRSPLRP  1500
             L+R  +YQKCHDP C     K  RSPL P
Sbjct  444   LKREVWYQKCHDPVCRAENFKSKRSPLPP  472



>ref|XP_006026668.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X1 [Alligator sinensis]
 ref|XP_006026669.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X2 [Alligator sinensis]
 ref|XP_006026670.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X3 [Alligator sinensis]
Length=604

 Score =   227 bits (578),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 161/449 (36%), Positives = 224/449 (50%), Gaps = 88/449 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +W  FP+Q +A  Y + C     VF+ + +  +G R +LV+TY + W  YK       H 
Sbjct  41    VWKIFPRQAQAFDYVKTCKEEVHVFALEKNTEDGQRFYLVTTYIELWFYYKGQKSSLFHC  100

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEF K  N   +G  MV  LI      L ++Y ++ S + ++ LD
Sbjct  101   YEVICEKAVCKLYFDLEFYKPVNPGADGKMMVAQLIELFCKNLEERYGVKCSANDVLNLD  160

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAF-------------------------------  807
             SST++KFS HLI  L K AFKDN HVG F                               
Sbjct  161   SSTDEKFSHHLIFLLHKTAFKDNIHVGNFVRRVLQPALRLTKTKAAAVIPEEEIGHVFQS  220

Query  808   ---TAEV-------------------CSRIYSSSETDERFRK---LFVSKDSKSVGIPAQ  912
                TAE+                   C R    +ET ++  K    F+  + K  G  +Q
Sbjct  221   SKATAELNGSPVNAVAVTNASGSWQSCMRKTLDTETSQQKEKSEFSFLVVNDKDGG--SQ  278

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRFKCK---NMS-EDEMFMASLICNI-  1071
             LFVD  VY++NR FRL  SSK+G+  +L      +F  K   N+S E++ F++SL+CNI 
Sbjct  279   LFVDMGVYTKNRNFRLYKSSKSGRRVILEIAEDNKFVPKLKENISIEEQYFLSSLVCNIR  338

Query  1072  DADCERLLVC-KMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
              +D E++L C   D     ++H N+ I++        P         +DP   Y    SP
Sbjct  339   SSDIEKILTCDNPDGKRGTSMHLNSNISR-------CPSVL------TDPIEGY--HYSP  383

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             +P VD FV  + +   V G IR W +FS   L+VY +S+ R+CE IGR HKSN++M ++D
Sbjct  384   YPEVDRFVLSLVNKDGVQGGIRHWNYFSLEELLVYDISRYRWCENIGRAHKSNNIMILID  443

Query  1429  LRRGDYYQKCHDPDC-----KGYRSPLRP  1500
             L+R  +YQKCHDP C     K  RSPL P
Sbjct  444   LKREVWYQKCHDPVCRAENFKSKRSPLPP  472



>ref|XP_008055415.1| PREDICTED: DNA-directed primase/polymerase protein [Tarsius syrichta]
Length=554

 Score =   226 bits (575),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 161/462 (35%), Positives = 231/462 (50%), Gaps = 82/462 (18%)
 Frame = +1

Query  307   LRLLHEIRVDLSEQKKLSQEIWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLV  480
             L L++  R+   EQ      IW  F +Q +A  +A  C  +  VF+ +  + +G R +LV
Sbjct  24    LSLVYRPRLSKPEQPP---SIWKLFHRQTQAFNFARSCKEDVHVFALEYKVGDGQRVYLV  80

Query  481   STYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVF  660
             +TY + W  YKS      H YEVI E   C LYFDLEFNK AN   +G EMV LLI  V 
Sbjct  81    TTYAELWFYYKSRK-NLLHCYEVIPENAVCKLYFDLEFNKPANPGADGKEMVALLIEHVC  139

Query  661   DTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS-  837
               L + +S+  S + ++ LDSST++KFSRHLI +L  +AFKDN H G F  ++       
Sbjct  140   KVLQELHSVNCSAEDVLNLDSSTDEKFSRHLIFQLHDVAFKDNIHAGHFVRKILQPALQL  199

Query  838   -SSETDE-----------------RFRKLFVSKDS-------------------------  888
              +SE+D+                  F K+   KD+                         
Sbjct  200   IASESDDGISETTGQGFPHVSEGISFNKMSTDKDTEGSCTLDSETLERLGSAEPSGPSLS  259

Query  889   ----KSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-  1038
                 K+     QLFVD  VY+RNR FRL  SSK GK   L      +F   + KN+SE+ 
Sbjct  260   FSVVKTDTGEKQLFVDLGVYTRNRNFRLYKSSKIGKHVTLEIAEDNKFFPTQSKNISEEY  319

Query  1039  EMFMASLICNID-ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESD  1215
             + F++SL+ N+  +D  R+L C+   +  + + +   ++ S +    T Q F+       
Sbjct  320   QYFLSSLVSNVRFSDTLRILTCETSQNKQKGVEYLNSMSTSGE----TIQGFQC------  369

Query  1216  PSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGRE  1395
                      SP+P VD FV  + +   + G IR W +F    L+VY + K R+CE IGR 
Sbjct  370   ---------SPYPEVDHFVLSLVNNHGIRGGIRRWNYFFPEELLVYDICKYRWCENIGRA  420

Query  1396  HKSNHVMYVVDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             HKSN++M +VDL+   +YQKCHDP CK   ++S   P+P  V
Sbjct  421   HKSNNIMILVDLKNEVWYQKCHDPVCKAEHFKSDCFPLPAEV  462



>ref|XP_003978395.1| PREDICTED: coiled-coil domain-containing protein 111 homolog 
[Takifugu rubripes]
Length=530

 Score =   224 bits (570),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 143/429 (33%), Positives = 214/429 (50%), Gaps = 62/429 (14%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQ--DHINGYRRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  +P+Q  A+ +A++C  A  VF+ +  + + G R +LV++Y + W  Y++      H
Sbjct  39    VWNLYPRQSMAIAFAQRCKEAVHVFALEKENSLPGQRIYLVTSYSELWHYYRTYTHSLMH  98

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LYFDLEF K AN   +G  MV  LI  V D L++ Y +  +   ++ L
Sbjct  99    CYEVIPEGTVCKLYFDLEFYKPANKGADGKVMVSRLIRYVCDKLMEIYGITSTTCNVLNL  158

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVC---------SRIYSSSETDERFRKL  870
             DSSTE+KFSRHLI  L    FKDN HVG F   +           R ++S        + 
Sbjct  159   DSSTEEKFSRHLIFNLKNAVFKDNIHVGRFIHAILQPILSTLKGGRSHNSGVNSSEISRA  218

Query  871   FVS-----KDSKSVGIPAQ-----------------------LFVDNAVYSRNRCFRLAL  966
              +S     K S+S G P                         LFVD  VY++NR FRL  
Sbjct  219   DISGGKPAKTSESCGSPPTKRHKQEERDLGFLLVKNKDGQDCLFVDLGVYTKNRNFRLYK  278

Query  967   SSKAGKSSVLIPS--GRFKCK----NMSEDEMFMASLICNIDADCERLLVCKMDSDCVRT  1128
             SSKAGK +V   +    F  K      +E+ +F+ASL+CN+    +R+L           
Sbjct  279   SSKAGKRTVFAVAEDNTFHAKPEKSRSAEESVFLASLVCNVSFTGQRILTW---------  329

Query  1129  LHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGK  1308
                  E+ ++ +  +  P+    +  +++       G SP   VD FV  +     + G 
Sbjct  330   -----EVPETTEAKASRPRC--QHGSDTNHELYSGGGSSPHQEVDDFVLTLVQKDGIQGS  382

Query  1309  IRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRS  1488
             IR W +F+   L+VY + K R+CE + R HKSN++M + DL+   +YQKCHDP+C+ +RS
Sbjct  383   IRRWNYFAAEQLLVYDIVKYRWCENVQRFHKSNNIMIIADLKEEVWYQKCHDPECRNFRS  442

Query  1489  PLRPIPGNV  1515
                P+P  +
Sbjct  443   SSYPLPQEI  451



>ref|XP_006026673.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X6 [Alligator sinensis]
Length=474

 Score =   222 bits (565),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 158/447 (35%), Positives = 224/447 (50%), Gaps = 85/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +W  FP+Q +A  Y + C     VF+ + +  +G R +LV+TY + W  YK       H 
Sbjct  41    VWKIFPRQAQAFDYVKTCKEEVHVFALEKNTEDGQRFYLVTTYIELWFYYKGQKSSLFHC  100

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEF K  N   +G  MV  LI      L ++Y ++ S + ++ LD
Sbjct  101   YEVICEKAVCKLYFDLEFYKPVNPGADGKMMVAQLIELFCKNLEERYGVKCSANDVLNLD  160

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAF-------------------------------  807
             SST++KFS HLI  L K AFKDN HVG F                               
Sbjct  161   SSTDEKFSHHLIFLLHKTAFKDNIHVGNFVRRVLQPALRLTKTKAAAVIPEEEIGHVFQS  220

Query  808   ---TAEV-------------------CSRIYSSSETDERFRK---LFVSKDSKSVGIPAQ  912
                TAE+                   C R    +ET ++  K    F+  + K  G  +Q
Sbjct  221   SKATAELNGSPVNAVAVTNASGSWQSCMRKTLDTETSQQKEKSEFSFLVVNDKDGG--SQ  278

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRFKCK---NMS-EDEMFMASLICNI-  1071
             LFVD  VY++NR FRL  SSK+G+  +L      +F  K   N+S E++ F++SL+CNI 
Sbjct  279   LFVDMGVYTKNRNFRLYKSSKSGRRVILEIAEDNKFVPKLKENISIEEQYFLSSLVCNIR  338

Query  1072  DADCERLLVC-KMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
              +D E++L C   D     ++H N+ I++        P         +DP   Y    SP
Sbjct  339   SSDIEKILTCDNPDGKRGTSMHLNSNISR-------CPSVL------TDPIEGYHY--SP  383

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             +P VD FV  + +   V G IR W +FS   L+VY +S+ R+CE IGR HKSN++M ++D
Sbjct  384   YPEVDRFVLSLVNKDGVQGGIRHWNYFSLEELLVYDISRYRWCENIGRAHKSNNIMILID  443

Query  1429  LRRGDYYQKCHDPDCKG--YRSPLRPI  1503
             L+R  +YQKCHDP C+   ++S  R I
Sbjct  444   LKREVWYQKCHDPVCRAENFKSKRRRI  470



>ref|XP_003380119.1| coiled-coil domain-containing protein 111 [Trichinella spiralis]
 gb|EFV60265.1| coiled-coil domain-containing protein 111 [Trichinella spiralis]
Length=585

 Score =   224 bits (570),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 156/449 (35%), Positives = 233/449 (52%), Gaps = 43/449 (10%)
 Frame = +1

Query  250   PLVFYGSPHGVPPKRPAS-LLRLLHEIRVDLSEQKKLS---------QEIWATFPKQVEA  399
             P +   S +G  PK P++ LL+ + +      E   +S         +  W  F +Q EA
Sbjct  4     PTISSSSFYGQRPKAPSNGLLQRIEDSVKKFKEHPLVSPRRCSLHDDKYCWKIFRRQNEA  63

Query  400   MKYAEQCINA---RVFSYQD--HINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGL  564
             + Y + C ++   ++F ++      G R FL+ST   FW  YK++    RH YEVI+E  
Sbjct  64    LTYLKSCSSSEPLKLFCFESISMPAGCRTFLISTVSHFWNVYKNLPEFGRHCYEVIREAT  123

Query  565   PCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKFS  744
              C LYFDLEF   +N   NG++ V + +  + + + + + +E ++  IV+LD+STE KFS
Sbjct  124   RCRLYFDLEFYFNSNPSHNGEQCVQIFVSFLCERIHESFGIECTYSCIVDLDASTEKKFS  183

Query  745   RHLIIRLPKIA-FKDNSHVGAFTAEVCSRIYSSSETDERFR---KLFVSKDSKSVGIPAQ  912
             RHLI+ LP+ A F+DN  VG F  ++C+R+ S S  + R R   +LFV  D         
Sbjct  184   RHLIVHLPENAVFEDNLSVGNFVKDLCARLKSMSTEERRDRSLEQLFVINDDGQ----ET  239

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGR---FKCKNM--SEDEMFMASLICNIDA  1077
             L  D  VY+RNR FRL LSSK  + + L  +     +  + +  SE E+F  SLI  +D 
Sbjct  240   LICDLGVYTRNRNFRLFLSSKMNQKNPLKLAKACEFYTARGIQPSEQEVFFDSLIEVLDE  299

Query  1078  DCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPP  1257
                 +L C  D        F   +  + QQ S   +   L N   D        +SPFP 
Sbjct  300   KEANVLACTSDK-------FAHSVKHAAQQHS---EHSTLKN--QDGILEGRHERSPFPE  347

Query  1258  VDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKN-RYCERIGREHKSNHVMYVVDLR  1434
             +D F E      +    +RSW +F     ++ ++++  RYC RIGREH+ NH+MY+VDL+
Sbjct  348   IDCFFEDYLQRQNPAAAVRSWIYFKNCQQLLLAVNRRFRYCHRIGREHRRNHIMYMVDLK  407

Query  1435  RGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             R  +YQKC DPDC+   YRS    +P NV
Sbjct  408   RAVFYQKCFDPDCQAVNYRSNDFVLPDNV  436



>ref|XP_341434.3| PREDICTED: DNA-directed primase/polymerase protein [Rattus norvegicus]
 ref|XP_001060721.2| PREDICTED: DNA-directed primase/polymerase protein [Rattus norvegicus]
 ref|XP_006222299.1| PREDICTED: DNA-directed primase/polymerase protein [Rattus norvegicus]
 ref|XP_006253229.1| PREDICTED: DNA-directed primase/polymerase protein [Rattus norvegicus]
Length=534

 Score =   222 bits (566),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 151/429 (35%), Positives = 222/429 (52%), Gaps = 66/429 (15%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + NG R +LV++Y  FW  YK+      H 
Sbjct  41    IWKIFHRQNQAFNFVKSCKESVHVFALEHKMGNGQRIYLVTSYAQFWFYYKTRT-TLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G EMV LL+  V + L + YS+  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPGADGKEMVALLVQHVCEALQEIYSVHCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS---RIYSSSETDERFR---------  864
             SSTE+KFSRHLI +L  +AFKDN+HVG F  ++      + +  + DE            
Sbjct  160   SSTEEKFSRHLIFQLHDVAFKDNTHVGNFVRKILQPALHLITKDDEDEITEAVGHEASCF  219

Query  865   -----KLFVSKDSKSVGIPAQ------------------LFVDNAVYSRNRCFRLALSSK  975
                  K  +S+  + + +P Q                  LFVD  VY++NR FRL  SSK
Sbjct  220   SVTPLKQEISEAWEKLALPKQCDPDLSFLVVKNHKGEKCLFVDLGVYTKNRNFRLYQSSK  279

Query  976   AGK--SSVLIPSGRF---KCKNMSED-EMFMASLICNID-ADCERLLVCKMDSDCVRTLH  1134
              GK  S  +    RF   + K++SE+ + F++SL+ N+  +D  R+L C       + + 
Sbjct  280   IGKRVSLEVAEDNRFIPKQSKDISEENQYFLSSLVSNVRFSDTLRILSCDPSQTKRKRVE  339

Query  1135  FNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIR  1314
             ++     S + +    + F+                SP+P VD FV  + +     G IR
Sbjct  340   YSNSAGTSVEPI----EGFQ---------------ASPYPEVDRFVLSLVNKPDTEGGIR  380

Query  1315  SWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKG--YRS  1488
              W +F    L+VY + K R+CE IGR HKSN++M +VDL+   +YQKCHDP CK   ++S
Sbjct  381   RWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAQNFKS  440

Query  1489  PLRPIPGNV  1515
                P+P  V
Sbjct  441   TCFPLPTEV  449



>sp|Q32PL8.2|PRIPO_DANRE RecName: Full=DNA-directed primase/polymerase protein; AltName: 
Full=Coiled-coil domain-containing protein 111 homolog [Danio 
rerio]
Length=523

 Score =   221 bits (564),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 148/420 (35%), Positives = 209/420 (50%), Gaps = 60/420 (14%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQC-INARVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRH  537
             IW  FP+Q  A+ +A+    +  +FS +   +  G R FLV++Y + W  Y +      H
Sbjct  42    IWRLFPRQNAAIAFAQHIKQDVHIFSLEKEGSDAGQRIFLVTSYSELWHYYSTHRHSLMH  101

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LYFDLEF+K +N + +G  MV  LI  V + L + Y L  S   +++L
Sbjct  102   CYEVILEGAVCKLYFDLEFHKASNKNLDGKMMVAKLIQYVCEKLEEVYGLHCSAKDVLDL  161

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSS-------------------  840
             DSST DKFS HLI  LP  AFKDNSHVG F  ++     ++                   
Sbjct  162   DSSTSDKFSHHLIFMLPNAAFKDNSHVGRFIHDILHPALTNLKKSNPEAPGENRDDVEGT  221

Query  841   ----SETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSG  1008
                  +T+E        K+ K      QLFVD  VY++NR FRL  SSK GK++  I + 
Sbjct  222   QAKRRKTEENDLGFLTVKNEKG---QEQLFVDLGVYTKNRNFRLYKSSKLGKNAAFIVAE  278

Query  1009  RFK-----CKNMSEDE-MFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQM  1170
               K      K +++DE +F+ASLI N+    +R+L   M                     
Sbjct  279   DNKFVPNPSKQITKDERIFLASLITNVSFTGQRILTYDMTQK------------------  320

Query  1171  SFTPQAFELNNFESDPSRTYLMG---KSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYG  1341
               +    E    E +   + L+G    SPF  VD FV  +     + G IR W +F+   
Sbjct  321   --STAGSECPTLERESHSSDLLGDQKTSPFKEVDEFVLTLVCKDGIQGSIRRWNYFACEQ  378

Query  1342  LIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCK--GYRSPLRPIPGNV  1515
             L+VY + K R+C  + R HKSN+++ VVDL+   +YQKCHDP+C+   YRS   P+P  V
Sbjct  379   LLVYDIEKFRWCHNVKRFHKSNNIIIVVDLKEEVWYQKCHDPECRRQNYRSSSFPLPQEV  438



>ref|XP_006916437.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X3 [Pteropus alecto]
Length=522

 Score =   220 bits (560),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 149/413 (36%), Positives = 211/413 (51%), Gaps = 50/413 (12%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +W  F +Q EA  + + C  +  VF+ +  + +G R +LV+TY  FW  YKS      H 
Sbjct  41    VWKLFHRQTEAFNFVKNCKEDVHVFALEYKVGDGQRIYLVTTYVQFWFYYKS-RKNLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G  MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPEADGKMMVALLIEHVCKALQELYRVNCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVC--SRIYSSSETDERFRKLFVSKDSK-  891
             SST++KFSRHLI +L  +AFKDN HVG F  ++   +    + E+D+   +  VS  S+ 
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVKKILQPASHLIAGESDDGIPETRVSHFSEI  219

Query  892   -----------------SVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF  1014
                              ++G    LFVD  VY+RNR FRL  SSK GK   L      +F
Sbjct  220   PVKQGISFSKMSTVVKNTIG-KKHLFVDLGVYTRNRNFRLYKSSKIGKPVALEVAEDNKF  278

Query  1015  KCKN---MSEDEMFMASLICNID-ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTP  1182
                      E++ F++SLI N+  +D  R+L C    +            +  Q   F+ 
Sbjct  279   SLTQSDISEENQYFLSSLISNVRFSDTLRILTCDTSQE-----------NKQKQVEYFSS  327

Query  1183  QAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMS  1362
              +  + N E           SP+P +D FV  + +   + G IR W +F    L+VY + 
Sbjct  328   TSTSVENIEG-------FQGSPYPEIDEFVLSLVNKNGIKGGIRHWNYFFPEELLVYDIC  380

Query  1363  KNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             K R+C  IGR HKSN++M +VDL+   +YQKCHDP CK   ++S   P+P  V
Sbjct  381   KYRWCGNIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAENFKSNRFPLPAEV  433



>gb|ELT98007.1| hypothetical protein CAPTEDRAFT_224955 [Capitella teleta]
Length=504

 Score =   219 bits (559),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 146/429 (34%), Positives = 212/429 (49%), Gaps = 70/429 (16%)
 Frame = +1

Query  370   WATFPKQVEAMKYAE-QCINARVFSYQDHI----NGYRRFLVSTYEDFWKRYKSMNPKRR  534
             W  F +Q EA  +A  Q     VF+++        G R +LV++ E FW  Y+ MN  +R
Sbjct  49    WKIFYRQKEAFHFARSQSKELHVFAFESETFQQKGGQRLYLVASLEHFWHYYQGMNRHQR  108

Query  535   HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVE  714
             HHYE+I EG  C LYFDLEF +  N DK+G   V +LI  +   L +++ +      ++ 
Sbjct  109   HHYELIPEGAVCRLYFDLEFQRAENPDKDGHSAVAVLIQYICACLKKRFQVNCCEKDVLI  168

Query  715   LDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFT------------AEVCSRI-YSSSETDE  855
             LD+ST  KFS+HLI  +   AFK N   G F             ++ C++   ++S  DE
Sbjct  169   LDASTPSKFSQHLIFHMAGAAFKCNVTAGNFVHSVMRLVLEEVNSQTCAKAELTNSLLDE  228

Query  856   RF----------RKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPS  1005
             +            K  + KD         L VD  VY+RNR FRL LS K GK++ L+ +
Sbjct  229   QILEWSGLKVEQLKELICKDKDG---KDSLIVDLGVYTRNRNFRLYLSCKMGKNNPLLTA  285

Query  1006  GRF-------KCKNM-----SEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEI  1149
              +        KCK       ++ ++F+ SL+     +  R+L C  D            +
Sbjct  286   AQNQFCCHQKKCKTRFIKPSTQQQLFLDSLVTASYENGMRILTCDEDP----------RL  335

Query  1150  AQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIA----SVGSVPGKIRS  1317
               +  Q S  P  F L  F+S          SP+P VDAF+   A      G  PG +R 
Sbjct  336   RNTSSQHSDRPTDF-LEGFQS----------SPYPEVDAFISERAKRWGGEGCPPGSVRQ  384

Query  1318  WYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKG--YRSP  1491
             W +FS   +I+Y++ +NR+C  IGR HKSN +M + DL+   +YQKCHDPDCK   Y+SP
Sbjct  385   WVYFSHGQIIIYNIVRNRWCANIGRMHKSNKIMLIADLKHRVFYQKCHDPDCKAVNYKSP  444

Query  1492  LRPIPGNVI  1518
                +P NV+
Sbjct  445   DEALPRNVL  453



>ref|XP_004682561.1| PREDICTED: coiled-coil domain-containing protein 111 [Condylura 
cristata]
Length=561

 Score =   220 bits (561),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 157/448 (35%), Positives = 220/448 (49%), Gaps = 86/448 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQ-DHINGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +    NG R +LV+TY + W  YK       H 
Sbjct  41    IWKLFHRQAQAFNFVKSCKEDVHVFALEYKGSNGQRVYLVTTYTELWFYYK-FRKNLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   NG +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPGANGKKMVALLIEHVCKALQELYKVNCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVC--------------------------  822
             SST++KFSRHLI +L  +AFKDN+HVG F  ++                           
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNAHVGNFVRKILQPACHLIACEDDHRIQGTTAHGFSPY  219

Query  823   -----------SRIYSSSETDE-------RFRKLFVSKDS----------KSVGIPAQLF  918
                        S+I +  +TDE       +  +L  ++ S           S+G   QLF
Sbjct  220   SETPVRQGVSFSKISTDEDTDESQTLSSKKLERLVSAEQSNSDLSFLVVKNSLG-EKQLF  278

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-A  1077
             VD  VY+RNR FRL  SSK GK + L      RF   + KN+SE+ + F++SL+ N+  +
Sbjct  279   VDLGVYTRNRNFRLYKSSKIGKLATLEIAEDNRFIPKQSKNISEENQYFLSSLVSNVRFS  338

Query  1078  DCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPP  1257
             D  R+L     SD  +      E   S      + + F+                SP+P 
Sbjct  339   DTLRILT----SDTPQIKQKGVEHCNSANTSVESIEGFQC---------------SPYPE  379

Query  1258  VDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRR  1437
             +D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+ 
Sbjct  380   IDQFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKN  439

Query  1438  GDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
               +YQKCHDP CK   ++S   P+P  V
Sbjct  440   EIWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|NP_001001184.1| DNA-directed primase/polymerase protein [Mus musculus]
 ref|XP_006509520.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X1 [Mus musculus]
 ref|XP_006509521.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X2 [Mus musculus]
 ref|XP_006509522.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X3 [Mus musculus]
 ref|XP_006509523.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X4 [Mus musculus]
 sp|Q6P1E7.1|PRIPO_MOUSE RecName: Full=DNA-directed primase/polymerase protein; AltName: 
Full=Coiled-coil domain-containing protein 111 [Mus musculus]
 gb|AAH65112.1| Coiled-coil domain containing 111 [Mus musculus]
 gb|EDL35576.1| coiled-coil domain containing 111 [Mus musculus]
Length=537

 Score =   220 bits (560),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 153/435 (35%), Positives = 219/435 (50%), Gaps = 78/435 (18%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQ-DHINGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +    NG R +LV++Y   W  YK+      H 
Sbjct  41    IWKLFHRQNQAFNFVKSCKESVHVFALECKRGNGQRIYLVTSYAQLWFYYKTRK-TLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G  MV LLI  V   L + Y+++ S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPGADGKMMVALLIQHVCKALEEFYNVQCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS-RIYSSSETDERFRKLFVSKDS---  888
             SSTE+KFSRHLI +L  +AFKDN H G F  ++    ++  +E DE      V +D+   
Sbjct  160   SSTEEKFSRHLIFQLHNVAFKDNRHAGNFVRKILQPALHLIAEDDEAKVPEAVGQDASGF  219

Query  889   -------------KSVGIPAQ------------------LFVDNAVYSRNRCFRLALSSK  975
                          + VG+P Q                  LFVD  VY++NR FRL  SSK
Sbjct  220   SVTPLKQEISEAREKVGLPKQCDPDLSFLVVKNHMGEKCLFVDLGVYTKNRNFRLYQSSK  279

Query  976   AGK--SSVLIPSGRF---KCKNMSED-EMFMASLICNID-ADCERLLVC------KMDSD  1116
              GK  S  +    RF   + K++SE+ + F++SL+ N+  +D  R+L C      +  ++
Sbjct  280   IGKCVSLEVAEDNRFIPKQSKDISEENQYFLSSLVSNVRFSDTLRVLTCHPSQTKRKRAE  339

Query  1117  CVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGS  1296
             C  +   + E  + FQ                          SP+P VD FV  + +   
Sbjct  340   CFNSTGTSVESIEGFQ-------------------------GSPYPEVDQFVLSLVNKHD  374

Query  1297  VPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCK  1476
             + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+   +YQKCHDP CK
Sbjct  375   IKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWYQKCHDPVCK  434

Query  1477  G--YRSPLRPIPGNV  1515
                ++S   P+P  V
Sbjct  435   AQNFKSTCSPLPTEV  449



>ref|NP_001032455.1| DNA-directed primase/polymerase protein [Danio rerio]
 gb|AAI08067.1| Zgc:123274 [Danio rerio]
Length=523

 Score =   219 bits (558),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 146/417 (35%), Positives = 211/417 (51%), Gaps = 54/417 (13%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQC-INARVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRH  537
             IW  FP+Q  A+ +A+    +  +FS +   +  G R FLV++Y + W  Y +      H
Sbjct  42    IWRLFPRQNAAIAFAQHIKQDVHIFSLEKEGSDAGQRIFLVTSYSELWHYYSTHRHSLMH  101

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LYFDLEF+K +N + +G  MV  LI  V + L + Y L  S   +++L
Sbjct  102   CYEVILEGAVCKLYFDLEFHKASNKNLDGKMMVAKLIQYVCEKLEEVYGLHCSAKDVLDL  161

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSS-------------------  840
             DSST DKFS HLI  LP  AFKDNSHVG F  ++     ++                   
Sbjct  162   DSSTSDKFSHHLIFMLPNAAFKDNSHVGRFINDILHPALTNLKKSNPEAPGENRDDVEGT  221

Query  841   ----SETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSG  1008
                  +T+E        K+ K      QLFVD  VY++NR FRL  SSK GK++  I + 
Sbjct  222   QAKRRKTEENDLGFLTVKNEKG---QEQLFVDLGVYTKNRNFRLYKSSKLGKNAAFIVAE  278

Query  1009  RFK-----CKNMSEDE-MFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQM  1170
               K      K +++DE +F+ASLI N+    +R+L   M           T+ + +  + 
Sbjct  279   DNKFVPNPSKQITKDERIFLASLITNVSFTGQRILTYDM-----------TQKSTAGSEC  327

Query  1171  SFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIV  1350
                 +    ++ + D         SPF  VD FV  +     + G IR W +F+   L+V
Sbjct  328   PTLQRESHSSDLQGD------QKTSPFKEVDEFVLTLVCKDGIQGSIRRWNYFACEQLLV  381

Query  1351  YSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCK--GYRSPLRPIPGNV  1515
             Y + K R+C  + R HKSN+++ VVDL+   +YQKCHDP+C+   YRS   P+P  V
Sbjct  382   YDIEKFRWCHNVKRFHKSNNIIIVVDLKEEVWYQKCHDPECRRQNYRSSSFPLPQEV  438



>ref|XP_010643496.1| PREDICTED: DNA-directed primase/polymerase protein [Fukomys damarensis]
 ref|XP_010643497.1| PREDICTED: DNA-directed primase/polymerase protein [Fukomys damarensis]
 ref|XP_010643498.1| PREDICTED: DNA-directed primase/polymerase protein [Fukomys damarensis]
 gb|KFO24339.1| Coiled-coil domain-containing protein 111 [Fukomys damarensis]
Length=545

 Score =   219 bits (557),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 162/447 (36%), Positives = 220/447 (49%), Gaps = 85/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  N  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFHRQNQAFHFVKSCKENVHVFALECKVGDGQRIYLVTTYAQLWFYYKSRK-HLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + YS+  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKHANPEADGKKMVVLLIEHVCKALQELYSVSCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST++KFSRHLI +L  +AFKDN HVG F  ++        SSE D+R            
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPALHLISSEGDDRIPNPMDHEFSHF  219

Query  859   ----------FRKLFVSKDS-----------------------------KSVGIPAQLFV  921
                       F ++   KD+                             KS      LFV
Sbjct  220   PETPLKQGISFNQISPDKDAVKSRTLNSKIPERPGSAEQSSPDLSFLVVKSDMGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK  VL      RF   + KN SE+ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKCVVLQVAEDNRFFPKQSKNTSEENQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    D  +     TE  +S   +  T + F+                SP+P V
Sbjct  340   SLRILTC----DTSQNKRKRTERVKSTSSIE-TIEGFQC---------------SPYPEV  379

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+C+ IGR HKSN++M VVDL+  
Sbjct  380   DCFVLSLVTKNDIKGGIRRWNYFFPEELLVYDICKYRWCQNIGRAHKSNNIMIVVDLKNE  439

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  440   VWYQKCHDPVCKAENFKSECFPLPVEV  466



>ref|XP_006916438.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X4 [Pteropus alecto]
Length=507

