BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22309_g2_i2 len=544 path=[443:0-49 493:50-238 1178:239-317
682:318-543]

Length=544
                                                                      Score     E

ref|XP_009602372.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    114   3e-29   
ref|XP_007207893.1|  hypothetical protein PRUPE_ppa021011mg             119   2e-28   
ref|XP_008228032.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    119   4e-28   
gb|KCW50735.1|  hypothetical protein EUGRSUZ_J00406                     116   7e-28   
ref|XP_010031429.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    117   1e-27   
ref|XP_007016018.1|  Serine carboxypeptidase S28 family protein         117   1e-27   
ref|XP_007208680.1|  hypothetical protein PRUPE_ppa025450mg             117   2e-27   
ref|XP_006424413.1|  hypothetical protein CICLE_v100282722mg            110   2e-27   
gb|KHN44803.1|  Lysosomal Pro-X carboxypeptidase                        117   2e-27   
ref|XP_007153468.1|  hypothetical protein PHAVU_003G038000g             117   2e-27   
ref|XP_003517871.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    117   2e-27   
ref|XP_006573176.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    116   2e-27   
ref|XP_004250994.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    117   2e-27   
ref|XP_010031432.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    116   2e-27   
ref|XP_008226847.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    116   3e-27   
ref|XP_006484929.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    110   3e-27   
ref|XP_004295650.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    116   4e-27   
ref|XP_009631310.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        115   7e-27   
ref|XP_006495244.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    109   9e-27   
ref|XP_010036093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    115   1e-26   
ref|XP_008385479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    108   1e-26   
emb|CBI17110.3|  unnamed protein product                                113   2e-26   
gb|KDO37777.1|  hypothetical protein CISIN_1g032719mg                   107   3e-26   
gb|KCW50732.1|  hypothetical protein EUGRSUZ_J00405                     113   3e-26   
ref|XP_009779688.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    114   3e-26   
ref|XP_010034183.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    113   3e-26   
ref|XP_004251370.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    113   4e-26   
ref|XP_002271733.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        113   6e-26   Vitis vinifera
ref|XP_006349129.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    112   6e-26   
ref|XP_006349128.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    112   7e-26   
gb|KCW50737.1|  hypothetical protein EUGRSUZ_J00408                     112   7e-26   
ref|XP_010031434.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    112   8e-26   
ref|XP_011089978.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    112   9e-26   
ref|XP_008458663.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    112   1e-25   
ref|XP_009351278.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    106   1e-25   
ref|XP_010100140.1|  Lysosomal Pro-X carboxypeptidase                   111   1e-25   
gb|KDO37776.1|  hypothetical protein CISIN_1g032719mg                   106   2e-25   
ref|XP_006488629.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    111   2e-25   
ref|XP_011004991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    111   2e-25   
ref|XP_011005222.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    110   3e-25   
ref|XP_006495097.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    111   3e-25   
ref|XP_009356964.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    110   3e-25   
ref|XP_006424415.1|  hypothetical protein CICLE_v10028929mg             109   3e-25   
ref|XP_006424409.1|  hypothetical protein CICLE_v10030113mg             111   3e-25   
emb|CBI17109.3|  unnamed protein product                                112   3e-25   
ref|XP_004487553.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    110   4e-25   
ref|XP_011004990.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    110   5e-25   
ref|XP_002313555.2|  hypothetical protein POPTR_0009s00740g             110   5e-25   Populus trichocarpa [western balsam poplar]
gb|KHG27095.1|  Lysosomal Pro-X carboxypeptidase                        110   5e-25   
ref|XP_011005221.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    110   5e-25   
ref|XP_008360161.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    107   6e-25   
ref|XP_007016019.1|  Serine carboxypeptidase S28 family protein, ...    109   7e-25   
gb|EYU36116.1|  hypothetical protein MIMGU_mgv1a004675mg                110   7e-25   
ref|XP_006484928.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    106   8e-25   
gb|KDP43933.1|  hypothetical protein JCGZ_05400                         108   9e-25   
ref|XP_008458662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    108   1e-24   
ref|XP_007016017.1|  Serine carboxypeptidase S28 family protein         108   1e-24   
ref|XP_004145825.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    108   2e-24   
ref|XP_004160099.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    108   2e-24   
ref|XP_010031433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    108   2e-24   
ref|XP_002271797.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        108   2e-24   Vitis vinifera
ref|XP_006485136.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    108   2e-24   
emb|CAN64374.1|  hypothetical protein VITISV_018664                     108   3e-24   Vitis vinifera
ref|XP_011024297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    102   3e-24   
ref|XP_004160098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    108   3e-24   
ref|XP_004145770.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    108   3e-24   
ref|XP_004295648.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    107   3e-24   
ref|XP_006369374.1|  hypothetical protein POPTR_0001s221001g            102   4e-24   
emb|CBI17112.3|  unnamed protein product                                108   5e-24   
ref|XP_002324914.2|  hypothetical protein POPTR_0018s02600g             107   5e-24   Populus trichocarpa [western balsam poplar]
ref|XP_009785587.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    107   5e-24   
ref|XP_002271961.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    107   6e-24   Vitis vinifera
ref|XP_009356983.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    107   6e-24   
emb|CDP07008.1|  unnamed protein product                                107   8e-24   
gb|KGN46898.1|  hypothetical protein Csa_6G149390                       107   8e-24   
ref|XP_010100139.1|  Lysosomal Pro-X carboxypeptidase                   108   9e-24   
ref|XP_004145824.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    107   1e-23   
ref|XP_006424406.1|  hypothetical protein CICLE_v10030241mg             106   2e-23   
gb|KCW50493.1|  hypothetical protein EUGRSUZ_J00219                     105   2e-23   
ref|XP_011036743.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    106   2e-23   
ref|XP_010034149.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    106   3e-23   
ref|XP_006424417.1|  hypothetical protein CICLE_v10028252mg             105   4e-23   
ref|XP_006487982.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    105   4e-23   
gb|KDO44733.1|  hypothetical protein CISIN_1g0127112mg                  102   4e-23   
ref|XP_002523752.1|  Lysosomal Pro-X carboxypeptidase, putative         104   7e-23   Ricinus communis
emb|CDP17394.1|  unnamed protein product                                104   7e-23   
ref|XP_006388623.1|  prolylcarboxypeptidase-related family protein    99.4    8e-23   
ref|XP_006485332.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    104   9e-23   
ref|XP_002523754.1|  Lysosomal Pro-X carboxypeptidase, putative         104   9e-23   Ricinus communis
ref|XP_006369363.1|  hypothetical protein POPTR_0001s22060g             104   9e-23   
ref|XP_008458666.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    102   1e-22   
ref|XP_006424403.1|  hypothetical protein CICLE_v10028401mg             103   1e-22   
ref|XP_006484933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    103   1e-22   
ref|XP_008458665.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    103   2e-22   
gb|KHN27695.1|  Lysosomal Pro-X carboxypeptidase                        102   3e-22   
gb|KDP43936.1|  hypothetical protein JCGZ_05403                         102   3e-22   
ref|XP_002315345.1|  hypothetical protein POPTR_0010s23860g             102   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010260171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    102   4e-22   
ref|XP_010034145.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    101   7e-22   
ref|XP_006424402.1|  hypothetical protein CICLE_v10030021mg             100   7e-22   
gb|KCW50433.1|  hypothetical protein EUGRSUZ_J00172                     102   7e-22   
ref|XP_006485140.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    100   1e-21   
gb|KDO44732.1|  hypothetical protein CISIN_1g010487mg                   100   2e-21   
ref|XP_007150128.1|  hypothetical protein PHAVU_005G129100g             100   3e-21   
ref|XP_002523750.1|  Lysosomal Pro-X carboxypeptidase, putative       99.8    3e-21   Ricinus communis
ref|XP_011005419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    100   3e-21   
ref|XP_006286678.1|  hypothetical protein CARUB_v10002667mg           98.2    7e-21   
ref|XP_010031430.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  98.2    1e-20   
ref|XP_010031431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  98.2    1e-20   
ref|XP_003539445.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  98.2    2e-20   
ref|XP_010267352.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  98.2    2e-20   
gb|KCW50722.1|  hypothetical protein EUGRSUZ_J00400                   98.2    2e-20   
ref|XP_002523751.1|  lysosomal pro-X carboxypeptidase, putative       97.4    3e-20   Ricinus communis
gb|KDP45057.1|  hypothetical protein JCGZ_01557                       95.9    3e-20   
ref|XP_002270231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      96.7    5e-20   Vitis vinifera
ref|XP_010100142.1|  Lysosomal Pro-X carboxypeptidase                 97.1    5e-20   
ref|XP_002874100.1|  hypothetical protein ARALYDRAFT_910290           96.3    7e-20   
ref|XP_010247711.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  96.3    7e-20   
ref|XP_010267351.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  95.1    1e-19   
ref|XP_008457347.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      95.1    2e-19   
gb|KDP43937.1|  hypothetical protein JCGZ_05404                       94.7    2e-19   
ref|NP_851059.1|  Serine carboxypeptidase S28 family protein          94.4    3e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CAN65360.1|  hypothetical protein VITISV_036071                   94.7    3e-19   Vitis vinifera
gb|AAM61502.1|  prolylcarboxypeptidase-like protein                   94.4    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002438751.1|  hypothetical protein SORBIDRAFT_10g025530        90.9    4e-19   Sorghum bicolor [broomcorn]
ref|XP_002874098.1|  serine carboxypeptidase S28 family protein       92.8    6e-19   
ref|XP_007150129.1|  hypothetical protein PHAVU_005G1292001g          91.3    6e-19   
ref|XP_008464256.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  92.0    6e-19   
ref|XP_007011977.1|  Alpha/beta-Hydrolases superfamily protein is...  93.6    6e-19   
ref|XP_006485335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  93.2    7e-19   
ref|XP_010535638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      93.2    9e-19   
ref|XP_009126572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      93.2    1e-18   
ref|XP_010527988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  92.8    1e-18   
gb|KFK27606.1|  hypothetical protein AALP_AA8G405500                  92.8    1e-18   
ref|XP_010254368.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  92.8    1e-18   
gb|KFK27605.1|  hypothetical protein AALP_AA8G405500                  92.8    1e-18   
ref|XP_010683431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      92.4    2e-18   
gb|EMS54705.1|  Lysosomal Pro-X carboxypeptidase                      92.8    2e-18   
ref|XP_010254367.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  92.0    2e-18   
ref|XP_010254366.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  92.0    2e-18   
gb|AFW87518.1|  putative serine peptidase S28 family protein          93.6    2e-18   
ref|XP_010454563.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  92.0    2e-18   
ref|XP_011005420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  92.0    2e-18   
ref|XP_006287572.1|  hypothetical protein CARUB_v10000782mg           92.0    2e-18   
ref|XP_007203815.1|  hypothetical protein PRUPE_ppa005504m1g          87.4    2e-18   
ref|XP_003596267.1|  Lysosomal Pro-X carboxypeptidase                 91.7    2e-18   
ref|XP_002272152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      91.7    3e-18   Vitis vinifera
gb|ACG41459.1|  lysosomal Pro-X carboxypeptidase precursor            92.0    3e-18   Zea mays [maize]
ref|NP_001142279.1|  uncharacterized protein LOC100274448 precursor   92.0    3e-18   Zea mays [maize]
ref|XP_002313554.2|  hypothetical protein POPTR_0009s00750g           91.7    3e-18   Populus trichocarpa [western balsam poplar]
gb|KEH38910.1|  lysosomal pro-X carboxypeptidase-like protein         91.7    3e-18   
ref|XP_004139280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  91.3    4e-18   
gb|KHG26338.1|  Lysosomal Pro-X carboxypeptidase                      90.9    6e-18   
ref|XP_004489068.1|  PREDICTED: uncharacterized protein LOC101510196  88.2    6e-18   
ref|XP_008661011.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  90.9    7e-18   
ref|XP_006408695.1|  hypothetical protein EUTSA_v10001967mg           90.1    1e-17   
ref|XP_002438753.1|  hypothetical protein SORBIDRAFT_10g025550        90.5    1e-17   Sorghum bicolor [broomcorn]
ref|XP_010247724.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  90.1    1e-17   
ref|XP_010419297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  90.9    1e-17   
ref|XP_004965729.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  90.1    1e-17   
ref|XP_010421083.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  89.7    1e-17   
gb|KFK43799.1|  hypothetical protein AALP_AA1G174100                  89.7    1e-17   
ref|XP_006369367.1|  hypothetical protein POPTR_0001s220902g          89.7    2e-17   
ref|XP_002523506.1|  lysosomal pro-X carboxypeptidase, putative       89.7    2e-17   Ricinus communis
ref|XP_009127344.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  89.4    2e-17   
ref|XP_007016020.1|  Serine carboxypeptidase S28 family protein, ...  89.4    2e-17   
gb|ABR16397.1|  unknown                                               89.4    2e-17   Picea sitchensis
ref|XP_006343677.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  89.4    2e-17   
ref|XP_004242567.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      89.0    2e-17   
ref|XP_010493394.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  89.0    2e-17   
gb|KDO70538.1|  hypothetical protein CISIN_1g0106562mg                84.7    2e-17   
gb|KCW84338.1|  hypothetical protein EUGRSUZ_B01187                   89.0    3e-17   
ref|XP_010047139.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      89.0    3e-17   
ref|XP_008779559.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  84.3    3e-17   
ref|XP_006388621.1|  hypothetical protein POPTR_0135s00200g           88.6    3e-17   
gb|EMT22762.1|  Lysosomal Pro-X carboxypeptidase                      86.3    4e-17   
gb|EEE66119.1|  hypothetical protein OsJ_22160                        87.4    4e-17   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ87416.1|  predicted protein                                    88.6    4e-17   
emb|CDY46135.1|  BnaA04g14230D                                        88.2    4e-17   
emb|CDY28235.1|  BnaA01g06140D                                        84.0    4e-17   
ref|XP_009140531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      88.2    5e-17   
emb|CDY09173.1|  BnaA02g05990D                                        88.2    5e-17   
ref|XP_010275727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  88.2    5e-17   
ref|XP_006657192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  88.2    5e-17   
dbj|BAJ92142.1|  predicted protein                                    88.2    5e-17   
ref|XP_010493392.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  86.3    5e-17   
gb|ABK95653.1|  unknown                                               85.1    5e-17   Populus trichocarpa [western balsam poplar]
gb|KFK32665.1|  serine carboxypeptidase s28 family protein            87.8    6e-17   
ref|XP_009617834.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      87.8    6e-17   
ref|XP_002878742.1|  serine carboxypeptidase S28 family protein       87.8    6e-17   
ref|XP_002438750.1|  hypothetical protein SORBIDRAFT_10g025520        88.2    6e-17   Sorghum bicolor [broomcorn]
gb|KHG29529.1|  Lysosomal Pro-X carboxypeptidase                      87.8    6e-17   
ref|XP_006294084.1|  hypothetical protein CARUB_v10023078mg           87.8    7e-17   
ref|NP_850050.1|  alpha/beta-Hydrolases superfamily protein           87.8    7e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDY20293.1|  BnaC04g36630D                                        87.8    7e-17   
ref|XP_010429398.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  87.4    8e-17   
ref|XP_010472431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  87.4    8e-17   
ref|XP_010525816.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      87.4    8e-17   
ref|NP_001058206.1|  Os06g0647400                                     87.4    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81080.1|  hypothetical protein OsI_23902                        87.4    1e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_010651835.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  85.5    1e-16   
gb|KCW50731.1|  hypothetical protein EUGRSUZ_J004041                  85.1    1e-16   
ref|XP_008243494.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      87.0    1e-16   
ref|XP_010493391.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  86.7    2e-16   
gb|EMS54706.1|  Lysosomal Pro-X carboxypeptidase                      87.0    2e-16   
emb|CBI17113.3|  unnamed protein product                              87.0    2e-16   
ref|XP_008659849.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  86.3    2e-16   
gb|EMT22761.1|  Lysosomal Pro-X carboxypeptidase                      86.3    2e-16   
emb|CDX68714.1|  BnaC01g07390D                                        85.1    3e-16   
ref|XP_006287573.1|  hypothetical protein CARUB_v10000783mg           85.9    3e-16   
ref|XP_003563318.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      86.3    3e-16   
gb|KDP32459.1|  hypothetical protein JCGZ_13384                       85.9    3e-16   
ref|XP_002874097.1|  serine carboxypeptidase S28 family protein       85.9    3e-16   
ref|XP_006436581.1|  hypothetical protein CICLE_v10033696mg           85.9    3e-16   
ref|XP_010246130.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  85.5    4e-16   
gb|EMT03389.1|  Lysosomal Pro-X carboxypeptidase                      85.9    4e-16   
ref|XP_011017986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  84.7    4e-16   
ref|XP_002324555.2|  serine carboxypeptidase S28 family protein       85.5    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009390988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      85.5    4e-16   
gb|EMT03388.1|  Lysosomal Pro-X carboxypeptidase                      85.1    4e-16   
emb|CDP10200.1|  unnamed protein product                              85.5    5e-16   
ref|XP_010932236.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  84.3    5e-16   
ref|XP_006481710.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  85.1    5e-16   
gb|KHN33176.1|  Lysosomal Pro-X carboxypeptidase                      84.3    6e-16   
emb|CBI18675.3|  unnamed protein product                              85.1    6e-16   
ref|XP_003633162.2|  PREDICTED: lysosomal Pro-X carboxypeptidase      85.1    6e-16   
ref|XP_011017985.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  84.7    7e-16   
ref|XP_011046918.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  84.7    8e-16   
ref|XP_010932235.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  84.7    8e-16   
ref|XP_006430123.1|  hypothetical protein CICLE_v10011529mg           84.7    8e-16   
ref|XP_006404933.1|  hypothetical protein EUTSA_v10000143mg           84.7    8e-16   
ref|XP_003521479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  84.7    9e-16   
ref|XP_009767201.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      84.3    9e-16   
ref|XP_008350184.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  84.7    9e-16   
ref|XP_010093782.1|  Lysosomal Pro-X carboxypeptidase                 83.6    9e-16   
gb|KEH24169.1|  lysosomal pro-X carboxypeptidase-like protein         84.3    1e-15   
gb|EYU25337.1|  hypothetical protein MIMGU_mgv1a004964mg              84.0    1e-15   
gb|KHN02193.1|  Lysosomal Pro-X carboxypeptidase                      84.0    1e-15   
ref|XP_006604647.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  84.0    1e-15   
gb|KEH24168.1|  lysosomal pro-X carboxypeptidase-like protein         82.8    3e-15   
ref|XP_009372536.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  83.2    3e-15   
dbj|BAJ86079.1|  predicted protein                                    83.2    3e-15   
ref|XP_002308456.2|  hypothetical protein POPTR_0006s22440g           83.2    3e-15   Populus trichocarpa [western balsam poplar]
gb|KDP38645.1|  hypothetical protein JCGZ_03998                       82.8    3e-15   
ref|XP_007162943.1|  hypothetical protein PHAVU_001G193200g           82.8    4e-15   