 Score =   218 bits (555),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 146/400 (37%), Positives = 208/400 (52%), Gaps = 39/400 (10%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +W  F +Q EA  + + C  +  VF+ +  + +G R +LV+TY  FW  YKS      H 
Sbjct  41    VWKLFHRQTEAFNFVKNCKEDVHVFALEYKVGDGQRIYLVTTYVQFWFYYKS-RKNLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G  MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPEADGKMMVALLIEHVCKALQELYRVNCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVC--SRIYSSSETDERFRKLFVSKDSKS  894
             SST++KFSRHLI +L  +AFKDN HVG F  ++   +    + E+D+   +  VS  S+ 
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVKKILQPASHLIAGESDDGIPETRVSHFSE-  218

Query  895   VGIPAQLFV-----DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRFKCKN---MSEDEM  1044
               IP +  +        VY+RNR FRL  SSK GK   L      +F         E++ 
Sbjct  219   --IPVKQGISFSKMSTGVYTRNRNFRLYKSSKIGKPVALEVAEDNKFSLTQSDISEENQY  276

Query  1045  FMASLICNID-ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPS  1221
             F++SLI N+  +D  R+L C    +            +  Q   F+  +  + N E    
Sbjct  277   FLSSLISNVRFSDTLRILTCDTSQE-----------NKQKQVEYFSSTSTSVENIEG---  322

Query  1222  RTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHK  1401
                    SP+P +D FV  + +   + G IR W +F    L+VY + K R+C  IGR HK
Sbjct  323   ----FQGSPYPEIDEFVLSLVNKNGIKGGIRHWNYFFPEELLVYDICKYRWCGNIGRAHK  378

Query  1402  SNHVMYVVDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             SN++M +VDL+   +YQKCHDP CK   ++S   P+P  V
Sbjct  379   SNNIMILVDLKNEVWYQKCHDPVCKAENFKSNRFPLPAEV  418



>ref|XP_001162592.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Pan troglodytes]
 ref|XP_009446918.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Pan troglodytes]
Length=560

 Score =   219 bits (557),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 157/447 (35%), Positives = 222/447 (50%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCREDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + YS+  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVRKALQELYSVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDE-------------  855
             SST++KFSRHLI +L  +AFKDN HVG F  ++         SE D+             
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPETTGHGFPHF  219

Query  856   ---------RFRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
                       F K+F            SK  + +G   Q                  LFV
Sbjct  220   SEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNVGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      RF   + K++S++ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKRVALEVTEDNRFFPTQSKDVSDEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C+   +  + + +   I  S +    T + F                 SP+P V
Sbjct  340   TLRILTCEPSQNKQKGVGYFNSIGTSVE----TIEGFRC---------------SPYPEV  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_003063911.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52284.1| predicted protein [Micromonas pusilla CCMP1545]
Length=669

 Score =   221 bits (562),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 133/391 (34%), Positives = 205/391 (52%), Gaps = 32/391 (8%)
 Frame = +1

Query  430   RVFSYQD-HINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKA  606
             R FS +D    G R+F+ ST + FW RY ++   +RH YE+I+    CHLY+DLE++K+A
Sbjct  203   RYFSAEDAEHRGRRKFIASTLDAFWARYVNVAWDKRHFYELIRADRACHLYYDLEYSKRA  262

Query  607   N---ADKNGDEMVDLLIVAVFDTLLQKYSLEG-------SHDWIVELDSSTEDKFSRHLI  756
             N   +D +G    D LI    + L ++  ++        + D +VEL S++  KFSRHL+
Sbjct  263   NPSVSDADGRAATDALISLTLEELAREEGIKTEDGEPLRASDVVVELQSTSATKFSRHLV  322

Query  757   IRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVY  936
              +LP  AF + +HVG F   +  R+  + ETD R   LFV KD     + A  FVD  VY
Sbjct  323   FKLPGAAFANAAHVGHFVRRLWKRVAETRETDPRCALLFVRKDIDDE-VAATPFVDLGVY  381

Query  937   SRNRCFRLALSSKAGKSSVLIPSGRF----KCKNMSEDE----MFMASLICNIDADCERL  1092
             +RNR FR+ LSSK  K + L+P+ R       +++   E    +F  SL   +D D +  
Sbjct  382   TRNRAFRVYLSSKFAKRTRLLPTHRLLRVGAGQSVPATEPDRGVFCGSLASVVD-DADAA  440

Query  1093  LVCKMDSDCVRTLHFNTEI------AQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
              V + +    R   +   +               +  +      ES P R       P P
Sbjct  441   RVIEYEGVGTRGAAYTGRVLRGFGGYGGGGGRVRSSSSSATTGVESRPRRG-PAANLPCP  499

Query  1255  PVDAFV----EYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYV  1422
                AFV    +  ++ GS   ++R+W  + ++G++V +M  NR+CE + R HKSN+V++ 
Sbjct  500   ETVAFVCRDFDAWSAPGSSGAEVRTWAAYPDHGVVVLNMQGNRFCENVDRAHKSNNVVFA  559

Query  1423  VDLRRGDYYQKCHDPDCKGYRSPLRPIPGNV  1515
             +DLR G YYQ+CHDP+C+GYR   R +P  +
Sbjct  560   IDLREGAYYQRCHDPECRGYRGRYRALPSEL  590



>ref|XP_004610468.1| PREDICTED: coiled-coil domain-containing protein 111 [Sorex araneus]
Length=560

 Score =   219 bits (557),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 155/454 (34%), Positives = 214/454 (47%), Gaps = 97/454 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q EA  +   C  +  +F+ +  + NG R +LV+TY   W  YK       H 
Sbjct  41    IWKLFHRQTEAFNFVRSCKEDVHIFALEYKVGNGQRIYLVTTYTQLWFYYK-FRRNLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + Y +  S   +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPEADGKKMVALLIEHVCQALQELYRVNCSAADVCNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST++KFSRHLI +L  +AFKDN HVG F  ++    +   +SE D+R            
Sbjct  160   SSTDEKFSRHLIFQLHNVAFKDNIHVGNFVRKILQPAFRLLASEDDDRTPETTGHGCFHF  219

Query  859   ----------FRKLFVSKDSKSVGI-----------------------------PAQLFV  921
                       F  + + +D    GI                                LFV
Sbjct  220   SELPVKHGLSFSTVSLDQDRGEGGILDSEKPERQWSAEQSGPDLSFLVVKSDSGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK + L      +F   + KN+S E++ F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKQAALEIAEDNKFFPRQLKNVSDENQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDS-------DCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMG  1239
               R+L C+          +C      + E  + FQ                         
Sbjct  340   TLRILTCEASCQNKQKGVECFSGASTSVETIEGFQC------------------------  375

Query  1240  KSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMY  1419
              SP+P VD FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M 
Sbjct  376   -SPYPEVDQFVLSLVTKNGIKGGIRRWNYFFPEELLVYDIYKYRWCENIGRAHKSNNIMI  434

Query  1420  VVDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +VDL+   +YQKCHDP CK   ++S   PIP  V
Sbjct  435   LVDLKNEVWYQKCHDPICKAENFKSKCFPIPAEV  468



>ref|XP_010342697.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Saimiri boliviensis boliviensis]
 ref|XP_010342698.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Saimiri boliviensis boliviensis]
 ref|XP_010342699.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Saimiri boliviensis boliviensis]
 ref|XP_010342700.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Saimiri boliviensis boliviensis]
 ref|XP_010342701.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Saimiri boliviensis boliviensis]
 ref|XP_010342703.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Saimiri boliviensis boliviensis]
 ref|XP_010342704.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Saimiri boliviensis boliviensis]
Length=557

 Score =   218 bits (556),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 154/447 (34%), Positives = 222/447 (50%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY + W  YKS      H 
Sbjct  41    IWKLFHRQTQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAELWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  + + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCAAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY----------------------  834
             SST++KFSRHLI +L  +AFKDN HVG F  ++    +                      
Sbjct  160   SSTDEKFSRHLIFQLRDVAFKDNIHVGNFLRKILQPAFNLLGSEDEDSTPETRGHGFPHF  219

Query  835   --SSSETDERFRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
               +S++    F K+F            SK  +S+G   Q                  LFV
Sbjct  220   SEASTKPGFSFNKMFAEKAVEESWTLNSKKLESLGSAEQSPSGLSFLVVKNNMGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      RF     +N+SE+ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKCVALEVAEENRFFPIPSENVSEEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    +  + + +   I+ S +    T + F+                SP+P V
Sbjct  340   TLRILTCDPSQNKQKGVGYFNSISTSVE----TIEGFQC---------------SPYPEV  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DRFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRPHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSDYFPLPAEV  467



>ref|XP_003823513.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Pan paniscus]
 ref|XP_008975364.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Pan paniscus]
 ref|XP_008975365.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Pan paniscus]
Length=560

 Score =   218 bits (556),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 156/447 (35%), Positives = 222/447 (50%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVRKALQELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDE-------------  855
             SST++KFSRHLI +L  +AFKDN HVG F  ++         SE D+             
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPETTGHGFPHF  219

Query  856   ---------RFRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
                       F K+F            SK  + +G   Q                  LFV
Sbjct  220   SEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNVGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      RF   + K++S++ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKRVALEVTEDNRFFPTQSKDVSDEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C+   +  + + +   I  S +    T + F+                SP+P V
Sbjct  340   TLRILTCEPSQNKQKGVGYFNSIGTSVE----TIEGFQC---------------SPYPEV  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_010342695.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Saimiri boliviensis boliviensis]
Length=568

 Score =   218 bits (556),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 154/447 (34%), Positives = 222/447 (50%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY + W  YKS      H 
Sbjct  52    IWKLFHRQTQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAELWFYYKSRK-NLLHC  110

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  + + ++ LD
Sbjct  111   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCAAEDVLNLD  170

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY----------------------  834
             SST++KFSRHLI +L  +AFKDN HVG F  ++    +                      
Sbjct  171   SSTDEKFSRHLIFQLRDVAFKDNIHVGNFLRKILQPAFNLLGSEDEDSTPETRGHGFPHF  230

Query  835   --SSSETDERFRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
               +S++    F K+F            SK  +S+G   Q                  LFV
Sbjct  231   SEASTKPGFSFNKMFAEKAVEESWTLNSKKLESLGSAEQSPSGLSFLVVKNNMGEKHLFV  290

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      RF     +N+SE+ + F++SL+ N+  +D
Sbjct  291   DLGVYTRNRNFRLYKSSKIGKCVALEVAEENRFFPIPSENVSEEYQYFLSSLVSNVRFSD  350

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    +  + + +   I+ S +    T + F+                SP+P V
Sbjct  351   TLRILTCDPSQNKQKGVGYFNSISTSVE----TIEGFQC---------------SPYPEV  391

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  392   DRFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRPHKSNNIMILVDLKNE  451

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  452   VWYQKCHDPVCKAENFKSDYFPLPAEV  478



>ref|XP_005630048.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X2 [Canis lupus familiaris]
Length=553

 Score =   218 bits (554),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 159/448 (35%), Positives = 222/448 (50%), Gaps = 88/448 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHIN-GYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  ++ G R +LV+TY   W  YKS N    H 
Sbjct  41    IWKLFHRQTQAFNFVKSCKEDVHVFALEYKVDDGQRIYLVTTYAQLWFYYKSRN--LLHC  98

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLE+NK AN + +G +MV LLI  V   L + Y ++ S + +  LD
Sbjct  99    YEVIPENAVCKLYFDLEYNKLANPEADGKKMVALLIEHVCKALQELYRVDCSAEDVFNLD  158

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY---------SSSETDE------  855
             SST++KFSRHLI +L  +AFKDN HVG F  ++    +         S+SET        
Sbjct  159   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIANEDDDSTSETPGLGFSHF  218

Query  856   ---------RFRKLFVSKDS-----------KSVGIPAQ------------------LFV  921
                       F K+   KD            + +G   Q                  LFV
Sbjct  219   PETPIKQGIAFSKMSSDKDRGENWTLDLREWERLGSAKQRSPDLSFLVVKNNTGEKHLFV  278

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + KN+SE+ + F++SL+ N+  +D
Sbjct  279   DLGVYTRNRNFRLYKSSKIGKHVALEIAEDNKFFPKQSKNISEENQYFLSSLVSNVRFSD  338

Query  1081  CERLLVC-KMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPP  1257
               R+L C    S   R  HF+T           + +A  +  F            SP+P 
Sbjct  339   TLRILTCDTFQSKQKRVEHFST-----------STKAENIEGFHC----------SPYPE  377

Query  1258  VDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRR  1437
             VD FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+ 
Sbjct  378   VDRFVLSLVNKNGIQGGIRRWSYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKN  437

Query  1438  GDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
               +YQKCHDP CK   ++S   P+P  V
Sbjct  438   EVWYQKCHDPVCKAENFKSDCFPLPAEV  465



>ref|XP_004757779.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X1 [Mustela putorius furo]
 ref|XP_004794168.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X1 [Mustela putorius furo]
Length=557

 Score =   218 bits (554),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 159/450 (35%), Positives = 221/450 (49%), Gaps = 90/450 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + NG R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFHRQNQAFNFVKSCKEDVHVFALEYKVGNGQRIYLVTTYAQLWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPEADGKKMVALLIEHVCKALQELYRVNCSPEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEV---------------------------  819
             SST++KFSRHLI +L  +AFKDN HVG F  ++                           
Sbjct  160   SSTDEKFSRHLIFQLRDVAFKDNIHVGNFVRKILQPAFHLIGREDDASTSETTGHEFSRF  219

Query  820   ----------CSRIYSSSETDERFRKLFVSKDSKSVGIP------------------AQL  915
                       CS++  SS+TD      + SK+ +S G                      L
Sbjct  220   PETPIKQGISCSKM--SSDTDRGESWAWNSKERESPGSAKLRGPDLSFLVVKNNVGEKHL  277

Query  916   FVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-  1074
             FVD  VY+RNR FRL  SSK GK   L      RF   + KN+SE+ + F++SL+ N+  
Sbjct  278   FVDLGVYTRNRNFRLYKSSKIGKQVALEIAEDNRFFPEQSKNISEENQYFLSSLVSNVRF  337

Query  1075  ADCERLLVCKM-DSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
             +D  R+L C    ++  R  +FN          S + +A  +  F            SP+
Sbjct  338   SDTLRILTCDTSQNEQKRVEYFN----------STSTKAGNIEGFHC----------SPY  377

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P +D FV  + +   + G IR W +F    L+VY + K R+C  IGR HKSN++M +VDL
Sbjct  378   PEIDQFVLSLVNKNGIKGGIRHWSYFFPEELLVYDICKYRWCRNIGRAHKSNNIMILVDL  437

Query  1432  RRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +   +YQKCHDP CK   +RS   P+P  V
Sbjct  438   KNEVWYQKCHDPVCKAENFRSDCFPLPAEV  467



>ref|XP_004021740.1| PREDICTED: coiled-coil domain-containing protein 111 [Ovis aries]
Length=554

 Score =   218 bits (554),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 157/450 (35%), Positives = 215/450 (48%), Gaps = 92/450 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C     VF+ +  + +G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTQAFNFVKSCKQEVHVFALECKVGDGQRIYLVTTYAQLWFYYKS----RRNL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y++  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQEFYTVNCSAEDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY-------------------  834
              LDSSTE+KFSRHLI +L  +AFKDN HVG F  ++    +                   
Sbjct  157   NLDSSTEEKFSRHLIFQLRDVAFKDNIHVGNFVRKILQPAFHLIASEDDDMTPETTGCEF  216

Query  835   -----SSSETDERFRKLFVSKDSKSVGIP-----------------------------AQ  912
                  ++SE    F K+    D    G                                +
Sbjct  217   THFSETASEQGTCFSKMSTDNDVGKSGTSNSEKLGRLGSAQQSSPGLSFLIVKNDMGEKR  276

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNID  1074
             LFVD  VY+RNR FRL  SSK GK   L      RF   + +++S E++ F+ASL+ N+ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKRVALEVAEDNRFFPVQSRDISKENQYFLASLVSNVR  336

Query  1075  -ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
              +D  R+L C       R   F      S    S T + F+                SP+
Sbjct  337   FSDALRILTCDTPQSNQRIPCF------SRASTSETTEGFQC---------------SPY  375

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P VD FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL
Sbjct  376   PEVDQFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDL  435

Query  1432  RRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +   +YQKCHDP CK   ++S   P+P  V
Sbjct  436   KNEVWYQKCHDPVCKAENFKSDCFPLPAEV  465



>ref|NP_689896.1| DNA-directed primase/polymerase protein isoform 1 [Homo sapiens]
 ref|XP_005262867.2| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X1 [Homo sapiens]
 dbj|BAB71553.1| unnamed protein product [Homo sapiens]
 gb|AAH64600.1| CCDC111 protein [Homo sapiens]
 gb|EAX04669.1| hypothetical protein FLJ33167, isoform CRA_c [Homo sapiens]
 gb|EAX04670.1| hypothetical protein FLJ33167, isoform CRA_c [Homo sapiens]
 gb|AIC53389.1| CCDC111, partial [synthetic construct]
Length=560

 Score =   218 bits (554),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 155/447 (35%), Positives = 222/447 (50%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDE-------------  855
             SST++KFSRHLI +L  +AFKDN HVG F  ++         SE D+             
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPETTGHGFPHF  219

Query  856   ---------RFRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
                       F K+F            SK  + +G   Q                  LFV
Sbjct  220   SEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + K++S++ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKRVALEVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C+   +  + + +   I  S +    T + F+                SP+P V
Sbjct  340   TLRILTCEPSQNKQKGVGYFNSIGTSVE----TIEGFQC---------------SPYPEV  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_005262869.2| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X3 [Homo sapiens]
Length=502

 Score =   216 bits (550),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 155/447 (35%), Positives = 222/447 (50%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDE-------------  855
             SST++KFSRHLI +L  +AFKDN HVG F  ++         SE D+             
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPETTGHGFPHF  219

Query  856   ---------RFRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
                       F K+F            SK  + +G   Q                  LFV
Sbjct  220   SEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + K++S++ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKRVALEVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C+   +  + + +   I  S +    T + F+                SP+P V
Sbjct  340   TLRILTCEPSQNKQKGVGYFNSIGTSVE----TIEGFQC---------------SPYPEV  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_005373542.1| PREDICTED: coiled-coil domain-containing protein 111 [Chinchilla 
lanigera]
Length=547

 Score =   217 bits (553),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 161/453 (36%), Positives = 221/453 (49%), Gaps = 96/453 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  N  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFHRQNQAFNFVKSCKENVHVFALEYKVGDGQRIYLVTTYAQLWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEF+K AN + +G +MV LLI  V   L + YS+  S + I  LD
Sbjct  100   YEVIPENAVCKLYFDLEFSKHANPEADGKKMVALLIEHVCKALQELYSVSCSAEDIFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST++KFSRHLI +L  +AFKDN HVG F  ++        SSE D+R            
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPALHLISSEDDDRIPNPMGHELSPF  219

Query  859   ----------FRKLFVSKD-SKSVGIPAQ----------------------------LFV  921
                       F ++   KD +KS  + +Q                            LFV
Sbjct  220   PETPVKQGTAFNQMSPDKDIAKSWALNSQRPERLDSAKQSSPELSFLVVKNNMGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSV--LIPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK     +    +F   K KN+SE+ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKCVAFEVAEDNKFFPKKSKNISEENQYFLSSLVTNVRFSD  339

Query  1081  CERLLVCKMDSDC-VRTLHFN-----TEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGK  1242
               R+L C    +   RT H N      E  + FQ                          
Sbjct  340   SLRILTCDTSQNKRKRTEHVNRTSSPVETIEGFQC-------------------------  374

Query  1243  SPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYV  1422
             SP+P VD FV  + +   + G IR W +F    L+VY + K R+C+ IGR HKSN++M +
Sbjct  375   SPYPEVDRFVLSLVTKNDIKGGIRRWNYFFPEELLVYDICKYRWCQNIGRAHKSNNIMIL  434

Query  1423  VDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             VDL+   +YQKCHDP CK   ++S   P+P  V
Sbjct  435   VDLKNEVWYQKCHDPICKAENFKSDCFPLPAEV  467



>ref|XP_005362641.1| PREDICTED: coiled-coil domain-containing protein 111 [Microtus 
ochrogaster]
Length=541

 Score =   216 bits (551),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 158/430 (37%), Positives = 216/430 (50%), Gaps = 68/430 (16%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  N  VF+ +    +G R +LV++Y   W  YKS      H 
Sbjct  40    IWKLFHRQNQAFNFVKSCKENVHVFALECKAGDGQRIYLVTSYAQLWFYYKSRK-TLLHC  98

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G  MV LLI  V   L + Y++  S + +  LD
Sbjct  99    YEVIPENAVCKLYFDLEFNKLANPEADGKRMVALLIEHVCKALEELYNVHCSAEDVFNLD  158

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFT--------------------AEVC------  822
             SSTE+KFSRHLI +L   AFKDN HVG F                      E+C      
Sbjct  159   SSTEEKFSRHLIFQLHDAAFKDNIHVGNFVRKILQPALHLITQKDEDKIPEEMCHEASCF  218

Query  823   SRIYSSSETDERFRKLFVSKD----------SKSVGIPAQLFVDNAVYSRNRCFRLALSS  972
             S +    ET E +  L + K             S+G    LFVD  VY+RNR FRL  SS
Sbjct  219   SDVPLEQETSEAWETLELPKQHSPDLSFLVVKNSIGEKC-LFVDLGVYTRNRNFRLYQSS  277

Query  973   KAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-ADCERLLVCKMDSDCVRTL  1131
             K GK   L      RF   + K++SE+ + F++SL+ N+  +D  R+L C    D  +T 
Sbjct  278   KIGKCVALEVAEDNRFIPEQSKDISEENQYFLSSLVSNVRFSDSLRILTC----DTSQTK  333

Query  1132  HFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKI  1311
                 E   S    + + + F+                SP+P VD FV  + +  ++ G I
Sbjct  334   RKRAEYFNSTGASAESIEGFQC---------------SPYPEVDQFVISLVNKHAIKGGI  378

Query  1312  RSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKG--YR  1485
             R W +F    L+VY + K R+CE IGR HKSN++M +VDL+   +YQKCHDP CK   ++
Sbjct  379   RRWNYFFPEELLVYDICKYRWCENIGRPHKSNNIMILVDLKNEVWYQKCHDPVCKAQNFK  438

Query  1486  SPLRPIPGNV  1515
             S   P+P  V
Sbjct  439   SNCFPLPTEV  448



>ref|XP_010708083.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Meleagris gallopavo]
Length=545

 Score =   216 bits (551),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 151/427 (35%), Positives = 217/427 (51%), Gaps = 65/427 (15%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRY-KSMNPKRRH  537
             +W  F +Q EA ++ + C  +  VF+ + +  NG R +LV+TY++ W  Y K       H
Sbjct  41    VWKIFCRQAEAFRFVKTCKEDVHVFALEKNTQNGQRFYLVTTYKELWHYYTKGYKTSLMH  100

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI E   C LYFDLEF K AN   +G +MV  LI  V   L + Y +  S   ++ L
Sbjct  101   CYEVIPEKDACKLYFDLEFYKAANPGADGKDMVAKLIELVSQKLKELYDVNCSARDVLNL  160

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSV  897
             DSST++KFSRHLI    K  FKDN HV   T  +  R  + ++ D         KD+ S 
Sbjct  161   DSSTDEKFSRHLIFLPCKTVFKDNIHVEGETGYIFQRP-APTDLDGSLTNFTAVKDA-SK  218

Query  898   GIPA-------------------------------QLFVDNAVYSRNRCFRLALSSKAGK  984
             G PA                               QLFVD  VY+RNR FR+  SSKAGK
Sbjct  219   GWPAIADQRNETETSYHGENSEFSFLIVNNKEGDKQLFVDLGVYTRNRNFRMYKSSKAGK  278

Query  985   SSVLIPSGRFK----C-KNMS-EDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTE  1146
             + +L  +   K    C +N+S E+  F++SL+CN+ +                    +T+
Sbjct  279   NVILTIAEDNKFVPNCEENISLEEAYFLSSLVCNVRS------------------KDDTK  320

Query  1147  IAQSFQQMSFTPQAFELNNFESDPSRTYLMG--KSPFPPVDAFVEYIASVGSVPGKIRSW  1320
             I  SF +      AF L +  +  +R  + G   SP+P +D FV  + +   V G IR W
Sbjct  321   ILSSFLEEEIKMSAF-LRSKTTRSTRESMEGYQDSPYPEIDCFVRSLINKDGVQGGIRQW  379

Query  1321  YWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDC--KGYRSPL  1494
              +FS   ++VY +S  R+CE IGR H+SN++M +VDL++  +YQKCHDP C  K ++S  
Sbjct  380   NYFSGEEILVYDISGYRWCENIGRAHRSNNIMILVDLKKEVWYQKCHDPVCKEKNFKSQS  439

Query  1495  RPIPGNV  1515
              P+P  +
Sbjct  440   LPLPPRI  446



>ref|XP_009446919.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Pan troglodytes]
Length=559

 Score =   217 bits (552),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 157/447 (35%), Positives = 221/447 (49%), Gaps = 85/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCREDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + YS+  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVRKALQELYSVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDE-------------  855
             SST++KFSRHLI +L  +AFKDN HVG F  ++         SE D+             
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPETTGHGFPHF  219

Query  856   ---------RFRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
                       F K+F            SK  + +G   Q                  LFV
Sbjct  220   SEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNVGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      RF   + K++S++ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKRVALEVTEDNRFFPTQSKDVSDEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C+   +  + + +   I       S T + F                 SP+P V
Sbjct  340   TLRILTCEPSQNKQKGVGYFNSIG-----TSETIEGFRC---------------SPYPEV  379

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  380   DHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  439

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  440   VWYQKCHDPVCKAENFKSDCFPLPAEV  466



>ref|XP_010834062.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Bison bison bison]
Length=554

 Score =   217 bits (552),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 158/448 (35%), Positives = 221/448 (49%), Gaps = 88/448 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C     VF+ +  + +G R +LV+TY   W  YKS N    H 
Sbjct  41    IWKLFHRQTQAFNFVKSCKQEVHVFALECKVGDGQRIYLVTTYTQLWFYYKSRN--LLHC  98

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y++  S + ++ LD
Sbjct  99    YEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQEFYTVNCSAEDVLNLD  158

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAF-------------------TAEVCSRIY---  834
             SSTE+KFSRHLI +L  +AFKDN HVG F                   T E  +R +   
Sbjct  159   SSTEEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASEDEDMTPETTAREFTHF  218

Query  835   --SSSETDERFRKLFVSKD--------SKSVGIPA---------------------QLFV  921
               + SE    F K+    D        S+ +G                        +LFV
Sbjct  219   SETPSEQGTCFGKMSTDIDVGESWTSNSEKLGRLGSAQQSSPDLSFLIVKNDMGEKRLFV  278

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + KN+S E++ F++SL+ N+  +D
Sbjct  279   DLGVYTRNRNFRLYKSSKIGKYVALEVAEDNKFFPIQSKNISKENQYFLSSLVSNVRFSD  338

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFE-LNNFESDPSRTYLMGKSPFPP  1257
               R+L C +            +  Q  Q  S T  + E +  F+           SP+P 
Sbjct  339   ALRILTCDV-----------PQTKQRVQCFSHTGTSVETIEGFQC----------SPYPE  377

Query  1258  VDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRR  1437
             +D FV  + +   + G IR W +F    L+VY + K R+CE IGR H+SN++M +VDL+ 
Sbjct  378   IDQFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHRSNNIMILVDLKN  437

Query  1438  GDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
               +YQKCHDP CK   ++S   P+P  V
Sbjct  438   EVWYQKCHDPVCKAENFKSDCFPLPAEV  465



>ref|XP_008975366.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Pan paniscus]
Length=559

 Score =   216 bits (551),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 156/447 (35%), Positives = 221/447 (49%), Gaps = 85/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVRKALQELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDE-------------  855
             SST++KFSRHLI +L  +AFKDN HVG F  ++         SE D+             
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPETTGHGFPHF  219

Query  856   ---------RFRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
                       F K+F            SK  + +G   Q                  LFV
Sbjct  220   SEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNVGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      RF   + K++S++ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKRVALEVTEDNRFFPTQSKDVSDEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C+   +  + + +   I       S T + F+                SP+P V
Sbjct  340   TLRILTCEPSQNKQKGVGYFNSIG-----TSETIEGFQC---------------SPYPEV  379

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  380   DHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  439

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  440   VWYQKCHDPVCKAENFKSDCFPLPAEV  466



>ref|XP_005517715.1| PREDICTED: coiled-coil domain-containing protein 111 [Pseudopodoces 
humilis]
Length=580

 Score =   217 bits (552),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 225/473 (48%), Gaps = 91/473 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRY-KSMNPKRRH  537
             +W  F +Q EA  Y + C  +  VF+ + +  NG R +LV+TY++ W  Y K       H
Sbjct  41    VWKIFSRQAEAFSYVKTCKEDVHVFALEKNTQNGQRFYLVTTYKELWFYYTKGCKTSLMH  100

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI     C LYFDLEF K AN D +G  MV  LI  V   L Q Y +  S   ++ L
Sbjct  101   CYEVIPAKDACKLYFDLEFYKPANPDADGKSMVKKLIELVSQKLKQLYDVNCSSKDVLNL  160

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS---RIYSSSET-------------  849
             DSSTE+KFSRHLI    K  FKDN+HVG F   +     R+  S                
Sbjct  161   DSSTEEKFSRHLIFLPQKTVFKDNAHVGKFVRTILQPAIRLIESGAAVIPTEEAGHVFQC  220

Query  850   ------DERFRKLFVSKD-----------SKSVGIP-------------------AQLFV  921
                   D  F  L   +D           +K + +P                    QLFV
Sbjct  221   SAGAGLDGSFTNLTAVEDDSKDWPAAAHETKDMEMPHQGENLDFSFLIVNNKEGNKQLFV  280

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF--KC-KNMS-EDEMFMASLICNIDADC  1083
             D  VY++NR FR+  SSKAGK+ +L      +F  KC K++S E+  F++SLICNI    
Sbjct  281   DLGVYTKNRNFRMYKSSKAGKNVILKIAEDNKFIPKCEKDVSLEEAYFLSSLICNIG---  337

Query  1084  ERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAF---ELNNFESDPSRTYLMGKSPFP  1254
                     +S+ ++ L      +  F +      AF   + N    DP   Y  G SP+P
Sbjct  338   --------ESNDIKVL------SSGFSEEERKISAFLNSKTNRSSRDPMEGYQEG-SPYP  382

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              +D FV  + +   + G IR W +FS   L++Y +S  R+CE IGR HKSN++M +VDL+
Sbjct  383   EIDNFVRSLVNKDGLQGGIRQWSYFSLKELLIYDISGYRWCENIGRAHKSNNIMILVDLK  442

Query  1435  RGDYYQKCHDPDCK--GYRSPLRPIPGNVIAHC-------SVSFDLDSNNEGR  1566
                +YQKCHDP C+   ++S   P+P  +           S+  D   N EG+
Sbjct  443   NEVWYQKCHDPVCREQNFKSQSFPLPPGICLQTLFKEEEESMLMDDRRNTEGK  495



>ref|XP_004757780.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X2 [Mustela putorius furo]
 ref|XP_004794169.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X2 [Mustela putorius furo]
Length=556

 Score =   216 bits (550),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 156/451 (35%), Positives = 219/451 (49%), Gaps = 93/451 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + NG R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFHRQNQAFNFVKSCKEDVHVFALEYKVGNGQRIYLVTTYAQLWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPEADGKKMVALLIEHVCKALQELYRVNCSPEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEV---------------------------  819
             SST++KFSRHLI +L  +AFKDN HVG F  ++                           
Sbjct  160   SSTDEKFSRHLIFQLRDVAFKDNIHVGNFVRKILQPAFHLIGREDDASTSETTGHEFSRF  219

Query  820   ----------CSRIYSSSETDERFRKLFVSKDSKSVGIP------------------AQL  915
                       CS++  SS+TD      + SK+ +S G                      L
Sbjct  220   PETPIKQGISCSKM--SSDTDRGESWAWNSKERESPGSAKLRGPDLSFLVVKNNVGEKHL  277

Query  916   FVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-  1074
             FVD  VY+RNR FRL  SSK GK   L      RF   + KN+SE+ + F++SL+ N+  
Sbjct  278   FVDLGVYTRNRNFRLYKSSKIGKQVALEIAEDNRFFPEQSKNISEENQYFLSSLVSNVRF  337

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGK--SP  1248
             +D  R+L C    +  + + +                      F S  ++  + G   SP
Sbjct  338   SDTLRILTCDTSQNEQKRVEY----------------------FNSTSTKGNIEGFHCSP  375

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             +P +D FV  + +   + G IR W +F    L+VY + K R+C  IGR HKSN++M +VD
Sbjct  376   YPEIDQFVLSLVNKNGIKGGIRHWSYFFPEELLVYDICKYRWCRNIGRAHKSNNIMILVD  435

Query  1429  LRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             L+   +YQKCHDP CK   +RS   P+P  V
Sbjct  436   LKNEVWYQKCHDPVCKAENFRSDCFPLPAEV  466



>ref|XP_003271526.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
1 [Nomascus leucogenys]
Length=559

 Score =   216 bits (550),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 157/446 (35%), Positives = 221/446 (50%), Gaps = 83/446 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVC--------SRIYSSSETDER------  858
             SST++KFSRHLI +L  +AFKDN HVG F  ++         S   S+ ET         
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDSAPETTGHGFPHFS  219

Query  859   ---------FRKLFV-----------SKDSKSVGIPAQ------------------LFVD  924
                      F K+F            SK  + +G   Q                  LFVD
Sbjct  220   EAPARQGFSFDKMFTEEATEESWTLNSKKLQRLGSAEQSSPDLSFLLVKNNMGEKHLFVD  279

Query  925   NAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-ADC  1083
               VY+RNR FRL  SSK GK   L      RF   + K++S+  + F++SL+ N+  +D 
Sbjct  280   LGVYTRNRNFRLYKSSKIGKRVALEVTEDNRFFPIQSKDVSDAYQYFLSSLVSNVRFSDT  339

Query  1084  ERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVD  1263
              R+L C    +  + + +   I  S +    T + F+                SP+P VD
Sbjct  340   LRILTCDPSQNKQKGVGYFNSIGTSVE----TIEGFQC---------------SPYPEVD  380

Query  1264  AFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGD  1443
              FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+   
Sbjct  381   HFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEV  440

Query  1444  YYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +YQKCHDP CK   ++S   P+P  V
Sbjct  441   WYQKCHDPVCKAENFKSDCFPLPAEV  466



>ref|XP_010342696.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Saimiri boliviensis boliviensis]
Length=567

 Score =   216 bits (550),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 154/447 (34%), Positives = 221/447 (49%), Gaps = 85/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY + W  YKS      H 
Sbjct  52    IWKLFHRQTQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAELWFYYKSRK-NLLHC  110

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  + + ++ LD
Sbjct  111   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCAAEDVLNLD  170

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY----------------------  834
             SST++KFSRHLI +L  +AFKDN HVG F  ++    +                      
Sbjct  171   SSTDEKFSRHLIFQLRDVAFKDNIHVGNFLRKILQPAFNLLGSEDEDSTPETRGHGFPHF  230

Query  835   --SSSETDERFRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
               +S++    F K+F            SK  +S+G   Q                  LFV
Sbjct  231   SEASTKPGFSFNKMFAEKAVEESWTLNSKKLESLGSAEQSPSGLSFLVVKNNMGEKHLFV  290

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      RF     +N+SE+ + F++SL+ N+  +D
Sbjct  291   DLGVYTRNRNFRLYKSSKIGKCVALEVAEENRFFPIPSENVSEEYQYFLSSLVSNVRFSD  350

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    +  + + +   I+      S T + F+                SP+P V
Sbjct  351   TLRILTCDPSQNKQKGVGYFNSIS-----TSETIEGFQC---------------SPYPEV  390

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  391   DRFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRPHKSNNIMILVDLKNE  450

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  451   VWYQKCHDPVCKAENFKSDYFPLPAEV  477



>ref|XP_006026672.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X5 [Alligator sinensis]
Length=507

 Score =   215 bits (547),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 144/393 (37%), Positives = 200/393 (51%), Gaps = 73/393 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +W  FP+Q +A  Y + C     VF+ + +  +G R +LV+TY + W  YK       H 
Sbjct  41    VWKIFPRQAQAFDYVKTCKEEVHVFALEKNTEDGQRFYLVTTYIELWFYYKGQKSSLFHC  100

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEF K  N   +G  MV  LI      L ++Y ++ S + ++ LD
Sbjct  101   YEVICEKAVCKLYFDLEFYKPVNPGADGKMMVAQLIELFCKNLEERYGVKCSANDVLNLD  160

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVG  900
             SST++KFS HLI  L K AFKDN HVG                                 
Sbjct  161   SSTDEKFSHHLIFLLHKTAFKDNIHVG---------------------------------  187

Query  901   IPAQLFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRFKCK---NMS-EDEMFMASLI  1062
                       VY++NR FRL  SSK+G+  +L      +F  K   N+S E++ F++SL+
Sbjct  188   ----------VYTKNRNFRLYKSSKSGRRVILEIAEDNKFVPKLKENISIEEQYFLSSLV  237

Query  1063  CNI-DADCERLLVC-KMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLM  1236
             CNI  +D E++L C   D     ++H N+ I++        P         +DP   Y  
Sbjct  238   CNIRSSDIEKILTCDNPDGKRGTSMHLNSNISR-------CPSVL------TDPIEGY--  282

Query  1237  GKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
               SP+P VD FV  + +   V G IR W +FS   L+VY +S+ R+CE IGR HKSN++M
Sbjct  283   HYSPYPEVDRFVLSLVNKDGVQGGIRHWNYFSLEELLVYDISRYRWCENIGRAHKSNNIM  342

Query  1417  YVVDLRRGDYYQKCHDPDC-----KGYRSPLRP  1500
              ++DL+R  +YQKCHDP C     K  RSPL P
Sbjct  343   ILIDLKREVWYQKCHDPVCRAENFKSKRSPLPP  375



>ref|XP_004040738.1| PREDICTED: coiled-coil domain-containing protein 111 [Gorilla 
gorilla gorilla]
Length=573

 Score =   216 bits (550),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 156/447 (35%), Positives = 221/447 (49%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  54    IWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  112

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  113   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLD  172

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS--------------------RIYSS  840
             SST++KFSRHLI +L  +AFKDN HVG F  ++                      R    
Sbjct  173   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPETTGHRFPHF  232

Query  841   SETDER----FRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
             SE   R    F K+F            SK  + +G   Q                  LFV
Sbjct  233   SEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFV  292

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + K++S++ + F++SL+ N+  +D
Sbjct  293   DLGVYTRNRNFRLYKSSKIGKRVALEVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSD  352

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C+   +  + + +   I  S      T + F+                SP+P V
Sbjct  353   TLRILTCEPSQNKQKGVGYFNSIGTSVD----TIEGFQC---------------SPYPEV  393

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  394   DHFVLSLVNKDGINGGIRHWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  453

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  454   VWYQKCHDPVCKAENFKSDCFPLPAEV  480



>ref|XP_008990643.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Callithrix jacchus]
 ref|XP_008990644.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Callithrix jacchus]
 ref|XP_008990645.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Callithrix jacchus]
 ref|XP_008990646.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Callithrix jacchus]
Length=556

 Score =   216 bits (549),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 157/447 (35%), Positives = 224/447 (50%), Gaps = 85/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY + W  YKS      H 
Sbjct  41    IWKLFHRQTQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAELWFHYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDE-----------RF  861
             SST++KFSRHLI +L  +AFKDN HVG F  ++    +   SSE D+           RF
Sbjct  160   SSTDEKFSRHLIFQLRDVAFKDNIHVGNFLRKILQPAFDLLSSEDDDSAPETRGHGFPRF  219

Query  862   -----------RKLFVSK--------DSKSVGIPA---------------------QLFV  921
                         K+F  K        +SK +  P                       LFV
Sbjct  220   SEASTKPGFSLNKMFTEKAVEESWTLNSKKLERPGSAEQTSPDLSFLVVKNKLGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL---IPSGRF--KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L     +G F  + +++SE+ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKCVALEVAEENGFFPTQSEDVSEEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    +  + + +   I+      S T + F+                SP+P V
Sbjct  340   TLRILTCDPSQNKQKGVGYFNSIS-----TSETMEGFQC---------------SPYPEV  379

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  380   DRFVLSLVNKDGIEGGIRRWNYFFPEELLVYDICKYRWCENIGRPHKSNNIMILVDLKNE  439

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  440   VWYQKCHDPVCKAENFKSDCFPLPAEV  466



>sp|Q96LW4.2|PRIPO_HUMAN RecName: Full=DNA-directed primase/polymerase protein; Short=hPrimpol1; 
AltName: Full=Coiled-coil domain-containing protein 
111 [Homo sapiens]
Length=560

 Score =   216 bits (549),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 154/447 (34%), Positives = 222/447 (50%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDE-------------  855
             SST++KFS+HLI +L  +AFKDN HVG F  ++         SE D+             
Sbjct  160   SSTDEKFSQHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPETTGHGFPHF  219

Query  856   ---------RFRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
                       F K+F            SK  + +G   Q                  LFV
Sbjct  220   SEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + K++S++ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKRVALEVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C+   +  + + +   I  S +    T + F+                SP+P V
Sbjct  340   TLRILTCEPSQNKQKGVGYFNSIGTSVE----TIEGFQC---------------SPYPEV  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_008620707.1| hypothetical protein SDRG_16281 [Saprolegnia diclina VS20]
 gb|EQC25832.1| hypothetical protein SDRG_16281 [Saprolegnia diclina VS20]
Length=529

 Score =   215 bits (547),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 147/410 (36%), Positives = 200/410 (49%), Gaps = 46/410 (11%)
 Frame = +1

Query  322   EIRVDLSEQKKLS--QEIWATFPKQVEAMKYAEQC------INARVFSYQDHINGYRRFL  477
             E R++ S Q ++      +  F  Q  AM +   C        AR++SY+    G RRFL
Sbjct  135   EYRIEHSMQCQIDGIARPYMAFALQQPAMSFLAACRAKHPTTTARLYSYE--TPGSRRFL  192

Query  478   VSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNG-DEMVDLLIVA  654
             V+    F ++Y +  P  RH YE+IQE  PC LYFDLEF K  N      D +++ L   
Sbjct  193   VADAALFCEKYLATAPHHRHVYEIIQENHPCRLYFDLEFTKAYNPTVTAPDTLLESLFRL  252

Query  655   VFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHLII-----RLPKIAFKDNSHVGAFTAEV  819
             +     + Y +      I++L SS++ KFSRH ++         + F++N H G F    
Sbjct  253   LALAFYRDYGVRLDRSAIIDLASSSDAKFSRHWVVAPTDESCKHVLFENNIHAGHF----  308

Query  820   CSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLI  999
               R+  +  +DE      V KD        QLF+D  VY+RNR FRL LSSK G   VL 
Sbjct  309   IKRLLETYLSDESHPFYVVKKDGTK-----QLFIDTGVYTRNRAFRLWLSSKFGSDRVLT  363

Query  1000  PSGRFKCKNMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFT  1179
                  +   M +     AS IC   A   RLL C   +    T   +   A+S       
Sbjct  364   RGE--EAGEMPDAAFLEASYICPTVAVGARLLQCDPPTTSRHTGRGSFARAKS-------  414

Query  1180  PQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEY-GLIVYS  1356
                       + PS  Y  G SP+P +DAFV   A+ G V G+IRSW    +Y   I Y 
Sbjct  415   ----------AVPSE-YKYGPSPWPALDAFVRGQATTGGVQGEIRSWQMHPDYPQRITYH  463

Query  1357  MSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIP  1506
             M +NR+C RIGR HKSN+VM++VD   G Y+QKCHDPDC G+RS    +P
Sbjct  464   MDRNRFCARIGRPHKSNNVMFLVDRTGGVYHQKCHDPDCAGFRSTALALP  513



>ref|XP_004281783.1| PREDICTED: coiled-coil domain-containing protein 111 [Orcinus 
orca]
Length=555

 Score =   215 bits (548),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 157/451 (35%), Positives = 224/451 (50%), Gaps = 93/451 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q EA  + ++C  +  VF+ +  + +G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTEAFNFVKRCKEDVHVFALEYKVGDGQRIYLVTTYTQLWFYYKS----RRNL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLEFN+ AN   +G +MV LLI  V   L Q Y +  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNRLANPGADGKKMVALLIEHVCRALQQFYRVSCSAEDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDE----------  855
              LDSST +KFSRHLI +L  +AFKDN HVG F  ++    +   +SE D+          
Sbjct  157   NLDSSTNEKFSRHLIFQLHDVAFKDNIHVGNFVRKMLEPAFHLIASEDDDMTPETMGHEF  216

Query  856   --------------------------------RFRKLFVSKDS----------KSVGIPA  909
                                             +  +L  +K S           +VG   
Sbjct  217   SHFSETPVKQGISFSKKSTDKDMGESWTTNSKKLERLGSAKQSSPDLSFLIVKNNVG-EK  275

Query  910   QLFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNI  1071
              LFVD  VY+RNR FRL  SSK GK   L      +F   + +N+S E++ F+++L+ N+
Sbjct  276   HLFVDLGVYTRNRNFRLYKSSKIGKYVPLEVAEDNKFYPVQSENISKENQYFLSALVSNV  335

Query  1072  -DADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
               +D  R+L C M  +  R  +FN   + S +    T + F+                SP
Sbjct  336   RSSDTLRILTCDMSQNKQRVENFN-HTSTSVE----TTEGFQC---------------SP  375

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             +P +D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VD
Sbjct  376   YPEIDQFVLLLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVD  435

Query  1429  LRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             L+   +YQKCHDP CK   ++S   P+P  V
Sbjct  436   LKNEVWYQKCHDPICKAENFKSDCFPLPAEV  466



>ref|XP_532846.3| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X7 [Canis lupus familiaris]
 ref|XP_005630047.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X1 [Canis lupus familiaris]
Length=554

 Score =   215 bits (548),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 160/451 (35%), Positives = 223/451 (49%), Gaps = 93/451 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHIN-GYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C  +  VF+ +  ++ G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTQAFNFVKSCKEDVHVFALEYKVDDGQRIYLVTTYAQLWFYYKS----RRNL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLE+NK AN + +G +MV LLI  V   L + Y ++ S + + 
Sbjct  97    LHCYEVIPENAVCKLYFDLEYNKLANPEADGKKMVALLIEHVCKALQELYRVDCSAEDVF  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY---------SSSETDE---  855
              LDSST++KFSRHLI +L  +AFKDN HVG F  ++    +         S+SET     
Sbjct  157   NLDSSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIANEDDDSTSETPGLGF  216

Query  856   ------------RFRKLFVSKDS-----------KSVGIPAQ------------------  912
                          F K+   KD            + +G   Q                  
Sbjct  217   SHFPETPIKQGIAFSKMSSDKDRGENWTLDLREWERLGSAKQRSPDLSFLVVKNNTGEKH  276

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID  1074
             LFVD  VY+RNR FRL  SSK GK   L      +F   + KN+SE+ + F++SL+ N+ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKHVALEIAEDNKFFPKQSKNISEENQYFLSSLVSNVR  336

Query  1075  -ADCERLLVC-KMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
              +D  R+L C    S   R  HF+T           + +A  +  F            SP
Sbjct  337   FSDTLRILTCDTFQSKQKRVEHFST-----------STKAENIEGFHC----------SP  375

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             +P VD FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VD
Sbjct  376   YPEVDRFVLSLVNKNGIQGGIRRWSYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVD  435

Query  1429  LRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             L+   +YQKCHDP CK   ++S   P+P  V
Sbjct  436   LKNEVWYQKCHDPVCKAENFKSDCFPLPAEV  466



>ref|XP_005630049.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X3 [Canis lupus familiaris]
Length=553

 Score =   215 bits (548),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 158/451 (35%), Positives = 221/451 (49%), Gaps = 94/451 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHIN-GYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C  +  VF+ +  ++ G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTQAFNFVKSCKEDVHVFALEYKVDDGQRIYLVTTYAQLWFYYKS----RRNL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLE+NK AN + +G +MV LLI  V   L + Y ++ S + + 
Sbjct  97    LHCYEVIPENAVCKLYFDLEYNKLANPEADGKKMVALLIEHVCKALQELYRVDCSAEDVF  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY---------SSSETDE---  855
              LDSST++KFSRHLI +L  +AFKDN HVG F  ++    +         S+SET     
Sbjct  157   NLDSSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIANEDDDSTSETPGLGF  216

Query  856   ------------RFRKLFVSKDS-----------KSVGIPAQ------------------  912
                          F K+   KD            + +G   Q                  
Sbjct  217   SHFPETPIKQGIAFSKMSSDKDRGENWTLDLREWERLGSAKQRSPDLSFLVVKNNTGEKH  276

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID  1074
             LFVD  VY+RNR FRL  SSK GK   L      +F   + KN+SE+ + F++SL+ N+ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKHVALEIAEDNKFFPKQSKNISEENQYFLSSLVSNVR  336

Query  1075  -ADCERLLVC-KMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
              +D  R+L C    S   R  HF+T   ++ +                          SP
Sbjct  337   FSDTLRILTCDTFQSKQKRVEHFSTSTKENIEGFHC----------------------SP  374

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             +P VD FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VD
Sbjct  375   YPEVDRFVLSLVNKNGIQGGIRRWSYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVD  434

Query  1429  LRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             L+   +YQKCHDP CK   ++S   P+P  V
Sbjct  435   LKNEVWYQKCHDPVCKAENFKSDCFPLPAEV  465



>ref|XP_007998588.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Chlorocebus sabaeus]
Length=507

 Score =   214 bits (545),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 153/444 (34%), Positives = 221/444 (50%), Gaps = 82/444 (18%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKVLRELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY---------SSSET--------  849
             SST++KFSRHLI +L  +AFKDN HVG F  ++              S+SET        
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSASETTGHGFPHF  219

Query  850   -----------------------DERFRKLFVSKDS----------KSVGIPAQLFVDNA  930
                                     E+  +L  ++ S           +VG    LFVD  
Sbjct  220   LEAPARQEFSFTEKATGESWTLNSEKLERLGSAEQSSPDLSFVVVKNNVG-EKHLFVDLG  278

Query  931   VYSRNRCFRLALSSKAGKSSVLIPSGR-----FKCKNMSED-EMFMASLICNID-ADCER  1089
             VY+RNR FRL  SSK GK   L  +        + K++S++ + F++SL+ N+  +D  R
Sbjct  279   VYTRNRNFRLYKSSKIGKRVALEVTEDNTFFPIRSKDVSDEYQYFLSSLVSNVRFSDTLR  338

Query  1090  LLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAF  1269
             +L C    +  + + +   I  S +    T + F+                SP+P VD F
Sbjct  339   ILTCDPSQNKQKGVGYFNSIGTSVE----TIEGFQC---------------SPYPEVDHF  379

Query  1270  VEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYY  1449
             V  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+   +Y
Sbjct  380   VLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWY  439

Query  1450  QKCHDPDCKG--YRSPLRPIPGNV  1515
             QKCHDP CK   ++S   P+P  V
Sbjct  440   QKCHDPVCKAENFKSDCFPLPAEV  463



>ref|XP_006970953.1| PREDICTED: DNA-directed primase/polymerase protein [Peromyscus 
maniculatus bairdii]
Length=534

 Score =   214 bits (546),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 153/429 (36%), Positives = 215/429 (50%), Gaps = 72/429 (17%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +W  F +Q +A  + + C  N  VF+ +    +G R +LV++Y   W  YKS      H 
Sbjct  40    VWKLFYRQNQAFNFVKSCKENVHVFALECKAGDGQRVYLVTSYAQLWFYYKSRK-TLLHC  98

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + YS+  S   +  LD
Sbjct  99    YEVIPENAVCKLYFDLEFNKLANPEADGKKMVALLIEHVCKALEELYSVHCSAADVFNLD  158

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDERFRKLFVSKDSKS  894
             SSTE+KFSRHLI +L  +AFKDN HVG F  ++        + E +++  +    + S  
Sbjct  159   SSTEEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPALHLITKEDEDKIPEAMGHEASCF  218

Query  895   VGIPAQ---------------------------LFVDNAVYSRNRCFRLALSSKAGKSSV  993
               +P +                           LFVD  VY+RNR FRL  SSK GK   
Sbjct  219   SDVPLKQEISEAWERHSPDLSFLVVKNNMGEECLFVDLGVYTRNRNFRLYQSSKIGKCVA  278

Query  994   L--IPSGRF---KCKNMSED-EMFMASLICNID-ADCERLLVCKM-DSDCVRTLHFNT--  1143
             L      RF   + K++SE+ + F++SL+ N+  +D  R+L C    +   RT +FN+  
Sbjct  279   LEVAEDNRFIPEQSKDVSEENQYFLSSLVSNVRFSDTLRILTCDTPQTKRKRTEYFNSTG  338

Query  1144  ---EIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIR  1314
                E  + FQ                          SP+P VD FV  + +   + G IR
Sbjct  339   TSVECIEGFQC-------------------------SPYPEVDQFVLSLVNKHDIKGGIR  373

Query  1315  SWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKG--YRS  1488
              W +F    L+VY + K R+CE IGR HKSN++M +VDL+   +YQKCHDP CK   ++S
Sbjct  374   RWSYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAQNFKS  433

Query  1489  PLRPIPGNV  1515
                P+P  V
Sbjct  434   NCFPLPTEV  442



>ref|NP_001287697.1| DNA-directed primase/polymerase protein isoform 3 [Homo sapiens]
 gb|EAX04667.1| hypothetical protein FLJ33167, isoform CRA_a [Homo sapiens]
Length=559

 Score =   215 bits (548),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 155/447 (35%), Positives = 221/447 (49%), Gaps = 85/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDE-------------  855
             SST++KFSRHLI +L  +AFKDN HVG F  ++         SE D+             
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPETTGHGFPHF  219

Query  856   ---------RFRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
                       F K+F            SK  + +G   Q                  LFV
Sbjct  220   SEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + K++S++ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKRVALEVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C+   +  + + +   I       S T + F+                SP+P V
Sbjct  340   TLRILTCEPSQNKQKGVGYFNSIG-----TSETIEGFQC---------------SPYPEV  379

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  380   DHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  439

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  440   VWYQKCHDPVCKAENFKSDCFPLPAEV  466



>ref|XP_007466581.1| PREDICTED: DNA-directed primase/polymerase protein [Lipotes vexillifer]
Length=555

 Score =   215 bits (548),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 155/450 (34%), Positives = 223/450 (50%), Gaps = 91/450 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYAQLWFYYKS----RRNL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLEFN+ AN   +G +MV LLI  V   L Q Y +  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNRLANPGADGKKMVALLIEHVCKALQQFYRVSCSAEDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY-------------------  834
              LDSST +KFSRHLI +L ++AFKDN HVG F  ++    +                   
Sbjct  157   NLDSSTNEKFSRHLIFQLHEVAFKDNIHVGNFVRKMLEPAFHLIASEDDDMTPETMGHEF  216

Query  835   --------------SSSETDERFRKLFV--SKDSKSVGIPAQ------------------  912
                           S   TD+   +++   SK  + +G   Q                  
Sbjct  217   SHFSETPVKQGISFSKKSTDKDMGEIWTTNSKKLERLGSAKQSSPDLSFLIVKNNVGEKH  276

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNID  1074
             LFVD  VY+RNR FRL  SSK GK   L      +F   + KN+S E++ F+++L+ N+ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKYVPLEVAEDNKFYPVQSKNISKENQYFLSALVSNVR  336

Query  1075  -ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
              +D  R+L C +  +  R  +FN   + S +    T + F+                SP+
Sbjct  337   FSDTLRILTCDISQNKQRVEYFN-HTSTSVE----TIEGFQC---------------SPY  376

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P +D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL
Sbjct  377   PEIDQFVLLLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDL  436

Query  1432  RRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +   +YQKCHDP CK   ++S   P+P  V
Sbjct  437   KNEVWYQKCHDPICKAENFKSDCFPLPAEV  466



>ref|XP_006187620.1| PREDICTED: coiled-coil domain-containing protein 111 [Camelus 
ferus]
 ref|XP_010951599.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Camelus bactrianus]
 ref|XP_010951600.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Camelus bactrianus]
Length=557

 Score =   215 bits (547),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 153/450 (34%), Positives = 221/450 (49%), Gaps = 90/450 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHIN-GYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  +A+ C  +  VF+ +  ++ G R +LV+TY   W  YKS    RRH 
Sbjct  41    IWKLFHRQTQAFNFAKSCKEDVHVFALEWKVDDGQRIYLVTTYAQLWFYYKS----RRHL  96

Query  541   ---YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
                YEVI E   C LYFDLEFNK AN   +G++MV LLI  V   L + Y +  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNKLANPGADGEKMVALLIEHVCKALQELYRVSCSAEGVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRI--------------------  831
              LDSSTE+KFS HLI +L  +AFKDN HVG F  ++                        
Sbjct  157   NLDSSTEEKFSHHLIFQLHDVAFKDNIHVGNFVRKILQPAVHLLASEDDCTIPETTGHGF  216

Query  832   -------------YSSSETDERFRKLFVSKDSKSVGIPA--------------------Q  912
                          +S   TDE   + + S   +  G+ +                     
Sbjct  217   SHFSETSTKQEISFSKMSTDEDIGECWTSNSKQLEGLASAKQSSPDLSFLVVKNSIGGKH  276

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID  1074
             LFVD  VY+RNR FRL  SSK GK   L      +F   + KN+SE+ + F++SL+ ++ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKYVALEVAEDNKFYPVQSKNISEEYQYFLSSLVSHVR  336

Query  1075  -ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
              +D  R+L C +  +         +  + F   S + +A E   F+           SP+
Sbjct  337   FSDTLRILTCDISQN-------KQDRVEYFNSTSTSVEAVE--GFQC----------SPY  377

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P +D FV  + +   + G IR W +F    L+VY + K R+CE I R HKSN++M +VDL
Sbjct  378   PEIDQFVLSLVNRNGIKGGIRRWNYFFPEELLVYDICKYRWCENIRRAHKSNNIMILVDL  437

Query  1432  RRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             ++  +YQKCHDP CK   ++S   P+P  V
Sbjct  438   KKEVWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_010115563.1| PREDICTED: DNA-directed primase/polymerase protein [Chlamydotis 
macqueenii]
Length=582

 Score =   216 bits (549),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 158/456 (35%), Positives = 217/456 (48%), Gaps = 88/456 (19%)
 Frame = +1

Query  355   LSQEIWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRY-KSMNP  525
             L   +W  F +Q EA  Y + C  +  VF+ +    +G R +LV+TY++ W  Y K    
Sbjct  37    LPSSVWKIFCRQAEAFNYVKTCKEDVHVFALEKKTQSGQRFYLVTTYKELWFYYTKGYKT  96

Query  526   KRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDW  705
                H YEVI E   C LYFDLEF K AN D +G  MV  LI  V   L + Y +  S   
Sbjct  97    SLMHCYEVIPEKDACKLYFDLEFYKPANPDADGKSMVAKLIELVSQKLKELYDVNCSAKD  156

Query  706   IVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSET------------  849
             ++ LDSST++KFSRHLI  L K  FKDN+HVG F   +        ET            
Sbjct  157   VLNLDSSTDEKFSRHLIFLLQKTVFKDNTHVGNFVRTILQPAIRLLETKAAVLIPEEEGG  216

Query  850   -------------DERFRKLFVSKDSKSVGIPA---------------------------  909
                          +     L   KD+ S G PA                           
Sbjct  217   GHVFQCSAGAVGLNASLTNLAAVKDA-SKGCPAIAHKTKDMETSHQGENLEFSFLIVNNK  275

Query  910   ----QLFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF--KCK-NMS-EDEMFMASL  1059
                 QLFVD  VY++NR FR+  SSKAGK+ +L      +F   C+ N+S E+  F++SL
Sbjct  276   EGDKQLFVDLGVYTKNRNFRMYKSSKAGKTVILKVAEDNKFVPNCEENVSLEEAYFLSSL  335

Query  1060  ICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMG  1239
             ICNI                 R       ++  F +      AF LN+  +  SR  + G
Sbjct  336   ICNI-----------------RVRDDTQVLSSGFSEEERKMSAF-LNSKTTRSSRDSMEG  377

Query  1240  --KSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHV  1413
                SP+P +D FV  + +   V G+IR W +FS   ++VY +S  R+CE IGR HKSN++
Sbjct  378   YQHSPYPEIDYFVRSLVNKDGVQGEIRQWNYFSLEEILVYDISGYRWCENIGRAHKSNNI  437

Query  1414  MYVVDLRRGDYYQKCHDPDC--KGYRSPLRPIPGNV  1515
             M +VDL++  +YQKCHDP C  K ++S   P+P  +
Sbjct  438   MILVDLKKEVWYQKCHDPVCREKNFKSQSFPLPPQI  473



>ref|XP_005483900.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X4 [Zonotrichia albicollis]
Length=493

 Score =   213 bits (543),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 153/455 (34%), Positives = 229/455 (50%), Gaps = 89/455 (20%)
 Frame = +1

Query  355   LSQEIWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRY-KSMNP  525
             +   +W  F +Q EA  Y + C  +  VF+ + +  +G R +LV+TYE+ W  Y +    
Sbjct  45    MPSSVWKIFSRQAEAFNYVKACEEDVHVFALEKNTQSGQRFYLVTTYEELWYYYTQGCKT  104

Query  526   KRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDW  705
                H YEVI E   C LYFDLEF K AN D +G  MV  LI  V   L + Y +  S D 
Sbjct  105   SLMHCYEVIPEKEACKLYFDLEFYKPANPDADGKSMVMKLIELVSQKLKEFYDVNCSSDD  164

Query  706   IVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVC----------SRIYSSSETDE  855
             ++ LDSST++KFSRHLI    K  FKDN+H+G F   +           + + ++ E   
Sbjct  165   VLNLDSSTDEKFSRHLIFLPQKTVFKDNTHIGNFVRTILQPAIRLMQSRAAVIATEEAGN  224

Query  856   RFR-----------------------KLFVSKDSKSVGIP-------------------A  909
              F+                       +  ++ ++K V  P                    
Sbjct  225   VFQCSAGAGLDGSLTNLPAVKDDSKDRPAIAHETKDVERPHQGENWDFSFLIVNDKEGNK  284

Query  910   QLFVDNAVYSRNRCFRLALSSKAGKSSVL--------IPSGRFKCKNMS-EDEMFMASLI  1062
             QLFVD  VY++NR FR+  SSKAGK+ +L        IP+     K++S E+  F++SLI
Sbjct  285   QLFVDLGVYTKNRNFRMYKSSKAGKNVILKIAEDNKFIPNCE---KDVSLEEAYFLSSLI  341