emb|CBI30345.3|  unnamed protein product                              82.4    4e-15   
gb|KEH24167.1|  lysosomal pro-X carboxypeptidase-like protein         82.8    4e-15   
gb|KDO39485.1|  hypothetical protein CISIN_1g0453072mg                76.6    4e-15   
ref|XP_002869352.1|  serine carboxypeptidase S28 family protein       82.4    4e-15   
ref|XP_004293172.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  82.4    5e-15   
ref|XP_002281618.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  82.4    5e-15   Vitis vinifera
gb|KDP36180.1|  hypothetical protein JCGZ_08824                       82.0    6e-15   
ref|XP_010432914.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  82.0    7e-15   
ref|XP_006854747.1|  hypothetical protein AMTR_s00030p00247420        82.0    7e-15   
ref|XP_010676045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  81.6    7e-15   
ref|XP_009592890.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      82.0    7e-15   
ref|XP_006285773.1|  hypothetical protein CARUB_v10007247mg           81.6    8e-15   
ref|XP_007027867.1|  Alpha/beta-Hydrolases superfamily protein is...  81.6    8e-15   
emb|CDY09174.1|  BnaA02g06000D                                        81.6    1e-14   
emb|CDP14439.1|  unnamed protein product                              81.3    1e-14   
ref|XP_009773191.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      81.3    1e-14   
gb|KHN33177.1|  Lysosomal Pro-X carboxypeptidase                      81.3    1e-14   
ref|XP_006577088.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  81.3    1e-14   
ref|XP_010245640.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  81.3    1e-14   
ref|XP_004305645.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  81.3    1e-14   
ref|XP_001776094.1|  predicted protein                                80.9    1e-14   
gb|KDO59435.1|  hypothetical protein CISIN_1g044064mg                 79.3    2e-14   
gb|EYU41363.1|  hypothetical protein MIMGU_mgv1a0060841mg             77.0    2e-14   
ref|XP_004167790.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  80.5    2e-14   
ref|XP_004136495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  80.1    3e-14   
ref|XP_004306148.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  80.9    3e-14   
ref|XP_003549991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  80.1    3e-14   
gb|KCW59597.1|  hypothetical protein EUGRSUZ_H02342                   80.5    3e-14   
gb|ABR17702.1|  unknown                                               80.1    3e-14   Picea sitchensis
gb|AIA26578.1|  serine protease                                       79.3    3e-14   
ref|XP_009624783.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  80.1    3e-14   
emb|CDP02648.1|  unnamed protein product                              79.7    4e-14   
ref|XP_008680725.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  79.7    4e-14   
gb|EPS74090.1|  hypothetical protein M569_00662                       79.3    5e-14   
ref|XP_002450303.1|  hypothetical protein SORBIDRAFT_05g003460        79.7    5e-14   
ref|XP_004494225.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  79.3    5e-14   
ref|XP_008442879.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  79.3    5e-14   
ref|XP_009801420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  79.3    6e-14   
ref|XP_007047632.1|  Serine carboxypeptidase S28 family protein i...  79.3    6e-14   
gb|ABR17682.1|  unknown                                               79.3    6e-14   
ref|XP_004509045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  79.3    6e-14   
ref|XP_004980174.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  79.3    6e-14   
gb|KEH31545.1|  serine carboxypeptidase S28 family protein            79.3    7e-14   
gb|EMT13135.1|  Lysosomal Pro-X carboxypeptidase                      79.0    7e-14   
ref|XP_009342192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  79.0    8e-14   
ref|XP_010026544.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  79.0    8e-14   
gb|AFW87519.1|  putative serine peptidase S28 family protein          79.0    8e-14   
gb|EYU18082.1|  hypothetical protein MIMGU_mgv1a005183mg              79.0    8e-14   
ref|XP_006453645.1|  hypothetical protein CICLE_v10010736mg           74.7    9e-14   
ref|XP_010042171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  76.6    9e-14   
ref|XP_008798889.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  78.6    9e-14   
ref|XP_008798888.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  78.6    1e-13   
ref|XP_006841179.1|  hypothetical protein AMTR_s00086p00173170        78.2    1e-13   
gb|EMS59622.1|  Lysosomal Pro-X carboxypeptidase                      77.8    1e-13   
gb|KDO44737.1|  hypothetical protein CISIN_1g038117mg                 78.2    1e-13   
gb|KCW59603.1|  hypothetical protein EUGRSUZ_H023451                  73.2    2e-13   
gb|KCW90503.1|  hypothetical protein EUGRSUZ_A02623                   77.4    2e-13   
ref|XP_010316042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  77.4    2e-13   
ref|XP_004288288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  77.4    2e-13   
ref|XP_004231954.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  77.4    3e-13   
ref|XP_010910623.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  76.3    3e-13   
ref|XP_010024706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  77.4    3e-13   
ref|XP_010059402.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  77.4    3e-13   
ref|XP_002530520.1|  lysosomal pro-X carboxypeptidase, putative       77.0    3e-13   
dbj|BAK05623.1|  predicted protein                                    77.0    4e-13   
ref|XP_006363792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  77.0    4e-13   
ref|XP_006341228.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  76.6    4e-13   
ref|XP_004246480.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  76.6    4e-13   
gb|EPS59259.1|  hypothetical protein M569_15548                       76.6    4e-13   
ref|XP_009406759.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  76.6    5e-13   
ref|XP_009406760.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  76.6    5e-13   
ref|XP_011073662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      76.6    5e-13   
ref|XP_010099406.1|  Lysosomal Pro-X carboxypeptidase                 76.6    5e-13   
ref|XP_010023342.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  76.3    6e-13   
ref|XP_010683638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  76.3    6e-13   
ref|XP_010943424.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      76.3    6e-13   
ref|XP_002263389.2|  PREDICTED: lysosomal Pro-X carboxypeptidase      76.3    7e-13   
ref|XP_002530593.1|  lysosomal pro-X carboxypeptidase, putative       74.3    8e-13   
ref|XP_006426159.1|  hypothetical protein CICLE_v10025375mg           75.9    9e-13   
ref|XP_006466409.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  75.9    9e-13   
ref|XP_011031335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      75.5    1e-12   
ref|XP_002310325.2|  hypothetical protein POPTR_0007s14600g           75.5    1e-12   
emb|CDP10629.1|  unnamed protein product                              75.1    1e-12   
gb|KFK28424.1|  hypothetical protein AALP_AA8G512800                  74.7    2e-12   
ref|XP_008237071.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      74.7    2e-12   
gb|EAZ17490.1|  hypothetical protein OsJ_33021                        72.4    2e-12   
gb|KDP32128.1|  hypothetical protein JCGZ_12589                       74.3    3e-12   
ref|XP_010518734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      74.3    3e-12   
ref|NP_201377.2|  Serine carboxypeptidase S28 family protein          73.9    4e-12   
dbj|BAB10683.1|  lysosomal Pro-X carboxypeptidase                     73.9    4e-12   
ref|XP_010931151.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  73.9    4e-12   
ref|XP_011094280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      73.6    4e-12   
ref|XP_002601798.1|  hypothetical protein BRAFLDRAFT_279167           73.6    5e-12   
gb|AFK45793.1|  unknown                                               70.9    6e-12   
ref|XP_010463531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  73.2    6e-12   
ref|XP_003576298.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  73.2    8e-12   
ref|NP_001065793.1|  Os11g0156200                                     72.8    8e-12   
gb|EAY80009.1|  hypothetical protein OsI_35177                        72.8    9e-12   
ref|XP_010444594.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  72.8    1e-11   
ref|XP_006646360.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  72.4    1e-11   
dbj|BAK01568.1|  predicted protein                                    72.4    1e-11   
ref|XP_007155790.1|  hypothetical protein PHAVU_003G232100g           72.0    1e-11   
gb|AGV54352.1|  lysosomal Pro-X carboxypeptidase-like protein         72.0    1e-11   
gb|EAY75958.1|  hypothetical protein OsI_03875                        72.0    2e-11   
ref|XP_002864979.1|  serine carboxypeptidase S28 family protein       72.0    2e-11   
ref|XP_010023346.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  72.0    2e-11   
ref|XP_971305.1|  PREDICTED: lysosomal Pro-X carboxypeptidase         72.0    2e-11   
ref|XP_010275726.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  72.0    2e-11   
gb|EAZ13666.1|  hypothetical protein OsJ_03583                        72.0    2e-11   
ref|XP_006393989.1|  hypothetical protein EUTSA_v10003988mg           72.0    2e-11   
ref|XP_006663226.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  71.2    2e-11   
gb|KFK21910.1|  hypothetical protein AALP_AAs61034U000100             68.2    2e-11   
ref|XP_009150668.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      71.6    3e-11   
ref|XP_004970093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  71.6    3e-11   
emb|CDY08753.1|  BnaA06g24710D                                        71.2    3e-11   
ref|XP_010675578.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  70.9    3e-11   
ref|XP_010680789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  71.2    3e-11   
ref|XP_006280309.1|  hypothetical protein CARUB_v10026232mg           70.9    4e-11   
ref|NP_001136852.1|  uncharacterized protein LOC100217003             69.7    4e-11   
emb|CDM83096.1|  unnamed protein product                              70.5    5e-11   
ref|NP_001044360.1|  Os01g0767100                                     70.5    6e-11   
emb|CDY45627.1|  BnaCnng13350D                                        70.5    6e-11   
gb|AGT17295.1|  hypothetical protein SHCRBa_168_J15_F_160             70.1    7e-11   
gb|AAM15096.1|  putative prolylcarboxypeptidase                       69.7    1e-10   
gb|AFW84965.1|  putative serine peptidase S28 family protein          69.7    1e-10   
ref|XP_008654499.1|  PREDICTED: uncharacterized protein LOC100217...  69.7    1e-10   
ref|XP_008799734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  69.3    1e-10   
ref|XP_002962483.1|  hypothetical protein SELMODRAFT_78660            69.3    1e-10   
ref|XP_972807.1|  PREDICTED: lysosomal Pro-X carboxypeptidase         68.9    1e-10   
ref|XP_002458558.1|  hypothetical protein SORBIDRAFT_03g035680        69.3    2e-10   
gb|KHN29945.1|  Lysosomal Pro-X carboxypeptidase                      63.9    7e-10   
ref|XP_003569899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      67.0    7e-10   
ref|XP_009383556.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  66.6    1e-09   
ref|XP_010675581.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  64.7    5e-09   
gb|EWM28137.1|  lysosomal pro-x                                       63.9    8e-09   
ref|XP_002127477.1|  PREDICTED: dipeptidyl peptidase 2                63.2    2e-08   
ref|XP_008902906.1|  hypothetical protein PPTG_09639                  63.2    2e-08   
gb|ETP48836.1|  hypothetical protein F442_05517                       62.8    2e-08   
gb|ETL44423.1|  hypothetical protein L916_05281                       62.8    2e-08   
gb|ETI51147.1|  hypothetical protein F443_05467                       62.4    2e-08   
gb|ETL97595.1|  hypothetical protein L917_05163                       62.4    2e-08   
ref|XP_005699540.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  62.4    3e-08   
gb|ETO79905.1|  hypothetical protein F444_05511                       62.4    3e-08   
gb|ETK91022.1|  hypothetical protein L915_05325                       62.4    3e-08   
ref|XP_783661.3|  PREDICTED: lysosomal Pro-X carboxypeptidase-like    62.4    3e-08   
gb|ETP20904.1|  hypothetical protein F441_05474                       62.4    3e-08   
ref|XP_002897830.1|  lysosomal Pro-X carboxypeptidase, putative       62.4    3e-08   
ref|XP_007664991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  62.0    3e-08   
ref|XP_004019472.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  62.0    4e-08   
ref|XP_004019471.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  61.6    4e-08   
ref|XP_001949478.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  61.6    5e-08   
ref|XP_005975525.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  61.6    5e-08   
gb|ACO10617.1|  Lysosomal Pro-X carboxypeptidase precursor            61.2    6e-08   
ref|XP_005975526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  61.2    6e-08   
ref|XP_005612064.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      61.2    6e-08   
gb|ACO10272.1|  Lysosomal Pro-X carboxypeptidase precursor            61.2    6e-08   
ref|XP_008537200.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      61.2    6e-08   
ref|XP_001628070.1|  predicted protein                                61.2    6e-08   
ref|NP_001033253.1|  lysosomal Pro-X carboxypeptidase precursor       61.2    6e-08   
ref|XP_005226767.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  61.2    6e-08   
ref|XP_005894702.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      61.2    6e-08   
ref|XP_006055696.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      61.2    6e-08   
ref|XP_010851518.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      61.2    7e-08   
gb|KDD71975.1|  hypothetical protein H632_c4069p0                     59.3    7e-08   
ref|XP_004342263.1|  dipeptidyl-peptidase family protein              60.8    7e-08   
ref|XP_006436573.1|  hypothetical protein CICLE_v10033642mg           59.7    8e-08   
ref|XP_006197540.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...  60.8    9e-08   
gb|ELU17643.1|  hypothetical protein CAPTEDRAFT_152094                60.5    9e-08   
ref|XP_003507068.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  60.5    9e-08   
ref|XP_003129755.3|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  60.5    1e-07   
emb|CCQ71326.1|  hypothetical Pro-X carboxypeptidase-like protein...  60.5    1e-07   
ref|XP_010988491.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  60.5    1e-07   
ref|XP_010988501.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  60.5    1e-07   
ref|XP_004338820.1|  lysosomal ProX carboxypeptidase                  60.5    1e-07   
ref|XP_006001899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      60.1    1e-07   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                  60.5    1e-07   
ref|XP_006186742.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      60.1    1e-07   
ref|XP_010971744.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  60.1    1e-07   
ref|XP_005074171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  60.1    2e-07   
ref|XP_003219412.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      60.1    2e-07   
ref|XP_003764661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      59.7    2e-07   
ref|XP_010971745.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  60.1    2e-07   
ref|XP_004590083.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      59.7    2e-07   
ref|XP_008842482.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  59.7    2e-07   
ref|XP_533994.2|  PREDICTED: lysosomal Pro-X carboxypeptidase iso...  59.7    2e-07   
gb|ACE75287.1|  prolylcarboxypeptidase                                59.3    2e-07   
ref|XP_006926718.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  59.3    2e-07   
ref|XP_008476948.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  59.7    2e-07   
ref|XP_003203584.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      59.3    2e-07   
ref|XP_009915842.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  56.2    2e-07   
gb|EDL06718.1|  prolylcarboxypeptidase (angiotensinase C)             59.3    3e-07   
ref|XP_010118701.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  55.5    3e-07   
gb|AAH26424.1|  Prcp protein                                          59.3    3e-07   
ref|XP_007187662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      59.3    3e-07   
ref|XP_006991953.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  59.3    3e-07   
ref|NP_082519.1|  lysosomal Pro-X carboxypeptidase precursor          59.3    3e-07   
ref|XP_009485283.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  56.2    3e-07   
ref|XP_003468571.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      58.9    3e-07   
ref|XP_008261572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      58.9    3e-07   
ref|XP_004390758.1|  PREDICTED: dipeptidyl peptidase 2                58.9    3e-07   
ref|XP_004333705.1|  prolylcarboxypeptidase isoform 2 preproprotein   58.9    3e-07   
ref|XP_004708913.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      58.5    4e-07   
ref|XP_009985955.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      58.5    4e-07   
ref|XP_004385551.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      58.9    4e-07   
gb|AAH55022.1|  Prcp protein                                          58.9    4e-07   
ref|XP_002109366.1|  hypothetical protein TRIADDRAFT_21030            58.5    4e-07   
ref|XP_007120155.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  58.9    4e-07   
ref|XP_006865041.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  58.5    4e-07   
ref|XP_007447423.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      58.5    4e-07   
ref|XP_007630098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  58.5    4e-07   
ref|XP_004473934.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  58.5    4e-07   
gb|EMT30656.1|  Lysosomal Pro-X carboxypeptidase                      58.5    4e-07   
ref|XP_003507065.2|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  58.5    4e-07   
ref|XP_006865042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  58.5    4e-07   
ref|XP_797434.3|  PREDICTED: dipeptidyl peptidase 2-like              58.5    4e-07   
gb|ERE79438.1|  lysosomal Pro-X carboxypeptidase-like protein         58.5    4e-07   
ref|XP_009523118.1|  hypothetical protein PHYSODRAFT_558788           58.5    5e-07   
ref|XP_009521613.1|  hypothetical protein PHYSODRAFT_327243           58.5    5e-07   
ref|XP_004763526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  58.5    5e-07   
ref|XP_003418585.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      58.2    5e-07   
ref|XP_006823122.1|  PREDICTED: dipeptidyl peptidase 2-like           57.8    6e-07   
ref|XP_009580164.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  55.5    6e-07   
ref|XP_009810637.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  55.1    6e-07   
ref|XP_004473931.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  58.2    6e-07   
ref|XP_005026125.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      58.2    6e-07   
ref|XP_004473932.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  58.2    6e-07   
ref|XP_004473933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  58.2    6e-07   
gb|EOA96670.1|  Lysosomal Pro-X carboxypeptidase                      58.2    6e-07   
gb|ETI36303.1|  hypothetical protein F443_17578                       57.8    6e-07   
ref|XP_005417883.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      58.2    6e-07   
ref|XP_007894423.1|  PREDICTED: dipeptidyl peptidase 2                58.5    6e-07   
ref|XP_005784179.1|  hypothetical protein EMIHUDRAFT_442078           58.2    6e-07   
ref|XP_004324072.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  57.8    7e-07   
gb|EYU30781.1|  hypothetical protein MIMGU_mgv1a0254691mg             55.8    7e-07   
ref|XP_005357662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  57.8    7e-07   
gb|KFO21464.1|  Dipeptidyl peptidase 2                                58.2    7e-07   
gb|ETL83161.1|  hypothetical protein L917_16836                       57.8    7e-07   
gb|ETK76493.1|  hypothetical protein L915_17113                       57.8    7e-07   
ref|XP_007900913.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      57.8    7e-07   
ref|XP_007945258.1|  PREDICTED: dipeptidyl peptidase 2                58.2    7e-07   
ref|XP_004271881.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      57.8    7e-07   
gb|ETL29931.1|  hypothetical protein L916_17009                       57.8    8e-07   
gb|ENN79585.1|  hypothetical protein YQE_04047                        57.8    8e-07   
ref|XP_007537171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      57.4    8e-07   
ref|XP_010191069.1|  PREDICTED: dipeptidyl peptidase 2                58.2    8e-07   
ref|XP_006882995.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      57.4    8e-07   
ref|XP_004683302.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      57.8    8e-07   
ref|XP_005772171.1|  hypothetical protein EMIHUDRAFT_242662           56.2    9e-07   
ref|XP_008702603.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      57.8    9e-07   
ref|XP_009050235.1|  hypothetical protein LOTGIDRAFT_207842           57.4    9e-07   
ref|XP_006132231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      57.4    9e-07   
ref|XP_005074170.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  57.8    9e-07   
emb|CDY09175.1|  BnaA02g06010D                                        57.4    9e-07   
ref|XP_006991950.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      57.4    1e-06   
ref|XP_009679016.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      57.4    1e-06   