Query  1063  CNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMG-  1239
             CN+ A           SD ++ L  ++  ++  ++MS    AF LN+  +  SR  + G 
Sbjct  342   CNVGA-----------SDDIKVL--SSGFSEEERKMS----AF-LNSKTTRSSRDPMEGY  383

Query  1240  -KSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
               SP+P +D FV  + +   + G IR W +FS   L++Y +S  R+CE IGR HKSN++M
Sbjct  384   QGSPYPEIDHFVRSLVNKDGLQGGIRQWSYFSLKELLIYDISGYRWCENIGRAHKSNNIM  443

Query  1417  YVVDLRRGDYYQKCHDPDCK--GYRSPLRPIPGNV  1515
              +VDL+   +YQKCHDP C+   ++S   P+P  +
Sbjct  444   ILVDLKNEVWYQKCHDPVCREQNFKSQSFPLPPGI  478



>ref|XP_010972867.1| PREDICTED: DNA-directed primase/polymerase protein [Camelus dromedarius]
Length=557

 Score =   215 bits (547),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 153/450 (34%), Positives = 221/450 (49%), Gaps = 90/450 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHIN-GYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  +A+ C  +  VF+ +  ++ G R +LV+TY   W  YKS    RRH 
Sbjct  41    IWKLFHRQTQAFNFAKSCKEDVHVFALEWKVDDGQRIYLVTTYAQLWFYYKS----RRHL  96

Query  541   ---YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
                YEVI E   C LYFDLEFNK AN   +G++MV LLI  V   L + Y +  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNKLANPGADGEKMVALLIEHVCKALQELYRVSCSAEGVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRI--------------------  831
              LDSSTE+KFS HLI +L  +AFKDN HVG F  ++                        
Sbjct  157   NLDSSTEEKFSHHLIFQLHDVAFKDNIHVGNFVRKILQPAVHLLASEDDCTIPETTGHGF  216

Query  832   -------------YSSSETDERFRKLFVSKDSKSVGIPA--------------------Q  912
                          +S   TDE   + + S   +  G+ +                     
Sbjct  217   SHFSETSTKQEISFSKMSTDEDIGECWTSNSKQLEGLASAKQSSPDLSFLVVKNSIGGKH  276

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID  1074
             LFVD  VY+RNR FRL  SSK GK   L      +F   + KN+SE+ + F++SL+ ++ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKYVALEVAEDNKFYPVQSKNISEEYQYFLSSLVSHVR  336

Query  1075  -ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
              +D  R+L C +  +         +  + F   S + +A E   F+           SP+
Sbjct  337   FSDTLRILTCDISQN-------KQDRVEYFNSTSTSVEAVE--GFQC----------SPY  377

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P +D FV  + +   + G IR W +F    L+VY + K R+CE I R HKSN++M +VDL
Sbjct  378   PEIDQFVLSLVNRNGIKGGIRRWNYFFPEELLVYDICKYRWCENIRRAHKSNNIMILVDL  437

Query  1432  RRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             ++  +YQKCHDP CK   ++S   P+P  V
Sbjct  438   KKEVWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_007998585.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Chlorocebus sabaeus]
 ref|XP_007998586.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Chlorocebus sabaeus]
Length=556

 Score =   215 bits (547),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 153/444 (34%), Positives = 221/444 (50%), Gaps = 82/444 (18%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKVLRELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY---------SSSET--------  849
             SST++KFSRHLI +L  +AFKDN HVG F  ++              S+SET        
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSASETTGHGFPHF  219

Query  850   -----------------------DERFRKLFVSKDS----------KSVGIPAQLFVDNA  930
                                     E+  +L  ++ S           +VG    LFVD  
Sbjct  220   LEAPARQEFSFTEKATGESWTLNSEKLERLGSAEQSSPDLSFVVVKNNVG-EKHLFVDLG  278

Query  931   VYSRNRCFRLALSSKAGKSSVLIPSGR-----FKCKNMSED-EMFMASLICNID-ADCER  1089
             VY+RNR FRL  SSK GK   L  +        + K++S++ + F++SL+ N+  +D  R
Sbjct  279   VYTRNRNFRLYKSSKIGKRVALEVTEDNTFFPIRSKDVSDEYQYFLSSLVSNVRFSDTLR  338

Query  1090  LLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAF  1269
             +L C    +  + + +   I  S +    T + F+                SP+P VD F
Sbjct  339   ILTCDPSQNKQKGVGYFNSIGTSVE----TIEGFQC---------------SPYPEVDHF  379

Query  1270  VEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYY  1449
             V  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+   +Y
Sbjct  380   VLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWY  439

Query  1450  QKCHDPDCKG--YRSPLRPIPGNV  1515
             QKCHDP CK   ++S   P+P  V
Sbjct  440   QKCHDPVCKAENFKSDCFPLPAEV  463



>ref|XP_006744795.1| PREDICTED: coiled-coil domain-containing protein 111 [Leptonychotes 
weddellii]
Length=557

 Score =   215 bits (547),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 152/449 (34%), Positives = 220/449 (49%), Gaps = 88/449 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFLRQTQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYAQLWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPEADGKKMVALLIEHVCKALQELYRVNCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEV---------------------------  819
             SST++KFSRHLI +L  +AFKDN HVG F  ++                           
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASEDDDSISESTGHGFSHF  219

Query  820   ----------CSRIYSSSETDERFRKLFVSKDSKSVGIPAQ------------------L  915
                       CS++  SS+ D    +   SK+ + +G   Q                  L
Sbjct  220   PETPIKQGISCSKM--SSDKDRGESRTQNSKEWERLGSAEQSSPDLSFLVVKNNVGEKHL  277

Query  916   FVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-  1074
             FVD  VY+RNR FRL  SSK GK   L      +F   + KN+SE+ + F++SL+ N+  
Sbjct  278   FVDLGVYTRNRNFRLYKSSKIGKQVALEIAEDNKFFPKRSKNISEENQYFLSSLVSNVRF  337

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
             +D  R+L C    +  + + ++          S   +A  +  F            SP+P
Sbjct  338   SDTLRILTCDTSQNKQKRVEYSN---------STNTKAENIEGFHC----------SPYP  378

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              +D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M ++DL+
Sbjct  379   EIDQFVLSLVNKNGIKGGIRHWSYFFPEELLVYDICKYRWCENIGRAHKSNNIMILIDLK  438

Query  1435  RGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
                +YQKCHDP CK   ++S   P+P  V
Sbjct  439   NEVWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_007177925.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Balaenoptera acutorostrata scammoni]
 ref|XP_007177926.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Balaenoptera acutorostrata scammoni]
 ref|XP_007177927.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Balaenoptera acutorostrata scammoni]
 ref|XP_007177928.1| PREDICTED: DNA-directed primase/polymerase protein isoform X4 
[Balaenoptera acutorostrata scammoni]
Length=556

 Score =   215 bits (547),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 153/451 (34%), Positives = 223/451 (49%), Gaps = 92/451 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAQLWFYYKS----RRTL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLEFN+ AN   +G +MV LLI  V   L Q Y +  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNRLANPGADGKKMVALLIEHVCKALQQFYRVSCSAEDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETD-----------  852
              LDSST +KFSRHLI +L  +AFKDN+HVG F  ++    +   +SE D           
Sbjct  157   NLDSSTSEKFSRHLIFQLHDVAFKDNTHVGNFVRKILEPAFHLIASEDDDMTPETTGHEF  216

Query  853   -------------------------------ERFRKLFVSKDS----------KSVGIPA  909
                                            E+  +L  +K S           ++G   
Sbjct  217   SHFSETPIKQGISFSKKSTDEDIGESWTTNSEKLERLGSAKQSSPDLSFLIVKNNIG-EK  275

Query  910   QLFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNI  1071
              LFVD  VY+RNR FRL  SSK GK   L      +F   + KN+S E++ F+++L+ N+
Sbjct  276   HLFVDLGVYTRNRNFRLYKSSKIGKYVPLEVAEDNKFYPIQSKNISIENQYFLSALVSNV  335

Query  1072  D-ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
               +D  R+L C +  +  + + +    + S +    T + F+                SP
Sbjct  336   RFSDTLRILTCDISQNKQKRVEYFNHTSTSVE----TIEGFQC---------------SP  376

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             +P +D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VD
Sbjct  377   YPEIDQFVLLLVNKNGIKGGIRRWNYFFLEELLVYDICKYRWCENIGRAHKSNNIMILVD  436

Query  1429  LRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             L+   +YQKCHDP CK   ++S   P+P  V
Sbjct  437   LKNEVWYQKCHDPICKAENFKSDCFPLPAEV  467



>emb|CCA21367.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=611

 Score =   216 bits (549),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 144/411 (35%), Positives = 210/411 (51%), Gaps = 47/411 (11%)
 Frame = +1

Query  328   RVDLSEQKKLSQEIWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKR  507
             RV +  +K+L + I  +  KQ+E +         +VFS++DH  G R+F+V+T   FW++
Sbjct  232   RVRIRRRKQLMEAI--SLDKQIELI--------PKVFSFEDHETGRRQFIVTTLPTFWQQ  281

Query  508   YKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSL  687
             Y S+   RRH YE+I E  PC LYFDLEF+K  N D NGD M   L+  +   L  ++  
Sbjct  282   YCSIASDRRHVYEIIPEDAPCRLYFDLEFSKILNHDVNGDRMTQRLLSLLRLYLYCEFFA  341

Query  688   EGSHDWIVELDSSTEDKFSRHLIIRLPK-IAFKDNSHVGAFTAEVCSRIYSSSETDERFR  864
                +  I+ELDSST++KFSRHL+IR+P    F+ N HVG        R   +       R
Sbjct  342   TVENTDIIELDSSTDEKFSRHLVIRMPHDQLFRSNLHVGYLVRHFVQRY--NLHKSFSLR  399

Query  865   KLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEM  1044
             K+   +D+         F+D  VY+RNR FR+  SSK GK ++L      K       + 
Sbjct  400   KMSQGQDA------CHSFIDLGVYTRNRMFRIVGSSKFGKVAILRFQSHSKSVESITQQE  453

Query  1045  FMASLICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSR  1224
             F  +L+C +  +  +  +      C R  HF              PQ F   N     S+
Sbjct  454   FCETLVCPVQREHTQSFL-----RCDRQRHFGA-----------PPQTFLNGNDIKRSSK  497

Query  1225  TYLM-GKSPFPPVDAFVEYIASVGSVPGKIR--SWYWFSEY-------GLIVYSMSKNRY  1374
             +  M   S FP +DAF+  I+  G V G+IR     + SE          ++Y M+ NR+
Sbjct  498   SMDMYNSSMFPRLDAFIRSISQQGGVQGEIRMVQCIYDSESKDGSNSPDKMIYHMAHNRF  557

Query  1375  CERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNVIA  1521
             C RI   HKSNH+M++VD  +  YYQKCHDP+C    Y  P +P+P N+++
Sbjct  558   CHRIQHSHKSNHIMWIVDTSQQQYYQKCHDPECHASSYAYPRQPLPSNLLS  608



>emb|CAI46079.1| hypothetical protein [Homo sapiens]
Length=559

 Score =   214 bits (546),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 156/447 (35%), Positives = 220/447 (49%), Gaps = 85/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDE-------------  855
             SST++KFSRHLI +L  +AFKDN HVG F  ++         SE D+             
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPETTGHGFPHF  219

Query  856   ---------RFRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
                       F K+F            SK  + +G   Q                  LFV
Sbjct  220   SEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + K++S E + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKRVALEVTEDNKFFPIQSKDVSGEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C+   +  + + +   I       S T + F+                SP+P V
Sbjct  340   TLRILTCEPSQNKQKGVGYFNSIG-----TSETIEGFQC---------------SPYPEV  379

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  380   DHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  439

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  440   VWYQKCHDPVCKAENFKSDCFPLPAEV  466



>ref|XP_004893080.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X3 [Heterocephalus glaber]
Length=515

 Score =   214 bits (544),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 158/447 (35%), Positives = 217/447 (49%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +W  F +Q +A  + + C  N  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    VWKLFHRQNQAFNFVKSCKENVHVFALECKVGDGQRIYLVTTYAQLWFYYKS-RKHLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + YS+  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKHANPEADGKKMVVLLIEHVCKALQELYSVSCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST++KFSRHLI +L  +AFKDN HVG F  ++        SSE D R            
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPALHLISSEYDNRIPNPVGHEFSHF  219

Query  859   ----------FRKLFVSKD-----SKSVGIPAQL------------------------FV  921
                       F +    KD     + +  IP +L                        FV
Sbjct  220   PETPLKQEISFNQTSPDKDIAKSWTLNSEIPERLESAEQSSPDLSFLVVKSNTGEEHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + KN+SE+ + F++SL+ NI  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKCVALEVAEDNKFFPKQSKNISEENQYFLSSLVSNIRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    D  +     TE   S      T + F+                SP+P +
Sbjct  340   SLRILTC----DTSQNKRKRTEHVNSTSSSVETIEGFQC---------------SPYPEI  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +     G IR W +F    L+VY + + R+C+ IGR HKSN++M VVDL+  
Sbjct  381   DRFVLSLVTKNDTKGGIRRWNYFFPEELLVYDICRYRWCQNIGRAHKSNNIMIVVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_010834061.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Bison bison bison]
 ref|XP_010834063.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Bison bison bison]
Length=555

 Score =   214 bits (546),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 159/451 (35%), Positives = 222/451 (49%), Gaps = 93/451 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C     VF+ +  + +G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTQAFNFVKSCKQEVHVFALECKVGDGQRIYLVTTYTQLWFYYKS----RRNL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y++  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQEFYTVNCSAEDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAF-------------------TAEVCSRIY  834
              LDSSTE+KFSRHLI +L  +AFKDN HVG F                   T E  +R +
Sbjct  157   NLDSSTEEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASEDEDMTPETTAREF  216

Query  835   -----SSSETDERFRKLFVSKD--------SKSVGIPA---------------------Q  912
                  + SE    F K+    D        S+ +G                        +
Sbjct  217   THFSETPSEQGTCFGKMSTDIDVGESWTSNSEKLGRLGSAQQSSPDLSFLIVKNDMGEKR  276

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNID  1074
             LFVD  VY+RNR FRL  SSK GK   L      +F   + KN+S E++ F++SL+ N+ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKYVALEVAEDNKFFPIQSKNISKENQYFLSSLVSNVR  336

Query  1075  -ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFE-LNNFESDPSRTYLMGKSP  1248
              +D  R+L C +            +  Q  Q  S T  + E +  F+           SP
Sbjct  337   FSDALRILTCDV-----------PQTKQRVQCFSHTGTSVETIEGFQC----------SP  375

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             +P +D FV  + +   + G IR W +F    L+VY + K R+CE IGR H+SN++M +VD
Sbjct  376   YPEIDQFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHRSNNIMILVD  435

Query  1429  LRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             L+   +YQKCHDP CK   ++S   P+P  V
Sbjct  436   LKNEVWYQKCHDPVCKAENFKSDCFPLPAEV  466



>ref|XP_003899457.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Papio anubis]
 ref|XP_009206215.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Papio anubis]
 ref|XP_009206216.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Papio anubis]
Length=556

 Score =   214 bits (546),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 154/444 (35%), Positives = 220/444 (50%), Gaps = 82/444 (18%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIKYVCKALRELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY---------SSSET--------  849
             SST++KFSRHLI +L  +AFKDN HVG F  ++              S+SET        
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSASETTGHGFHHF  219

Query  850   -----------------------DERFRKLFVSKDS----------KSVGIPAQLFVDNA  930
                                     E   +L  ++ S           +VG    LFVD  
Sbjct  220   LEAPARQEFSFTEKATGESWTLNSEELERLGSAEQSSPDLSFLVVKNNVG-EKHLFVDLG  278

Query  931   VYSRNRCFRLALSSKAGKSSVL-IPSGR----FKCKNMSED-EMFMASLICNID-ADCER  1089
             VY+RNR FRL  SSK GKS  L +P        + K +S++ + F++SL+ N+  +D  R
Sbjct  279   VYTRNRNFRLYKSSKIGKSVALEVPEDNAFFPVRPKGVSDEYQCFLSSLVSNVRFSDTLR  338

Query  1090  LLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAF  1269
             +L C    +  + + +   I  S + +      F+                SP+P VD F
Sbjct  339   ILTCDPSQNKQKGVGYFNSIGTSVETIG----GFQC---------------SPYPEVDHF  379

Query  1270  VEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYY  1449
             V  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+   +Y
Sbjct  380   VLSLVNKDGIRGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWY  439

Query  1450  QKCHDPDCKG--YRSPLRPIPGNV  1515
             QKCHDP CK   ++S   P+P  V
Sbjct  440   QKCHDPVCKAENFKSDCFPLPAEV  463



>ref|XP_006198039.1| PREDICTED: coiled-coil domain-containing protein 111 [Vicugna 
pacos]
Length=557

 Score =   214 bits (546),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 155/455 (34%), Positives = 220/455 (48%), Gaps = 100/455 (22%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHIN-GYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  +A+ C  +  VF+ +  ++ G R +LV+TY   W  YKS    RRH 
Sbjct  41    IWKLFHRQTQAFNFAKSCKEDVHVFALEWKVDDGQRIYLVTTYAQLWFYYKS----RRHL  96

Query  541   ---YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
                YEVI E   C LYFDLEFNK AN   +G++MV LLI  V   L + Y +  S   ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNKLANPGADGEKMVALLIEHVCKALEELYRVSCSAKDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRI--------------------  831
              LDSSTE+KFS HLI +L  +AFKDN HVG F  ++                        
Sbjct  157   NLDSSTEEKFSHHLIFQLHDVAFKDNIHVGNFVRKILQPAVQLLASEDDCTIPETTGHGF  216

Query  832   -------------YSSSETDERFRKLFVSKDSKSVGIPA--------------------Q  912
                          +S   TDE   + + S   +  G+ +                     
Sbjct  217   SHFSETSTKQGISFSKMSTDEDIGECWTSNSKQLEGLASAKQSSPDLSFLVVKNSVGGRH  276

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL----------IPSGRFKCKNMSED-EMFMASL  1059
             LFVD  VY+RNR FRL  SSK GK   L          +PS     KN+SE+ + F++SL
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKYVALEVAEDNKFYPVPS-----KNISEEYQYFLSSL  331

Query  1060  ICNID-ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLM  1236
             + N+  +D  R+L C +  +    + +       F   S + +A E   F+         
Sbjct  332   VSNVRFSDALRILTCDISQNKQNRVEY-------FNSTSTSVEAVE--GFQC--------  374

Query  1237  GKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
               SP+P +D FV  + +   + G IR W +F    L+VY + K R+CE I R HKSN++M
Sbjct  375   --SPYPEIDQFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCENIRRAHKSNNIM  432

Query  1417  YVVDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +VDL++  +YQKCHDP CK   ++S   P+P  V
Sbjct  433   ILVDLKKEVWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_008315112.1| PREDICTED: DNA-directed primase/polymerase protein [Cynoglossus 
semilaevis]
Length=556

 Score =   214 bits (546),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 144/434 (33%), Positives = 207/434 (48%), Gaps = 64/434 (15%)
 Frame = +1

Query  370   WATFPKQVEAMKYAEQCINA-RVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             W  FP+Q  A  +A  C  A  VF+ +      G R +LV++Y + W  Y++      H 
Sbjct  72    WKLFPRQSLAFSFARSCKEAVHVFALEKESASPGQRIYLVTSYSELWHYYRTHPQSLMHC  131

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI EG  C LYFDLEF+K +N   +G  MV  LI    D L++ Y +  S   ++ LD
Sbjct  132   YEVIPEGAVCKLYFDLEFHKPSNKGADGKAMVASLIQYFCDKLMEVYGIRCSAQNVLNLD  191

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSET----DERFRKLFVSKDS  888
             SSTE+KFSRHLI  +    FKDN+HVG F   V   + S  +     D    +      +
Sbjct  192   SSTEEKFSRHLIFNVQNAIFKDNTHVGRFIHSVLRPVLSKGKNGSCLDNDVAQNCEKGST  251

Query  889   KSV-----GIPAQ----------------------LFVDNAVYSRNRCFRLALSSKAGKS  987
             + V     G+P+                       LFVD  VY++NR FRL  SSK GK+
Sbjct  252   RGVREEMDGVPSTKKRRQETTDLSFLQVKNQGQDCLFVDLGVYTKNRNFRLYGSSKLGKN  311

Query  988   SV--------LIPSGRFKCKNMSEDE-MFMASLICNIDADCERLLVCKMDSDCVRTLHFN  1140
             +          IP      K  S DE +F+ASL+CN+    +R+L               
Sbjct  312   AAFTVADDNQFIPKPE---KGTSPDESIFLASLVCNVSFTGQRILT--------------  354

Query  1141  TEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSW  1320
              +I ++ +  +  P    L   ++ P        SP   VD FV  +       G IR W
Sbjct  355   YDIPETKESTTCRP----LPGSDTKPGSLTGCQTSPHQEVDNFVLTLVRKEGKQGAIRRW  410

Query  1321  YWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRP  1500
              +F    L+VY ++  R+CE + R HKSN+++ VVDL+   +YQKCHDPDC+ +RS   P
Sbjct  411   NYFVAEQLLVYDIANYRWCENVQRFHKSNNILIVVDLKEEVWYQKCHDPDCRNFRSSGYP  470

Query  1501  IPGNVIAHCSVSFD  1542
             +P  +     ++ D
Sbjct  471   LPQEICVSYIMALD  484



>ref|XP_004893078.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X1 [Heterocephalus glaber]
 gb|EHB08377.1| Coiled-coil domain-containing protein 111 [Heterocephalus glaber]
Length=546

 Score =   214 bits (545),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 158/447 (35%), Positives = 218/447 (49%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +W  F +Q +A  + + C  N  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    VWKLFHRQNQAFNFVKSCKENVHVFALECKVGDGQRIYLVTTYAQLWFYYKSRK-HLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + YS+  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKHANPEADGKKMVVLLIEHVCKALQELYSVSCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST++KFSRHLI +L  +AFKDN HVG F  ++        SSE D R            
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPALHLISSEYDNRIPNPVGHEFSHF  219

Query  859   ----------FRKLFVSKD-SKSVGIPAQ----------------------------LFV  921
                       F +    KD +KS  + ++                            LFV
Sbjct  220   PETPLKQEISFNQTSPDKDIAKSWTLNSEIPERLESAEQSSPDLSFLVVKSNTGEEHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + KN+SE+ + F++SL+ NI  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKCVALEVAEDNKFFPKQSKNISEENQYFLSSLVSNIRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    D  +     TE   S      T + F+                SP+P +
Sbjct  340   SLRILTC----DTSQNKRKRTEHVNSTSSSVETIEGFQC---------------SPYPEI  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +     G IR W +F    L+VY + + R+C+ IGR HKSN++M VVDL+  
Sbjct  381   DRFVLSLVTKNDTKGGIRRWNYFFPEELLVYDICRYRWCQNIGRAHKSNNIMIVVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_010376227.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Rhinopithecus roxellana]
Length=560

 Score =   214 bits (545),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 155/447 (35%), Positives = 217/447 (49%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFRRQAQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G  MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKNMVALLIKYVCKALRELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY---------SSSETDER-----  858
             SST++KFSRHLI +L  +AFKDN HVG F  ++              S+SET        
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSTSETTGHGFPHF  219

Query  859   ----------FRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
                       F K+F            SK  + +G   Q                  LFV
Sbjct  220   LEAPARQGFSFNKMFTEKATGESWTLNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVLIPSGR-----FKCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L  +        + K++S++ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKRVALEVTEDNTFFPMRSKDVSDEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    +  + + +   I  S +                    T     SP+P V
Sbjct  340   TLRILTCDPSQNKQKGVGYFNSIGTSVEA-------------------TEGCQCSPYPEV  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DHFVLSLVNKDGIKGGIRRWNYFFPEELMVYDICKYRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   +RS   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFRSDCFPLPAEV  467



>ref|XP_004893079.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X2 [Heterocephalus glaber]
 ref|XP_004853063.1| PREDICTED: coiled-coil domain-containing protein 111 [Heterocephalus 
glaber]
Length=547

 Score =   214 bits (545),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 158/447 (35%), Positives = 218/447 (49%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +W  F +Q +A  + + C  N  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    VWKLFHRQNQAFNFVKSCKENVHVFALECKVGDGQRIYLVTTYAQLWFYYKSRK-HLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + YS+  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKHANPEADGKKMVVLLIEHVCKALQELYSVSCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST++KFSRHLI +L  +AFKDN HVG F  ++        SSE D R            
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPALHLISSEYDNRIPNPVGHEFSHF  219

Query  859   ----------FRKLFVSKD-SKSVGIPAQ----------------------------LFV  921
                       F +    KD +KS  + ++                            LFV
Sbjct  220   PETPLKQEISFNQTSPDKDIAKSWTLNSEIPERLESAEQSSPDLSFLVVKSNTGEEHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + KN+SE+ + F++SL+ NI  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKCVALEVAEDNKFFPKQSKNISEENQYFLSSLVSNIRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    D  +     TE   S      T + F+                SP+P +
Sbjct  340   SLRILTC----DTSQNKRKRTEHVNSTSSSVETIEGFQC---------------SPYPEI  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +     G IR W +F    L+VY + + R+C+ IGR HKSN++M VVDL+  
Sbjct  381   DRFVLSLVTKNDTKGGIRRWNYFFPEELLVYDICRYRWCQNIGRAHKSNNIMIVVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSDCFPLPAEV  467



>emb|CCI50664.1| unnamed protein product [Albugo candida]
Length=357

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 131/367 (36%), Positives = 186/367 (51%), Gaps = 48/367 (13%)
 Frame = +1

Query  430   RVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKAN  609
             +VFS++DH  G R+FLV+T   FW++Y+ +   RRH YE+I + +PC LYFDLEF+K  N
Sbjct  15    KVFSFEDHDTGRRQFLVTTLSKFWQQYRPVGSDRRHVYEIIPKDVPCRLYFDLEFSKTLN  74

Query  610   ADKNGDEMVDLLIVAVFDTLLQKY-------SLEGSHDWIVELDSSTEDKFSRHLIIRLP  768
                NGD++V  L+     +LL+ Y       ++E +H  I++LDSSTE+KFSRHL+IR+P
Sbjct  75    PGVNGDQLVQRLL-----SLLRMYLYCDFFAAVENTH--IIQLDSSTEEKFSRHLVIRMP  127

Query  769   K-IAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRN  945
                 F++N HVG        R           +K F  +            VD  VY+RN
Sbjct  128   HDQLFQNNLHVGNLVRHFVQRY--------NLQKTFSLRKKSQGQYTDHSLVDLGVYTRN  179

Query  946   RCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLVCKMDSDCVR  1125
             R FR+  SSK GKS++L      K         F ++L+C +  D     +      C R
Sbjct  180   RMFRILGSSKFGKSAILRFHSHSKSVESITQHEFCSTLVCPVQRDHFHPFL-----RCDR  234

Query  1126  TLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPG  1305
               HF +            P      +       T L  +S FP +DAF+  I+  G V G
Sbjct  235   RRHFGS-----------LPTYLSGRDLTRSNQTTDLYSESMFPHLDAFIRSISQQGGVQG  283

Query  1306  KIRSWYWFSEY---------GLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKC  1458
             +IR      +            ++Y M+ NRYC RI R HKSN+VM++VD  +  YYQKC
Sbjct  284   EIRMVQCIYDSTSQNPSNWPNKLIYHMTHNRYCHRIQRSHKSNNVMWIVDTFQQYYYQKC  343

Query  1459  HDPDCKG  1479
             HDP+C  
Sbjct  344   HDPECHA  350



>ref|XP_003495520.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Cricetulus griseus]
 ref|XP_007639553.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Cricetulus griseus]
 ref|XP_007639557.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Cricetulus griseus]
 ref|XP_007639563.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Cricetulus griseus]
 ref|XP_007639567.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Cricetulus griseus]
 ref|XP_007639574.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Cricetulus griseus]
 gb|ERE86722.1| coiled-coil domain-containing protein [Cricetulus griseus]
Length=540

 Score =   214 bits (544),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 154/429 (36%), Positives = 216/429 (50%), Gaps = 66/429 (15%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  N  VF+ +    +G R +LV++Y   W  YK       H 
Sbjct  40    IWKLFHRQNQAFNFVKSCKENVHVFALECKAGDGQRIYLVTSYAQLWFYYK-FRKTLLHC  98

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y++  S + ++ LD
Sbjct  99    YEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALEELYNVHCSVEDVINLD  158

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDERFRKLFVSKDS--  888
             SSTE+KFSRHLI +L  +AFKDN+HVG F  ++        + E D++  +    K S  
Sbjct  159   SSTEEKFSRHLIFQLHDVAFKDNTHVGNFVRKILQPALHLITKEDDDKIPEATDHKVSCF  218

Query  889   -------------KSVGIPAQ------------------LFVDNAVYSRNRCFRLALSSK  975
                          +  G P Q                  LFVD  VY+RNR FRL  SSK
Sbjct  219   SDVPLKQEILETWEKPGSPKQYIPDLSFLVVKNNMGEKCLFVDLGVYTRNRNFRLYRSSK  278

Query  976   AGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-ADCERLLVCKMDSDCVRTLH  1134
              GK   L      RF   + K++SE+ + F++SL+ N+  +D  R+L C        T  
Sbjct  279   IGKCVALEVAEDNRFIPKQSKDISEENQYFLSSLVSNVRFSDTLRILTCD-------TSQ  331

Query  1135  FNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIR  1314
                + A+ F     + ++ E   F            SP+P VD FV  + +   + G IR
Sbjct  332   TKRKRAEYFNSTGTSVESLE--GFHC----------SPYPEVDQFVLSLVNKHDIKGGIR  379

Query  1315  SWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKG--YRS  1488
              W +F    L+VY + K R+CE IGR HKSN++M +VDL+   +YQKCHDP CK   ++S
Sbjct  380   RWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAQNFKS  439

Query  1489  PLRPIPGNV  1515
                P+P  V
Sbjct  440   NCFPLPTEV  448



>ref|XP_005483897.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X1 [Zonotrichia albicollis]
Length=587

 Score =   214 bits (546),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 152/451 (34%), Positives = 223/451 (49%), Gaps = 89/451 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRY-KSMNPKRRH  537
             +W  F +Q EA  Y + C  +  VF+ + +  +G R +LV+TYE+ W  Y +       H
Sbjct  49    VWKIFSRQAEAFNYVKACEEDVHVFALEKNTQSGQRFYLVTTYEELWYYYTQGCKTSLMH  108

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI E   C LYFDLEF K AN D +G  MV  LI  V   L + Y +  S D ++ L
Sbjct  109   CYEVIPEKEACKLYFDLEFYKPANPDADGKSMVMKLIELVSQKLKEFYDVNCSSDDVLNL  168

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVC----------SRIYSSSETDERFR-  864
             DSST++KFSRHLI    K  FKDN+H+G F   +           + + ++ E    F+ 
Sbjct  169   DSSTDEKFSRHLIFLPQKTVFKDNTHIGNFVRTILQPAIRLMQSRAAVIATEEAGNVFQC  228

Query  865   ----------------------KLFVSKDSKSVGIP-------------------AQLFV  921
                                   +  ++ ++K V  P                    QLFV
Sbjct  229   SAGAGLDGSLTNLPAVKDDSKDRPAIAHETKDVERPHQGENWDFSFLIVNDKEGNKQLFV  288