>ref|XP_009602372.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Nicotiana 
tomentosiformis]
Length=95

 Score =   114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL+++SD+++AV TRNGSHCLDIL    TDPDWLT QR REVEII  W
Sbjct  19   SNGLRDPYSSAGVLQDLSDSLIAVTTRNGSHCLDILTSQPTDPDWLTMQRNREVEIIEGW  78

Query  183  ITKYYADLQALKK  221
            IT YYADL+ LK 
Sbjct  79   ITTYYADLKVLKN  91



>ref|XP_007207893.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
 gb|EMJ09092.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
Length=503

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDIL-GESKTDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLE+ISDTI+AV+ +NGSHCLDIL  ++ TDPDWL  QRK EV+II+R
Sbjct  430  SNGLRDPYSSGGVLEDISDTIVAVHAKNGSHCLDILNADNITDPDWLVNQRKIEVKIIKR  489

Query  180  WITKYYADLQALKK  221
            WI +YYADLQA KK
Sbjct  490  WIARYYADLQAFKK  503



>ref|XP_008228032.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=503

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESK-TDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLE+ISDT++AV+ +NGSHCLD+L  +  TDPDWL  QRK EV+II+R
Sbjct  430  SNGLRDPYSSGGVLEDISDTVVAVHAKNGSHCLDLLNANNITDPDWLVNQRKIEVKIIKR  489

Query  180  WITKYYADLQALKK  221
            WI KYYADLQA KK
Sbjct  490  WIAKYYADLQAFKK  503



>gb|KCW50735.1| hypothetical protein EUGRSUZ_J00406 [Eucalyptus grandis]
Length=312

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+SSGGVL+NIS T++A+YT  GSHCLDILG  K+DPDWL EQRK EV+I+++W
Sbjct  240  SNGLQDPYSSGGVLKNISSTVVAIYTAKGSHCLDILGADKSDPDWLVEQRKTEVKIMKKW  299

Query  183  ITKYYADLQAL  215
            + KYYADL A 
Sbjct  300  LAKYYADLHAF  310



>ref|XP_010031429.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50725.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
 gb|KCW50726.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
Length=496

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL+NISD+I+AVYT  GSHCLDIL E +TDPDWL  QRK EVEII+ W
Sbjct  424  SNGLRDPYSSAGVLKNISDSIIAVYTEKGSHCLDILAEKQTDPDWLVMQRKVEVEIIKGW  483

Query  183  ITKYYADLQALKK  221
            I KYY+DL A K+
Sbjct  484  IAKYYSDLLAFKQ  496



>ref|XP_007016018.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33637.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=500

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENIS++ILAV T NGSHCLDIL E +TDP+WL  QRK EV+II+ W
Sbjct  428  SNGLRDPYSSGGVLENISNSILAVSTVNGSHCLDILAERETDPEWLIRQRKIEVKIIKGW  487

Query  183  ITKYYADLQALKK  221
            I KYYADL+A K+
Sbjct  488  IAKYYADLKAFKQ  500



>ref|XP_007208680.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
 gb|EMJ09879.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
Length=521

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AV+T+NGSHCLDI+G + TDPDWL  QRK EV+II+ W
Sbjct  433  SNGLRDPYSSGGVLENISDTVVAVHTKNGSHCLDIVGANTTDPDWLVNQRKVEVKIIKGW  492

Query  183  ITKYYADLQALKK*KT  230
            + KYYA+L+A    K+
Sbjct  493  LDKYYAELRAYSNNKS  508



>ref|XP_006424413.1| hypothetical protein CICLE_v100282722mg, partial [Citrus clementina]
 gb|ESR37653.1| hypothetical protein CICLE_v100282722mg, partial [Citrus clementina]
Length=104

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKT-DPDWLTEQRKREVEIIRR  179
            SNGLRDP+S+GGVL+NISD+I+A+ T NGSHCLDI+  SKT DPDWL +QR  EVEII  
Sbjct  31   SNGLRDPYSAGGVLKNISDSIIALPTVNGSHCLDIVKSSKTSDPDWLVQQRNTEVEIIEG  90

Query  180  WITKYYADLQALKK  221
            WI KYYADL+A+ K
Sbjct  91   WIAKYYADLKAINK  104



>gb|KHN44803.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=471

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S GGVL+NISD+I+AV+T NGSHCLD+L  +++DP WL EQRK+EV+II+RW
Sbjct  392  SNGLRDPYSIGGVLDNISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRW  451

Query  183  ITKYYADLQALK  218
            IT+YYADL ALK
Sbjct  452  ITQYYADLDALK  463



>ref|XP_007153468.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
 gb|ESW25462.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
Length=496

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S GGVLENISD I+A++T NGSHCLDIL  +++DP+WL +QRK+E++I++RW
Sbjct  417  SNGLKDPYSIGGVLENISDNIVAIHTVNGSHCLDILRANESDPEWLVKQRKKEIKIMKRW  476

Query  183  ITKYYADLQALK  218
            ITKYYADL ALK
Sbjct  477  ITKYYADLHALK  488



>ref|XP_003517871.2| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=503

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S GGVL+NISD+I+AV+T NGSHCLD+L  +++DP WL EQRK+EV+II+RW
Sbjct  424  SNGLRDPYSIGGVLDNISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRW  483

Query  183  ITKYYADLQALK  218
            IT+YYADL ALK
Sbjct  484  ITQYYADLDALK  495



>ref|XP_006573176.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Glycine 
max]
Length=444

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S GGVL+NISD+I+AV+T NGSHCLD+L  +++DP WL EQRK+EV+II+RW
Sbjct  365  SNGLRDPYSIGGVLDNISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRW  424

Query  183  ITKYYADLQALK  218
            IT+YYADL ALK
Sbjct  425  ITQYYADLDALK  436



>ref|XP_004250994.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=504

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL++ISD++LAV+TRNGSHCLDIL +  +DP+WLT QR  EV+II  W
Sbjct  428  SNGLRDPYSSAGVLQDISDSLLAVHTRNGSHCLDILSKMSSDPEWLTMQRNTEVKIIEGW  487

Query  183  ITKYYADLQALKK*KTN  233
            ITKYYADL+A+KK K +
Sbjct  488  ITKYYADLKAIKKGKMH  504



>ref|XP_010031432.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50733.1| hypothetical protein EUGRSUZ_J00406 [Eucalyptus grandis]
Length=504

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+SSGGVL+NIS T++A+YT  GSHCLDILG  K+DPDWL EQRK EV+I+++W
Sbjct  432  SNGLQDPYSSGGVLKNISSTVVAIYTAKGSHCLDILGADKSDPDWLVEQRKTEVKIMKKW  491

Query  183  ITKYYADLQAL  215
            + KYYADL A 
Sbjct  492  LAKYYADLHAF  502



>ref|XP_008226847.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=521

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AV+T+NGSHCLDI+G + TDPDWL  QRK EV+II+ W
Sbjct  433  SNGLRDPYSSGGVLENISDTVVAVHTKNGSHCLDIVGANTTDPDWLVNQRKVEVKIIKGW  492

Query  183  ITKYYADLQALKK*KT  230
            ++ YYA+L+A    K+
Sbjct  493  LSNYYAELRAYSNNKS  508



>ref|XP_006484929.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=135

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILG-ESKTDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLENISD ++A+ T NGSHCLDILG +  +DPDWL  QR+ E+EII  
Sbjct  63   SNGLRDPYSSGGVLENISDNVVAIPTINGSHCLDILGAKESSDPDWLVTQRETEIEIIEG  122

Query  180  WITKYYADLQALK  218
            WI+KYYADL+A+K
Sbjct  123  WISKYYADLKAIK  135



>ref|XP_004295650.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESK-TDPDWLTEQRKREVEIIRR  179
            SNGLRDP+S GGVLENISD+++AVYT+NGSHCLDIL  +  TDPDWL  QRK EV II+ 
Sbjct  432  SNGLRDPYSIGGVLENISDSVVAVYTKNGSHCLDILISNHITDPDWLVNQRKTEVRIIKG  491

Query  180  WITKYYADLQALK  218
            WI KYYADLQALK
Sbjct  492  WIAKYYADLQALK  504



>ref|XP_009631310.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=523

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL++IS ++ AV+TRNGSHCLDIL    TDPDWLT QRK EVEII  W
Sbjct  447  SNGLRDPYSSAGVLQDISHSLRAVHTRNGSHCLDILTSKPTDPDWLTMQRKTEVEIIEGW  506

Query  183  ITKYYADLQALK  218
            ITKYYADL ALK
Sbjct  507  ITKYYADLNALK  518



>ref|XP_006495244.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=140

 Score =   109 bits (273),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKT-DPDWLTEQRKREVEIIRR  179
            SNGLRDP+S+GGVL+NISD I+A+ T NGSHCLDI+  +KT DPDWL +QRK EVEII  
Sbjct  60   SNGLRDPYSAGGVLKNISDNIIALPTVNGSHCLDIVKSNKTSDPDWLVQQRKTEVEIIEG  119

Query  180  WITKYYADLQALKK  221
            WI KYYADL+A+ K
Sbjct  120  WIAKYYADLKAINK  133



>ref|XP_010036093.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=509

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGG+L+NISDTI AVYT+ GSHCLDIL   + DP+WL  QRKREVEII+ W
Sbjct  426  SNGLRDPYSSGGILKNISDTIDAVYTQKGSHCLDILASEQADPNWLVRQRKREVEIIKGW  485

Query  183  ITKYYADLQALKK  221
            ITKY+A L A K+
Sbjct  486  ITKYHAHLLAFKQ  498



>ref|XP_008385479.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=124

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AV+ +NGSHCLD+L    TDP WL EQRK EV+II  W
Sbjct  52   SNGLRDPYSSGGVLENISDTVVAVHAKNGSHCLDVLRSDSTDPGWLVEQRKTEVKIIEGW  111

Query  183  ITKYYADLQALKK  221
            + +YY +L+A ++
Sbjct  112  LAEYYGELRAFEQ  124



>emb|CBI17110.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVL+NISD++LA+ T NGSHCLDIL  + TDP+WL  QRK EVE+I  W
Sbjct  333  SNGLRDPYSSGGVLKNISDSVLAILTVNGSHCLDILPATSTDPEWLVMQRKAEVEVIESW  392

Query  183  ITKYYADLQALKK  221
            I +YYADL A+ K
Sbjct  393  IAQYYADLHAITK  405



>gb|KDO37777.1| hypothetical protein CISIN_1g032719mg [Citrus sinensis]
Length=103

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESK-TDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLENISD+++A+ T NGSHCLDIL  ++ +DPDWL  QR+ E++II  
Sbjct  31   SNGLRDPYSSGGVLENISDSVVAIPTINGSHCLDILAANQSSDPDWLVTQRETEIDIIEG  90

Query  180  WITKYYADLQALK  218
            W +KYYADL+A+K
Sbjct  91   WTSKYYADLKAIK  103



>gb|KCW50732.1| hypothetical protein EUGRSUZ_J00405 [Eucalyptus grandis]
Length=476

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+SSGGVL+NISDT++AVYT  GSHCLDIL  +K DPDWL +QRK E+EII++W
Sbjct  404  SNGLQDPYSSGGVLKNISDTVVAVYTAKGSHCLDILPATKADPDWLVKQRKIEIEIIQKW  463

Query  183  ITKYYADLQALKK  221
            I  Y+ADL+ L K
Sbjct  464  IATYHADLRTLGK  476



>ref|XP_009779688.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=509

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL++IS ++ AV+TRNGSHCLDIL    TDP+WLT QRK EVEII  W
Sbjct  433  SNGLRDPYSSAGVLQDISHSLRAVHTRNGSHCLDILTSKPTDPEWLTMQRKTEVEIIEGW  492

Query  183  ITKYYADLQALK  218
            ITKYYADL ALK
Sbjct  493  ITKYYADLNALK  504



>ref|XP_010034183.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=497

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+SSGGVL+NISDT++AVYT  GSHCLDIL  +K DPDWL +QRK E+EII++W
Sbjct  425  SNGLQDPYSSGGVLKNISDTVVAVYTAKGSHCLDILPATKADPDWLVKQRKIEIEIIQKW  484

Query  183  ITKYYADLQALKK  221
            I  Y+ADL+ L K
Sbjct  485  IATYHADLRTLGK  497



>ref|XP_004251370.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=504

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL++IS+++ AV+TRNGSHCLDIL ++ +DP+WLT QR  EV+II  W
Sbjct  428  SNGLRDPYSSAGVLQDISNSLQAVHTRNGSHCLDILSKTSSDPEWLTMQRNTEVKIIEGW  487

Query  183  ITKYYADLQALKK*KTN  233
            ITKYYADL+A+KK K +
Sbjct  488  ITKYYADLKAIKKGKMH  504



>ref|XP_002271733.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=505

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AVYTR+GSHCLDIL   K+DP WL  QRK EVEII+ W
Sbjct  434  SNGLRDPYSSGGVLENISDTLVAVYTRHGSHCLDILPSQKSDPQWLVMQRKMEVEIIKGW  493

Query  183  ITKYYADL  206
            + KYY DL
Sbjct  494  MDKYYTDL  501



>ref|XP_006349129.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=453

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL++IS ++ AV+TRNGSHCLDIL +  TDP+WLT QR  EV+II  W
Sbjct  377  SNGLRDPYSSAGVLQDISHSVQAVHTRNGSHCLDILSKDSTDPEWLTMQRNTEVKIIEGW  436

Query  183  ITKYYADLQALKK*KTN  233
            ITK+YADL+ALKK K +
Sbjct  437  ITKHYADLKALKKGKMH  453



>ref|XP_006349128.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=504

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL++IS ++ AV+TRNGSHCLDIL +  +DP+WLT QR  EV+II  W
Sbjct  428  SNGLRDPYSSAGVLQDISHSLQAVHTRNGSHCLDILSKDSSDPEWLTMQRNTEVKIIEGW  487

Query  183  ITKYYADLQALKK*KTN  233
            ITKYYADL+ALKK K +
Sbjct  488  ITKYYADLKALKKGKMH  504



>gb|KCW50737.1| hypothetical protein EUGRSUZ_J00408 [Eucalyptus grandis]
Length=500

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+SSGGVL+NIS T++A+YT  GSH LDILG  K+DPDWL EQRK EV+I+++W
Sbjct  428  SNGLQDPYSSGGVLKNISSTVVAIYTAKGSHTLDILGADKSDPDWLVEQRKTEVKIMKKW  487

Query  183  ITKYYADLQAL  215
            + KYYADL+A 
Sbjct  488  LAKYYADLRAF  498