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--------IPSGRFKCKNMS-EDEMFMASLICNID  1074
             D  VY++NR FR+  SSKAGK+ +L        IP+     K++S E+  F++SLICN+ 
Sbjct  289   DLGVYTKNRNFRMYKSSKAGKNVILKIAEDNKFIPNCE---KDVSLEEAYFLSSLICNVG  345

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMG--KSP  1248
             A           SD ++ L      +  F +      AF LN+  +  SR  + G   SP
Sbjct  346   A-----------SDDIKVL------SSGFSEEERKMSAF-LNSKTTRSSRDPMEGYQGSP  387

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             +P +D FV  + +   + G IR W +FS   L++Y +S  R+CE IGR HKSN++M +VD
Sbjct  388   YPEIDHFVRSLVNKDGLQGGIRQWSYFSLKELLIYDISGYRWCENIGRAHKSNNIMILVD  447

Query  1429  LRRGDYYQKCHDPDCK--GYRSPLRPIPGNV  1515
             L+   +YQKCHDP C+   ++S   P+P  +
Sbjct  448   LKNEVWYQKCHDPVCREQNFKSQSFPLPPGI  478



>ref|XP_005556457.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X1 [Macaca fascicularis]
 ref|XP_005556458.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X2 [Macaca fascicularis]
 gb|EHH54097.1| hypothetical protein EGM_14857 [Macaca fascicularis]
Length=556

 Score =   214 bits (545),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 156/449 (35%), Positives = 221/449 (49%), Gaps = 92/449 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALRELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY---------SSSET--------  849
             SST++KFSRHLI +L  +AFKDN HVG F  ++              S+SET        
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSASETTGHGFPHF  219

Query  850   -----------------------DERFRKLFVSKDS----------KSVGIPAQLFVDNA  930
                                     E+   L  ++ S           +VG    LFVD  
Sbjct  220   LEAPARQGFSFTEKATGESWTLNSEKLEMLGSAEQSSPDLSFLVVKNNVG-EKHLFVDLG  278

Query  931   VYSRNRCFRLALSSKAGKSSVL----------IPSGRFKCKNMSED-EMFMASLICNID-  1074
             VY+RNR FRL  SSK GK   L          IPS     K++S++ + F++SL+ N+  
Sbjct  279   VYTRNRNFRLYKSSKIGKRVALEVTEDNTFFPIPS-----KDVSDEYQYFLSSLVSNVRF  333

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
             +D  R+L C    +  + + +   I  S +    T + F+                SP+P
Sbjct  334   SDTLRILTCDPSQNKQKGVGYFNSIGTSVE----TIEGFQC---------------SPYP  374

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              VD FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+
Sbjct  375   EVDHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLK  434

Query  1435  RGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
                +YQKCHDP CK   ++S   P+P  V
Sbjct  435   NEVWYQKCHDPVCKAENFKSDCFPLPAEV  463



>ref|XP_008515502.1| PREDICTED: DNA-directed primase/polymerase protein isoform X5 
[Equus przewalskii]
Length=486

 Score =   212 bits (540),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 155/447 (35%), Positives = 221/447 (49%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQ-DHINGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q EA  + + C  +  VF+ +    +G R +LV+TY + W  YKS      H 
Sbjct  41    IWKLFYRQTEAFNFVKSCQEDVHVFALERKGGDGQRIYLVTTYTELWFYYKS-RKNLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEHVCKALQELYRVNCSTEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST++KFS HLI +L  +AFKDN HVG F  ++        +SE D+R            
Sbjct  160   SSTDEKFSCHLIFQLHDVAFKDNIHVGNFVRKILQPALHLIASEDDDRNPETMDHGFSHF  219

Query  859   ----------FRKL-----------FVSKDSKSVGIPAQ------------------LFV  921
                       F ++             SK+ + +G   Q                  LFV
Sbjct  220   SETPIKQEISFSEMSTDKDVGESWTLNSKEQERLGSAKQSSPDLSFLVVKNNKGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L    + RF   +  N+SE+ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKHVALEVAEANRFSPARSTNISEEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C +  +  + + +       F   S + +A E   F+           SP+P +
Sbjct  340   TLRILTCDISRNEQKRVEY-------FNGTSTSVEAIE--GFQC----------SPYPEI  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DQFVLSLVNKNGIKGGIRRWNYFFLEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSACFPLPAEV  467



>ref|XP_008150149.1| PREDICTED: DNA-directed primase/polymerase protein [Eptesicus 
fuscus]
Length=562

 Score =   214 bits (545),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 154/454 (34%), Positives = 218/454 (48%), Gaps = 95/454 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  FP+Q +A  + + C  +  VF+ +  + +G R +LV++Y   W  YKS    RRH 
Sbjct  41    IWKLFPRQTQAFNFVKSCKEDVHVFALECEVGDGQRIYLVTSYVQLWFHYKS----RRHL  96

Query  541   ---YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
                YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + + 
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQELYRVNCSAEDVF  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEV------------------------  819
              LDSST++KFSRHLI +L  +AFKDN HVG F  ++                        
Sbjct  157   NLDSSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASGDDEDDGGIPETTG  216

Query  820   ----------------CSRIYSSSETDERFRKLFVSKDSKSVGI---------------P  906
                             CS + +  E  E +     SK  + +G                P
Sbjct  217   QAFSHFSEPPIKQGISCSEMSTDKEIGESW--TLNSKAPERLGSAERSSPDLSFLVVKDP  274

Query  907   A---QLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKC-----KNMSEDEM-FMASL  1059
             A   +LFVD  VY+RNR FRL  SSK GK  VL  +   +C     +++SE+E  F++SL
Sbjct  275   AGKRRLFVDLGVYTRNRNFRLYKSSKRGKPVVLEVAADNRCSLPQAESISEEEQRFLSSL  334

Query  1060  ICNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMG  1239
             + N+             SD +R L  +    +  Q   F   +  + N E          
Sbjct  335   VSNVRF-----------SDTLRVLRCDASENKQKQAGHFNSTSTSVENIEG-------YQ  376

Query  1240  KSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMY  1419
              SP+P +D FV  + +   + G IR W +F    L+VY + K R+C  IGR HKSN++M 
Sbjct  377   GSPYPEIDQFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCGNIGRAHKSNNIMI  436

Query  1420  VVDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +VDL+   +YQKCHDP CK   ++S   P+P  +
Sbjct  437   LVDLKNEVWYQKCHDPICKAENFKSDRFPLPAEI  470



>ref|XP_005329280.1| PREDICTED: coiled-coil domain-containing protein 111 [Ictidomys 
tridecemlineatus]
Length=555

 Score =   214 bits (544),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 155/447 (35%), Positives = 217/447 (49%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFYRQNQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAQLWFYYKS-RKSLMHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + Y++  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPEADGKKMVALLIEYVCKALQELYNVSCSSEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST++KFSRHLI +L  +AFKDN HVG F  ++    +   +SE D+R            
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNVHVGNFVRKILQPAFHFIASEDDDRILEITDYQSSHF  219

Query  859   ----------FRKLFVSKDS-----------------------------KSVGIPAQLFV  921
                         K+   KD                              K+      LFV
Sbjct  220   SEAPLKQGSSLNKMLTVKDMGESWALNLEELERLGSADKSGPDLSFLIVKNNMGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + K++SE+ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKHVALEIAEDNKFFPKQSKSISEENQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    D  +      E   S      T + F+                SP+P V
Sbjct  340   TLRILTC----DAPQIKRKQAEYLNSTITSVETIEGFQC---------------SPYPEV  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY +SK R+CE IGR HKSN++M +VDL+  
Sbjct  381   DRFVLSLVNKNDIKGGIRRWSYFFPEELLVYDISKFRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSDYFPLPAEV  467



>ref|XP_005972659.1| PREDICTED: coiled-coil domain-containing protein 111 [Pantholops 
hodgsonii]
Length=555

 Score =   214 bits (544),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 155/454 (34%), Positives = 215/454 (47%), Gaps = 99/454 (22%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C     VF+ +  + +G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTQAFNFVKSCKQEVHVFALECKVGDGQRIYLVTTYAQLWFYYKS----RRNL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y++  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQEFYTVNCSAEDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY-------------------  834
              LDSSTE+KFSRHLI +L  +AFKDN HVG F  ++    +                   
Sbjct  157   NLDSSTEEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASEEDDMTPETTGCEF  216

Query  835   -----SSSETDERFRKLFVSKDSKSVGIP-----------------------------AQ  912
                  ++SE    F K+    D    G                                 
Sbjct  217   THFSETASEQGTCFSKMSTDNDVGKSGTSNSEKLGRLGSAQQSSPGLSFLIVKNDMGEKH  276

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNID  1074
             LFVD  VY+RNR FRL  SSK GK   L      RF   + +++S E++ F+ASL+ N+ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKRVALEVAEDNRFSPVQSRDISKENQYFLASLVSNVR  336

Query  1075  -ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFE-LNNFESDPSRTYLMGK--  1242
              +D  R+L C                         TPQ+ + +  F    +    +G   
Sbjct  337   FSDALRILTCD------------------------TPQSNQRIPRFSRTSTSVETIGGFQ  372

Query  1243  -SPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMY  1419
              SP+P VD FV  + +     G IR W +F    L+VY + K R+CE IGR H+SN++M 
Sbjct  373   CSPYPEVDQFVLSLVNKNGTEGGIRRWNYFFPEELLVYDICKYRWCENIGRAHRSNNIMI  432

Query  1420  VVDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +VDL+   +YQKCHDP CK   ++S   P+P  V
Sbjct  433   LVDLKNEVWYQKCHDPVCKAENFKSDCFPLPAEV  466



>ref|XP_004428795.1| PREDICTED: coiled-coil domain-containing protein 111 [Ceratotherium 
simum simum]
Length=557

 Score =   214 bits (544),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 157/447 (35%), Positives = 214/447 (48%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q EA  + + C  +  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFYRQTEAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYTQLWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQELYRVNCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST +KFS HLI +LP +AFKDN HVG F  ++    +   +SE D+R            
Sbjct  160   SSTHEKFSCHLIFQLPDVAFKDNIHVGNFVRKILQPAFHFIASENDDRIPETTNHGFSHF  219

Query  859   ----------FRKLFVSKDS-----------KSVGIPAQ------------------LFV  921
                       F K    KD            + +G   Q                  LFV
Sbjct  220   SATPTKQGISFSKTSSEKDIGESWTLNSKKLERLGSAKQSSPDLSFLIVKNNKGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      RF   +  N+SE+ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKHVALEVAEDNRFSPTQSTNISEEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C                  +FQ      + F  N   +   R      SP+P +
Sbjct  340   TLRILTC-----------------DTFQNEQKRVEDF--NGTSTSVERIEGFQCSPYPEI  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DQFVLSLVNKNGIKGGIRRWNYFFLEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAGNFKSDCFPLPAEV  467



>ref|XP_008708709.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Ursus maritimus]
Length=556

 Score =   213 bits (543),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 153/449 (34%), Positives = 219/449 (49%), Gaps = 89/449 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q  A  + + C     VF+ +  + +G R +LV+TY + W  YKS      H 
Sbjct  41    IWKLFHRQTHAFNFVKSCKEEVHVFALEYKVGDGQRIYLVTTYAELWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANQEADGKKMVALLIEHVCKALQELYGVHCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS---------------------  837
             SST++KFSRHLI +L  +AFKDN HVG F  ++    +                      
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASEDDDSISETTGHGFSHF  219

Query  838   --------------SSETDERFRKLFVSKDSKSVGIPAQ------------------LFV  921
                           SS+ D    +   SK+ + +G   Q                  LFV
Sbjct  220   PETPIKQGISFSEMSSDEDRGESRTRNSKEQERLGSAEQSSPDLSFLVVKNNVGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + KN+SE+ + F++SL+ N+  +D
Sbjct  280   DFGVYTRNRNFRLYKSSKIGKQVALEVAEDNKFFPKQSKNISEENQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGK--SPFP  1254
               R+L C              + +Q+ Q+         +  F S  ++  + G   SP+P
Sbjct  340   TLRILTC--------------DTSQNKQK--------RVECFNSTRTKENIEGYHCSPYP  377

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              +D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+
Sbjct  378   EIDRFVLSLVNKNGIKGGIRRWSYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLK  437

Query  1435  RGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
                +YQKCHDP CK   ++S   P+P  V
Sbjct  438   NEVWYQKCHDPVCKAENFKSDCFPLPAEV  466



>ref|XP_010863692.1| PREDICTED: DNA-directed primase/polymerase protein [Esox lucius]
 ref|XP_010863693.1| PREDICTED: DNA-directed primase/polymerase protein [Esox lucius]
Length=550

 Score =   213 bits (543),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 147/472 (31%), Positives = 224/472 (47%), Gaps = 74/472 (16%)
 Frame = +1

Query  241   QFCPLVFYGSPHGVPPKRPASLLRLLHEIRVDLSEQKKLSQEIWATFPKQVEAMKYAEQC  420
             Q CPL     P    P +P+S                     IW  FP+Q  A+ +A+ C
Sbjct  32    QQCPLSSVYKPRLSRPWQPSS---------------------IWKLFPRQCMAIHFAQSC  70

Query  421   I-NARVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLE  591
               +  VF+ +      G R +LV++Y + W  Y +      H YE+I EG  C LYFDLE
Sbjct  71    REDVHVFALEKEQTKMGQRIYLVTSYSELWHYYSTYRQSLMHCYELIPEGAVCKLYFDLE  130

Query  592   FNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPK  771
             F++ +N+ ++G  MV  LI  V + L   + +E S   ++ LDSSTE+KFSRHLI  LP 
Sbjct  131   FHRPSNSRRDGKVMVASLIQYVCEKLKDVFGIECSEKDVLNLDSSTEEKFSRHLIFILPN  190

Query  772   IAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLF--VSKDSKSVGIPAQ-----------  912
              AFKDN  VG F   +   + S         K    V++D    G+              
Sbjct  191   AAFKDNIQVGQFIHAILQPVLSLHRRGRELEKDLGGVTEDRGERGLKRNSQAMRPKHEDR  250

Query  913   ---------------LFVDNAVYSRNRCFRLALSSKAGKSSVLIPS--GRFKCK---NMS  1032
                            LFVD  VY++NR FRL  SSK GK++    +   +F  K   N+S
Sbjct  251   DLSFLLVKNKDGQDVLFVDLGVYTKNRNFRLYKSSKVGKNAAFTVAEDNKFIAKPERNVS  310

Query  1033  -EDEMFMASLICNIDADCERLLVC-KMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNF  1206
              E+ +F++SLI N+    +++L   + D+   +    + E + +   +S   + ++    
Sbjct  311   AEESLFLSSLISNVSFTSQKILTWDRHDTKYRKYPKPHAEESSTSHCISDALEGYQC---  367

Query  1207  ESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERI  1386
                         SP   VD+FV  +     + G IR W +F    L+VY + K R+C+ +
Sbjct  368   ------------SPHKEVDSFVLTVVKKDGIQGSIRRWNYFVSEQLLVYDILKYRWCQNV  415

Query  1387  GREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNVIAHCSVSFD  1542
              R HKSN++M +VDL+   +YQKCHDP CK +RS   P+P ++     ++ D
Sbjct  416   NRFHKSNNIMILVDLKDEVWYQKCHDPACKNFRSSSYPLPQDISVSYFITMD  467



>ref|XP_010376228.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Rhinopithecus roxellana]
Length=559

 Score =   213 bits (543),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 155/447 (35%), Positives = 216/447 (48%), Gaps = 85/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFRRQAQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G  MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKNMVALLIKYVCKALRELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY---------SSSETDER-----  858
             SST++KFSRHLI +L  +AFKDN HVG F  ++              S+SET        
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSTSETTGHGFPHF  219

Query  859   ----------FRKLFV-----------SKDSKSVGIPAQ------------------LFV  921
                       F K+F            SK  + +G   Q                  LFV
Sbjct  220   LEAPARQGFSFNKMFTEKATGESWTLNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVLIPSGR-----FKCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L  +        + K++S++ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKRVALEVTEDNTFFPMRSKDVSDEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    +  + + +   I  S                      T     SP+P V
Sbjct  340   TLRILTCDPSQNKQKGVGYFNSIGTS--------------------EATEGCQCSPYPEV  379

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  380   DHFVLSLVNKDGIKGGIRRWNYFFPEELMVYDICKYRWCENIGRAHKSNNIMILVDLKNE  439

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   +RS   P+P  V
Sbjct  440   VWYQKCHDPVCKAENFRSDCFPLPAEV  466



>ref|XP_008851796.1| PREDICTED: DNA-directed primase/polymerase protein [Nannospalax 
galili]
Length=561

 Score =   213 bits (543),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 154/455 (34%), Positives = 219/455 (48%), Gaps = 98/455 (22%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  FP+Q +A  + + C  +  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFPRQNQAFNFVKSCKEDVHVFALECKVGDGQRVYLVTTYAQLWFYYKSRK-TLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV  LI  V   L + YS+  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKSANPQADGKKMVAFLIEYVCKALQELYSVHCSSEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRI--YSSSETDER------------  858
             SSTE+KFS HLI +L  +AFKDN HVG F  ++      + + E D+R            
Sbjct  160   SSTEEKFSCHLIFQLHDVAFKDNIHVGNFVRKIFQPALHFIAKEDDDRIPEIMDHGVSHV  219

Query  859   ------------FRKLFV-----------SKDSKSVGIPAQ------------------L  915
                         F K+ +           S+  + +  P Q                  L
Sbjct  220   SFSNVSLKQEISFNKMSIDKAIEERWTLNSETPEKLRSPEQSGPDLSFLVVKNNMGEKHL  279

Query  916   FVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNID-  1074
             FVD  VY+RNR FRL  SSK GK   L      +F   + K++S E++ F++SL+ NI  
Sbjct  280   FVDLGVYTRNRNFRLYKSSKIGKCVALEVAEDNKFFPKQSKDISQENQYFLSSLVSNIRF  339

Query  1075  ADCERLLVC------KMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLM  1236
             +D  R+L C      +  ++C      + E  + FQ                        
Sbjct  340   SDTLRILTCDTSQNKRKRAECFNNTGISAETIEGFQC-----------------------  376

Query  1237  GKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
               SP+P VD FV  + +   + G IR W +F    L+VY +SK R+C+ IGR HKSN++M
Sbjct  377   --SPYPEVDQFVLSLVTKNDIKGGIRRWNYFFPEELLVYDISKYRWCKNIGRAHKSNNIM  434

Query  1417  YVVDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +VDL+   +YQKCHDP CK   ++S   P+P  +
Sbjct  435   ILVDLKNEVWYQKCHDPVCKAENFKSDCFPLPAEL  469



>ref|XP_002709540.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Oryctolagus cuniculus]
 ref|XP_008248734.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Oryctolagus cuniculus]
Length=552

 Score =   213 bits (542),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 155/449 (35%), Positives = 216/449 (48%), Gaps = 88/449 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q EA  + + C  +  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFRRQTEAFNFVKSCKQDVHVFALEYKMGDGQRIYLVTTYAQLWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L   YS+  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEHVCRALQDLYSVRCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS---RIYSSSETD-------------  852
             SST++KFSRHLI +L  +AFKDN HVG F   +     ++ +S + D             
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRTILQPALQLIASEDDDSISETVDQGFSHF  219

Query  853   ----------------------------ERFRKLFVSKDS----------KSVGIPAQLF  918
                                         E+ R+L  +K S           +VG    LF
Sbjct  220   SEAPTKQGASYNKMSPDKDTGESWTLNSEKPRRLGSAKQSDPDLSFLVVKNNVG-EKHLF  278

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRFKCKNM----SEDEMFMASLICNID-A  1077
             VD  VY+RNR F L  SSK GK   L      +F  K       E++ F++S +CN+  +
Sbjct  279   VDLGVYTRNRNFWLYKSSKLGKHVALEIAEDNKFFPKQSKTIPEENQYFLSSFVCNVRFS  338

Query  1078  DCERLLVCKMDSDCVRTL-HFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
             D  R+L C    +  + + HFN          S +P    +  F+           SP+P
Sbjct  339   DTLRILTCDTPQNKRKRMKHFN----------STSPSVGTIEGFQC----------SPYP  378

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              VD FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+
Sbjct  379   EVDQFVLSLVTKNDIKGGIRRWSYFFPEQLLVYDIFKYRWCENIGRAHKSNNIMILVDLK  438

Query  1435  RGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
                +YQKCHDP CK   +++   P+P  V
Sbjct  439   NEVWYQKCHDPICKAENFKTDCLPLPAEV  467



>ref|XP_003469156.1| PREDICTED: coiled-coil domain-containing protein 111 [Cavia porcellus]
Length=547

 Score =   213 bits (542),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 170/502 (34%), Positives = 234/502 (47%), Gaps = 91/502 (18%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHIN-GYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  N  VF+ +  ++ G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFHRQDQAFNFVKSCKENVHVFALEYKVDDGRRIYLVTTYAQLWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK+AN + +G +MV LLI  V   L + YS+  S + + +LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKRANPEADGKKMVALLIEHVCKALQELYSVSCSAEDVFKLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDERFRKLFVSKDSKS  894
             SST++KFS HLI +L  +AFKDN HVG F  ++        SS+ D+R R     K S  
Sbjct  160   SSTDEKFSCHLIFQLHDVAFKDNIHVGNFVKKILHPALHLISSQEDDRIRNPMDHKFSHF  219

Query  895   VGIPAQ----------------------------------------LFVDN---------  927
                P +                                        L V N         
Sbjct  220   PETPLKQEISYNQMSPDKDIAKSWTLNSKIPERQESTQQSNPDLSFLVVKNNMGEKHLFV  279

Query  928   --AVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
                VY+RNR FRL  SSK GK   L      RF   + KNMSE+ + F+ SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKCVALEVAEDNRFFPKQSKNMSEENQNFLFSLVTNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    D        T +  S      T + F+                SP+P V
Sbjct  340   SLRILTC----DTSENKRKRTNLVNSTSSSVETIEGFQC---------------SPYPEV  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+C+ IGR HKSN++M +VDL+  
Sbjct  381   DRFVLSLVTKNEIKGGIRRWNYFFPEELLVYDICKYRWCQNIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV----IAHCSVSFDLDS--NNEGREHTPVATDAN  1596
              +YQKCHDP CK   ++S   P+P  V    +      F  D   NNE + +   + DA 
Sbjct  441   VWYQKCHDPVCKAENFKSNCFPLPAEVSLLNLFKEEEEFTADETWNNEAK-NPGASADAA  499

Query  1597  IVDSCKKEWWLEAIRFAEQVEG  1662
               +S    ++LEA   AE  E 
Sbjct  500   WDNSTDDAYFLEATDDAELAEA  521



>ref|XP_004389724.1| PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain-containing 
protein 111 [Trichechus manatus latirostris]
Length=561

 Score =   213 bits (542),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 158/474 (33%), Positives = 228/474 (48%), Gaps = 87/474 (18%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q EA  + + C  +  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFYRQAEAFNFVKSCKEDIHVFALECKVGDGQRIYLVTTYAQLWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y++  S + +  LD
Sbjct  100   YEVIPENSVCKLYFDLEFNKLANPRADGKKMVALLIEHVCKALRELYNVNCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS---RIYSSSETDER-----------  858
             SST++KFSRHLI +L  +AFKDN HVG F  ++     ++ +S + D+            
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPALKLIASEDDDKTPETTGCRFSHF  219

Query  859   ----------FRKLFVSKDS-----------KSVGIPAQ------------------LFV  921
                       F  + + KD+           K +G   Q                  LFV
Sbjct  220   SEASIQQGTSFNTMSMEKDTRESWTLNSEKLKRLGSAKQSSPDLSFLVVKNNIGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSEDE-MFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + KN+SE+   F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKHVALEVAEDNKFFPMQSKNISEENHYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               ++L C    +  + + +      S +    T + F+                SP+P +
Sbjct  340   TLQILTCDTSQNKQKQVEYFNHSNTSVE----TIEGFQC---------------SPYPEI  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + + R+CE IGR HKSN++M +VDL+  
Sbjct  381   DRFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICRYRWCENIGRAHKSNNIMILVDLKND  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATDAN  1596
              +YQKCHDP CK   ++S   P+P  V   C +    D     RE   V T  N
Sbjct  441   VWYQKCHDPVCKAENFKSDCFPLPPEV---CLLRLFKDEEEFTREDETVETKNN  491



>gb|ETL81452.1| hypothetical protein L917_18227 [Phytophthora parasitica]
Length=694

 Score =   215 bits (548),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 145/453 (32%), Positives = 223/453 (49%), Gaps = 94/453 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI----------------------NARVFSYQDHINGYRRFLV  480
             I ++FP+Q EA ++A+Q                          RVFS++   +G RRFLV
Sbjct  252   ISSSFPRQQEAFEFADQVAALRRRVKATSSASPGIGYGGDSTPRVFSFESAGDGKRRFLV  311

Query  481   STYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVF  660
             ++  +FWK YK     +RH YE+I+EG+PC LYFDLEF ++ N   +GD +V  L+  + 
Sbjct  312   ASLTEFWKNYKKTRDDQRHVYEIIREGVPCRLYFDLEFKREINLHVDGDALVARLVSLLQ  371

Query  661   DTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIA-FKDNSHVGAFTAEVCSRIYS  837
               L ++Y L   H  I +LDSST  KFSRHLI   P  + F+DN H GAF  E  + +  
Sbjct  372   LQLFRRYGLRVHHRDIYQLDSSTPAKFSRHLIFHFPDGSLFRDNLHAGAFVREFINDLVD  431

Query  838   ----SSETDERFRKLFVSKDSKSVGI-PAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIP  1002
                 +S  D+      V+ +S +  +   QLF+D  VY+RNR FR+  SSK  K ++L P
Sbjct  432   LTDYTSAPDDLLSPFLVNTESGNDPVDKKQLFIDTGVYTRNRMFRVLGSSKFKKHAILRP  491

Query  1003  SGRFKCKNMSEDE----MFMASLIC------NIDADCE----RLLVCKMDSDCVRTLHFN  1140
                    N +E E    +F+ +L+C      +++ D +    RLL C+  +   R+    
Sbjct  492   ------LNAAETELDLDLFVNTLVCPYPSLESMELDRKTKNYRLLRCESSAALQRSRKST  545

Query  1141  TEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSW  1320
                A+S    S   +                  +S +P +DAF+   A+ G V G+IR+ 
Sbjct  546   YAGAKSITSSSVECR------------------RSIYPMLDAFIRSQATTGGVQGEIRAI  587

Query  1321  YWFSEYG--------------------------LIVYSMSKNRYCERIGREHKSNHVMYV  1422
                                              +I+Y M++NR+C  I R HKSN+VM++
Sbjct  588   QMLMTSSSTVLAVLPGQEDVQEAEDNAAKPHPWMIIYHMARNRWCANIRRPHKSNNVMFI  647

Query  1423  VDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             VD+ +  +YQKCHDP C+   +RS  +P+P ++
Sbjct  648   VDIDQRVFYQKCHDPACQAIDFRSSPQPLPPHI  680



>ref|XP_007998587.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Chlorocebus sabaeus]
Length=555

 Score =   213 bits (542),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 153/444 (34%), Positives = 220/444 (50%), Gaps = 83/444 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKVLRELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY---------SSSET--------  849
             SST++KFSRHLI +L  +AFKDN HVG F  ++              S+SET        
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSASETTGHGFPHF  219

Query  850   -----------------------DERFRKLFVSKDS----------KSVGIPAQLFVDNA  930
                                     E+  +L  ++ S           +VG    LFVD  
Sbjct  220   LEAPARQEFSFTEKATGESWTLNSEKLERLGSAEQSSPDLSFVVVKNNVG-EKHLFVDLG  278

Query  931   VYSRNRCFRLALSSKAGKSSVLIPSGR-----FKCKNMSED-EMFMASLICNID-ADCER  1089
             VY+RNR FRL  SSK GK   L  +        + K++S++ + F++SL+ N+  +D  R
Sbjct  279   VYTRNRNFRLYKSSKIGKRVALEVTEDNTFFPIRSKDVSDEYQYFLSSLVSNVRFSDTLR  338

Query  1090  LLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAF  1269
             +L C    +  + + +   I       S T + F+                SP+P VD F
Sbjct  339   ILTCDPSQNKQKGVGYFNSIG-----TSETIEGFQC---------------SPYPEVDHF  378

Query  1270  VEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYY  1449
             V  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+   +Y
Sbjct  379   VLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWY  438

Query  1450  QKCHDPDCKG--YRSPLRPIPGNV  1515
             QKCHDP CK   ++S   P+P  V
Sbjct  439   QKCHDPVCKAENFKSDCFPLPAEV  462



>ref|XP_004579316.1| PREDICTED: coiled-coil domain-containing protein 111 [Ochotona 
princeps]
Length=553

 Score =   213 bits (541),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 159/447 (36%), Positives = 213/447 (48%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  +A+ C  +  VF+ +    +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFHRQTQAFNFAKTCKQDVHVFALEYKTGDGQRIYLVTTYFQLWFYYKS-RKNLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L   Y +  S   +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVMLLIEYVCRELQDLYGINCSAVDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFT-------------------AEVCSRIYS--  837
             SSTE+KFSRHLI +L   AFKDN HVG F                     E   R +S  
Sbjct  160   SSTEEKFSRHLIFQLRDAAFKDNIHVGNFVRTVLQPAIDLIASEDDVNLPETVDRGFSHL  219

Query  838   --------------SSETDERFRKLFVSKDSKSVGIPAQ------------------LFV  921
                           S +   R      S+   S+G   Q                  LFV
Sbjct  220   PEALIEQGSSFNRMSQDMGLRENGTLNSRKQDSLGSAKQSDPDLSFLIVKNNMGERHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + K +SE+ + F++SL+CN+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKLGKHVTLEIAEDNKFFPKQSKAVSEEYQYFLSSLVCNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C+   D       N +  + F   + + +  E   F S          SP+P V
Sbjct  340   ALRILTCEATQD-------NRKRPEHFNNTNISVETLE--GFHS----------SPYPEV  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +FS   L+VY + K R+CE I R HKSN++M +VDL+  
Sbjct  381   DRFVLSLVTKNDIKGGIRRWSYFSSEELLVYDIFKYRWCENIRRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSACFPLPDEV  467



>ref|XP_007177929.1| PREDICTED: DNA-directed primase/polymerase protein isoform X5 
[Balaenoptera acutorostrata scammoni]
Length=555

 Score =   213 bits (542),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 153/451 (34%), Positives = 222/451 (49%), Gaps = 93/451 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAQLWFYYKS----RRTL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLEFN+ AN   +G +MV LLI  V   L Q Y +  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNRLANPGADGKKMVALLIEHVCKALQQFYRVSCSAEDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETD-----------  852
              LDSST +KFSRHLI +L  +AFKDN+HVG F  ++    +   +SE D           
Sbjct  157   NLDSSTSEKFSRHLIFQLHDVAFKDNTHVGNFVRKILEPAFHLIASEDDDMTPETTGHEF  216

Query  853   -------------------------------ERFRKLFVSKDS----------KSVGIPA  909
                                            E+  +L  +K S           ++G   
Sbjct  217   SHFSETPIKQGISFSKKSTDEDIGESWTTNSEKLERLGSAKQSSPDLSFLIVKNNIG-EK  275

Query  910   QLFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNI  1071
              LFVD  VY+RNR FRL  SSK GK   L      +F   + KN+S E++ F+++L+ N+
Sbjct  276   HLFVDLGVYTRNRNFRLYKSSKIGKYVPLEVAEDNKFYPIQSKNISIENQYFLSALVSNV  335

Query  1072  D-ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSP  1248
               +D  R+L C +  +  + + +    +      S T + F+                SP
Sbjct  336   RFSDTLRILTCDISQNKQKRVEYFNHTS-----TSETIEGFQC---------------SP  375

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             +P +D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VD
Sbjct  376   YPEIDQFVLLLVNKNGIKGGIRRWNYFFLEELLVYDICKYRWCENIGRAHKSNNIMILVD  435

Query  1429  LRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             L+   +YQKCHDP CK   ++S   P+P  V
Sbjct  436   LKNEVWYQKCHDPICKAENFKSDCFPLPAEV  466



>ref|XP_008515496.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Equus przewalskii]
 ref|XP_008515497.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Equus przewalskii]
 ref|XP_008515498.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Equus przewalskii]
Length=558

 Score =   213 bits (542),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 155/447 (35%), Positives = 221/447 (49%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQ-DHINGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q EA  + + C  +  VF+ +    +G R +LV+TY + W  YKS      H 
Sbjct  41    IWKLFYRQTEAFNFVKSCQEDVHVFALERKGGDGQRIYLVTTYTELWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEHVCKALQELYRVNCSTEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST++KFS HLI +L  +AFKDN HVG F  ++        +SE D+R            
Sbjct  160   SSTDEKFSCHLIFQLHDVAFKDNIHVGNFVRKILQPALHLIASEDDDRNPETMDHGFSHF  219

Query  859   ----------FRKL-----------FVSKDSKSVGIPAQ------------------LFV  921
                       F ++             SK+ + +G   Q                  LFV
Sbjct  220   SETPIKQEISFSEMSTDKDVGESWTLNSKEQERLGSAKQSSPDLSFLVVKNNKGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L    + RF   +  N+SE+ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKHVALEVAEANRFSPARSTNISEEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C +  +  + + +       F   S + +A E   F+           SP+P +
Sbjct  340   TLRILTCDISRNEQKRVEY-------FNGTSTSVEAIE--GFQC----------SPYPEI  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DQFVLSLVNKNGIKGGIRRWNYFFLEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSACFPLPAEV  467



>ref|XP_005883918.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X1 [Myotis brandtii]
 ref|XP_005883919.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X2 [Myotis brandtii]
 ref|XP_005883920.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X3 [Myotis brandtii]
Length=561

 Score =   213 bits (542),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 156/450 (35%), Positives = 218/450 (48%), Gaps = 87/450 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  FP+Q +A  + + C  +  VF+ +  + +G R +LV++Y   W  YKS      H 
Sbjct  41    IWKLFPRQTQAFNFVKSCKEDVHVFALEFEVGDGQRIYLVTSYVQLWFHYKSRK-HLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQELYRVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS----RIYSSSETDE-----------  855
             SST++KFS HLI +L  +AFKDN HVG F  ++       I S  + D+           
Sbjct  160   SSTDEKFSCHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASGDDEDDGGIPGTTGQAF  219

Query  856   ------------RFRKL-----------FVSKDSKSVGI---------------PA---Q  912
                          FR++             SK  + +G                PA   +
Sbjct  220   SHFSEPPIKQGISFREMSTDEERGESWMLTSKAPERLGSIEWSGPDLSFLVVKDPAGKKR  279

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSEDEM-FMASLICNID  1074
             LFVD  VY+RNR FRL  SSK GK  VL      RF   + KN SE+E  F++SL+ N+ 
Sbjct  280   LFVDLGVYTRNRNFRLYKSSKKGKPVVLEVAEDNRFSLTQSKNTSEEEQYFLSSLVSNVR  339

Query  1075  -ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
              +D  R+L C    D  +                   QA  LN+  +          SP+
Sbjct  340   FSDTLRVLRCDASEDKQK-------------------QAGHLNSTSTSVENIEGFQASPY  380

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P +D FV  + +   + G IR W +F    L+VY + K R+C  IGR HKSN++M +VDL
Sbjct  381   PEIDQFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCGNIGRAHKSNNIMILVDL  440

Query  1432  RRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +   +YQKCHDP CK   ++S   P+P  +
Sbjct  441   KNEVWYQKCHDPICKAENFKSDRFPLPAEI  470



>gb|ETP04317.1| hypothetical protein F441_18882 [Phytophthora parasitica CJ01A1]
Length=694

 Score =   215 bits (548),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 145/453 (32%), Positives = 222/453 (49%), Gaps = 94/453 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI----------------------NARVFSYQDHINGYRRFLV  480
             I ++FP+Q EA ++A+Q                          RVFS++   +G RRFLV
Sbjct  252   ISSSFPRQQEAFEFADQVAALRRRVKATSSASPGIGYGGDSTPRVFSFESAGDGKRRFLV  311

Query  481   STYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVF  660
             ++  +FWK YK     +RH YE+I+EG+PC LYFDLEF +  N   +GD +V  L+  + 
Sbjct  312   ASLTEFWKNYKKTRDDQRHVYEIIREGVPCRLYFDLEFKRGINLHVDGDALVARLVSLLQ  371

Query  661   DTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIA-FKDNSHVGAFTAEVCSRIYS  837
               L ++Y L   H  I +LDSST  KFSRHLI   P  + F+DN H GAF  E  + +  
Sbjct  372   LQLFRRYGLRVHHRDIYQLDSSTPAKFSRHLIFHFPDGSLFRDNLHAGAFVREFINDLVD  431

Query  838   ----SSETDERFRKLFVSKDSKSVGI-PAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIP  1002
                 +S  D+      V+ +S +  +   QLF+D  VY+RNR FR+  SSK  K ++L P
Sbjct  432   LTDYTSAPDDLLSPFLVNTESGNDPVDKKQLFIDTGVYTRNRMFRVLGSSKFKKHAILRP  491

Query  1003  SGRFKCKNMSEDE----MFMASLIC------NIDADCE----RLLVCKMDSDCVRTLHFN  1140
                    N +E E    +F+ +L+C      +++ D +    RLL C+  +   R+    
Sbjct  492   ------LNAAETELDLDLFVNTLVCPYPSLESMELDRKTKNYRLLRCESSAALQRSRKST  545

Query  1141  TEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSW  1320
                A+S    S   +                  +S +P +DAF+   A+ G V G+IR+ 
Sbjct  546   YAGAKSITSSSVECR------------------RSIYPMLDAFIRSQATTGGVQGEIRAI  587

Query  1321  YWFSEYG--------------------------LIVYSMSKNRYCERIGREHKSNHVMYV  1422
                                              +I+Y M++NR+C  I R HKSN+VM++
Sbjct  588   QMLMTSSSTVLAVLPGQEDVQEAEDNAAKPHPWMIIYHMARNRWCANIRRPHKSNNVMFI  647

Query  1423  VDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             VD+ +  +YQKCHDP C+   +RS  +P+P ++
Sbjct  648   VDIDQRVFYQKCHDPACQAIDFRSSPQPLPPHI  680



>ref|XP_001491218.2| PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain-containing 
protein 111 [Equus caballus]
Length=558

 Score =   213 bits (541),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 155/447 (35%), Positives = 221/447 (49%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQ-DHINGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q EA  + + C  +  VF+ +    +G R +LV+TY + W  YKS      H 
Sbjct  41    IWKLFYRQTEAFNFVKSCQEDVHVFALERKGGDGQRIYLVTTYTELWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEHVCKALQELYRVNCSTEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST++KFS HLI +L  +AFKDN HVG F  ++        +SE D+R            
Sbjct  160   SSTDEKFSCHLIFQLHDVAFKDNIHVGNFVRKILQPALHLIASEDDDRNPETMDHGFSHF  219

Query  859   ----------FRKL-----------FVSKDSKSVGIPAQ------------------LFV  921
                       F ++             SK+ + +G   Q                  LFV
Sbjct  220   SETPNKQEISFSEMSTDKDVGESWTLNSKEQERLGSAKQSSPDLSFFSCEEXQRRKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L    + RF   +  N+SE+ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKHVALEVAEANRFSPARSTNISEEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C +  +  + + +       F   S + +A E   F+           SP+P +
Sbjct  340   TLRILTCDISRNEQKRVEY-------FNGTSTSVEAIE--GFQC----------SPYPEI  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DQFVLSLVNKNGIKGGIRRWNYFFLEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSACFPLPAEV  467



>gb|ETI34418.1| hypothetical protein F443_19074 [Phytophthora parasitica P1569]
Length=694

 Score =   215 bits (547),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 145/453 (32%), Positives = 222/453 (49%), Gaps = 94/453 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI----------------------NARVFSYQDHINGYRRFLV  480
             I ++FP+Q EA ++A+Q                          RVFS++   +G RRFLV
Sbjct  252   ISSSFPRQQEAFEFADQVAALRRRVKATSSASPGIGYGGDSTPRVFSFESAGDGKRRFLV  311

Query  481   STYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVF  660
             ++  +FWK YK     +RH YE+I+EG+PC LYFDLEF ++ N   +GD +V  L+  + 
Sbjct  312   ASLTEFWKNYKKTRDDQRHVYEIIREGVPCRLYFDLEFKREINLHVDGDALVARLVSLLQ  371

Query  661   DTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKI-AFKDNSHVGAFTAEVCSRIYS  837
               L ++Y L   H  I +LDSST  KFSRHLI   P    F+DN H GAF  E  + +  
Sbjct  372   LQLFRRYGLRVHHRDIYQLDSSTPAKFSRHLIFHFPDGNLFRDNLHAGAFVREFINDLVD  431

Query  838   ----SSETDERFRKLFVSKDSKSVGI-PAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIP  1002
                 +S  D+      V+ +S +  +   QLF+D  VY+RNR FR+  SSK  K ++L P
Sbjct  432   LTDYTSAPDDLLSPFLVNTESGNDPVDKKQLFIDTGVYTRNRMFRVLGSSKFKKHAILRP  491

Query  1003  SGRFKCKNMSEDE----MFMASLIC------NIDADCE----RLLVCKMDSDCVRTLHFN  1140
                    N +E E    +F+ +L+C      +++ D +    RLL C+  +   R+    
Sbjct  492   ------LNAAETELDLDLFVNTLVCPYPSLESMELDRKTKNYRLLRCESSAALQRSRKST  545

Query  1141  TEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSW  1320
                A+S    S   +                  +S +P +DAF+   A+ G V G+IR+ 
Sbjct  546   YAGAKSITSSSVECR------------------RSIYPMLDAFIRSQATTGGVQGEIRAI  587

Query  1321  YWFSEYG--------------------------LIVYSMSKNRYCERIGREHKSNHVMYV  1422
                                              +I+Y M++NR+C  I R HKSN+VM++
Sbjct  588   QMLMTSSSTVLAVLPGQEDVQEAEDNAAKPHPWMIIYHMARNRWCANIRRPHKSNNVMFI  647

Query  1423  VDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             VD+ +  +YQKCHDP C+   +RS  +P+P ++
Sbjct  648   VDIDQRVFYQKCHDPACQAIDFRSSPQPLPPHI  680



>ref|XP_008923017.1| PREDICTED: DNA-directed primase/polymerase protein [Manacus vitellinus]
Length=582

 Score =   213 bits (542),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 167/488 (34%), Positives = 229/488 (47%), Gaps = 101/488 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRY-KSMNPKRRH  537
             +W  F +Q EA  Y + C  +  VF+ + +  +G R +LV+TY++ W  Y K       H
Sbjct  41    VWKIFSRQAEAFNYVKICKEDVHVFALEKNTQSGQRFYLVTTYKELWFYYTKGYKTSLMH  100

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI E   C LYFDLEF K AN   +G  MV  LI  V   L + Y +  S   ++ L
Sbjct  101   CYEVIPEKDACKLYFDLEFYKPANPGADGKSMVAKLIELVSQKLKELYDVNCSTKDVLNL  160

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFT---------------------AEVCSRIY  834
             DSST++KFSRHLI    K  FKDN HVG F                       E   R++
Sbjct  161   DSSTDEKFSRHLIFLPQKTVFKDNVHVGNFVRTILQPAIRLMESKAAAAVIPEEEAGRVF  220

Query  835   SSSE----TDERFRKLFVSKDSKSVGIPA-------------------------------  909
              SS      D   R L   KD+ S G PA                               
Sbjct  221   QSSAEAVGLDGSLRNLTAVKDA-SKGWPAIAHKTKDMEMSHQGENLDFSFLIVNDTKGNK  279

Query  910   QLFVDNAVYSRNRCFRLALSSKAGKSSVL--------IPSGRFKCKNMS-EDEMFMASLI  1062
             QLFVD  VY++NR FR+  SSKAGK+ +L        IPS     K++S E+  F++SLI
Sbjct  280   QLFVDLGVYTKNRNFRMYKSSKAGKNVILKIAEDNKFIPSCE---KDVSLEEAYFLSSLI  336

Query  1063  CNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMG-  1239
             CNI             SD  + L      +  F +      AF LN+  +  S+  + G 
Sbjct  337   CNIRV-----------SDDTKVL------SSGFSEEERKMSAF-LNSKTTRSSQDSMEGY  378

Query  1240  -KSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
               SP+P +D FV  + +   + G IR W +FS   ++VY +S  R+CE IGR HKSN++M
Sbjct  379   QGSPYPEIDNFVHSLVNKDGLQGGIRQWNYFSLKEILVYDISGYRWCENIGRAHKSNNIM  438

Query  1417  YVVDLRRGDYYQKCHDPDCK--GYRSPLRPIPGNVIAHCSVSFDLDSNNEGREHTPVATD  1590
              +VDL+   +YQKCHDP C+   ++S   P+P  +   C  S       E  E+TP+   
Sbjct  439   ILVDLKNEVWYQKCHDPVCREQNFKSQSFPLPPGI---CLPSL----FQEEEEYTPMDER  491

Query  1591  ANIVDSCK  1614
              N  +  K
Sbjct  492   GNTEEKVK  499



>ref|XP_003205563.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Meleagris gallopavo]
Length=569

 Score =   213 bits (541),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 154/449 (34%), Positives = 221/449 (49%), Gaps = 85/449 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRY-KSMNPKRRH  537
             +W  F +Q EA ++ + C  +  VF+ + +  NG R +LV+TY++ W  Y K       H
Sbjct  41    VWKIFCRQAEAFRFVKTCKEDVHVFALEKNTQNGQRFYLVTTYKELWHYYTKGYKTSLMH  100

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI E   C LYFDLEF K AN   +G +MV  LI  V   L + Y +  S   ++ L
Sbjct  101   CYEVIPEKDACKLYFDLEFYKAANPGADGKDMVAKLIELVSQKLKELYDVNCSARDVLNL  160

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS---RIYSSS--------ETDERFR  864
             DSST++KFSRHLI    K  FKDN HVG F   +     R+  S+        ET   F+
Sbjct  161   DSSTDEKFSRHLIFLPCKTVFKDNIHVGNFVKTILQPAIRLMESNVTAPIAEGETGYIFQ  220

Query  865   KL-----------FVSKDSKSVGIPA-------------------------------QLF  918
             +            F +    S G PA                               QLF
Sbjct  221   RPAPTDLDGSLTNFTAVKDASKGWPAIADQRNETETSYHGENSEFSFLIVNNKEGDKQLF  280

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFK----CK-NMS-EDEMFMASLICNIDAD  1080
             VD  VY+RNR FR+  SSKAGK+ +L  +   K    C+ N+S E+  F++SL+CN+ + 
Sbjct  281   VDLGVYTRNRNFRMYKSSKAGKNVILTIAEDNKFVPNCEENISLEEAYFLSSLVCNVRS-  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMG--KSPFP  1254
                                +T+I  SF +      AF L +  +  +R  + G   SP+P
Sbjct  340   -----------------KDDTKILSSFLEEEIKMSAF-LRSKTTRSTRESMEGYQDSPYP  381

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              +D FV  + +   V G IR W +FS   ++VY +S  R+CE IGR H+SN++M +VDL+
Sbjct  382   EIDCFVRSLINKDGVQGGIRQWNYFSGEEILVYDISGYRWCENIGRAHRSNNIMILVDLK  441

Query  1435  RGDYYQKCHDPDC--KGYRSPLRPIPGNV  1515
             +  +YQKCHDP C  K ++S   P+P  +
Sbjct  442   KEVWYQKCHDPVCKEKNFKSQSLPLPPRI  470



>ref|XP_007627840.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Cricetulus griseus]
Length=540

 Score =   212 bits (539),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 152/429 (35%), Positives = 219/429 (51%), Gaps = 66/429 (15%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  N  VF+ +    +G R +LV++Y   W  YK       H 
Sbjct  40    IWKLFHRQNQAFNFVKSCKENVHVFALECKAGDGQRIYLVTSYAQLWFYYK-FRKTLLHC  98

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y++  S + ++ LD
Sbjct  99    YEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALEELYNVHCSVEDVINLD  158

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDERFRKLFVSKDS--  888
             SSTE+KFSRHLI +L  +AFKDN+HVG F  ++        + E D++  +    K S  
Sbjct  159   SSTEEKFSRHLIFQLHDVAFKDNTHVGNFVRKILQPALHLITKEDDDKIPEATDHKVSCF  218

Query  889   -------------KSVGIPAQ------------------LFVDNAVYSRNRCFRLALSSK  975
                          +  G P Q                  LFVD  VY+RNR FRL  SSK
Sbjct  219   SDVPLKQEILETWEKPGSPKQYIPDLSFLVVKNNMGEKCLFVDLGVYTRNRNFRLYRSSK  278

Query  976   AGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-ADCERLLVCKMDSDCVRTLH  1134
              GK   L      RF   + K++SE+ + F++SL+ N+  +D  R+L C           
Sbjct  279   IGKCVALEVAEDNRFIPKQSKDISEENQYFLSSLVSNVRFSDTLRILTC-----------  327

Query  1135  FNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIR  1314
                + +Q+ ++     +A   N+  +   ++     SP+P VD FV  + +   + G IR
Sbjct  328   ---DTSQTKRK-----RAEYFNSTGTSVDKSPGFHCSPYPEVDQFVLSLVNKHDIKGGIR  379

Query  1315  SWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKG--YRS  1488
              W +F    L+VY + K R+CE IGR HKSN++M +VDL+   +YQKCHDP CK   ++S
Sbjct  380   RWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAQNFKS  439

Query  1489  PLRPIPGNV  1515
                P+P  V
Sbjct  440   NCFPLPTEV  448



>gb|ETK74767.1| hypothetical protein L915_18498 [Phytophthora parasitica]
Length=694

 Score =   215 bits (547),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 145/453 (32%), Positives = 222/453 (49%), Gaps = 94/453 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI----------------------NARVFSYQDHINGYRRFLV  480
             I ++FP+Q EA ++A+Q                          RVFS++   +G RRFLV
Sbjct  252   ISSSFPRQQEAFEFADQVAALRRRVKATSSASPGIGYGGDSTPRVFSFESAGDGKRRFLV  311

Query  481   STYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVF  660
             ++  +FWK YK     +RH YE+I+EG+PC LYFDLEF +  N   +GD +V  L+  + 
Sbjct  312   ASLTEFWKNYKKTRDDQRHVYEIIREGVPCRLYFDLEFKRGINLHVDGDALVARLVSLLQ  371

Query  661   DTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIA-FKDNSHVGAFTAEVCSRIYS  837
               L ++Y L   H  I +LDSST  KFSRHLI   P  + F+DN H GAF  E  + +  
Sbjct  372   LQLFRRYGLRVHHRDIYQLDSSTPAKFSRHLIFHFPDGSLFRDNLHAGAFVREFINDLVD  431

Query  838   ----SSETDERFRKLFVSKDSKSVGI-PAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIP  1002
                 +S  D+      V+ +S +  +   QLF+D  VY+RNR FR+  SSK  K ++L P
Sbjct  432   LTDYTSAPDDLLSPFLVNTESGNDPVDKKQLFIDTGVYTRNRMFRVLGSSKFKKHAILRP  491

Query  1003  SGRFKCKNMSEDE----MFMASLIC------NIDADCE----RLLVCKMDSDCVRTLHFN  1140
                    N +E E    +F+ +L+C      +++ D +    RLL C+  +   R+    
Sbjct  492   ------LNAAETELDLDLFVNTLVCPYPSLESMELDRKTKNYRLLRCESSAALQRSRKST  545

Query  1141  TEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSW  1320
                A+S    S   +                  +S +P +DAF+   A+ G V G+IR+ 
Sbjct  546   YAGAKSITSSSVECR------------------RSIYPMLDAFIRSQATTGGVQGEIRAI  587

Query  1321  YWFSEYG--------------------------LIVYSMSKNRYCERIGREHKSNHVMYV  1422
                                              +I+Y M++NR+C  I R HKSN+VM++
Sbjct  588   QMLMTSSSTVLAVLPGQEDVQEAEDNAAKPHPWMIIYHMARNRWCANIRRPHKSNNVMFI  647

Query  1423  VDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             VD+ +  +YQKCHDP C+   +RS  +P+P ++
Sbjct  648   VDIDQRVFYQKCHDPACQAIDFRSSPQPLPPHI  680



>ref|XP_009206217.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Papio anubis]
Length=555

 Score =   212 bits (540),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 154/444 (35%), Positives = 217/444 (49%), Gaps = 83/444 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIKYVCKALRELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY---------SSSET--------  849
             SST++KFSRHLI +L  +AFKDN HVG F  ++              S+SET        
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSASETTGHGFHHF  219

Query  850   -----------------------DERFRKLFVSKDS----------KSVGIPAQLFVDNA  930
                                     E   +L  ++ S           +VG    LFVD  
Sbjct  220   LEAPARQEFSFTEKATGESWTLNSEELERLGSAEQSSPDLSFLVVKNNVG-EKHLFVDLG  278

Query  931   VYSRNRCFRLALSSKAGKSSVL-IPSGR----FKCKNMSED-EMFMASLICNID-ADCER  1089
             VY+RNR FRL  SSK GKS  L +P        + K +S++ + F++SL+ N+  +D  R
Sbjct  279   VYTRNRNFRLYKSSKIGKSVALEVPEDNAFFPVRPKGVSDEYQCFLSSLVSNVRFSDTLR  338

Query  1090  LLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAF  1269
             +L C    +  + + +   I  S     F                      SP+P VD F
Sbjct  339   ILTCDPSQNKQKGVGYFNSIGTSETIGGFQC--------------------SPYPEVDHF  378

Query  1270  VEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYY  1449
             V  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+   +Y
Sbjct  379   VLSLVNKDGIRGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWY  438

Query  1450  QKCHDPDCKG--YRSPLRPIPGNV  1515
             QKCHDP CK   ++S   P+P  V
Sbjct  439   QKCHDPVCKAENFKSDCFPLPAEV  462



>ref|XP_004412788.1| PREDICTED: coiled-coil domain-containing protein 111 [Odobenus 
rosmarus divergens]
Length=557

 Score =   212 bits (540),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 152/447 (34%), Positives = 216/447 (48%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFHRQTQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYPQLWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPEADGKKMVALLIEHVCKALQELYRVNCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDE-------------  855
             SST++KFSRHLI +L  +AFKDN HVG F  ++    +   +SE D+             
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNVHVGNFVRKILQPAFHLIASEDDDSISESTGHGFSHF  219

Query  856   ---------RFRKLFVSKD--------SKSVGIPA---------------------QLFV  921
                       F K+   KD        SK  G                         LFV
Sbjct  220   PETPIKQGISFSKMSSDKDRGESQTQNSKEQGRLGSAEQSRPDLSFLVVKNNVGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      +F   + K +SE+ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKQVALEIAEDNKFFPKQSKTISEENQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    +  + + ++                   N+  +    T     SP+P +
Sbjct  340   TLRILTCDTSQNKQKRVEYS-------------------NSTNTKAENTEGFHCSPYPEI  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DQFVLSLVNKNGIKGGIRHWSYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_005556459.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X3 [Macaca fascicularis]
Length=555

 Score =   212 bits (540),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 156/449 (35%), Positives = 220/449 (49%), Gaps = 93/449 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY +FW  YKS      H 
Sbjct  41    IWRLFHRQAQAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYAEFWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALRELYGVNCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY---------SSSET--------  849
             SST++KFSRHLI +L  +AFKDN HVG F  ++              S+SET        
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSASETTGHGFPHF  219

Query  850   -----------------------DERFRKLFVSKDS----------KSVGIPAQLFVDNA  930
                                     E+   L  ++ S           +VG    LFVD  
Sbjct  220   LEAPARQGFSFTEKATGESWTLNSEKLEMLGSAEQSSPDLSFLVVKNNVG-EKHLFVDLG  278

Query  931   VYSRNRCFRLALSSKAGKSSVL----------IPSGRFKCKNMSED-EMFMASLICNID-  1074
             VY+RNR FRL  SSK GK   L          IPS     K++S++ + F++SL+ N+  
Sbjct  279   VYTRNRNFRLYKSSKIGKRVALEVTEDNTFFPIPS-----KDVSDEYQYFLSSLVSNVRF  333

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
             +D  R+L C    +  + + +   I       S T + F+                SP+P
Sbjct  334   SDTLRILTCDPSQNKQKGVGYFNSIG-----TSETIEGFQC---------------SPYP  373

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              VD FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+
Sbjct  374   EVDHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLK  433

Query  1435  RGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
                +YQKCHDP CK   ++S   P+P  V
Sbjct  434   NEVWYQKCHDPVCKAENFKSDCFPLPAEV  462



>ref|XP_008515501.1| PREDICTED: DNA-directed primase/polymerase protein isoform X4 
[Equus przewalskii]
Length=539

 Score =   212 bits (539),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 155/447 (35%), Positives = 221/447 (49%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQ-DHINGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q EA  + + C  +  VF+ +    +G R +LV+TY + W  YKS      H 
Sbjct  41    IWKLFYRQTEAFNFVKSCQEDVHVFALERKGGDGQRIYLVTTYTELWFYYKS-RKNLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEHVCKALQELYRVNCSTEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST++KFS HLI +L  +AFKDN HVG F  ++        +SE D+R            
Sbjct  160   SSTDEKFSCHLIFQLHDVAFKDNIHVGNFVRKILQPALHLIASEDDDRNPETMDHGFSHF  219

Query  859   ----------FRKL-----------FVSKDSKSVGIPAQ------------------LFV  921
                       F ++             SK+ + +G   Q                  LFV
Sbjct  220   SETPIKQEISFSEMSTDKDVGESWTLNSKEQERLGSAKQSSPDLSFLVVKNNKGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L    + RF   +  N+SE+ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKHVALEVAEANRFSPARSTNISEEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C +  +  + + +       F   S + +A E   F+           SP+P +
Sbjct  340   TLRILTCDISRNEQKRVEY-------FNGTSTSVEAIE--GFQC----------SPYPEI  380

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+  
Sbjct  381   DQFVLSLVNKNGIKGGIRRWNYFFLEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNE  440

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  441   VWYQKCHDPVCKAENFKSACFPLPAEV  467



>ref|XP_008409909.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Poecilia reticulata]
Length=496

 Score =   211 bits (536),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 140/432 (32%), Positives = 203/432 (47%), Gaps = 85/432 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINA-RVFSYQDHIN--GYRRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  FP+Q  A+ +A  C  A  VF+ +      G R +LV++Y + W  Y+       H
Sbjct  39    VWKLFPRQNLAISFAHSCKEAVHVFALEKEKASLGQRIYLVTSYSELWHYYRVYPQSLMH  98

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
              YEVI EG  C LYFDLEF+K +N   +G  MV LLI  V D L++ Y +E S   ++ L
Sbjct  99    CYEVIPEGAVCKLYFDLEFHKPSNKGSDGKSMVSLLIQYVCDMLVEVYGIECSVKNVLNL  158

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVS-KDSKS  894
             DSSTE+KFSRHLI  L    FKDN HVG F   +   + S  ++D R  K  +S  D++ 
Sbjct  159   DSSTEEKFSRHLIFMLQDAVFKDNIHVGRFIHAILQPVMSKLKSDSRLHKGDISLTDNRH  218

Query  895   VGIPAQ------------------------------LFVDNAVYSRNRCFRLALSSKAGK  984
               I ++                              LFVD  VY++NR FRL  SSK G+
Sbjct  219   TNIDSELTQSPDTKRQKQEVRDLSFLLVKNKDGRDGLFVDLGVYTKNRNFRLYKSSKVGR  278

Query  985   SSVLIPS--GRFKC----KNMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHFNTE  1146
             ++    +   +F      +  +E+ +F+ASL+CN+    +R+L      D   T    + 
Sbjct  279   NAAFAVAEDNQFTAEPAKEKSAEENVFLASLVCNVSFTGQRILTW----DAPETKEVKSP  334

Query  1147  IAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYW  1326
              AQS Q +         N F +D                                     
Sbjct  335   TAQSQQGLDSNQGIRRWNYFSAD-------------------------------------  357

Query  1327  FSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIP  1506
                  L+VY ++K R+CE + R HKSN++M VVDL+   +YQKCHDPDC+ +RS   P+P
Sbjct  358   ----QLLVYDIAKYRWCENVSRFHKSNNIMIVVDLKEEVWYQKCHDPDCRNFRSSSFPLP  413

Query  1507  GNVIAHCSVSFD  1542
               +     ++ D
Sbjct  414   QEICVRYILTLD  425



>ref|XP_008708708.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Ursus maritimus]
Length=557

 Score =   212 bits (540),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 152/446 (34%), Positives = 213/446 (48%), Gaps = 82/446 (18%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q  A  + + C     VF+ +  + +G R +LV+TY + W  YKS      H 
Sbjct  41    IWKLFHRQTHAFNFVKSCKEEVHVFALEYKVGDGQRIYLVTTYAELWFYYKS-RKNLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANQEADGKKMVALLIEHVCKALQELYGVHCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS---------------------  837
             SST++KFSRHLI +L  +AFKDN HVG F  ++    +                      
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASEDDDSISETTGHGFSHF  219

Query  838   --------------SSETDERFRKLFVSKDSKSVGIPAQ------------------LFV  921
                           SS+ D    +   SK+ + +G   Q                  LFV
Sbjct  220   PETPIKQGISFSEMSSDEDRGESRTRNSKEQERLGSAEQSSPDLSFLVVKNNVGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNIDADC  1083
             D  VY+RNR FRL  SSK GK   L      +F   + KN+SE+ + F++SL+ N+    
Sbjct  280   DFGVYTRNRNFRLYKSSKIGKQVALEVAEDNKFFPKQSKNISEENQYFLSSLVSNVRF--  337

Query  1084  ERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVD  1263
                      SD +R L  +T   +  +   F     +  N E           SP+P +D
Sbjct  338   ---------SDTLRILTCDTSQNKQKRVECFNSTRTKAENIEG-------YHCSPYPEID  381

Query  1264  AFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGD  1443
              FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+   
Sbjct  382   RFVLSLVNKNGIKGGIRRWSYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEV  441

Query  1444  YYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +YQKCHDP CK   ++S   P+P  V
Sbjct  442   WYQKCHDPVCKAENFKSDCFPLPAEV  467



>gb|ETM34647.1| hypothetical protein L914_18311 [Phytophthora parasitica]
Length=694

 Score =   214 bits (546),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 145/453 (32%), Positives = 222/453 (49%), Gaps = 94/453 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI----------------------NARVFSYQDHINGYRRFLV  480
             I ++FP+Q EA ++A+Q                          RVFS++   +G RRFLV
Sbjct  252   ISSSFPRQQEAFEFADQVAALRRRVKATSSASPGIGYGGDSTPRVFSFESAGDGKRRFLV  311