>ref|XP_010031434.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=506

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+SSGGVL+NIS T++A+YT  GSH LDILG  K+DPDWL EQRK EV+I+++W
Sbjct  434  SNGLQDPYSSGGVLKNISSTVVAIYTAKGSHTLDILGADKSDPDWLVEQRKTEVKIMKKW  493

Query  183  ITKYYADLQAL  215
            + KYYADL+A 
Sbjct  494  LAKYYADLRAF  504



>ref|XP_011089978.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Sesamum indicum]
Length=501

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLE++S++I+AV T  GSHCLDIL  +KTDPDWL  QRKRE+EII  W
Sbjct  429  SNGLRDPYSSGGVLEDLSESIVAVTTPKGSHCLDILYSAKTDPDWLILQRKREIEIIEGW  488

Query  183  ITKYYADLQALKK  221
            +  YY+DLQALK+
Sbjct  489  LKTYYSDLQALKR  501



>ref|XP_008458663.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Cucumis 
melo]
Length=499

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVL+N+SD++LAV+T NGSHCLDIL  ++TDP WL EQR++EV II  W
Sbjct  425  SNGLRDPYSSGGVLQNLSDSLLAVHTLNGSHCLDILRANETDPQWLVEQREKEVSIIEGW  484

Query  183  ITKYYADLQALKK  221
            I++YYADL+  KK
Sbjct  485  ISQYYADLEKSKK  497



>ref|XP_009351278.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=135

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDIL-GESKTDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLE+IS T++AV  +NGSHCLDIL     TDP WL EQRK EV II+ 
Sbjct  63   SNGLRDPYSSGGVLEDISRTVVAVQAKNGSHCLDILRANHTTDPGWLVEQRKTEVHIIKG  122

Query  180  WITKYYADLQALK  218
            W+ +YYADLQA K
Sbjct  123  WLAEYYADLQAFK  135



>ref|XP_010100140.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81591.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=465

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENIS +++AV T  GSHCLDIL   +TDPDWL +QRK EV II+RW
Sbjct  390  SNGLRDPYSSGGVLENISKSVVAVTTTKGSHCLDILQAKETDPDWLVKQRKVEVNIIKRW  449

Query  183  ITKYYADLQALKK  221
            I +YY DL+ L+K
Sbjct  450  IAQYYFDLEVLRK  462



>gb|KDO37776.1| hypothetical protein CISIN_1g032719mg [Citrus sinensis]
Length=135

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESK-TDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLENISD+++A+ T NGSHCLDIL  ++ +DPDWL  QR+ E++II  
Sbjct  63   SNGLRDPYSSGGVLENISDSVVAIPTINGSHCLDILAANQSSDPDWLVTQRETEIDIIEG  122

Query  180  WITKYYADLQALK  218
            W +KYYADL+A+K
Sbjct  123  WTSKYYADLKAIK  135



>ref|XP_006488629.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=494

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILG-ESKTDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLENISD ++A+ T NGSHCLDILG +  +DPDWL  QR+ E+EII  
Sbjct  422  SNGLRDPYSSGGVLENISDNVVAIPTINGSHCLDILGAKESSDPDWLVTQRETEIEIIEG  481

Query  180  WITKYYADLQALK  218
            WI+KYYADL+A+K
Sbjct  482  WISKYYADLKAIK  494



>ref|XP_011004991.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Populus 
euphratica]
Length=480

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AV T NGSHCLDIL   +TDP+WL  QRK E++II+ W
Sbjct  410  SNGLRDPYSSGGVLENISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEW  469

Query  183  ITKYYADL  206
            I KYYADL
Sbjct  470  INKYYADL  477



>ref|XP_011005222.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Populus 
euphratica]
Length=480

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AV T NGSHCLDIL   +TDP+WL  QRK E++II+ W
Sbjct  410  SNGLRDPYSSGGVLENISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEW  469

Query  183  ITKYYADL  206
            I KYYADL
Sbjct  470  INKYYADL  477



>ref|XP_006495097.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Citrus 
sinensis]
Length=502

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILG-ESKTDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLENISD ++A+ T NGSHCLDILG +  +DPDWL  QR+ E+EII  
Sbjct  430  SNGLRDPYSSGGVLENISDNVVAIPTINGSHCLDILGAKESSDPDWLVTQRETEIEIIEG  489

Query  180  WITKYYADLQALK  218
            WI+KYYADL+A+K
Sbjct  490  WISKYYADLKAIK  502



>ref|XP_009356964.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Pyrus 
x bretschneideri]
Length=506

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AV  +NGSHCLD+L    TDPDWL EQRK EV+II  W
Sbjct  434  SNGLRDPYSSGGVLENISDTVVAVLAKNGSHCLDVLLSDSTDPDWLVEQRKTEVKIIEGW  493

Query  183  ITKYYADLQALKK  221
            + +YY +L+A ++
Sbjct  494  LAEYYGELRAFEQ  506



>ref|XP_006424415.1| hypothetical protein CICLE_v10028929mg [Citrus clementina]
 gb|ESR37655.1| hypothetical protein CICLE_v10028929mg [Citrus clementina]
Length=303

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDIL-GESKTDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLENISD+++A+ T NGSHCLDIL     +DPDWL  QR+ E+EII  
Sbjct  231  SNGLRDPYSSGGVLENISDSVVAIATINGSHCLDILRANQSSDPDWLVTQRETEIEIIEG  290

Query  180  WITKYYADLQALK  218
            WI+KYYADL+A+K
Sbjct  291  WISKYYADLKAIK  303



>ref|XP_006424409.1| hypothetical protein CICLE_v10030113mg [Citrus clementina]
 gb|ESR37649.1| hypothetical protein CICLE_v10030113mg [Citrus clementina]
Length=521

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKT-DPDWLTEQRKREVEIIRR  179
            SNGLRDP+S+GGVL+NISD I+A+ T NGSHCLDI+  +KT DPDWL +QRK EVEII+ 
Sbjct  441  SNGLRDPYSAGGVLKNISDNIIALPTVNGSHCLDIVKSNKTSDPDWLVQQRKTEVEIIKG  500

Query  180  WITKYYADLQALKK  221
            WI KYYADL+A+ K
Sbjct  501  WIAKYYADLKAINK  514



>emb|CBI17109.3| unnamed protein product [Vitis vinifera]
Length=975

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AVYTR+GSHCLDIL   K+DP WL  QRK EVEII+ W
Sbjct  904  SNGLRDPYSSGGVLENISDTLVAVYTRHGSHCLDILPSQKSDPQWLVMQRKMEVEIIKGW  963

Query  183  ITKYYADL  206
            + KYY DL
Sbjct  964  MDKYYTDL  971


 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL+NIS T+LA++T NGSHCLDIL    TDP+WL  QRK EVEII  W
Sbjct  404  SNGLRDPYSSAGVLKNISHTVLAIHTVNGSHCLDILPAKSTDPEWLIMQRKTEVEIIESW  463

Query  183  ITKYYADLQALKK  221
            I +Y+ADL A +K
Sbjct  464  IAQYHADLDATRK  476



>ref|XP_004487553.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=506

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 63/72 (88%), Gaps = 1/72 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S+GGVL N+SD+++AVYT NGSHCLDIL   ++DP WL +QRK+EVEII+RW
Sbjct  430  SNGLKDPYSTGGVLSNLSDSLIAVYTTNGSHCLDILQTRQSDPKWLIQQRKKEVEIIKRW  489

Query  183  ITKYYADLQALK  218
            I +YY+DL ALK
Sbjct  490  IEQYYSDL-ALK  500



>ref|XP_011004990.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Populus 
euphratica]
Length=531

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AV T NGSHCLDIL   +TDP+WL  QRK E++II+ W
Sbjct  461  SNGLRDPYSSGGVLENISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEW  520

Query  183  ITKYYADL  206
            I KYYADL
Sbjct  521  INKYYADL  528



>ref|XP_002313555.2| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
 gb|EEE87510.2| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
Length=495

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AV T NGSHCLDIL   +TDP+WL  QRK E++II+ W
Sbjct  425  SNGLRDPYSSGGVLENISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEW  484

Query  183  ITKYYADL  206
            I KYYADL
Sbjct  485  INKYYADL  492



>gb|KHG27095.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=537

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S GGVLENIS++ILAV T NGSHCLDIL ++ +DP+WL +QR+ EVEI++ W
Sbjct  463  SNGLRDPYSRGGVLENISESILAVKTVNGSHCLDILAQNASDPEWLVKQRQTEVEIMKGW  522

Query  183  ITKYYADLQAL  215
            I +YYADL+A+
Sbjct  523  IAQYYADLKAI  533



>ref|XP_011005221.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Populus 
euphratica]
Length=531

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AV T NGSHCLDIL   +TDP+WL  QRK E++II+ W
Sbjct  461  SNGLRDPYSSGGVLENISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEW  520

Query  183  ITKYYADL  206
            I KYYADL
Sbjct  521  INKYYADL  528



>ref|XP_008360161.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=254

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDIL-GESKTDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLE+IS T++AV+ +NGSHCLDIL     TDP WL EQRK EV II+ 
Sbjct  182  SNGLRDPYSSGGVLEDISRTVVAVHAKNGSHCLDILRANHTTDPGWLVEQRKTEVHIIKG  241

Query  180  WITKYYADLQALK  218
            W+ KYYADL A K
Sbjct  242  WLAKYYADLXAFK  254



>ref|XP_007016019.1| Serine carboxypeptidase S28 family protein, putative [Theobroma 
cacao]
 gb|EOY33638.1| Serine carboxypeptidase S28 family protein, putative [Theobroma 
cacao]
Length=468

 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLEN+SD+ILAV T  GSHCLDI  + +TDP+WL EQRK  V+II+ W
Sbjct  395  SNGLRDPYSSGGVLENLSDSILAVSTVKGSHCLDIQPKRETDPEWLVEQRKTVVKIIKGW  454

Query  183  ITKYYADLQALKK  221
            + KYYADL+A K+
Sbjct  455  MAKYYADLKAFKR  467



>gb|EYU36116.1| hypothetical protein MIMGU_mgv1a004675mg [Erythranthe guttata]
Length=515

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLE++S++++AV TRNGSHCLDIL  +KTDP+WL  QR  E++II+ W
Sbjct  443  SNGLRDPYSSGGVLEDLSESVVAVTTRNGSHCLDILQATKTDPEWLIMQRNTELQIIQGW  502

Query  183  ITKYYADLQALKK  221
            +T YYADL++L K
Sbjct  503  LTTYYADLKSLNK  515



>ref|XP_006484928.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=206

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESK-TDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLENISD+++A+ T NGSHCLDIL  ++ +DPDWL  QR+ E++II  
Sbjct  134  SNGLRDPYSSGGVLENISDSVVAIPTINGSHCLDILAANQSSDPDWLVTQRETEIDIIEG  193

Query  180  WITKYYADLQALK  218
            W +KYYADL+A+K
Sbjct  194  WTSKYYADLKAIK  206



>gb|KDP43933.1| hypothetical protein JCGZ_05400 [Jatropha curcas]
Length=419

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S+GGVLENISD+I+A+ T NGSHCLDI  E  +DP+WL  QRK EVEII+ W
Sbjct  345  SNGLRDPYSTGGVLENISDSIVAISTVNGSHCLDIQKEKPSDPNWLVMQRKTEVEIIQGW  404

Query  183  ITKYYADLQALK  218
            I+KYY DL  LK
Sbjct  405  ISKYYTDLLELK  416



>ref|XP_008458662.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=495

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S GGVL NISD++ AVYT NGSHCLDIL  ++ DP+WL  QRK EV II+ W
Sbjct  423  SNGLKDPYSIGGVLHNISDSLPAVYTANGSHCLDILSSNRMDPEWLVTQRKTEVRIIKEW  482

Query  183  ITKYYADLQALKK  221
            I KYYADL   KK
Sbjct  483  IDKYYADLANYKK  495



>ref|XP_007016017.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33636.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=505

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISD+++AV+T +GSHCLDIL E K+DP WL +QRK EV+II  W
Sbjct  431  SNGLRDPYSSGGVLENISDSVVAVHTIHGSHCLDILPEKKSDPQWLVKQRKTEVQIIEAW  490

Query  183  ITKYYADL  206
            + KYY DL
Sbjct  491  LAKYYTDL  498



>ref|XP_004145825.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46899.1| hypothetical protein Csa_6G149400 [Cucumis sativus]
Length=491

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S GGVL NISD++LAVYT NGSHCLDIL  ++ DP+WL  QRK EV II+ W
Sbjct  419  SNGLKDPYSIGGVLHNISDSLLAVYTANGSHCLDILTANRMDPEWLVTQRKTEVGIIKEW  478

Query  183  ITKYYADLQALKK  221
            I +YYADL   KK
Sbjct  479  IDEYYADLANYKK  491



>ref|XP_004160099.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=491

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S GGVL NISD++LAVYT NGSHCLDIL  ++ DP+WL  QRK EV II+ W
Sbjct  419  SNGLKDPYSIGGVLHNISDSLLAVYTANGSHCLDILTANRMDPEWLVTQRKTEVGIIKEW  478

Query  183  ITKYYADLQALKK  221
            I +YYADL   KK
Sbjct  479  IDEYYADLANYKK  491



>ref|XP_010031433.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=496

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL+NIS++I+AVYT  GSHCLD+  E +TDP+WL  QRK EV+II+ W
Sbjct  424  SNGLRDPWSSAGVLKNISNSIIAVYTEKGSHCLDLYSEMQTDPNWLVMQRKTEVKIIKAW  483

Query  183  ITKYYADLQALKK  221
            I +YYADL A K+
Sbjct  484  IAEYYADLLAFKQ  496



>ref|XP_002271797.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=510

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL+NIS T+LA++T NGSHCLDIL    TDP+WL  QRK EVEII  W
Sbjct  432  SNGLRDPYSSAGVLKNISHTVLAIHTVNGSHCLDILPAKSTDPEWLIMQRKTEVEIIESW  491

Query  183  ITKYYADLQALKK  221
            I +Y+ADL A +K
Sbjct  492  IAQYHADLDATRK  504



>ref|XP_006485136.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=498

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDPFS GGVLENISD+I+A+ T+ GSHCLD+ G  K+DPDWL +QRK EV+I++ W
Sbjct  426  SNGMRDPFSRGGVLENISDSIIALSTKYGSHCLDLDGAKKSDPDWLVQQRKTEVKIMQGW  485

Query  183  ITKYYADLQALKK  221
            IT+YY D +A+ K
Sbjct  486  ITQYYDDFKAINK  498



>emb|CAN64374.1| hypothetical protein VITISV_018664 [Vitis vinifera]
Length=502

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL+NIS T+LA++T NGSHCLDIL    TDP+WL  QRK EVEII  W
Sbjct  424  SNGLRDPYSSAGVLKNISHTVLAIHTVNGSHCLDILPAKSTDPEWLIMQRKTEVEIIESW  483

Query  183  ITKYYADLQALKK  221
            I +Y+ADL A +K
Sbjct  484  IAQYHADLDATRK  496



>ref|XP_011024297.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=124

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISD+ILAVYT  G+HC+DIL  +  DPDW+  QR  E+EII  W
Sbjct  52   SNGLRDPYSSGGVLENISDSILAVYTTKGAHCMDILPATNGDPDWVVLQRNIEIEIINGW  111

Query  183  ITKYYADL  206
            I KYY DL
Sbjct  112  ILKYYQDL  119



>ref|XP_004160098.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=514

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S  GVL NISD++LAVYT NGSHCLDIL   +TDP+WL  QRK EV II+ W
Sbjct  442  SNGLKDPYSIAGVLHNISDSLLAVYTTNGSHCLDILKAHETDPEWLVRQRKTEVGIIKGW  501

Query  183  ITKYYADLQALKK  221
            I+KYYADL+  K+
Sbjct  502  ISKYYADLKKYKQ  514


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 4/43 (9%)
 Frame = +3

Query  51   ISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRR  179
            ++DT+++V    GSHCLDIL   +TDP+WL  QRK EV I++ 
Sbjct  7    LTDTLISV----GSHCLDILKAHETDPEWLVTQRKTEVGIVKH  45



>ref|XP_004145770.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 ref|XP_004160074.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46900.1| hypothetical protein Csa_6G149410 [Cucumis sativus]
Length=499

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVL+N+SD++LAV+T  GSHCLDIL  ++TDP WL +QR+ EV II  W
Sbjct  425  SNGLRDPYSSGGVLQNLSDSLLAVHTPKGSHCLDILRANETDPQWLVKQRETEVRIIEGW  484

Query  183  ITKYYADLQALKK  221
            I+KYYADL+  KK
Sbjct  485  ISKYYADLEKSKK  497



>ref|XP_004295648.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDIL-GESKTDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSG VL+NISD+++AVYT+NGSHCLD++     TDPDWL  QRK EVEII+ 
Sbjct  402  SNGLRDPYSSGRVLQNISDSLVAVYTKNGSHCLDLVPSNPSTDPDWLINQRKIEVEIIKG  461

Query  180  WITKYYADLQALKK  221
            W+T YYA LQ  K 
Sbjct  462  WMTTYYAALQTFKS  475



>ref|XP_006369374.1| hypothetical protein POPTR_0001s221001g, partial [Populus trichocarpa]
 gb|ERP65943.1| hypothetical protein POPTR_0001s221001g, partial [Populus trichocarpa]
Length=143

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVL NISD+I+AV T NGSHCLDI     +DPDWL  QRK EV+II  W
Sbjct  67   SNGLRDPYSSGGVLNNISDSIVAVSTVNGSHCLDIQRARPSDPDWLVMQRKIEVKIIEGW  126