Query  481   STYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVF  660
             ++  +FWK YK     +RH YE+I+EG+PC LYFDLEF ++ N   +GD +V  L+  + 
Sbjct  312   ASLTEFWKNYKKTRDDQRHVYEIIREGVPCRLYFDLEFKREINLHVDGDALVARLVSLLQ  371

Query  661   DTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKI-AFKDNSHVGAFTAEVCSRIYS  837
               L ++Y L   H  I +LDSST  KFSRHLI   P    F+DN H GAF  E  + +  
Sbjct  372   LQLFRRYGLRVHHRDIYQLDSSTPAKFSRHLIFHFPDGNLFRDNLHAGAFVREFINDLVD  431

Query  838   ----SSETDERFRKLFVSKDSKSVGI-PAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIP  1002
                 +S  D+      V+ +S +  +   QLF+D  VY+RNR FR+  SSK  K ++L P
Sbjct  432   LTDYTSAPDDLLSPFLVNTESGNDPVDKKQLFIDTGVYTRNRMFRVLGSSKFKKHAILRP  491

Query  1003  SGRFKCKNMSEDE----MFMASLIC------NIDADCE----RLLVCKMDSDCVRTLHFN  1140
                    N +E E    +F+ +L+C      +++ D +    RLL C+  +   R+    
Sbjct  492   ------LNAAETELDLDLFVNTLVCPYPSLESMELDRKTKNYRLLRCESSAALQRSRKST  545

Query  1141  TEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSW  1320
                A+S    S   +                  +S +P +DAF+   A+ G V G+IR+ 
Sbjct  546   YAGAKSITSSSVECR------------------RSIYPMLDAFIRSQATTGGVQGEIRAI  587

Query  1321  YWFSEYG--------------------------LIVYSMSKNRYCERIGREHKSNHVMYV  1422
                                              +I+Y M++NR+C  I R HKSN+VM++
Sbjct  588   QMLMTSSSTVLAVLPGQEDVQEAEDNAAKPHPWMIIYHMARNRWCANIRRPHKSNNVMFI  647

Query  1423  VDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             VD+ +  +YQKCHDP C+   +RS  +P+P ++
Sbjct  648   VDIDQRVFYQKCHDPACQTIDFRSSPQPLPPHI  680



>ref|XP_004666443.1| PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain-containing 
protein 111 [Jaculus jaculus]
Length=556

 Score =   212 bits (539),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 152/444 (34%), Positives = 220/444 (50%), Gaps = 81/444 (18%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFYRQNQAFDFVKSCREDVHVFALECKVGDGQRTYLVTTYTQLWFYYKSRK-DLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L   YS+  S + ++ LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQDLYSVHCSAEDVLNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SSTE+KFS+HLI +L ++AFKDN  VG F  ++        + E+D+R            
Sbjct  160   SSTEEKFSQHLIFQLHEVAFKDNIQVGNFVRKMLQPALQLIAKESDDRIPETMDQEFSDI  219

Query  859   -------FRKLFVSKDS-KSVGIPAQ----------------------------LFVDNA  930
                      K+  +KD+ KS  + ++                            LFVD  
Sbjct  220   PLKQEISLNKISTNKDTEKSWTLNSEKPKRLESAKQTGPDLSFLVVKNNLGERHLFVDLG  279

Query  931   VYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-ADCER  1089
             VY+RNR FRL  SSK GK   L      RF     K++SE+ + F+ SL+ N+  +D  R
Sbjct  280   VYTRNRNFRLYKSSKIGKYVALEVAEDNRFFPKPSKHLSEENQYFLYSLVSNVRFSDTLR  339

Query  1090  LLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAF  1269
             +L C       + + +   I+ S + +    + F+                SP+P VD F
Sbjct  340   ILTCDTSQTKEKPVEYLNNISTSVEAI----EGFQC---------------SPYPEVDQF  380

Query  1270  VEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYY  1449
             V  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M ++DL+   +Y
Sbjct  381   VLSLVNKNGIKGGIRRWNYFVPEELLVYDICKYRWCENIGRSHKSNNIMILIDLKNEVWY  440

Query  1450  QKCHDPDCKG--YRSPLRPIPGNV  1515
             QKCHDP CK   ++S   P+P  V
Sbjct  441   QKCHDPVCKAENFKSDYFPLPAEV  464



>gb|ETL28194.1| hypothetical protein L916_18398 [Phytophthora parasitica]
Length=694

 Score =   214 bits (545),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 145/453 (32%), Positives = 221/453 (49%), Gaps = 94/453 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI----------------------NARVFSYQDHINGYRRFLV  480
             I ++FP+Q EA ++A+Q                          RVFS++   +G RRFLV
Sbjct  252   ISSSFPRQQEAFEFADQVAALRRRVKATSSASPGIGYGGDSTPRVFSFESAGDGKRRFLV  311

Query  481   STYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVF  660
             ++  +FWK YK     +RH YE+I+EG+PC LYFDLEF +  N   +GD +V  L+  + 
Sbjct  312   ASLTEFWKNYKKTRDDQRHVYEIIREGVPCRLYFDLEFKRGINLHVDGDALVARLVSLLQ  371

Query  661   DTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKI-AFKDNSHVGAFTAEVCSRIYS  837
               L ++Y L   H  I +LDSST  KFSRHLI   P    F+DN H GAF  E  + +  
Sbjct  372   LQLFRRYGLRVHHRDIYQLDSSTPAKFSRHLIFHFPDGNLFRDNLHAGAFVREFINDLVD  431

Query  838   ----SSETDERFRKLFVSKDSKSVGI-PAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIP  1002
                 +S  D+      V+ +S +  +   QLF+D  VY+RNR FR+  SSK  K ++L P
Sbjct  432   LTDYTSAPDDLLSPFLVNTESGNDPVDKKQLFIDTGVYTRNRMFRVLGSSKFKKHAILRP  491

Query  1003  SGRFKCKNMSEDE----MFMASLIC------NIDADCE----RLLVCKMDSDCVRTLHFN  1140
                    N +E E    +F+ +L+C      +++ D +    RLL C+  +   R+    
Sbjct  492   ------LNAAETELDLDLFVNTLVCPYPSLESMELDRKTKNYRLLRCESSAALQRSRKST  545

Query  1141  TEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSW  1320
                A+S    S   +                  +S +P +DAF+   A+ G V G+IR+ 
Sbjct  546   YAGAKSITSSSVECR------------------RSIYPMLDAFIRSQATTGGVQGEIRAI  587

Query  1321  YWFSEYG--------------------------LIVYSMSKNRYCERIGREHKSNHVMYV  1422
                                              +I+Y M++NR+C  I R HKSN+VM++
Sbjct  588   QMLMTSSSTVLAVLPGQEDVQEAEDNAAKPHPWMIIYHMARNRWCANIRRPHKSNNVMFI  647

Query  1423  VDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             VD+ +  +YQKCHDP C+   +RS  +P+P ++
Sbjct  648   VDIDQRVFYQKCHDPACQAIDFRSSPQPLPPHI  680



>ref|XP_008515499.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Equus przewalskii]
Length=557

 Score =   211 bits (538),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 157/448 (35%), Positives = 222/448 (50%), Gaps = 87/448 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQ-DHINGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q EA  + + C  +  VF+ +    +G R +LV+TY + W  YKS      H 
Sbjct  41    IWKLFYRQTEAFNFVKSCQEDVHVFALERKGGDGQRIYLVTTYTELWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEHVCKALQELYRVNCSTEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDER------------  858
             SST++KFS HLI +L  +AFKDN HVG F  ++        +SE D+R            
Sbjct  160   SSTDEKFSCHLIFQLHDVAFKDNIHVGNFVRKILQPALHLIASEDDDRNPETMDHGFSHF  219

Query  859   ----------FRKL-----------FVSKDSKSVGIPAQ------------------LFV  921
                       F ++             SK+ + +G   Q                  LFV
Sbjct  220   SETPIKQEISFSEMSTDKDVGESWTLNSKEQERLGSAKQSSPDLSFLVVKNNKGEKHLFV  279

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSED-EMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L    + RF   +  N+SE+ + F++SL+ N+  +D
Sbjct  280   DLGVYTRNRNFRLYKSSKIGKHVALEVAEANRFSPARSTNISEEYQYFLSSLVSNVRFSD  339

Query  1081  CERLLVCKMD-SDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPP  1257
               R+L C +  ++  R  +FN          + T +A E   F+           SP+P 
Sbjct  340   TLRILTCDISRNEQKRVEYFNG---------TSTSEAIE--GFQC----------SPYPE  378

Query  1258  VDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRR  1437
             +D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+ 
Sbjct  379   IDQFVLSLVNKNGIKGGIRRWNYFFLEELLVYDICKYRWCENIGRAHKSNNIMILVDLKN  438

Query  1438  GDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
               +YQKCHDP CK   ++S   P+P  V
Sbjct  439   EVWYQKCHDPVCKAENFKSACFPLPAEV  466



>ref|XP_004349736.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW43178.1| hypothetical protein CAOG_01222 [Capsaspora owczarzaki ATCC 30864]
Length=651

 Score =   213 bits (542),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 149/451 (33%), Positives = 216/451 (48%), Gaps = 62/451 (14%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQ--DHINGYRRFLVSTYEDFWKRYKSMNPKRRH  537
             +W  FPKQ  A  +A  C +   VF+++  +   G R+FLV++Y +FW  Y  +   +RH
Sbjct  109   VWRIFPKQDMAFAFAGSCFHKVHVFAFEAPNFTAGRRKFLVTSYAEFWHVYSQLLSDQRH  168

Query  538   HYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVEL  717
             +YEVI +G  C  YFD+EFN   N   +G + +D +  A      + +S+  + D I++L
Sbjct  169   YYEVIPDGCVCKAYFDVEFNASLNPTLDGCKAIDAIQYA----FRKWFSITVARDQILDL  224

Query  718   DSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEV-----CSRIYSSSE------------  846
             DS+T+ KFSRHLI+ LP  AF+ N HVG F   +     C R   S+             
Sbjct  225   DSTTQAKFSRHLIVNLPGAAFQSNEHVGLFVEWLAGQAECWRTDPSTMPAEVGIGADEVE  284

Query  847   -----TDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGR  1011
                  TD+  R L V +  K V +   +     VYSRNR FR+ LSSK GK   L+ S +
Sbjct  285   VLFACTDKGTRTLMVDR-GKRVAVEWWM----CVYSRNRNFRIYLSSKQGKRVRLVASEQ  339

Query  1012  FKCKNMSEDEMFMASLICNIDADCERLLVCKMDSDCVRTLHF---------NTEIAQSFQ  1164
                +     E  +  ++ +  A     L  K+ S   R  H          N   +Q  +
Sbjct  340   -NSRIPKSSETGLPMVVPSTPASLTATLPEKVWSASERAFHHAVFLDSLICNVPFSQGVR  398

Query  1165  QMSF--TPQAFELNNFESDPSRTYLMGK---------SPFPPVDAFVEYIASVGSVPGKI  1311
              +S+     A     F +  S T              SP+P VDAF+   AS    P ++
Sbjct  399   ILSWPGASAAPRRKAFTAATSSTVGGANVRTSQGEASSPYPAVDAFILNAASAMGPPARL  458

Query  1312  RSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSP  1491
             R W  FSE   ++Y +S NR+C  I REHKSN V YVVDL    + Q+C+DPDC+G+RS 
Sbjct  459   RRWIHFSESMCLLYDISGNRWCHNIDREHKSNGVYYVVDLSSRTWSQRCYDPDCRGFRSA  518

Query  1492  LRPIPGNVIAHCSVSFDLDSNNEGREHTPVA  1584
                +P +V+     S       EGR    +A
Sbjct  519   TSVLPNDVLQASGAS-------EGRSRDGIA  542



>ref|XP_006916435.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X1 [Pteropus alecto]
 ref|XP_006916436.1| PREDICTED: coiled-coil domain-containing protein 111 isoform 
X2 [Pteropus alecto]
Length=553

 Score =   211 bits (537),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 152/443 (34%), Positives = 212/443 (48%), Gaps = 79/443 (18%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +W  F +Q EA  + + C  +  VF+ +  + +G R +LV+TY  FW  YKS      H 
Sbjct  41    VWKLFHRQTEAFNFVKNCKEDVHVFALEYKVGDGQRIYLVTTYVQFWFYYKS-RKNLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G  MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKLANPEADGKMMVALLIEHVCKALQELYRVNCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVC-----------------SRIYSSSET  849
             SST++KFSRHLI +L  +AFKDN HVG F  ++                  +R+   SE 
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVKKILQPASHLIAGESDDGIPETRVSHFSEI  219

Query  850   DER----FRKL-----------FVSKDSKSVGIPAQ------------------LFVDNA  930
               +    F K+             SK  + +G   Q                  LFVD  
Sbjct  220   PVKQGISFSKMSTGNDRGESWTLNSKKLERLGSAKQSDPDLSFLVVKNTIGKKHLFVDLG  279

Query  931   VYSRNRCFRLALSSKAGKSSVL--IPSGRFKCKN---MSEDEMFMASLICNID-ADCERL  1092
             VY+RNR FRL  SSK GK   L      +F         E++ F++SLI N+  +D  R+
Sbjct  280   VYTRNRNFRLYKSSKIGKPVALEVAEDNKFSLTQSDISEENQYFLSSLISNVRFSDTLRI  339

Query  1093  LVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFV  1272
             L C    +            +  Q   F+  +  + N E           SP+P +D FV
Sbjct  340   LTCDTSQE-----------NKQKQVEYFSSTSTSVENIEG-------FQGSPYPEIDEFV  381

Query  1273  EYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQ  1452
               + +   + G IR W +F    L+VY + K R+C  IGR HKSN++M +VDL+   +YQ
Sbjct  382   LSLVNKNGIKGGIRHWNYFFPEELLVYDICKYRWCGNIGRAHKSNNIMILVDLKNEVWYQ  441

Query  1453  KCHDPDCKG--YRSPLRPIPGNV  1515
             KCHDP CK   ++S   P+P  V
Sbjct  442   KCHDPVCKAENFKSNRFPLPAEV  464



>ref|XP_008248743.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Oryctolagus cuniculus]
Length=551

 Score =   211 bits (537),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 155/449 (35%), Positives = 216/449 (48%), Gaps = 89/449 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q EA  + + C  +  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFRRQTEAFNFVKSCKQDVHVFALEYKMGDGQRIYLVTTYAQLWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L   YS+  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEHVCRALQDLYSVRCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS---RIYSSSETD-------------  852
             SST++KFSRHLI +L  +AFKDN HVG F   +     ++ +S + D             
Sbjct  160   SSTDEKFSRHLIFQLHDVAFKDNIHVGNFVRTILQPALQLIASEDDDSISETVDQGFSHF  219

Query  853   ----------------------------ERFRKLFVSKDS----------KSVGIPAQLF  918
                                         E+ R+L  +K S           +VG    LF
Sbjct  220   SEAPTKQGASYNKMSPDKDTGESWTLNSEKPRRLGSAKQSDPDLSFLVVKNNVG-EKHLF  278

Query  919   VDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRFKCKNM----SEDEMFMASLICNID-A  1077
             VD  VY+RNR F L  SSK GK   L      +F  K       E++ F++S +CN+  +
Sbjct  279   VDLGVYTRNRNFWLYKSSKLGKHVALEIAEDNKFFPKQSKTIPEENQYFLSSFVCNVRFS  338

Query  1078  DCERLLVCKMDSDCVRTL-HFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
             D  R+L C    +  + + HFN+         S T + F+                SP+P
Sbjct  339   DTLRILTCDTPQNKRKRMKHFNS------TSPSGTIEGFQC---------------SPYP  377

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              VD FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VDL+
Sbjct  378   EVDQFVLSLVTKNDIKGGIRRWSYFFPEQLLVYDIFKYRWCENIGRAHKSNNIMILVDLK  437

Query  1435  RGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
                +YQKCHDP CK   +++   P+P  V
Sbjct  438   NEVWYQKCHDPICKAENFKTDCLPLPAEV  466



>ref|XP_009573928.1| PREDICTED: DNA-directed primase/polymerase protein [Fulmarus 
glacialis]
Length=581

 Score =   211 bits (538),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 161/455 (35%), Positives = 219/455 (48%), Gaps = 87/455 (19%)
 Frame = +1

Query  355   LSQEIWATFPKQVEAMKYAEQCI-NARVFSYQDHINGYRRF-LVSTYEDFWKRY-KSMNP  525
             L   +W  F +Q EA  Y + C  +  VF+ + +I   +RF LV+TY++ W  Y K    
Sbjct  37    LPSSVWKIFCRQAEAFNYVKTCKEDVHVFALEKNIQSGKRFYLVTTYKELWFYYTKGYKT  96

Query  526   KRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDW  705
                H YEVI E   C LYFDLEF K AN   +G  MV  LI  V   L + Y +  S   
Sbjct  97    SLMHCYEVIPEKDACKLYFDLEFYKPANPGADGKSMVAKLIELVSQKLKELYDVNCSAKD  156

Query  706   IVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFT--------------------AEVCS  825
             ++ LDSST++KFSRHLI    K  FKDN+HVG F                      E   
Sbjct  157   VLNLDSSTDEKFSRHLIFLPQKTVFKDNTHVGNFVRTILQPAVRLRESKAAVVIPEEGAG  216

Query  826   RIYSSSE----TDERFRKLFVSKDSKSVGIPA----------------------------  909
              I+  S      D     L   +D+ S G PA                            
Sbjct  217   HIFQCSAEAVGLDGSLTNLTAVEDA-SKGWPAVARETKDTETSHQGENLEFSFLLVNDKE  275

Query  910   ---QLFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF--KCK-NMS-EDEMFMASLI  1062
                QLFVD  VY+RNR FR+  SSKAGK+ +L      +F   C+ N+S E+  F++SLI
Sbjct  276   GDKQLFVDLGVYTRNRNFRMYKSSKAGKNVILKIAEDNKFVPNCEENVSLEEAYFLSSLI  335

Query  1063  CNIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMG-  1239
             CNI A        K D+           ++  F +      AF LN+  +  SR  + G 
Sbjct  336   CNIRA--------KDDTKV---------LSSGFSEEEREMSAF-LNSKTTRSSRDSMEGY  377

Query  1240  -KSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
               SP+P +D FV  + +  SV G IR W +FS   ++VY +   R+CE IGR HKSN++M
Sbjct  378   QDSPYPEIDYFVRSLVNKDSVQGGIRRWNYFSLEEILVYDIFGYRWCENIGRAHKSNNIM  437

Query  1417  YVVDLRRGDYYQKCHDPDC--KGYRSPLRPIPGNV  1515
              +VDL++  +YQKCHDP C  K ++S   P+P  +
Sbjct  438   ILVDLKKEVWYQKCHDPVCREKNFKSQSFPLPPRI  472



>gb|ETO63209.1| hypothetical protein F444_19026 [Phytophthora parasitica P1976]
Length=694

 Score =   213 bits (543),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 145/453 (32%), Positives = 221/453 (49%), Gaps = 94/453 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI----------------------NARVFSYQDHINGYRRFLV  480
             I ++FP+Q EA ++A+Q                          RVFS++   +G RRFLV
Sbjct  252   ISSSFPRQQEAFEFADQVAALRRRVKATSSASPGIGYGGDSTPRVFSFESAGDGKRRFLV  311

Query  481   STYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVF  660
             ++  +FWK YK     +RH YE+I+EG+PC LYFDLEF +  N   +GD +V  L+  + 
Sbjct  312   ASLTEFWKNYKKTRDDQRHVYEIIREGVPCRLYFDLEFKRGINLHVDGDALVARLVSLLQ  371

Query  661   DTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIA-FKDNSHVGAFTAEVCSRIYS  837
               L ++Y L   H  I +LDSST  KFSRHLI   P  + F+DN H GAF  E  + +  
Sbjct  372   LQLFRRYGLRVHHRDIYQLDSSTPAKFSRHLIFHFPDGSLFRDNLHAGAFVREFINDLVD  431

Query  838   ----SSETDERFRKLFVSKDSKSVGI-PAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIP  1002
                 +S  D+      V+ +S +  +   QLF+D  VY+RNR FR+  SSK  K ++L P
Sbjct  432   LTDYTSAPDDLLSPFLVNTESGNDPVDKKQLFIDTGVYTRNRMFRVLGSSKFKKHAILRP  491

Query  1003  SGRFKCKNMSEDE----MFMASLIC------NIDADCE----RLLVCKMDSDCVRTLHFN  1140
                    N +E E    +F+ +L+C      +++ D +    RLL C+      R+    
Sbjct  492   ------LNAAETELDLDLFVNTLVCPYPSLESMELDRKTKNYRLLRCESSVVLQRSRKST  545

Query  1141  TEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSW  1320
                A+S    S   +                  +S +P +DAF+   A+ G V G+IR+ 
Sbjct  546   YAGAKSITSSSVECR------------------RSIYPMLDAFIRSQATTGGVQGEIRAI  587

Query  1321  YWFSEYG--------------------------LIVYSMSKNRYCERIGREHKSNHVMYV  1422
                                              +I+Y M++NR+C  I R HKSN+VM++
Sbjct  588   QMLMTSSSTVLAVLPGQEDVQEAEDNAAKPHPWMIIYHMARNRWCANIRRPHKSNNVMFI  647

Query  1423  VDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             VD+ +  +YQKCHDP C+   +RS  +P+P ++
Sbjct  648   VDIDQRVFYQKCHDPACQAIDFRSSPQPLPPHI  680



>ref|XP_005226028.1| PREDICTED: DNA-directed primase/polymerase protein isoform X3 
[Bos taurus]
Length=474

 Score =   208 bits (530),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 157/450 (35%), Positives = 220/450 (49%), Gaps = 91/450 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C     VF+ +  + +G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTQAFNFVKSCKQEVHVFALECKVGDGQRIYLVTTYTQLWFYYKS----RRNL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y++  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQEFYTVNCSAEDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY-------------------  834
              LDSSTE+KFSRHLI +L  +AFKDN HVG F  ++    +                   
Sbjct  157   NLDSSTEEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASEDEDMTPETTGHEF  216

Query  835   -----SSSETDERFRKLFV------SKDSKS-----VGIPAQ-------LFVDN------  927
                  + SE    F K+        S+ S S     +G   Q       L V N      
Sbjct  217   THFSETPSEQGTCFSKMSTDIDVGESQTSNSEKLGRLGSAQQSSPDLSFLIVKNDMGEKR  276

Query  928   -----AVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNID  1074
                   VY+RNR FRL  SSK GK   L      +F   + KN+S E++ F++SL+ N+ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKYVALEVAEDNKFFPIQSKNISKENQYFLSSLVSNVR  336

Query  1075  -ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
              +D  R+L C +     R         Q F +   + +A E   F+           SP+
Sbjct  337   FSDALRILTCDVPQSKQR--------VQCFSRTGTSVEAIE--GFQC----------SPY  376

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P +D FV  + +   + G IR W +F    L+VY + K R+CE IGR H+SN++M +VDL
Sbjct  377   PEIDQFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHRSNNIMILVDL  436

Query  1432  RRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +   +YQKCHDP CK   ++S   P+P  V
Sbjct  437   KNEVWYQKCHDPVCKAENFKSDCFPLPAEV  466



>ref|XP_006882341.1| PREDICTED: coiled-coil domain-containing protein 111 [Elephantulus 
edwardii]
Length=564

 Score =   210 bits (535),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 149/447 (33%), Positives = 215/447 (48%), Gaps = 84/447 (19%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q +A  +A+ C  +  VF+ +  + +G R +LV+TY  FW  YKS      H 
Sbjct  50    IWKLFHRQTQAFHFAKTCKEDVHVFALEYKVGDGKRIYLVTTYVQFWFYYKSRK-TLLHC  108

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEF+K AN   +G +MV LLI  V   L + Y +E S + +  LD
Sbjct  109   YEVIPENSVCKLYFDLEFSKPANPGADGQKMVALLIEHVCKALKELYHVECSSEDVFNLD  168

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS---RIYSSSETD-------------  852
             SS++ KFSRHL+ +L  +AFKDN HVG F  ++     R+ +S   D             
Sbjct  169   SSSDKKFSRHLVFQLHDVAFKDNIHVGNFVRKILQPAFRLIASEGDDMIQETTHHECSHI  228

Query  853   ----------------------------ERFRKLFVSKDS---------KSVGIPAQLFV  921
                                         E+  +L  +++          K+      LFV
Sbjct  229   SEALIEPGPSLSTTTTEKEREETWTLNPEKLERLGATEEGSPDLSFLVVKNDTGEKHLFV  288

Query  922   DNAVYSRNRCFRLALSSKAGKSSVL--IPSGRFKCKN----MSEDEMFMASLICNID-AD  1080
             D  VY+RNR FRL  SSK GK   L      RF  K       E++ F++SL+ N+  +D
Sbjct  289   DLGVYTRNRNFRLYKSSKIGKHIALEVAKDNRFSPKQSESICEENQYFLSSLVSNVRYSD  348

Query  1081  CERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPV  1260
               R+L C    +  R + +      S   M    + F+                SP+P +
Sbjct  349   TLRILTCDSPQNTQRQVEYFNHNGTSADTM----EGFQC---------------SPYPEI  389

Query  1261  DAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRG  1440
             D FV  + +   + G IR W +F    L+VY +SK R+CE +GR HKSN++M ++DL+  
Sbjct  390   DHFVLSLVNKYGIQGGIRRWSYFFPEELLVYDISKYRWCENVGRAHKSNNIMILIDLKNE  449

Query  1441  DYYQKCHDPDCKG--YRSPLRPIPGNV  1515
              +YQKCHDP CK   ++S   P+P  V
Sbjct  450   VWYQKCHDPVCKAENFKSNCFPLPPEV  476



>ref|XP_003133387.2| PREDICTED: coiled-coil domain-containing protein 111-like [Sus 
scrofa]
Length=554

 Score =   210 bits (535),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 155/451 (34%), Positives = 221/451 (49%), Gaps = 94/451 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C  +  VF+ +  + +G R +LV+TY + W  YKS    RR  
Sbjct  41    IWKLFHRQSQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYTELWYYYKS----RRNL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + Y +  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNKLANPEADGKKMVALLIEHVCKALQEFYGVNCSAEDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY-------------------  834
              LDSST +KFSRHLI +L  +AFKDN HVG F  ++    +                   
Sbjct  157   NLDSSTNEKFSRHLIFQLHDVAFKDNVHVGNFVKKILQPAFHLLAGEDDDMIPETVDHGF  216

Query  835   --------------SSSETD-----------ERFRKLFVSKDS---------KSVGIPAQ  912
                           S + TD           E+  +L  +K S         K+      
Sbjct  217   SHFPGTQVKQGISLSETSTDKDIGESWSLNSEKLERLGAAKQSSPDLSFLVVKNNTGEKH  276

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRFK---CKNMS-EDEMFMASLICNID  1074
             LFVD  VY+RNR FRL  SSK GK   L      RF+    KN+S E++ F++SL+ N+ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKYVALEVAEDNRFRPIQSKNVSMENQYFLSSLVSNVR  336

Query  1075  -ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFE-LNNFESDPSRTYLMGKSP  1248
              +D  R+L C +               + F+  + T  + E +  F+           SP
Sbjct  337   FSDTLRILTCDIPQQ------------KRFEYFNSTNTSVETIEGFQC----------SP  374

Query  1249  FPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVD  1428
             +  +D FV  + +   + G IR W +F    L+VY + K R+CE IGR HKSN++M +VD
Sbjct  375   YFEIDQFVLSLVNKNDIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVD  434

Query  1429  LRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             L+   +YQKCHDP CK   ++S   P+P  V
Sbjct  435   LKNEVWYQKCHDPVCKAENFKSNCFPLPPEV  465



>gb|ETP32454.1| hypothetical protein F442_18855 [Phytophthora parasitica P10297]
Length=694

 Score =   213 bits (541),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 145/453 (32%), Positives = 220/453 (49%), Gaps = 94/453 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI----------------------NARVFSYQDHINGYRRFLV  480
             I ++FP+Q EA ++A+Q                          RVFS++   +G RRFLV
Sbjct  252   ISSSFPRQQEAFEFADQVAALRRRVKATSSASPGIGYGGDSTPRVFSFESAGDGKRRFLV  311

Query  481   STYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVF  660
             ++  +FWK YK     +RH YE+I+EG+PC LYFDLEF +  N   +GD +V  L+  + 
Sbjct  312   ASLTEFWKNYKKTRDDQRHVYEIIREGVPCRLYFDLEFKRGINLHVDGDALVARLVSLLQ  371

Query  661   DTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKI-AFKDNSHVGAFTAEVCSRIYS  837
               L ++Y L   H  I +LDSST  KFSRHLI   P    F+DN H GAF  E  + +  
Sbjct  372   LQLFRRYGLRVHHRDIYQLDSSTPAKFSRHLIFHFPDGNLFRDNLHAGAFVREFINDLVD  431

Query  838   ----SSETDERFRKLFVSKDSKSVGI-PAQLFVDNAVYSRNRCFRLALSSKAGKSSVLIP  1002
                 +S  D+      V+ +S +  +   QLF+D  VY+RNR FR+  SSK  K ++L P
Sbjct  432   LNDYTSAPDDLLSPFLVNTESGNDPVDKKQLFIDTGVYTRNRMFRVLGSSKFKKHAILRP  491

Query  1003  SGRFKCKNMSEDE----MFMASLIC------NIDADCE----RLLVCKMDSDCVRTLHFN  1140
                    N +E E    +F+ +L+C      +++ D +    RLL C+      R+    
Sbjct  492   ------LNAAETELDLDLFVNTLVCPYPSLESMELDRKTKNYRLLRCESSVVLQRSRKST  545

Query  1141  TEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSW  1320
                A+S    S   +                  +S +P +DAF+   A+ G V G+IR+ 
Sbjct  546   YAGAKSITSSSVECR------------------RSIYPMLDAFIRSQATTGGVQGEIRAI  587

Query  1321  YWFSEYG--------------------------LIVYSMSKNRYCERIGREHKSNHVMYV  1422
                                              +I+Y M++NR+C  I R HKSN+VM++
Sbjct  588   QMLMTSSSTVLAVLPGQEDVQEAEDNAAKPHPWMIIYHMARNRWCANIRRPHKSNNVMFI  647

Query  1423  VDLRRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             VD+ +  +YQKCHDP C+   +RS  +P+P ++
Sbjct  648   VDIDQRVFYQKCHDPACQAIDFRSSPQPLPPHI  680



>ref|XP_003486917.1| PREDICTED: coiled-coil domain-containing protein 111-like [Bombus 
impatiens]
Length=445

 Score =   207 bits (527),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 136/401 (34%), Positives = 210/401 (52%), Gaps = 42/401 (10%)
 Frame = +1

Query  364   EIWATFPKQVEAMKYAEQCINAR----VFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKR  531
             + W  F KQV+A+  A +  N       F YQ+  NGYR+F+V+  E +W  Y+ +  +R
Sbjct  49    DFWMKFDKQVDALNTASKESNDYNMLCTFVYQE-CNGYRKFIVAHPEIYWWHYEHLPAER  107

Query  532   RHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
             R  YE+I E  PC LY DLE++ + N++ +G  M ++LI      LL+ + +  +   ++
Sbjct  108   RCSYEIIPENQPCRLYLDLEYSIELNSEHDGPSMTNILIDIFCMYLLKHWRIICNRYNVI  167

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSK  891
              LDSST++KFSRH+I  +  +AF+DN HVG     +C  I     + E+   +    D  
Sbjct  168   NLDSSTDEKFSRHVIFNIRDVAFRDNYHVGRLVKSICMDILDYVSSKEKQHDILTCFDRM  227

Query  892   SV-GIPAQ------LFVDNAVYSRNRCFRLALSSKAGKSSVLIPSG--RFKCK---NMSE  1035
              + G+  +      LFVD AVY++NR FR+  S+K GK S L+ S   ++ C    N +E
Sbjct  228   QLEGLIVETKKGKRLFVDTAVYTKNRHFRIYKSTKWGKQSNLVVSNDCKYICSSAYNDNE  287

Query  1036  DEMFMASLICNIDADCERLLVCKMDSDCV-RTLHFNTEIAQSFQQMSFTPQAFELNNFES  1212
               +F+ SLI   D   + L++ +   +CV  T  F   + Q   Q S +           
Sbjct  288   LSIFLDSLISYFDTK-KGLILLEWSGNCVPNTNCFKDRVQQCSYQESGS-----------  335

Query  1213  DPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGR  1392
                       S FP +D +V  + S    PGKIR    +    ++VY     RYCE IGR
Sbjct  336   --------ACSNFPMLDKYVNNLIS----PGKIRICKHYEYAKILVYETVGYRYCENIGR  383

Query  1393  EHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNV  1515
              HKSN+V+++V+L+    YQKCHDPDC G++S  + +P  +
Sbjct  384   CHKSNNVLWIVNLKNKMIYQKCHDPDCFGFKSQPKQLPEEI  424



>ref|XP_006263936.1| PREDICTED: coiled-coil domain-containing protein 111 [Alligator 
mississippiensis]
Length=578

 Score =   210 bits (535),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 153/448 (34%), Positives = 218/448 (49%), Gaps = 94/448 (21%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             +W  FP+Q +A  Y + C     VF+ + +  +G R +LV+TY + W  YK       H 
Sbjct  41    VWKIFPRQAQAFDYVKTCKEEVHVFALEKNTEDGQRFYLVTTYIELWFYYKGQKSSLFHC  100

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI+E   C LYFDLEF K  N   +G  MV  LI      L ++Y ++ S + ++ LD
Sbjct  101   YEVIREKAVCKLYFDLEFYKPVNPGADGKMMVAQLIELFCKNLEERYGVKCSANDVLNLD  160

Query  721   SSTEDKFSRHLIIRLPKIAFKDN-------------------------------SHV---  798
             SST++KFS HLI  L K AFKDN                                HV   
Sbjct  161   SSTDEKFSHHLIFLLHKTAFKDNIHVGNFVRRVLQPALRLTKTKAAAVIPEEEIGHVFQS  220

Query  799   ---------------------GAFTAEVCSRIYS-SSETDERFRKLFVSKDSKSVGIPAQ  912
                                  G++ +  C  + + +S+  E+    F+  + K  G  +Q
Sbjct  221   SKATAELNGSPVNSVAVTNASGSWQSCTCKTLDTETSQQKEKSEFSFLVVNDKDGG--SQ  278

Query  913   LFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRFKCK---NMS-EDEMFMASLICNI-  1071
             LFVD  VY++NR FRL  SSK+G+  +L      +F  K   N+S E++ F++SL+CNI 
Sbjct  279   LFVDMGVYTKNRNFRLYKSSKSGRHVILEIAEDNKFVPKLKENISVEEQYFLSSLVCNIR  338

Query  1072  DADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
              +D E++L C  + D  R    +  I                    +DP   Y    SP+
Sbjct  339   SSDIEKILTCD-NPDEKRGTSMHLSIL-------------------TDPIEGYHY--SPY  376

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P VD FV  + +   V G IR W +FS   L+VY +S+ R+CE IGR HKSN++M ++DL
Sbjct  377   PEVDRFVLSLVNKDGVQGGIRHWNYFSLEELLVYDISRYRWCENIGRAHKSNNIMILIDL  436

Query  1432  RRGDYYQKCHDPDC-----KGYRSPLRP  1500
             +R  +YQKCHDP C     K  RSPL P
Sbjct  437   KREVWYQKCHDPVCRAENFKSKRSPLPP  464



>ref|XP_009517785.1| hypothetical protein PHYSODRAFT_310394 [Phytophthora sojae]
 gb|EGZ30510.1| hypothetical protein PHYSODRAFT_310394 [Phytophthora sojae]
Length=697

 Score =   213 bits (541),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 144/454 (32%), Positives = 221/454 (49%), Gaps = 95/454 (21%)
 Frame = +1

Query  346   QKKLSQEIWATFPKQVEAMKYAEQCIN----------------------ARVFSYQDHIN  459
             Q + +  I ++FP+Q EA ++A+Q                          RVFS++   +
Sbjct  247   QLEGTAPISSSFPRQHEAFEFADQVAALRRRVKASRGVSGYVGPDDERVPRVFSFESAGD  306

Query  460   GYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVD  639
             G RRFLV+++ +FWK YK     +RH YE+I+EG PC LYFDLE  +  N   +GD +V 
Sbjct  307   GKRRFLVASFAEFWKNYKKTRVDQRHVYEIIREGTPCRLYFDLELKRAINPHVDGDSLVT  366

Query  640   LLIVAVFDTLLQKYSLEGSHDWIVELDSSTEDKFSRHLIIRLPKIA-FKDNSHVGAFTAE  816
              L+  +   L ++Y +      I +LDSST  KFSRHLI  LP  A F DN H GAF  E
Sbjct  367   RLVSLLQLQLYRRYGIHTHLGSIYQLDSSTPAKFSRHLIFHLPDGALFVDNLHAGAFVRE  426

Query  817   VCSRI--YSSSETDER-----FRKLFVSKDSKSVGI-PAQLFVDNAVYSRNRCFRLALSS  972
               S +  +S  ++D+R     F    ++ +S+   +   QLF+D  VY+RNR FR+  SS
Sbjct  427   FISDLVAFSGDDSDDREAHDLFTPFLINTESQDDPVDKKQLFIDTGVYTRNRMFRVLGSS  486

Query  973   KAGKSSVLIPSGRFKCKNMSEDE----MFMASLIC----------NIDADCERLLVCKMD  1110
             K  K+++L P       + + DE    +F+ +L+C          N      RLL C+  
Sbjct  487   KFKKNAILRP---LNASSSTPDELNQDLFVNTLVCPYPSLEAMEMNQPTIRRRLLRCEPS  543

Query  1111  SDCV-RTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIAS  1287
                + R+  F T  + S                ++ PS +    +S +P +D F+  I++
Sbjct  544   PTALGRSKRFTTSRSTS----------------KTLPSSSVECRRSIYPALDTFIRSIST  587

Query  1288  VGSVPGKIRSWYWF-------------------SEYG-----------LIVYSMSKNRYC  1377
              G V G+IR+                        + G           +I+Y M++NR+C
Sbjct  588   TGGVQGEIRAIQMLMANNSAMLAVLPGQQPNQEEQTGDTTTAAQAYPWMIIYHMARNRWC  647

Query  1378  ERIGREHKSNHVMYVVDLRRGDYYQKCHDPDCKG  1479
               I R HKSN+VM++VD+ +  +YQKCHDP C+ 
Sbjct  648   ANIRRPHKSNNVMFIVDIDQRVFYQKCHDPACQA  681



>emb|CCI50665.1| unnamed protein product [Albugo candida]
Length=350

 Score =   204 bits (520),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 130/367 (35%), Positives = 185/367 (50%), Gaps = 55/367 (15%)
 Frame = +1

Query  430   RVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHHYEVIQEGLPCHLYFDLEFNKKAN  609
             +VFS++DH  G R+FLV+T   FW++Y+ +   RRH YE+I + +PC LYFDLEF+K  N
Sbjct  15    KVFSFEDHDTGRRQFLVTTLSKFWQQYRPVGSDRRHVYEIIPKDVPCRLYFDLEFSKTLN  74

Query  610   ADKNGDEMVDLLIVAVFDTLLQKY-------SLEGSHDWIVELDSSTEDKFSRHLIIRLP  768
                NGD++V  L+     +LL+ Y       ++E +H  I++LDSSTE+KFSRHL+IR+P
Sbjct  75    PGVNGDQLVQRLL-----SLLRMYLYCDFFAAVENTH--IIQLDSSTEEKFSRHLVIRMP  127

Query  769   K-IAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIPAQLFVDNAVYSRN  945
                 F++N HVG                    +K F  +            VD  VY+RN
Sbjct  128   HDQLFQNNLHVG---------------NRYNLQKTFSLRKKSQGQYTDHSLVDLGVYTRN  172

Query  946   RCFRLALSSKAGKSSVLIPSGRFKCKNMSEDEMFMASLICNIDADCERLLVCKMDSDCVR  1125
             R FR+  SSK GKS++L      K         F ++L+C +  D     +      C R
Sbjct  173   RMFRILGSSKFGKSAILRFHSHSKSVESITQHEFCSTLVCPVQRDHFHPFL-----RCDR  227

Query  1126  TLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDAFVEYIASVGSVPG  1305
               HF +            P      +       T L  +S FP +DAF+  I+  G V G
Sbjct  228   RRHFGS-----------LPTYLSGRDLTRSNQTTDLYSESMFPHLDAFIRSISQQGGVQG  276

Query  1306  KIRSWYWFSEY---------GLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDYYQKC  1458
             +IR      +            ++Y M+ NRYC RI R HKSN+VM++VD  +  YYQKC
Sbjct  277   EIRMVQCIYDSTSQNPSNWPNKLIYHMTHNRYCHRIQRSHKSNNVMWIVDTFQQYYYQKC  336

Query  1459  HDPDCKG  1479
             HDP+C  
Sbjct  337   HDPECHA  343



>ref|XP_009509499.1| PREDICTED: DNA-directed primase/polymerase protein [Phalacrocorax 
carbo]
Length=579

 Score =   209 bits (533),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 156/451 (35%), Positives = 219/451 (49%), Gaps = 87/451 (19%)
 Frame = +1

Query  355   LSQEIWATFPKQVEAMKYAEQCI-NARVFSYQ-DHINGYRRFLVSTYEDFWKRY-KSMNP  525
             L   +W  FP+Q EA  Y + C  +  VF+ + +  +G R +LV+TY++ W  Y K+   
Sbjct  37    LPSSVWKIFPRQAEAFNYVKTCKEDVHVFALEKNRQSGQRFYLVTTYKELWFYYTKNYKT  96

Query  526   KRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDW  705
                H YEVI E   C LYFDLEF K AN   +G  MV  LI  V   L + Y +  S   
Sbjct  97    SLMHCYEVIPEKGACKLYFDLEFYKPANPGTDGKSMVAKLIELVSQKLKELYDVNCSAKD  156

Query  706   IVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS---RIYSSSET---------  849
             ++ LDSST++KFSRHLI    K  FKDN HVG F   +     R+  S            
Sbjct  157   VLNLDSSTDEKFSRHLIFLPQKTVFKDNIHVGNFVRTILQPAIRLMESEAAAVISEGAGC  216

Query  850   -----------DERFRKLFVSKDSKSVGIPA-----------------------------  909
                        D     L   +D+ S G PA                             
Sbjct  217   VFQCSAEAVGLDSSLTNLTAVEDA-SKGWPAIARKTEDMETSHQGENAEFSFLIVNDKQG  275

Query  910   --QLFVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF--KCK-NMS-EDEMFMASLIC  1065
               QLFVD  VY+RNR FR+  SSKAGK+ +L      +F   C+ N+S E+  F++SL+C
Sbjct  276   DKQLFVDLGVYTRNRNFRMYKSSKAGKNVILKIAEDNKFVPNCEENVSLEEAYFLSSLVC  335

Query  1066  NIDADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMG--  1239
             NI          +M  D   T   +++ ++  +  +F      LNN  +   R  + G  
Sbjct  336   NI----------RMKDD---TKVLSSDFSEERKMSAF------LNNKTTRSIRDPMEGYQ  376

Query  1240  KSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMY  1419
              SP+P +D FV  + +   V G IR W +FS   ++VY +   R+CE IGR HKSN++M 
Sbjct  377   DSPYPEIDYFVRSLVNKDGVQGGIRRWNYFSLEEILVYDIYGYRWCENIGRAHKSNNIMI  436

Query  1420  VVDLRRGDYYQKCHDPDC--KGYRSPLRPIP  1506
             +VDL++  +YQKCHDP C  K ++S   P+P
Sbjct  437   LVDLKKEVWYQKCHDPVCREKNFKSQSFPLP  467



>ref|XP_005698770.1| PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain-containing 
protein 111 [Capra hircus]
Length=556

 Score =   209 bits (531),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 155/450 (34%), Positives = 215/450 (48%), Gaps = 90/450 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C     VF+ +  + +G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTQAFNFVKSCKQEVHVFALECKVGDGQRIYLVTTYAQLWFYYKS----RRNL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y++  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQEFYTVNCSAEDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY-------------------  834
              LDSSTE+KFSRHLI +L  +AFKDN HVG F  ++    +                   
Sbjct  157   NLDSSTEEKFSRHLIFQLRDVAFKDNVHVGNFVRKILQPAFHLIASEDDDMTPETTGCEF  216

Query  835   --------------SSSETDERFRKLFVSKDSK--SVGIPAQ-------LFVDN------  927
                           S   TD    K   S   K   +G   Q       L V N      
Sbjct  217   THFSETASEQGTCSSKMSTDNDVGKSGTSNSEKLGRLGSAQQSSPGLSFLIVKNDMGEKR  276

Query  928   -----AVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNID  1074
                   VY+RNR FRL  SSK GK   L      RF   + +++S E++ F+ASL+ N+ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKRVALEVAEDNRFFPVQSRDISKENQYFLASLVSNVR  336

Query  1075  -ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
              +D  ++L C       R L F    + + +    T + F+                SP+
Sbjct  337   FSDALQVLTCDTPQSNQRLLXFIINFSVALE----TIEGFQC---------------SPY  377

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P VD FV  + +   + G IR W +F    L+VY + K R+CE IGR H+SN++M +VDL
Sbjct  378   PEVDQFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHRSNNIMILVDL  437

Query  1432  RRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +   +YQKCHDP CK   ++S   P+P  V
Sbjct  438   KNEVWYQKCHDPVCKAENFKSDCFPLPAEV  467



>ref|XP_007099074.1| PREDICTED: DNA-directed primase/polymerase protein [Panthera 
tigris altaica]
Length=556

 Score =   209 bits (531),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 152/445 (34%), Positives = 212/445 (48%), Gaps = 81/445 (18%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCI-NARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRRHH  540
             IW  F +Q EA  + + C  +  VF+ +  + +G R +LV+TY   W  YKS      H 
Sbjct  41    IWKLFHRQTEAFNFVKSCKEDVHVFALEYKVGDGQRIYLVTTYTQLWFYYKSRK-NLLHC  99

Query  541   YEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELD  720
             YEVI E   C LYFDLEFNK AN + +G +MV LLI  V   L + Y +  S + +  LD
Sbjct  100   YEVIPENAVCKLYFDLEFNKHANPEADGKKMVALLIEHVCKALQELYRVNCSAEDVFNLD  159

Query  721   SSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYS--SSETDERFRK---------  867
             SSTE+KFSRHLI +L  +AFKDN HVG F  ++    +   +SE D    K         
Sbjct  160   SSTEEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASEDDSISEKTGHGFSHFS  219

Query  868   -----------------------LFVSKDSKSVGIPAQ------------------LFVD  924
                                    +  SK+ + +G   Q                  LFVD
Sbjct  220   ETPIKQGISFGEMSPDQDGGESWMLNSKELERLGSAKQSSPDLSFLVVRNNTGEKQLFVD  279

Query  925   NAVYSRNRCFRLALSSKAGKSSVL--IPSGRFKCKN----MSEDEMFMASLICNIDADCE  1086
               VY+RNR FRL  SSK GK   L      +F  K+      E++ F++SL+ N+     
Sbjct  280   LGVYTRNRNFRLYKSSKIGKHVALEIAEDNKFFPKHSETVSEENQCFLSSLVSNVRF---  336

Query  1087  RLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFPPVDA  1266
                     SD +R L  +T   +  +   F+    +  N E           SP+P +D 
Sbjct  337   --------SDTLRILTCDTSQNKEKRVECFSSTNTKAENIEG-------FHCSPYPEIDQ  381

Query  1267  FVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLRRGDY  1446
             FV  + +   + G IR W +F    L+VY + K R+CE I R HKSN++M +VDL+   +
Sbjct  382   FVLSLVNKNGIQGGIRRWSYFFPEELLVYDICKYRWCENIRRAHKSNNIMILVDLKNEVW  441

Query  1447  YQKCHDPDCKG--YRSPLRPIPGNV  1515
             YQKCHDP CK   ++S   P+P  V
Sbjct  442   YQKCHDPVCKAENFKSDCFPLPAEV  466



>ref|XP_003401024.1| PREDICTED: coiled-coil domain-containing protein 111-like [Bombus 
terrestris]
Length=445

 Score =   206 bits (523),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 135/401 (34%), Positives = 208/401 (52%), Gaps = 42/401 (10%)
 Frame = +1

Query  364   EIWATFPKQVEAMKYAEQCINAR----VFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKR  531
             + W  F KQV+A+  A +  N       F YQ+  NGYR+F+V+  E +W  Y+ +  +R
Sbjct  49    DFWMKFDKQVDALNTASKESNDYNMLCTFVYQE-CNGYRKFIVAHPEIYWWHYEHLPAER  107

Query  532   RHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
             R  YE+I E  PC LY DLE++ + N++ +G  M ++LI      LL+ + +  +   ++
Sbjct  108   RCSYEIIPENQPCRLYLDLEYSIELNSEHDGPSMTNILIDIFCMYLLKYWRIICNKYNVI  167

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSK  891
              LDSST +KFSRH+I  + ++AF++N HVG     +C  I     +  +   +    D  
Sbjct  168   NLDSSTNEKFSRHVIFNIREVAFRNNYHVGRLVKSICMDILDYVSSKRKQHDILTCFDRM  227

Query  892   SV-GIPAQ------LFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFK-----CKNMSE  1035
              + G+  +      LFVD AVY++NR FR+  S+K GK S L+ S   K       N +E
Sbjct  228   QLEGLIVETKKGKRLFVDTAVYTKNRHFRIYKSTKWGKQSNLVISNDCKYIPSNAYNDNE  287

Query  1036  DEMFMASLICNIDADCERLLVCKMDSDCV-RTLHFNTEIAQSFQQMSFTPQAFELNNFES  1212
               +F+ SLI   D   + L++ +   +CV  T  F   + Q   Q S +           
Sbjct  288   LSIFIDSLISYFDTK-KGLILLEWSENCVPNTNCFKDRVQQCSYQESGS-----------  335

Query  1213  DPSRTYLMGKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGR  1392
                       S FP +D +V  + S    PGKIR   ++    ++VY     RYCE IGR
Sbjct  336   --------ACSNFPMLDKYVNNLIS----PGKIRVCKYYESAKILVYETVGYRYCENIGR  383

Query  1393  EHKSNHVMYVVDLRRGDYYQKCHDPDCKGYRSPLRPIPGNV  1515
              HKSN+V+++V+L+    YQKCHDPDC G++S  + +P  V
Sbjct  384   CHKSNNVLWIVNLKNKTIYQKCHDPDCFGFKSQPKQLPEEV  424



>ref|XP_009375542.1| PREDICTED: DNA-directed primase/polymerase protein-like isoform 
X3 [Pyrus x bretschneideri]
Length=176

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 121/168 (72%), Gaps = 1/168 (1%)
 Frame = +1

Query  727   TEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIYSSSETDERFRKLFVSKDSKSVGIP  906
              E KFSRHLIIR+ K AFKDNSH GAF  E CSRI S+ E D RF  LF+ KDS S   P
Sbjct  9     VEAKFSRHLIIRIEKTAFKDNSHAGAFVTETCSRISSAKERDGRFGNLFIRKDSSSSDSP  68

Query  907   AQLFVDNAVYSRNRCFRLALSSKAGKSSVLIPSGRFKCKNM-SEDEMFMASLICNIDADC  1083
             ++LFVD AVY+RNRCF LALSSKAGK+SVL+P+GRFK   M  E+EMFMASLICN+D  C
Sbjct  69    SKLFVDTAVYTRNRCFCLALSSKAGKNSVLLPTGRFKANRMQGEEEMFMASLICNLDVGC  128

Query  1084  ERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRT  1227
             E+LL+CK D DC+R LHF+TE+ +   +    PQ + LN   S  S T
Sbjct  129   EKLLLCKPDLDCIRALHFDTEVNRGLGKCYSWPQEYALNGCTSGASAT  176



>ref|NP_001068956.1| DNA-directed primase/polymerase protein [Bos taurus]
 ref|XP_010818555.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Bos taurus]
 ref|XP_010818556.1| PREDICTED: DNA-directed primase/polymerase protein isoform X1 
[Bos taurus]
 sp|Q08DZ8.1|PRIPO_BOVIN RecName: Full=DNA-directed primase/polymerase protein; AltName: 
Full=Coiled-coil domain-containing protein 111 [Bos taurus]
 gb|AAI23493.1| Coiled-coil domain containing 111 [Bos taurus]
 tpg|DAA14533.1| TPA: coiled-coil domain-containing protein 111 [Bos taurus]
Length=555

 Score =   208 bits (530),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 157/450 (35%), Positives = 220/450 (49%), Gaps = 91/450 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C     VF+ +  + +G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTQAFNFVKSCKQEVHVFALECKVGDGQRIYLVTTYTQLWFYYKS----RRNL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y++  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQEFYTVNCSAEDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY-------------------  834
              LDSSTE+KFSRHLI +L  +AFKDN HVG F  ++    +                   
Sbjct  157   NLDSSTEEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASEDEDMTPETTGHEF  216

Query  835   -----SSSETDERFRKLFV------SKDSKS-----VGIPAQ-------LFVDN------  927
                  + SE    F K+        S+ S S     +G   Q       L V N      
Sbjct  217   THFSETPSEQGTCFSKMSTDIDVGESQTSNSEKLGRLGSAQQSSPDLSFLIVKNDMGEKR  276

Query  928   -----AVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNID  1074
                   VY+RNR FRL  SSK GK   L      +F   + KN+S E++ F++SL+ N+ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKYVALEVAEDNKFFPIQSKNISKENQYFLSSLVSNVR  336

Query  1075  -ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
              +D  R+L C +     R         Q F +   + +A E   F+           SP+
Sbjct  337   FSDALRILTCDVPQSKQR--------VQCFSRTGTSVEAIE--GFQC----------SPY  376

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P +D FV  + +   + G IR W +F    L+VY + K R+CE IGR H+SN++M +VDL
Sbjct  377   PEIDQFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHRSNNIMILVDL  436

Query  1432  RRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +   +YQKCHDP CK   ++S   P+P  V
Sbjct  437   KNEVWYQKCHDPVCKAENFKSDCFPLPAEV  466



>ref|XP_006092756.1| PREDICTED: coiled-coil domain-containing protein 111 [Myotis 
lucifugus]
Length=547

 Score =   208 bits (529),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 154/449 (34%), Positives = 217/449 (48%), Gaps = 99/449 (22%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCINARVFSYQDHINGYRRFLVSTYEDFWKRYKSMNPKRRHH-Y  543
             IW  FP+Q +A  + + C    ++            LV++Y   W  YKS  PK   H Y
Sbjct  41    IWKLFPRQTQAFNFVKSCKERSIY------------LVTSYVQLWFHYKS--PKHLLHCY  86

Query  544   EVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIVELDS  723
             EVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y +  S + ++ LDS
Sbjct  87    EVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQELYRVNCSAEDVLNLDS  146

Query  724   STEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCS----RIYSSSETDE------------  855
             ST++KFSRHLI +L  +AFKDN HVG F  ++       I S  + D+            
Sbjct  147   STDEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASGDDEDDGGIPGTTGQAFS  206

Query  856   -----------RFRKL-----------FVSKDSKSVGI---------------PA---QL  915
                         FR++             SK  + +G                PA   +L
Sbjct  207   HFSEPPIKQGISFREMSTDEERGESWTLTSKAPERLGSAERSGPDLSFLVVKDPAGKKRL  266

Query  916   FVDNAVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMSEDEM-FMASLICNID-  1074
             FVD  VY+RNR FRL  SSK GK  VL      R+   + KN SE+E  F++SL+ N+  
Sbjct  267   FVDLGVYTRNRNFRLYKSSKKGKPVVLEVAEDNRYSLTQSKNTSEEEQYFLSSLVSNVRF  326

Query  1075  ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPFP  1254
             +D  R+L C              + +++ Q+     QA  LN+  +          SP+P
Sbjct  327   SDTLRVLRC--------------DASENKQK-----QAGHLNSTSTSVENIEGFQASPYP  367

Query  1255  PVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDLR  1434
              +D FV  + +   + G IR W +F    L+VY + K R+C  IGR HKSN++M +VDL+
Sbjct  368   EIDQFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCGNIGRAHKSNNIMILVDLK  427

Query  1435  RGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
                +YQKCHDP CK   ++S   P+P  +
Sbjct  428   NEVWYQKCHDPICKAENFKSDRFPLPAEI  456



>ref|XP_009932265.1| PREDICTED: DNA-directed primase/polymerase protein [Opisthocomus 
hoazin]
Length=580

 Score =   208 bits (529),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 154/455 (34%), Positives = 209/455 (46%), Gaps = 87/455 (19%)
 Frame = +1

Query  355   LSQEIWATFPKQVEAMKYAEQCI-NARVFSYQDHINGYRRF-LVSTYEDFWKRY-KSMNP  525
             L   +W  F +Q EA  Y + C  +  VF+ + +    +RF LV+TY++ W  Y K    
Sbjct  37    LPSSVWKIFCRQAEAFSYLKTCKEDVHVFALEKNTQSGKRFYLVTTYKELWFYYTKGYKT  96

Query  526   KRRHHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDW  705
                H YEVI E   C LYFDLEF K  N   +G  MV  LI  V   L + Y +  S   
Sbjct  97    SLMHCYEVIPEKAACKLYFDLEFYKPTNPGADGKSMVAKLIELVSQKLKELYDVTCSAKD  156

Query  706   IVELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFT--------------------AEVCS  825
             ++ LDSST++KFSRHLI    K  FKDN H+G F                      E   
Sbjct  157   VLNLDSSTDEKFSRHLIFLPQKTVFKDNIHIGNFVRTILQPAMRFMESKAAVVTPGEGAG  216

Query  826   RIYSSSE----TDERFRKLFVSKDSKSVGIPA----------------------------  909
             R++  S      D     L    D+ S G PA                            
Sbjct  217   RVFQCSAEAAGLDGSLTNLAAVGDA-SQGWPAIAHKTEGTETSHQGENSEFSFLIVNDKE  275

Query  910   ---QLFVDNAVYSRNRCFRLALSSKAGKSSVL-IPSGRFKCKNMSED-----EMFMASLI  1062
                QLFVD  VY++NR FR+  SSKAGK+ +L I        N  ED       F++SLI
Sbjct  276   GDKQLFVDLGVYTKNRNFRMYKSSKAGKNVILKIAEDNKFVPNCEEDVSLEESYFLSSLI  335

Query  1063  CNIDADCERLLVCKMDSDCVR--TLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLM  1236
             CNI    +  ++    S+  R  +   N+E A+S                  D    Y  
Sbjct  336   CNIRMRDDTKVLSSGSSEVERKTSAFLNSEAARS----------------SGDAVEGYR-  378

Query  1237  GKSPFPPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVM  1416
               SP+P +D FV  + +   V G IR WY+FS   ++VY +S  R+CE IGR HKSN++M
Sbjct  379   -DSPYPEIDDFVRSLVNKDGVQGGIRQWYYFSLEEILVYDISGYRWCENIGRAHKSNNIM  437

Query  1417  YVVDLRRGDYYQKCHDPDC--KGYRSPLRPIPGNV  1515
              +VDL++  +YQKCHDP C  K ++S   P+P  +
Sbjct  438   ILVDLKKEVWYQKCHDPVCREKNFKSQSFPLPPRI  472



>ref|XP_005226027.1| PREDICTED: DNA-directed primase/polymerase protein isoform X2 
[Bos taurus]
Length=554

 Score =   207 bits (528),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 156/450 (35%), Positives = 219/450 (49%), Gaps = 92/450 (20%)
 Frame = +1

Query  367   IWATFPKQVEAMKYAEQCIN-ARVFSYQDHI-NGYRRFLVSTYEDFWKRYKSMNPKRR--  534
             IW  F +Q +A  + + C     VF+ +  + +G R +LV+TY   W  YKS    RR  
Sbjct  41    IWKLFHRQTQAFNFVKSCKQEVHVFALECKVGDGQRIYLVTTYTQLWFYYKS----RRNL  96

Query  535   -HHYEVIQEGLPCHLYFDLEFNKKANADKNGDEMVDLLIVAVFDTLLQKYSLEGSHDWIV  711
              H YEVI E   C LYFDLEFNK AN   +G +MV LLI  V   L + Y++  S + ++
Sbjct  97    LHCYEVIPENAVCKLYFDLEFNKLANPGADGKKMVALLIEHVCKALQEFYTVNCSAEDVL  156

Query  712   ELDSSTEDKFSRHLIIRLPKIAFKDNSHVGAFTAEVCSRIY-------------------  834
              LDSSTE+KFSRHLI +L  +AFKDN HVG F  ++    +                   
Sbjct  157   NLDSSTEEKFSRHLIFQLHDVAFKDNIHVGNFVRKILQPAFHLIASEDEDMTPETTGHEF  216

Query  835   -----SSSETDERFRKLFV------SKDSKS-----VGIPAQ-------LFVDN------  927
                  + SE    F K+        S+ S S     +G   Q       L V N      
Sbjct  217   THFSETPSEQGTCFSKMSTDIDVGESQTSNSEKLGRLGSAQQSSPDLSFLIVKNDMGEKR  276

Query  928   -----AVYSRNRCFRLALSSKAGKSSVL--IPSGRF---KCKNMS-EDEMFMASLICNID  1074
                   VY+RNR FRL  SSK GK   L      +F   + KN+S E++ F++SL+ N+ 
Sbjct  277   LFVDLGVYTRNRNFRLYKSSKIGKYVALEVAEDNKFFPIQSKNISKENQYFLSSLVSNVR  336

Query  1075  -ADCERLLVCKMDSDCVRTLHFNTEIAQSFQQMSFTPQAFELNNFESDPSRTYLMGKSPF  1251
              +D  R+L C +            +  Q  Q  S T  +  +  F+           SP+
Sbjct  337   FSDALRILTCDV-----------PQSKQRVQCFSRTGTSEAIEGFQC----------SPY  375

Query  1252  PPVDAFVEYIASVGSVPGKIRSWYWFSEYGLIVYSMSKNRYCERIGREHKSNHVMYVVDL  1431
             P +D FV  + +   + G IR W +F    L+VY + K R+CE IGR H+SN++M +VDL
Sbjct  376   PEIDQFVLSLVNKNGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHRSNNIMILVDL  435

Query  1432  RRGDYYQKCHDPDCKG--YRSPLRPIPGNV  1515
             +   +YQKCHDP CK   ++S   P+P  V
Sbjct  436   KNEVWYQKCHDPVCKAENFKSDCFPLPAEV  465



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5939628547788