Query  183  ITKYYADLQALK  218
            I+KYY DL  +K
Sbjct  127  ISKYYTDLLEVK  138



>emb|CBI17112.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   108 bits (270),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S GGVL+NIS+++LA+ T NGSHCLD+L  + TDP+WL  QRK EVEII  W
Sbjct  552  SNGLRDPYSIGGVLKNISNSVLAILTVNGSHCLDLLPAASTDPEWLVMQRKAEVEIIEGW  611

Query  183  ITKYYADLQALKK  221
            I +YY DL A+ K
Sbjct  612  IAQYYVDLHAITK  624



>ref|XP_002324914.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
 gb|EEF03479.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
Length=510

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVL+NISD+++A+ T  GSHCLD+L  +K+DP WL  QRK EV IIR+W
Sbjct  434  SNGLRDPYSSGGVLQNISDSVVAITTVKGSHCLDVLATTKSDPQWLVAQRKEEVRIIRKW  493

Query  183  ITKYYADLQALKK*K  227
            I  Y++DL A +K K
Sbjct  494  IRNYFSDLDACEKGK  508



>ref|XP_009785587.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=504

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL+++SD++LAV TRNGSHCLDIL     DP+WLT QR REVEII  W
Sbjct  428  SNGLRDPYSSAGVLQDLSDSLLAVTTRNGSHCLDILTSQPNDPEWLTLQRNREVEIIEGW  487

Query  183  ITKYYADLQALKK  221
            IT Y ADL+ LK 
Sbjct  488  ITTYCADLKVLKN  500



>ref|XP_002271961.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Vitis 
vinifera]
Length=505

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S GGVL+NIS+++LA+ T NGSHCLD+L  + TDP+WL  QRK EVEII  W
Sbjct  433  SNGLRDPYSIGGVLKNISNSVLAILTVNGSHCLDLLPAASTDPEWLVMQRKAEVEIIEGW  492

Query  183  ITKYYADLQALKK  221
            I +YY DL A+ K
Sbjct  493  IAQYYVDLHAITK  505



>ref|XP_009356983.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=507

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDIL-GESKTDPDWLTEQRKREVEIIRR  179
            SNGLRDPFS  GVLENISDT++AV+ +NGSHCLD+L   + TDPDWL EQRK EV+II  
Sbjct  434  SNGLRDPFSGAGVLENISDTVVAVHAKNGSHCLDVLRSNNITDPDWLVEQRKTEVKIIEG  493

Query  180  WITKYYADLQALKK  221
            W+ +YY+ L+A K+
Sbjct  494  WLAEYYSKLRAFKQ  507



>emb|CDP07008.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+SS GV EN+SD++LAVYT  GSHCLDIL   KTDP WL  QRK EVEII  W
Sbjct  441  SNGLKDPYSSAGVRENLSDSLLAVYTAKGSHCLDILAAQKTDPSWLVAQRKLEVEIIEGW  500

Query  183  ITKYYADLQ  209
            I +YYADL+
Sbjct  501  IKQYYADLE  509



>gb|KGN46898.1| hypothetical protein Csa_6G149390 [Cucumis sativus]
Length=511

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S  GVL NISD++LAVYT NGSHCLDIL   +TDP+WL  QRK EV II+ W
Sbjct  439  SNGLKDPYSIAGVLHNISDSLLAVYTTNGSHCLDILKAHETDPEWLVRQRKTEVGIIKGW  498

Query  183  ITKYYADLQALKK  221
            I++YYADL+  K+
Sbjct  499  ISEYYADLKKYKQ  511



>ref|XP_010100139.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81590.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=652

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENIS +++AV T  GSHCLDI    +TDPDWL +QRK EV II+RW
Sbjct  580  SNGLRDPYSSGGVLENISKSVVAVTTTKGSHCLDIHRAKETDPDWLVKQRKIEVNIIKRW  639

Query  183  ITKYYADLQALKK  221
            I +YY DL+A  K
Sbjct  640  IAQYYFDLEAFNK  652



>ref|XP_004145824.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=507

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S  GVL NISD++LAVYT NGSHCLDIL   +TDP+WL  QRK EV II+ W
Sbjct  435  SNGLKDPYSIAGVLHNISDSLLAVYTTNGSHCLDILKAHETDPEWLVRQRKTEVGIIKGW  494

Query  183  ITKYYADLQALKK  221
            I++YYADL+  K+
Sbjct  495  ISEYYADLKKYKQ  507



>ref|XP_006424406.1| hypothetical protein CICLE_v10030241mg, partial [Citrus clementina]
 gb|ESR37646.1| hypothetical protein CICLE_v10030241mg, partial [Citrus clementina]
Length=501

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDPFS GGVLENISD+I+A+ T++GSHCLD+    K+DPDWL +QRK EV+I++ W
Sbjct  429  SNGMRDPFSRGGVLENISDSIIALSTKHGSHCLDLDEAKKSDPDWLVQQRKTEVKIMQGW  488

Query  183  ITKYYADLQALKK  221
            IT+YY D +A+ K
Sbjct  489  ITQYYDDFKAINK  501



>gb|KCW50493.1| hypothetical protein EUGRSUZ_J00219 [Eucalyptus grandis]
Length=503

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DPFS GG+L++IS++++AVYT  GSHCLDI+  +K DP WL  QRK EVEIIR+W
Sbjct  430  SNGLQDPFSYGGILKSISNSVVAVYTAKGSHCLDIMPATKKDPKWLVNQRKTEVEIIRKW  489

Query  183  ITKYYADLQAL  215
            I  Y+ADL+A 
Sbjct  490  IATYHADLRAF  500



>ref|XP_011036743.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=514

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVL+NIS++++A+ T  GSHCLD+L  +K+DP WL  QRK EV IIR+W
Sbjct  438  SNGLRDPYSSGGVLQNISESVVAITTVKGSHCLDVLATTKSDPQWLVAQRKEEVRIIRKW  497

Query  183  ITKYYADLQALKK*K  227
            I  Y++DL A +K K
Sbjct  498  IRNYFSDLDACEKGK  512



>ref|XP_010034149.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=670

 Score =   106 bits (265),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DPFS GG+L++IS++++AVYT  GSHCLDI+  +K DP WL  QRK EVEIIR+W
Sbjct  597  SNGLQDPFSYGGILKSISNSVVAVYTAKGSHCLDIMPATKKDPKWLVNQRKTEVEIIRKW  656

Query  183  ITKYYADLQAL  215
            I  Y+ADL+A 
Sbjct  657  IATYHADLRAF  667



>ref|XP_006424417.1| hypothetical protein CICLE_v10028252mg [Citrus clementina]
 gb|ESR37657.1| hypothetical protein CICLE_v10028252mg [Citrus clementina]
Length=502

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDIL-GESKTDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLE+IS++++A++T NGSHCLDIL     +DPDWL  QRK EVEII  
Sbjct  430  SNGLRDPYSSGGVLEDISESVIAIHTVNGSHCLDILRANQDSDPDWLVMQRKAEVEIIEG  489

Query  180  WITKYYADLQALK  218
            WI+KYY DL+A++
Sbjct  490  WISKYYDDLKAVQ  502



>ref|XP_006487982.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=502

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDIL-GESKTDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVLE+IS++++A++T NGSHCLDIL     +DPDWL  QRK EVEII  
Sbjct  430  SNGLRDPYSSGGVLEDISESVVAIHTVNGSHCLDILRANQDSDPDWLVMQRKAEVEIIEG  489

Query  180  WITKYYADLQALK  218
            WI+KYY DL+A++
Sbjct  490  WISKYYDDLKAVQ  502



>gb|KDO44733.1| hypothetical protein CISIN_1g0127112mg, partial [Citrus sinensis]
Length=264

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S+GGVL NISD+++A+ T NGSHCLDIL ESK+DP WL  QRK E++II  W
Sbjct  188  SNGLRDPYSTGGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKAEIKIIEEW  247

Query  183  ITKYYADLQALKK  221
            I KY  DL   K+
Sbjct  248  IAKYQNDLLEFKE  260



>ref|XP_002523752.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38692.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDIL-GESKTDPDWLTEQRKREVEIIRR  179
            SNG+RDP+SSGGVLE+ISDTILAV+T NGSHCLDIL     TDP+WL  QRK E+ II+ 
Sbjct  427  SNGIRDPYSSGGVLEDISDTILAVHTANGSHCLDILIANETTDPEWLVAQRKTEINIIKG  486

Query  180  WITKYYADL  206
            WI+KYY DL
Sbjct  487  WISKYYDDL  495



>emb|CDP17394.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+SSGGV EN+S ++LA+YT  GSHCLDIL   ++DP WL  QRK EVEII  W
Sbjct  434  SNGLKDPYSSGGVRENLSSSLLAIYTVKGSHCLDILAAKESDPSWLVAQRKLEVEIIEEW  493

Query  183  ITKYYADLQALKK  221
            I +YYAD+ ++ K
Sbjct  494  IKQYYADVHSIGK  506



>ref|XP_006388623.1| prolylcarboxypeptidase-related family protein, partial [Populus 
trichocarpa]
 gb|ERP47537.1| prolylcarboxypeptidase-related family protein, partial [Populus 
trichocarpa]
Length=143

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVL NIS +I+AV T NGSHCLDI   S +DP WL  QRK EV+II  W
Sbjct  67   SNGLRDPYSSGGVLNNISYSIVAVSTVNGSHCLDIQRASPSDPHWLVMQRKIEVKIIEGW  126

Query  183  ITKYYADLQALK  218
            I+KYY DL  +K
Sbjct  127  ISKYYTDLLEVK  138



>ref|XP_006485332.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=511

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            S+GL DP+S+ GVLE+ISD+ILAV T+NGSHCLDIL   K DPDWLT QR+ EV I+  W
Sbjct  433  SSGLHDPYSTAGVLEDISDSILAVPTKNGSHCLDILPAKKDDPDWLTMQRQVEVNIVHAW  492

Query  183  ITKYYADLQALKK  221
            I KYYADL  + K
Sbjct  493  ILKYYADLLQISK  505



>ref|XP_002523754.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38694.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=517

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+SSGGVLENISD+I+A+ T NGSHCLDI     TDP WL  QRK E+EII+ W
Sbjct  440  SNGLKDPYSSGGVLENISDSIVAISTVNGSHCLDIQQTQPTDPHWLVMQRKAEIEIIQGW  499

Query  183  ITKYYADLQALKK*KT  230
            I+KY  DL  LK  +T
Sbjct  500  ISKYNIDLHELKDERT  515



>ref|XP_006369363.1| hypothetical protein POPTR_0001s22060g [Populus trichocarpa]
 gb|ERP65932.1| hypothetical protein POPTR_0001s22060g [Populus trichocarpa]
Length=576

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDIL-GESKTDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVL NISD+I+AV T NGSHCLDI      TDPDWL  QRK+EVEII  
Sbjct  486  SNGLRDPYSSGGVLNNISDSIVAVTTVNGSHCLDIQRANPSTDPDWLVMQRKKEVEIIEG  545

Query  180  WITKYYADLQALK  218
            WIT+YY DL   K
Sbjct  546  WITQYYEDLYEFK  558



>ref|XP_008458666.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Cucumis 
melo]
Length=365

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S  GVL +ISD++LAV+T NGSHCLDIL   +TDP+WL  QRK EV II+ W
Sbjct  293  SNGLKDPYSIAGVLHSISDSLLAVHTTNGSHCLDILKAHETDPEWLVTQRKTEVGIIKGW  352

Query  183  ITKYYADLQALKK  221
            I++YYADL+  K+
Sbjct  353  ISEYYADLKKYKQ  365



>ref|XP_006424403.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
 gb|ESR37643.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
Length=458

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S+GGVL NISD+++A+ T NGSHCLDIL ESK+DP WL  QRK E++II  W
Sbjct  382  SNGLRDPYSTGGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKSEIKIIEEW  441

Query  183  ITKYYADLQALKK  221
            I KY  DL   K+
Sbjct  442  IAKYENDLLEFKE  454



>ref|XP_006484933.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=502

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S+GGVL NISD+++A+ T NGSHCLDIL ESK+DP WL  QRK E++II  W
Sbjct  426  SNGLRDPYSTGGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKAEIKIIEEW  485

Query  183  ITKYYADLQALKK  221
            I KY  DL   K+
Sbjct  486  IAKYQNDLLEFKE  498



>ref|XP_008458665.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Cucumis 
melo]
Length=511

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S  GVL +ISD++LAV+T NGSHCLDIL   +TDP+WL  QRK EV II+ W
Sbjct  439  SNGLKDPYSIAGVLHSISDSLLAVHTTNGSHCLDILKAHETDPEWLVTQRKTEVGIIKGW  498

Query  183  ITKYYADLQALKK  221
            I++YYADL+  K+
Sbjct  499  ISEYYADLKKYKQ  511



>gb|KHN27695.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=511

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 2/73 (3%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILG--ESKTDPDWLTEQRKREVEIIR  176
            SNGLRDP+SSGGVL+NISD+++A++T NGSHCLDILG   + +DP+WL EQ KRE+ +++
Sbjct  430  SNGLRDPYSSGGVLKNISDSLVAIHTVNGSHCLDILGANANHSDPEWLVEQWKREIMVMK  489

Query  177  RWITKYYADLQAL  215
             WI +YY DL AL
Sbjct  490  GWIAQYYDDLVAL  502



>gb|KDP43936.1| hypothetical protein JCGZ_05403 [Jatropha curcas]
Length=503

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESK-TDPDWLTEQRKREVEIIRR  179
            SNGLRDP+SSGGVL NISDTI+AVYT  GSHCLDIL  +K TDP+WL  QR  E+ II +
Sbjct  431  SNGLRDPYSSGGVLANISDTIVAVYTSEGSHCLDILQANKTTDPEWLVAQRNTEINIIDQ  490

Query  180  WITKYYADLQ  209
            WI KYY DL 
Sbjct  491  WINKYYDDLH  500



>ref|XP_002315345.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
 gb|EEF01516.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
Length=513

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISD+ILAVYT  G+HC+DIL  +  DPDW+  QR  E+EII  W
Sbjct  435  SNGLRDPYSSGGVLENISDSILAVYTTKGAHCMDILPATIGDPDWVVLQRNIEIEIINGW  494

Query  183  ITKYYADL  206
            I KYY DL
Sbjct  495  ILKYYQDL  502



>ref|XP_010260171.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=506

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SS GVL +ISD++LA+YT  G HCLDI+  S  DP+WL  QR+RE+EII  W
Sbjct  435  SNGLRDPYSSAGVLTSISDSLLAIYTNEGCHCLDIVQSSPDDPNWLVMQRRREIEIISDW  494

Query  183  ITKYYADLQA  212
            I +YYADL A
Sbjct  495  IKQYYADLAA  504



>ref|XP_010034145.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=502

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP S GG+L+NIS++++A++T  GSHCLDI   +K DP WL +QRK EVEIIR+W
Sbjct  429  SNGLQDPLSYGGILKNISNSVVAIHTAKGSHCLDIWPATKKDPIWLVKQRKTEVEIIRKW  488

Query  183  ITKYYADLQALKK  221
            I  Y+ADL+A  K
Sbjct  489  IATYHADLRAFGK  501



>ref|XP_006424402.1| hypothetical protein CICLE_v10030021mg, partial [Citrus clementina]
 gb|ESR37642.1| hypothetical protein CICLE_v10030021mg, partial [Citrus clementina]
Length=429

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVL+NISD+++A+ T NGSHCLDIL   ++DP WL  QRK EVEII  W
Sbjct  347  SNGLRDPYSSGGVLKNISDSVVALNTVNGSHCLDILPAKESDPLWLIMQRKAEVEIIEGW  406

Query  183  ITKYYADL  206
            + KY+ADL
Sbjct  407  LAKYHADL  414



>gb|KCW50433.1| hypothetical protein EUGRSUZ_J00172, partial [Eucalyptus grandis]
Length=516

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP S GG+L+NIS++++A++T  GSHCLDI   +K DP WL +QRK EVEIIR+W
Sbjct  443  SNGLQDPLSYGGILKNISNSVVAIHTAKGSHCLDIWPATKKDPIWLVKQRKTEVEIIRKW  502

Query  183  ITKYYADLQALKK  221
            I  Y+ADL+A  K
Sbjct  503  IATYHADLRAFGK  515



>ref|XP_006485140.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=463

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVL+NISD+++A+ T NGSHCLDIL   ++DP WL  QRK EVEII  W
Sbjct  381  SNGLRDPYSSGGVLKNISDSVVALNTVNGSHCLDILPAKESDPLWLIMQRKAEVEIIEGW  440

Query  183  ITKYYADL  206
            + KY+ADL
Sbjct  441  LAKYHADL  448



>gb|KDO44732.1| hypothetical protein CISIN_1g010487mg [Citrus sinensis]
Length=509

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVL+NISD+++A+ T NGSHCLDIL   ++DP WL  QRK EVEII  W
Sbjct  427  SNGLRDPYSSGGVLKNISDSVVALNTVNGSHCLDILPAKESDPLWLIMQRKAEVEIIEGW  486

Query  183  ITKYYADL  206
            + KY+ADL
Sbjct  487  LAKYHADL  494



>ref|XP_007150128.1| hypothetical protein PHAVU_005G129100g [Phaseolus vulgaris]
 gb|ESW22122.1| hypothetical protein PHAVU_005G129100g [Phaseolus vulgaris]
Length=511

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLE+ISD+++AV T NG HCLDI      DP+WL  QR +EV+II+ W
Sbjct  429  SNGLRDPYSSGGVLESISDSVVAVTTVNGCHCLDIQSRKTNDPEWLVRQRNKEVKIIKGW  488

Query  183  ITKYYADLQALKK  221
            I +Y ADL AL K
Sbjct  489  IAEYQADLIALTK  501



>ref|XP_002523750.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38690.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=491

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            +NGLRDP+S+GGVLE+ISDT++AVYT  G+HCLD+   +  DPDWL EQR +E++II  W
Sbjct  421  ANGLRDPWSAGGVLEDISDTVVAVYTEYGAHCLDLYPPTPNDPDWLVEQRDKEIKIIAAW  480

Query  183  ITKYYADL  206
            I +YYA L
Sbjct  481  IAEYYAKL  488



>ref|XP_011005419.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=500

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S GGVL NISD+I+AV   NGSHCLDI   S +DP WL  QRK EV+II  W
Sbjct  424  SNGLRDPYSGGGVLNNISDSIVAVSAVNGSHCLDIQRASPSDPHWLVTQRKIEVKIIEGW  483

Query  183  ITKYYADLQALK  218
            I+KYY DL   K
Sbjct  484  ISKYYTDLLEFK  495



>ref|XP_006286678.1| hypothetical protein CARUB_v10002667mg [Capsella rubella]
 gb|EOA19576.1| hypothetical protein CARUB_v10002667mg [Capsella rubella]
Length=424

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S G VLENISDT++A+ T NGSHC+DI  + K DPDWL EQR++EV+II  W
Sbjct  350  SNGLLDPYSVGSVLENISDTVVAITTNNGSHCMDITLKRKDDPDWLVEQREKEVQIIGSW  409

Query  183  ITKYYADLQALK  218
            I  Y  DL+ LK
Sbjct  410  IRTYQKDLKELK  421



>ref|XP_010031430.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50723.1| hypothetical protein EUGRSUZ_J00402 [Eucalyptus grandis]
Length=497

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESK----TDPDWLTEQRKREVEI  170
            SNGLRDP+S  GVL+NIS++I+AV T  GSHC+DI  ES      DPDWL +QRK EVEI
Sbjct  422  SNGLRDPWSGAGVLKNISESIIAVITDQGSHCVDIYPESHDTQCPDPDWLVKQRKTEVEI  481

Query  171  IRRWITKYYADLQALK  218
            I+ WI +YYADL+A K
Sbjct  482  IKGWIDQYYADLRASK  497



>ref|XP_010031431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=497

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKT----DPDWLTEQRKREVEI  170
            SNGLRDP+S  GVL+NIS++I+AV T  GSHC+DI  ES      DPDWL +QRK EVEI
Sbjct  422  SNGLRDPWSGAGVLKNISESIIAVITDQGSHCVDIYPESHNPQYPDPDWLVKQRKTEVEI  481

Query  171  IRRWITKYYADLQALK  218
            I+ WI +YYADL+A K
Sbjct  482  IKGWIDQYYADLRASK  497



>ref|XP_003539445.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN27694.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLE+IS+T++AV T NG HCLDI      DP WL  QR  EV+II+ W
Sbjct  427  SNGLRDPYSSGGVLESISNTVVAVTTVNGCHCLDIQSRKANDPQWLVTQRNTEVKIIKGW  486

Query  183  ITKYYADLQALKK  221
            I +Y ADL AL K
Sbjct  487  IAEYKADLIALTK  499



>ref|XP_010267352.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=514

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+SSGGVL NISD+I+A+YT  GSHC+D+   S  DP WL  QR+ E+E I+ W
Sbjct  433  SNGLKDPYSSGGVLANISDSIVAIYTNEGSHCMDLYQASAHDPKWLVMQRQLEIETIKGW  492

Query  183  ITKYYADLQALKK  221
            I KYY +L A  +
Sbjct  493  IEKYYVELAAANQ  505



>gb|KCW50722.1| hypothetical protein EUGRSUZ_J00400 [Eucalyptus grandis]
Length=535

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKT----DPDWLTEQRKREVEI  170
            SNGLRDP+S  GVL+NIS++I+AV T  GSHC+DI  ES      DPDWL +QRK EVEI
Sbjct  460  SNGLRDPWSGAGVLKNISESIIAVITDQGSHCVDIYPESHNPQYPDPDWLVKQRKTEVEI  519

Query  171  IRRWITKYYADLQALK  218
            I+ WI +YYADL+A K
Sbjct  520  IKGWIDQYYADLRASK  535



>ref|XP_002523751.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38691.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=489

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            +NGLRDP+S+GGVLE+ISD+I+AVYT +G+HCLD+   +  DP+WL EQR++E++II  W
Sbjct  419  ANGLRDPWSAGGVLEDISDSIVAVYTEHGAHCLDLYPSTPDDPNWLVEQREKEIKIIAAW  478

Query  183  ITKYYADL  206
            + +YYA L
Sbjct  479  LAEYYAKL  486



>gb|KDP45057.1| hypothetical protein JCGZ_01557 [Jatropha curcas]
Length=391

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLE+ISD+I+A+ TR GSHC+DIL  +K DP+WL  QR   +EII  W
Sbjct  320  SNGLRDPYSSGGVLEDISDSIVALTTREGSHCMDILYATKDDPEWLVLQRNTALEIISGW  379

Query  183  ITKYYADL  206
            I  YY DL
Sbjct  380  ILTYYQDL  387



>ref|XP_002270231.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
 emb|CBI23429.3| unnamed protein product [Vitis vinifera]
Length=503

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLE+IS +I+AV+T  GSHCLDIL  ++ DP+WL  QR  E+EII  W
Sbjct  432  SNGLRDPYSSGGVLEDISHSIIAVHTPRGSHCLDILPSTEDDPNWLVLQRNVEIEIIHGW  491

Query  183  ITKYYADL  206
            + KYY DL
Sbjct  492  LLKYYEDL  499



>ref|XP_010100142.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81593.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=544

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S GGVLENI+++++AV T NGSHCLD+L    +DP WL  QRK E+EII  W
Sbjct  437  SNGLRDPYSRGGVLENITESVVAVTTDNGSHCLDLLSSRPSDPQWLVMQRKNEIEIIEGW  496

Query  183  ITKYYAD  203
            I KY AD
Sbjct  497  IAKYRAD  503



>ref|XP_002874100.1| hypothetical protein ARALYDRAFT_910290 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50359.1| hypothetical protein ARALYDRAFT_910290 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE+ISDT++A+ TR+GSHC DI+ +SK DP+WL EQR++EV+II  W
Sbjct  424  SNGLLDPYSVGGVLEDISDTVIAITTRDGSHCQDIVLKSKEDPEWLVEQREKEVKIIDSW  483

Query  183  ITKYYADL  206
            I+ Y  DL
Sbjct  484  ISTYQKDL  491



>ref|XP_010247711.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=505

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSG VL+NISD+++A+YT  GSHC+DIL E   DP WL  QR +E++II +W
Sbjct  434  SNGLRDPYSSGSVLKNISDSLVAIYTTQGSHCMDILPELPDDPKWLVMQRNQEIKIIGQW  493

Query  183  ITKYYAD  203
            I +YY D
Sbjct  494  IKQYYMD  500



>ref|XP_010267351.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=468

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+SSGGVL++IS ++ A+YT  GSHCLDIL     DP WL +QR+REVEII  W
Sbjct  398  SNGLKDPYSSGGVLKSISKSLPAIYTTEGSHCLDILPSLPNDPKWLIKQRRREVEIISNW  457

Query  183  ITKYYADL  206
              +YY DL
Sbjct  458  FRQYYTDL  465



>ref|XP_008457347.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cucumis melo]
Length=499

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL NIS +I+A+ T  G+H +D    +K DPDWL EQRK+EVEII +W
Sbjct  425  SNGMQDPWSRGGVLRNISTSIIAIVTEKGAHHVDFRSATKDDPDWLVEQRKQEVEIIHQW  484

Query  183  ITKYYADLQALKK  221
            I +YYAD++  KK
Sbjct  485  INEYYADMKQDKK  497



>gb|KDP43937.1| hypothetical protein JCGZ_05404 [Jatropha curcas]
Length=491

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLE+ISD+++A++T  G+HC D+   S  DP WL EQR++EV+II  W
Sbjct  417  SNGLRDPWSSGGVLEDISDSVVAIHTEYGAHCADLFPSSPDDPVWLVEQREKEVKIIAVW  476

Query  183  ITKYYADL  206
            I +YYA L
Sbjct  477  IAEYYAKL  484



>ref|NP_851059.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 dbj|BAB10607.1| prolylcarboxypeptidase-like protein [Arabidopsis thaliana]
 gb|AED93088.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=502

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE+ISDT++A+ T+NGSHCLDI  +SK DP+WL  QR++E+++I  W
Sbjct  428  SNGLSDPYSVGGVLEDISDTLVAITTKNGSHCLDITLKSKEDPEWLVIQREKEIKVIDSW  487

Query  183  ITKYYADLQAL  215
            I+ Y  DL+ L
Sbjct  488  ISTYQNDLRDL  498



>emb|CAN65360.1| hypothetical protein VITISV_036071 [Vitis vinifera]
Length=580

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLE+IS +I+AV+T  GSHCLDIL   + DP+WL  QR  E+EI+  W
Sbjct  432  SNGLRDPYSSGGVLEDISHSIIAVHTPRGSHCLDILPSREDDPNWLVLQRNVEIEILHGW  491

Query  183  ITKYYADL  206
            + KYY DL
Sbjct  492  LLKYYEDL  499



>gb|AAM61502.1| prolylcarboxypeptidase-like protein [Arabidopsis thaliana]
Length=502

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE+ISDT++A+ T+NGSHCLDI  +SK DP+WL  QR++E+++I  W
Sbjct  428  SNGLSDPYSVGGVLEDISDTLVAITTKNGSHCLDITLKSKEDPEWLVIQREKEIKVIDSW  487

Query  183  ITKYYADLQAL  215
            I+ Y  DL+ L
Sbjct  488  ISTYQNDLRDL  498



>ref|XP_002438751.1| hypothetical protein SORBIDRAFT_10g025530 [Sorghum bicolor]
 gb|EER90118.1| hypothetical protein SORBIDRAFT_10g025530 [Sorghum bicolor]
Length=192

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD+ G +K DPDW+ EQR++EVEII+ W
Sbjct  121  SNGMRDPWSGGGVLKNISSSIVALVTEKGAHHLDLRGATKDDPDWVIEQRRQEVEIIQGW  180

Query  183  ITKYYAD  203
            I +YY D
Sbjct  181  IDQYYQD  187



>ref|XP_002874098.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50357.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=427

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE+ISDT++A+ T+NGSHC DI  +SK DP+WL  QR++E+++I  W
Sbjct  354  SNGLSDPYSVGGVLEDISDTVVAITTKNGSHCQDINLKSKGDPEWLVMQREKEIKVINSW  413

Query  183  ITKYYADLQAL  215
            I+ Y  DL+ L
Sbjct  414  ISTYQNDLRDL  424



>ref|XP_007150129.1| hypothetical protein PHAVU_005G1292001g, partial [Phaseolus vulgaris]
 gb|ESW22123.1| hypothetical protein PHAVU_005G1292001g, partial [Phaseolus vulgaris]
Length=243

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKT-DPDWLTEQRKREVEIIRRW  182
            NGLRDP+SSGGVLE++SD+++A+    GSHCLD++ ++ T DP WL + R +EV II+ W
Sbjct  156  NGLRDPYSSGGVLEDLSDSLVAIQAAQGSHCLDLVPQNLTSDPKWLVDLRNKEVSIIKGW  215

Query  183  ITKYYADLQAL  215
            I +YY DLQ L
Sbjct  216  IAQYYVDLQTL  226



>ref|XP_008464256.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=378

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSG VL+NIS +I+A+ T  GSHCLDI  + + DPDWL  QRK E++I+  W
Sbjct  300  SNGLRDPYSSGSVLQNISQSIVAITTAKGSHCLDIGPDGEDDPDWLIMQRKSEMDIVDGW  359

Query  183  ITKYYADL  206
            I+ Y+ADL
Sbjct  360  ISNYHADL  367



>ref|XP_007011977.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29596.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=498

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T+ G+H +D    +K DPDWL EQR++EVEII++W
Sbjct  428  SNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFRSATKDDPDWLVEQRRQEVEIIQKW  487

Query  183  ITKYYADLQ  209
            + +YYADL+
Sbjct  488  LNEYYADLR  496



>ref|XP_006485335.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=471

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLR+P+SS GVLE+IS++I+ V TRNGS+CLDI  E++ DP W+  QRK EV+++  W
Sbjct  379  SNGLRNPYSSAGVLEDISNSIIVVTTRNGSYCLDIQPETEDDPKWVVVQRKIEVDVVHDW  438

Query  183  ITKYYADL  206
            I KY+ADL
Sbjct  439  ILKYFADL  446



>ref|XP_010535638.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=507

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE+ISDTI+A+ T NGSHCLD++ ++K DP WL  QR++EV+II  W
Sbjct  434  SNGLSDPYSVGGVLEDISDTIVAIKT-NGSHCLDLIFKTKDDPKWLVMQRQKEVKIIDSW  492

Query  183  ITKYYADLQALK  218
            I+ Y  DL+ LK
Sbjct  493  ISNYQKDLKDLK  504



>ref|XP_009126572.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=502

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE+ISD+++A+ + NGSHC DI+ + K DP+WL  QR +E++II  W
Sbjct  428  SNGLSDPYSVGGVLEDISDSVVAIKSNNGSHCQDIVMKMKGDPEWLVMQRDKEIKIIESW  487

Query  183  ITKYYADLQAL  215
            I+ Y  DL+AL
Sbjct  488  ISTYQKDLKAL  498



>ref|XP_010527988.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Tarenaya hassleriana]
Length=493

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE+ISDTILAV T NGSHC+D++ E+K DP WL  QR++EVEII  W
Sbjct  423  SNGLSDPYSVGGVLEDISDTILAVKT-NGSHCMDLVFETKEDPKWLVLQRQKEVEIIDSW  481

Query  183  ITKYYADLQ  209
            I+ Y  DL+
Sbjct  482  ISIYQNDLK  490



>gb|KFK27606.1| hypothetical protein AALP_AA8G405500 [Arabis alpina]
Length=499

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S GGVLE+IS +++A+ T NGSHC DI+ +SK DP+WL  QR++E++II  W
Sbjct  425  SNGLKDPYSVGGVLEDISGSVVAIKTENGSHCQDIVLKSKEDPEWLVMQREKEIDIIESW  484

Query  183  ITKYYADLQAL  215
            IT Y  DL+ L
Sbjct  485  ITSYKRDLRDL  495



>ref|XP_010254368.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=508

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S  GVL ++S +++A+ T+ GSHCLD+L  S  DP WLT QR REV II RW
Sbjct  437  SNGLRDPYSVAGVLRSLSHSLVALITKQGSHCLDLLPASPDDPHWLTAQRSREVRIIARW  496

Query  183  ITKYYADLQA  212
            IT+Y AD  A
Sbjct  497  ITQYKADRAA  506



>gb|KFK27605.1| hypothetical protein AALP_AA8G405500 [Arabis alpina]
Length=509

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S GGVLE+IS +++A+ T NGSHC DI+ +SK DP+WL  QR++E++II  W
Sbjct  435  SNGLKDPYSVGGVLEDISGSVVAIKTENGSHCQDIVLKSKEDPEWLVMQREKEIDIIESW  494

Query  183  ITKYYADLQAL  215
            IT Y  DL+ L
Sbjct  495  ITSYKRDLRDL  505



>ref|XP_010683431.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+SS GVL N+SD+I+AVY   GSHC+DI    K DP+WL   R  E+EII  W
Sbjct  430  SNGLQDPYSSAGVLYNLSDSIIAVYATQGSHCVDIQHAKKDDPEWLINMRNTEIEIISGW  489

Query  183  ITKYYADLQALKK  221
            I KYY DL+   K
Sbjct  490  IRKYYDDLKQYFK  502



>gb|EMS54705.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=568

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD+   +K DPDW+ EQR++EVEIIR W
Sbjct  496  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDLRSATKDDPDWVVEQRRQEVEIIRGW  555

Query  183  ITKYYADLQAL  215
            I +Y  D++ +
Sbjct  556  IDQYNKDIEQM  566



>ref|XP_010254367.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Nelumbo 
nucifera]
Length=476

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDPFS+GGVLE++SD+++A+ T  GSHCLDI      DPDWL  QR+ E++II +W
Sbjct  402  SNGLRDPFSAGGVLESLSDSLVALPTAKGSHCLDIYAALPNDPDWLIVQRRSELKIISQW  461

Query  183  ITKYYADLQA  212
            I +Y+ D  A
Sbjct  462  IAQYHMDRAA  471



>ref|XP_010254366.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Nelumbo 
nucifera]
Length=478

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDPFS+GGVLE++SD+++A+ T  GSHCLDI      DPDWL  QR+ E++II +W
Sbjct  404  SNGLRDPFSAGGVLESLSDSLVALPTAKGSHCLDIYAALPNDPDWLIVQRRSELKIISQW  463

Query  183  ITKYYADLQA  212
            I +Y+ D  A
Sbjct  464  IAQYHMDRAA  473



>gb|AFW87518.1| putative serine peptidase S28 family protein [Zea mays]
Length=1052

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD+   +K DPDW+TEQR++EVEII  W
Sbjct  488  SNGMRDPWSRGGVLKNISSSIVALVTEKGAHHLDLRSATKDDPDWVTEQRRQEVEIIHGW  547

Query  183  ITKYYADL  206
            I +YY D+
Sbjct  548  IDQYYRDM  555



>ref|XP_010454563.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=502

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GG+LE+ISDT++A+ T NGSHC DI  +SK DP+WL  QR++E++II  W
Sbjct  428  SNGLSDPYSVGGILEDISDTVVAITTNNGSHCQDISLKSKEDPEWLVMQREKEIKIIDSW  487

Query  183  ITKYYADLQAL  215
            I+ Y  DL+ L
Sbjct  488  ISTYQKDLRDL  498



>ref|XP_011005420.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
 ref|XP_011005421.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
 ref|XP_011005422.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=496

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AV T NGSHCLDIL   +TDP+WL  QRK E++II+ W
Sbjct  426  SNGLRDPYSSGGVLENISDTVVAVKTANGSHCLDILFAEETDPEWLVTQRKIEIKIIKEW  485

Query  183  ITKYYADLQAL  215
            I KYYADL   
Sbjct  486  INKYYADLTMF  496



>ref|XP_006287572.1| hypothetical protein CARUB_v10000782mg [Capsella rubella]
 gb|EOA20470.1| hypothetical protein CARUB_v10000782mg [Capsella rubella]
Length=502

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GG+LE+ISDTI+A+ T+NGSHC DI  +SK DP+WL  QR++E++I+  W
Sbjct  428  SNGLSDPYSVGGILEDISDTIVAITTKNGSHCQDIGLKSKDDPEWLVMQREKEIKILDSW  487

Query  183  ITKYYADLQAL  215
            I+ Y  DL+ L
Sbjct  488  ISTYQKDLRDL  498



>ref|XP_007203815.1| hypothetical protein PRUPE_ppa005504m1g, partial [Prunus persica]
 gb|EMJ05014.1| hypothetical protein PRUPE_ppa005504m1g, partial [Prunus persica]
Length=139

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS++I+A+  + G+H +D++ +S  DP+WL + RK+E++II +WI
Sbjct  69   NGLRDPWSGGGVLKNISNSIVAIVAKEGAHHVDLMFKSSEDPEWLKDVRKQEIKIIAKWI  128

Query  186  TKYYADLQAL  215
            ++YY DL  L
Sbjct  129  SQYYHDLAQL  138



>ref|XP_003596267.1| Lysosomal Pro-X carboxypeptidase [Medicago truncatula]
 gb|AES66518.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=479

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVL NISD+++A+ T NG HC DI+   ++DP WL  QR  EVEII+ W
Sbjct  410  SNGLRDPYSSGGVLNNISDSLVALPTVNGYHCQDIVPAIESDPAWLVHQRNTEVEIIQSW  469

Query  183  ITKYYADL  206
            I KYY ++
Sbjct  470  IKKYYDEV  477



>ref|XP_002272152.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=493

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S+GGVL++ISD+++A+YT  G+HCLD+   + TDPDWL  Q+++EV+II  W
Sbjct  417  SNGLRDPYSAGGVLQDISDSVVAIYTDKGAHCLDLSTPTATDPDWLVSQQEKEVKIIGLW  476

Query  183  ITKYYADL  206
            + +Y A L
Sbjct  477  LAEYNARL  484



>gb|ACG41459.1| lysosomal Pro-X carboxypeptidase precursor [Zea mays]
Length=542

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD+   +K DPDWL EQR++EVEII+ W
Sbjct  470  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDLRSSTKGDPDWLIEQRRQEVEIIQGW  529

Query  183  ITKYYADL  206
            I +Y+ D+
Sbjct  530  IDQYHQDM  537



>ref|NP_001142279.1| uncharacterized protein LOC100274448 precursor [Zea mays]
 gb|ACF78774.1| unknown [Zea mays]
 gb|ACF88076.1| unknown [Zea mays]
 gb|AFW76174.1| putative serine peptidase S28 family protein [Zea mays]
Length=542

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD+   +K DPDWL EQR++EVEII+ W
Sbjct  470  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDLRSSTKGDPDWLIEQRRQEVEIIQGW  529

Query  183  ITKYYADL  206
            I +Y+ D+
Sbjct  530  IDQYHQDM  537



>ref|XP_002313554.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
 gb|EEE87509.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
Length=494

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S+GGVLE+ISD+++A+YT  GSHCLD+   + +DPDWL   R +E +II  W
Sbjct  422  SNGLRDPWSAGGVLEDISDSVVALYTEQGSHCLDLYPPTSSDPDWLLALRDKENKIIAYW  481

Query  183  ITKYYADLQALKK  221
            + +YYA L  +  
Sbjct  482  LAEYYAKLNYISN  494



>gb|KEH38910.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=510

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRN------GSHCLDILGESKTDPDWLTEQRKREV  164
            SNGL+DP+SS GVL ++S +++AV T N      GSHCLDIL   ++DP WL EQR +EV
Sbjct  425  SNGLKDPYSSAGVLHDLSKSLVAVPTINDINSIAGSHCLDILPSKESDPKWLIEQRNKEV  484

Query  165  EIIRRWITKYYADLQAL  215
            +II+ WI +YY DL AL
Sbjct  485  KIIQEWIAQYYIDLGAL  501



>ref|XP_004139280.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 ref|XP_004159394.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN60732.1| hypothetical protein Csa_2G008720 [Cucumis sativus]
Length=499

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL NIS +I+A+ T  G+H +D    +K DPDWL EQR++EVEII +W
Sbjct  425  SNGMQDPWSRGGVLRNISTSIVALVTEKGAHHVDFRSATKDDPDWLVEQRRQEVEIIHQW  484

Query  183  ITKYYADLQALKK  221
            I ++YAD++  KK
Sbjct  485  INEHYADMKQDKK  497



>gb|KHG26338.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=501

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL NIS TI+A+ T  G+H +D    +K DPDWL +QR++EVEII+RW
Sbjct  431  SNGMQDPWSRGGVLRNISATIIALVTEKGAHHVDFRAATKDDPDWLIQQRRQEVEIIQRW  490

Query  183  ITKYYADLQ  209
            + +YY DL+
Sbjct  491  LDEYYVDLR  499



>ref|XP_004489068.1| PREDICTED: uncharacterized protein LOC101510196 [Cicer arietinum]
Length=253

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SN L+D + + GVL +IS +++A++T NGSH LDILG  K+DP+WL +QRK+EV+I++RW
Sbjct  184  SNELKDSYGNAGVLNDISTSLVALHTINGSHVLDILGADKSDPNWLVDQRKKEVKIMKRW  243

Query  183  ITKYYA  200
            I +YYA
Sbjct  244  IAEYYA  249


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +3

Query  93   HCLDILGESKTDPDWLTEQRKREVEIIRRWITKYYA-DLQALKK  221
            H LDILG  K+DP W  +QRK+EV+I++RWI +YYA +L  L+K
Sbjct  24   HVLDILGADKSDPKWSVDQRKKEVKIMKRWIAEYYAVELVTLEK  67



>ref|XP_008661011.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=532

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD+   +K DPDW+TEQR++EVEII  W
Sbjct  461  SNGMRDPWSRGGVLKNISSSIVALVTEKGAHHLDLRSATKDDPDWVTEQRRQEVEIIHGW  520

Query  183  ITKYYADL  206
            I +YY D+
Sbjct  521  IDQYYRDM  528



>ref|XP_006408695.1| hypothetical protein EUTSA_v10001967mg [Eutrema salsugineum]
 gb|ESQ50148.1| hypothetical protein EUTSA_v10001967mg [Eutrema salsugineum]
Length=502

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE+ISD+I+A+ T+NGSHC DI  + K DP+WL  QR++E +II  W
Sbjct  428  SNGLSDPYSVGGVLEDISDSIVAIKTKNGSHCQDISLKRKGDPEWLVMQREKEFKIIESW  487

Query  183  ITKYYADLQAL  215
            I+ Y  DL+ L
Sbjct  488  ISMYQKDLRDL  498



>ref|XP_002438753.1| hypothetical protein SORBIDRAFT_10g025550 [Sorghum bicolor]
 gb|EER90120.1| hypothetical protein SORBIDRAFT_10g025550 [Sorghum bicolor]
Length=569

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S GGVL++IS +I+A+ T  G+H LD+   +K DPDW+ EQR++EVEII  W
Sbjct  498  SNGLRDPWSRGGVLKDISSSIVALVTEKGAHHLDLRSATKDDPDWVIEQRRQEVEIIHGW  557

Query  183  ITKYYADL  206
            I +Y+ D+
Sbjct  558  IDQYHQDM  565



>ref|XP_010247724.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=501

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S GGVL+NISD+++A+ T NGSHCLDIL ES  DP WL+ QR+ E+EII  W
Sbjct  430  SNGLRDPYSIGGVLQNISDSVVALATVNGSHCLDILSESPNDPKWLSMQRQSEIEIIEGW  489

Query  183  ITKYYADLQA  212
            I KYYADL A
Sbjct  490  IEKYYADLAA  499



>ref|XP_010419297.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=810

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S GGVL+NIS +I+A+ T+ G+H  D+   +K DP+WL EQR +EV II +W
Sbjct  424  SNGLQDPWSRGGVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKW  483

Query  183  ITKYYADLQALK  218
            I++YY DL+  +
Sbjct  484  ISEYYRDLRXFR  495


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 8/77 (10%)
 Frame = +3

Query  3    SNGLRDPFSSGG--------VLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKR  158
            SNGL+DP+S GG        VL+NIS +I+A+ T+ G+H  D+   +K DP+WL EQR +
Sbjct  731  SNGLQDPWSRGGSVLTSNFRVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQ  790

Query  159  EVEIIRRWITKYYADLQ  209
            EV II +WI++YY DL+
Sbjct  791  EVAIIEKWISEYYRDLR  807



>ref|XP_004965729.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=544

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD    +K DPDW+ EQR++EVEII+ W
Sbjct  472  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSATKGDPDWVIEQRRQEVEIIQGW  531

Query  183  ITKYYADL  206
            I +Y+ D+
Sbjct  532  IDQYHQDM  539



>ref|XP_010421083.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
Length=500

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE++SD+++A+ T NGSHC DI  +SK DP+WL  QR++E++II  W
Sbjct  426  SNGLSDPYSVGGVLEDLSDSVVAITTNNGSHCQDINLKSKGDPEWLVMQREKEIKIIDYW  485

Query  183  ITKYYADLQAL  215
            + KY  DL+ L
Sbjct  486  LLKYQKDLRDL  496



>gb|KFK43799.1| hypothetical protein AALP_AA1G174100 [Arabis alpina]
Length=497

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS++I+A+ T+ G+H  D+   +K DP+WL EQR++EV II +W
Sbjct  424  SNGMQDPWSRGGVLKNISNSIIALVTKKGAHHTDLRAATKYDPEWLKEQRRQEVAIIEKW  483

Query  183  ITKYYADLQ  209
            I +YY+DL+
Sbjct  484  INEYYSDLR  492



>ref|XP_006369367.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
 gb|ERP65936.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
Length=517

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AV T NGSHCLDIL   +TDP+WL  QRK E++II+ W
Sbjct  447  SNGLRDPYSSGGVLENISDTVVAVKTVNGSHCLDILFAKETDPEWLVTQRKIEIKIIKEW  506

Query  183  ITKYYADLQAL  215
            I KYY DL   
Sbjct  507  INKYYVDLTMF  517



>ref|XP_002523506.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38845.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+ DP+S GGVL+NIS +I+A+ T+ G+H +D    +K DP+WL E RK+E++II RW
Sbjct  427  SNGMEDPWSRGGVLKNISSSIIAIVTKKGAHHVDFRSATKDDPNWLKEMRKQEIQIIGRW  486

Query  183  ITKYYADLQ  209
            I +YYADL+
Sbjct  487  IDEYYADLK  495



>ref|XP_009127344.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brassica rapa]
Length=504

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S GGVL+NIS +I+A+ TR G+H  D+   +K DP+WL +QR++EV II +W
Sbjct  430  SNGLQDPWSGGGVLKNISSSIIALVTRKGAHHTDLRAATKDDPEWLKQQRRQEVAIIEKW  489

Query  183  ITKYYADLQ  209
            I++YY DL+
Sbjct  490  ISEYYNDLE  498



>ref|XP_007016020.1| Serine carboxypeptidase S28 family protein, putative [Theobroma 
cacao]
 gb|EOY33639.1| Serine carboxypeptidase S28 family protein, putative [Theobroma 
cacao]
Length=465

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLR+P+S+GGVL+NISD+++AVYT+ G+HCLD+   S +DPDWL  QR +E+ II  W
Sbjct  388  SNGLRNPWSAGGVLQNISDSVVAVYTKEGAHCLDLSNPSSSDPDWLVAQRDKEINIIGSW  447

Query  183  ITKYYADL  206
               Y   L
Sbjct  448  SEDYKVKL  455



>gb|ABR16397.1| unknown [Picea sitchensis]
Length=508

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVL+NISD+I+A+  + G HC DI   +  DP+WL EQR++E+ IIR+W
Sbjct  441  SNGLRDPYSSGGVLKNISDSIVAITAKEGVHCEDIRSSTNDDPNWLKEQRQKEINIIRKW  500

Query  183  ITKY  194
            I  Y
Sbjct  501  IIDY  504



>ref|XP_006343677.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=498

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T+ G+H +D   E+K DPDWL  QRK+EV II +W
Sbjct  428  SNGMQDPWSRGGVLKNISSSIVALVTQKGAHHVDFRSETKNDPDWLIMQRKQEVAIIEKW  487

Query  183  ITKYYADLQ  209
            + +YY DL+
Sbjct  488  LEEYYKDLK  496



>ref|XP_004242567.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Solanum lycopersicum]
Length=498

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T+ G+H +D   E+K DPDWL  QRK+EV II +W
Sbjct  428  SNGMQDPWSRGGVLKNISSSIVALVTQKGAHHVDFRSETKNDPDWLIMQRKQEVAIIEKW  487

Query  183  ITKYYADLQ  209
            + +YY DL+
Sbjct  488  LEEYYKDLK  496



>ref|XP_010493394.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
 ref|XP_010493396.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=501

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GG+LE+ISDT++A+ T NGSHC DI  +SK DP+WL  QR++E++II  W
Sbjct  428  SNGLSDPYSVGGILEDISDTVVAI-TTNGSHCQDITLKSKEDPEWLVRQREKEIKIIDSW  486

Query  183  ITKYYADLQAL  215
            I+ Y  DL+ L
Sbjct  487  ISTYQKDLRDL  497



>gb|KDO70538.1| hypothetical protein CISIN_1g0106562mg, partial [Citrus sinensis]
Length=137

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS T+LA+  + G+H +D+   +K DP WL + R+REVEII +WI
Sbjct  69   NGLRDPWSGGGVLKNISKTVLALVEKEGAHHVDLRFSTKEDPQWLKDVRRREVEIIGKWI  128

Query  186  TKYYADL  206
            ++Y+ DL
Sbjct  129  SQYFQDL  135



>gb|KCW84338.1| hypothetical protein EUGRSUZ_B01187, partial [Eucalyptus grandis]
Length=478

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKRE  161
            SNGLRDP+SSGG+L+NISDTI AVYT+ GSHCLDIL   + DP+WL  QRKRE
Sbjct  426  SNGLRDPYSSGGILKNISDTIDAVYTQKGSHCLDILASEQADPNWLVRQRKRE  478



>ref|XP_010047139.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Eucalyptus grandis]
 gb|KCW78947.1| hypothetical protein EUGRSUZ_C00378 [Eucalyptus grandis]
Length=502

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T  G+H +D    +K DP+WL EQRK+EV+II+ W
Sbjct  433  SNGMQDPWSRGGVLKNISASIVALVTEEGAHHVDFRFATKDDPNWLVEQRKQEVDIIQSW  492

Query  183  ITKYYADLQA  212
            I +YYADL++
Sbjct  493  IDEYYADLRS  502



>ref|XP_008779559.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Phoenix dactylifera]
Length=147

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL NIS +I+A+ T  G+H LD+   +K DP WL EQRK+E++II+ W
Sbjct  78   SNGMRDPWSRGGVLRNISSSIIALVTEKGAHHLDLRFATKDDPKWLLEQRKQEIDIIQSW  137

Query  183  ITKYYADLQ  209
            I +Y+ D +
Sbjct  138  IDQYHIDFK  146



>ref|XP_006388621.1| hypothetical protein POPTR_0135s00200g [Populus trichocarpa]
 gb|ERP47535.1| hypothetical protein POPTR_0135s00200g [Populus trichocarpa]
Length=496

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+SSGGVLENISDT++AV T NGSHCLDIL   + DP WL  QRK E++II+ W
Sbjct  426  SNGLRDPYSSGGVLENISDTVVAVKTVNGSHCLDILFAEENDPAWLVTQRKIEIKIIKEW  485

Query  183  ITKYYADL  206
            I KYYADL
Sbjct  486  INKYYADL  493



>gb|EMT22762.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=269

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD    +K DPDW+ EQR++EVEII  W
Sbjct  140  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGW  199

Query  183  ITKYYADLQAL  215
            I +Y  D+  +
Sbjct  200  IDQYNKDIAQM  210


 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +3

Query  39   VLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWITKYYADLQAL  215
            VL+NIS +I+A+ T  G+H LD    +K DPDW+ EQR++EVEII  WI +Y  D+  +
Sbjct  211  VLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGWIDQYNKDIAQM  269



>gb|EEE66119.1| hypothetical protein OsJ_22160 [Oryza sativa Japonica Group]
Length=393

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD    +K DPDW+ EQR++EV+II+ W
Sbjct  321  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVKIIQGW  380

Query  183  ITKYYADLQALKK  221
            I +Y  DL  + K
Sbjct  381  IDQYNEDLAQISK  393



>dbj|BAJ87416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD   E+K DPDW+ EQR++EVEII  W
Sbjct  454  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSETKDDPDWVVEQRRQEVEIIHGW  513

Query  183  ITKYYADLQAL  215
            I +Y  D+  +
Sbjct  514  IDQYNKDIAQM  524



>emb|CDY46135.1| BnaA04g14230D [Brassica napus]
Length=494

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T+ G+H  D+   +K DP+WL EQR++EV II +W
Sbjct  423  SNGMQDPWSRGGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIEKW  482

Query  183  ITKYYADLQ  209
            I++YY DL+
Sbjct  483  ISEYYRDLK  491



>emb|CDY28235.1| BnaA01g06140D [Brassica napus]
Length=135

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYT-RNGSHCLDILGESKTDPDWLTEQRKREVEIIRR  179
            SNGL+DP+S GGVL+NIS +I+A+ T + G+H  D+   +K DP+WL +QR++EV II +
Sbjct  53   SNGLQDPWSGGGVLKNISSSIIALVTIKAGAHHTDLRAATKDDPEWLKQQRRQEVAIIEK  112

Query  180  WITKYYADLQ  209
            WI++YY+DL+
Sbjct  113  WISEYYSDLE  122



>ref|XP_009140531.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=526

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S GGVL+NIS +I+A+ T+ G+H  D+   +K DP+WL EQR++EV I+ +W
Sbjct  455  SNGLQDPWSRGGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIVEKW  514

Query  183  ITKYYADLQ  209
            I++YY DL+
Sbjct  515  ISEYYRDLK  523



>emb|CDY09173.1| BnaA02g05990D [Brassica napus]
Length=517

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRN-GSHCLDILGESKTDPDWLTEQRKREVEIIRR  179
            SNGL DP+S GGVLE+ISD+++A+ + N GSHC DI+ + K DP+WL  QR +E++II  
Sbjct  442  SNGLSDPYSVGGVLEDISDSVVAIKSNNAGSHCQDIVMKMKGDPEWLVMQRDKEIKIIES  501

Query  180  WITKYYADLQAL  215
            WI+ Y  DL+AL
Sbjct  502  WISTYQKDLKAL  513



>ref|XP_010275727.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Nelumbo 
nucifera]
Length=491

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S G VL+NIS +I+A+ T  G+H +D    +K DPDWL EQR++EVEII+RW
Sbjct  423  SNGMQDPWSRGSVLKNISASIIALATEKGAHHVDFRSATKEDPDWLVEQRRQEVEIIQRW  482

Query  183  ITKYYADLQ  209
            I +Y++D +
Sbjct  483  INEYHSDFK  491



>ref|XP_006657192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=532

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I A+ T  G+H LD    +K DPDW+ EQR++EVEII+ W
Sbjct  460  SNGMRDPWSRGGVLKNISSSIFALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIQGW  519

Query  183  ITKYYADLQALKK  221
            I +Y  D+  + K
Sbjct  520  IDQYNKDIAQMSK  532



>dbj|BAJ92142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD   E+K DPDW+ EQR++EVEII  W
Sbjct  465  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSETKDDPDWVVEQRRQEVEIIHGW  524

Query  183  ITKYYADLQAL  215
            I +Y  D+  +
Sbjct  525  IDQYNKDIAQM  535



>ref|XP_010493392.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=353

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE++SD+++A+ T NGSHC DI  +SK DP+WL  QR+ E++II  W
Sbjct  279  SNGLSDPYSVGGVLEDLSDSVVAITTNNGSHCQDINLKSKGDPEWLVMQREEEIKIIDSW  338

Query  183  ITKYYADLQAL  215
            ++ Y  D++ L
Sbjct  339  LSTYQKDIRDL  349



>gb|ABK95653.1| unknown [Populus trichocarpa]
Length=213

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T  G+H +D    +K DP+WL E R++EVEII+ W
Sbjct  140  SNGMQDPWSRGGVLKNISSSIIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGW  199

Query  183  ITKYYADLQALKK  221
            I +YY DL+   K
Sbjct  200  IDQYYPDLKRTNK  212



>gb|KFK32665.1| serine carboxypeptidase s28 family protein [Arabis alpina]
Length=496

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T+ G+H  D+   +K DP+WL EQR +EV II +W
Sbjct  425  SNGMQDPWSRGGVLKNISSSIVALVTKKGAHHADLRAATKDDPEWLKEQRMQEVTIIEQW  484

Query  183  ITKYYADLQ  209
            IT+YY DL+
Sbjct  485  ITQYYKDLR  493



>ref|XP_009617834.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=497

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T+ G+H +D   E+K DPDWL  QRK+E+ II++W
Sbjct  427  SNGMQDPWSRGGVLKNISASIVALVTQKGAHHVDFRSETKNDPDWLIMQRKQEMAIIQKW  486

Query  183  ITKYYADLQ  209
            + +YY DL+
Sbjct  487  LEEYYIDLK  495



>ref|XP_002878742.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH55001.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=495

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T+ G+H  D+   +K DP+WL EQR++EV II +W
Sbjct  423  SNGMQDPWSRGGVLKNISSSIVALVTKKGAHHADLRAATKDDPEWLKEQRRQEVSIIEKW  482

Query  183  ITKYYADLQ  209
            I++YY DL+
Sbjct  483  ISEYYRDLR  491



>ref|XP_002438750.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
 gb|EER90117.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
Length=558

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD    +K DPDW+ EQR++EV+II+ W
Sbjct  486  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSSTKGDPDWVIEQRRQEVDIIQGW  545

Query  183  ITKYYADL  206
            I +Y+ D+
Sbjct  546  IDQYHQDM  553



>gb|KHG29529.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=492

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T  G+H +D    +K DP WL + RK+EVEII++W
Sbjct  425  SNGMQDPWSRGGVLKNISSSIIALVTEKGAHHVDFRSATKKDPKWLIQLRKQEVEIIQKW  484

Query  183  ITKYYADL  206
            + +YYADL
Sbjct  485  LNEYYADL  492



>ref|XP_006294084.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
 gb|EOA26982.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
Length=495

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S GGVL+NIS +I+A+ T+ G+H  D+   +K DP+WL EQR++EV II  W
Sbjct  424  SNGLQDPWSRGGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIENW  483

Query  183  ITKYYADLQ  209
            I++YY DL+
Sbjct  484  ISEYYRDLR  492



>ref|NP_850050.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL25591.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AAM98275.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AEC07556.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=494

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T+ G+H  D+   +K DP+WL EQR++EV II +W
Sbjct  423  SNGMQDPWSRGGVLKNISSSIVALVTKKGAHHADLRAATKDDPEWLKEQRRQEVAIIEKW  482

Query  183  ITKYYADLQ  209
            I++YY DL+
Sbjct  483  ISEYYRDLR  491



>emb|CDY20293.1| BnaC04g36630D [Brassica napus]
Length=492

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T+ G+H  D+   +K DP+WL EQR++EV II +W
Sbjct  423  SNGMQDPWSRGGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIEKW  482

Query  183  ITKYYADLQ  209
            I++YY D++
Sbjct  483  ISEYYRDMK  491



>ref|XP_010429398.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S GGVL+NIS +I+A+ T+ G+H  D+   +K DP+WL EQR +EV II +W
Sbjct  424  SNGLQDPWSRGGVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKW  483

Query  183  ITKYYADLQA  212
            I++YY DL+ 
Sbjct  484  ISEYYRDLRG  493



>ref|XP_010472431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S GGVL+NIS +I+A+ T+ G+H  D+   +K DP+WL EQR +EV II +W
Sbjct  424  SNGLQDPWSRGGVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKW  483

Query  183  ITKYYADLQA  212
            I++YY DL+ 
Sbjct  484  ISEYYRDLRG  493



>ref|XP_010525816.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=502

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T+ G+H  D+  E++ DPDWL EQR++EV II++W
Sbjct  433  SNGMQDPWSRGGVLKNISSSIIALVTKQGAHHADLRRETEEDPDWLKEQRRQEVAIIQKW  492

Query  183  ITKYYAD  203
            I +YY+D
Sbjct  493  IDEYYSD  499



>ref|NP_001058206.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAD37324.1| putative prolylcarboxypeptidase isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20120.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAG95990.1| unnamed protein product [Oryza sativa Japonica Group]
Length=539

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD    +K DPDW+ EQR++EV+II+ W
Sbjct  467  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVKIIQGW  526

Query  183  ITKYYADLQALKK  221
            I +Y  DL  + K
Sbjct  527  IDQYNEDLAQISK  539



>gb|EEC81080.1| hypothetical protein OsI_23902 [Oryza sativa Indica Group]
Length=539

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD    +K DPDW+ EQR++EV+II+ W
Sbjct  467  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVKIIQGW  526

Query  183  ITKYYADLQALKK  221
            I +Y  DL  + K
Sbjct  527  IDQYNEDLAQISK  539



>ref|XP_010651835.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=376

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S GGVL++IS++++AVYT  G+HCLD+     +DPDWL  QR +E++I+  W
Sbjct  306  SNGLRDPYSIGGVLQDISESVVAVYTLKGAHCLDLGTPMPSDPDWLVAQRDKEIKIVALW  365

Query  183  ITKYYA  200
            + +Y A
Sbjct  366  LAEYNA  371



>gb|KCW50731.1| hypothetical protein EUGRSUZ_J004041, partial [Eucalyptus grandis]
Length=346

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRK  155
            SNGLRDPFSS GVL+NISD+I+AVYT  G+HCLD+  E ++DPDWL  QRK
Sbjct  295  SNGLRDPFSSAGVLKNISDSIVAVYTEKGAHCLDVYAEDQSDPDWLVMQRK  345



>ref|XP_008243494.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=504

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS +I+A+  + G+H +D++ +S  DP+WL + RK+E++II +WI
Sbjct  434  NGLRDPWSGGGVLKNISKSIVAIVAKEGAHHVDLMFKSSEDPEWLQDVRKQEIKIIAKWI  493

Query  186  TKYYADLQAL  215
            ++YY DL  L
Sbjct  494  SQYYHDLAQL  503



>ref|XP_010493391.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
Length=500

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE++SD+++A+ T NGSHC DI  +SK DP+WL  QR+ E++II  W
Sbjct  426  SNGLSDPYSVGGVLEDLSDSVVAITTNNGSHCQDINLKSKGDPEWLVMQREEEIKIIDSW  485

Query  183  ITKYYADLQAL  215
            ++ Y  D++ L
Sbjct  486  LSTYQKDIRDL  496



>gb|EMS54706.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=632

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD    +K DPDW+ EQR++EVEII  W
Sbjct  562  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGW  621

Query  183  ITKY  194
            I +Y
Sbjct  622  IDQY  625



>emb|CBI17113.3| unnamed protein product [Vitis vinifera]
Length=623

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDP+S GGVL++IS++++AVYT  G+HCLD+     +DPDWL  QR +E++I+  W
Sbjct  424  SNGLRDPYSIGGVLQDISESVVAVYTLKGAHCLDLGTPMPSDPDWLVAQRDKEIKIVALW  483

Query  183  ITKYYA  200
            + +Y A
Sbjct  484  LAEYNA  489



>ref|XP_008659849.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=533

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD+   +  DPDW+TEQR++EVEII  W
Sbjct  462  SNGMRDPWSRGGVLKNISSSIVALVTEKGAHHLDLRFATDEDPDWVTEQRRQEVEIIEGW  521

Query  183  ITKYYADL  206
            I +Y+ D+
Sbjct  522  IDQYHRDM  529



>gb|EMT22761.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=539

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD    +K DPDW+ EQR++EVEII  W
Sbjct  469  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGW  528

Query  183  ITKYYADLQAL  215
            I +Y  D+  +
Sbjct  529  IDQYNKDIAQM  539



>emb|CDX68714.1| BnaC01g07390D [Brassica napus]
Length=390

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRN-GSHCLDILGESKTDPDWLTEQRKREVEIIRR  179
            SNGL+DP+S GGVL+NIS +I+A+ TR  G+H  D+   +K DP+WL +QR++EV II +
Sbjct  315  SNGLQDPWSGGGVLKNISSSIIALVTRKAGAHHTDLRAATKDDPEWLKQQRRQEVAIIEK  374

Query  180  WITKYYADLQ  209
            WI++YY DL+
Sbjct  375  WISEYYNDLE  384



>ref|XP_006287573.1| hypothetical protein CARUB_v10000783mg [Capsella rubella]
 gb|EOA20471.1| hypothetical protein CARUB_v10000783mg [Capsella rubella]
Length=502

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE+ISD+++A+ T  GSHC DI  + K DP+WL  QR++E++II  W
Sbjct  427  SNGLSDPYSVGGVLEDISDSVVAITTEKGSHCRDINSKKKDDPEWLVMQREKEIKIIDSW  486

Query  183  ITKYYADLQAL  215
            +  Y  DL+ L
Sbjct  487  LLTYQKDLRDL  497



>ref|XP_003563318.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=536

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD    +K DPDW+ EQR++EVEII+ W
Sbjct  464  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRTATKDDPDWVIEQRRQEVEIIQGW  523

Query  183  ITKYYADLQALKK  221
            I +Y  D+  + +
Sbjct  524  IDQYNKDIAHMSQ  536



>gb|KDP32459.1| hypothetical protein JCGZ_13384 [Jatropha curcas]
Length=503

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGLRDPFS GGVLE+ISD+++A+ T  G+HCLD+   +  D DWL  QR+ E+ II  W
Sbjct  410  SNGLRDPFSVGGVLEDISDSVVAIKTEKGAHCLDLYTATPNDSDWLVAQREEEINIIAHW  469

Query  183  ITKYYA  200
            I +Y A
Sbjct  470  IDEYNA  475



>ref|XP_002874097.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50356.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=501

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL DP+S GGVLE+ISDT++A+ T NGSHC DI  ++K DP WL  QR++E+++I  W
Sbjct  428  SNGLSDPYSVGGVLEDISDTVVAI-TTNGSHCQDISLKNKEDPQWLVMQREKEIKVIDSW  486

Query  183  ITKYYADLQAL  215
            I+ Y  DL+ L
Sbjct  487  ISTYQNDLRDL  497



>ref|XP_006436581.1| hypothetical protein CICLE_v10033696mg [Citrus clementina]
 gb|ESR49821.1| hypothetical protein CICLE_v10033696mg [Citrus clementina]
Length=506

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            S+GL DP+S+ GVLE+ISD+ILAV T+N     DIL   K DPDWLT QR+ EV I+  W
Sbjct  433  SSGLHDPYSTAGVLEDISDSILAVPTKN-----DILPAKKDDPDWLTMQRQVEVNIVHAW  487

Query  183  ITKYYADLQALKK  221
            I KYYADL  + K
Sbjct  488  ILKYYADLLQISK  500



>ref|XP_010246130.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=504

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVLE+IS +I+A+  + G+H +D+   +K DP+WL + RKREV IIR+W+
Sbjct  437  NGLRDPWSGGGVLESISKSIIAIVAKEGAHHVDLRFSTKEDPEWLRDVRKREVGIIRKWL  496

Query  186  TKYYADL  206
            ++YY DL
Sbjct  497  SQYYNDL  503



>gb|EMT03389.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=536

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD+   +K DPDW+ EQR++EVEII  W
Sbjct  407  SNGMRDPWSGGGVLKNISSSIIALVTEKGAHHLDLRSATKDDPDWVVEQRRQEVEIIHGW  466

Query  183  ITKYYAD  203
            I +Y  D
Sbjct  467  IDQYNKD  473


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  27   SSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWITKYYAD  203
            ++ GVL+NIS +I+A++T  G+H LD+   +K DPDW+ EQR++EVEII  WI +Y  D
Sbjct  474  TAQGVLKNISSSIIALFTDKGAHHLDLRSATKDDPDWVVEQRRQEVEIIHGWIDQYNKD  532



>ref|XP_011017986.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Populus 
euphratica]
Length=410

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +++A+ T  G+H +D    +K DP+WL E R++EVEII+ W
Sbjct  337  SNGMQDPWSRGGVLKNISSSVIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGW  396

Query  183  ITKYYADLQALKK  221
            I +YY DL+   K
Sbjct  397  IDQYYPDLKRTNK  409



>ref|XP_002324555.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
 gb|ABK95724.1| unknown [Populus trichocarpa]
 gb|EEF03120.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
Length=500

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T  G+H +D    +K DP+WL E R++EVEII+ W
Sbjct  427  SNGMQDPWSRGGVLKNISSSIIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGW  486

Query  183  ITKYYADLQALKK  221
            I +YY DL+   K
Sbjct  487  IDQYYPDLKRTNK  499



>ref|XP_009390988.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Musa acuminata subsp. 
malaccensis]
Length=506

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD    +K DP WL EQR+ EV+II+ W
Sbjct  437  SNGMRDPWSRGGVLKNISSSIIALVTPLGAHHLDFRAATKDDPKWLKEQRETEVKIIQAW  496

Query  183  ITKYYADLQ  209
            I +YY DL+
Sbjct  497  IDQYYEDLR  505



>gb|EMT03388.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=459

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL+NIS +I+A+ T  G+H LD+   +K DPDWL EQR++EV II  W
Sbjct  389  SNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDLRSATKDDPDWLVEQRRQEVGIIHGW  448

Query  183  ITKYYADLQAL  215
            I +Y  D+  +
Sbjct  449  IDQYNKDIAQM  459



>emb|CDP10200.1| unnamed protein product [Coffea canephora]
Length=496

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T  G+H +D    +  DP+WL +QR++EVEII++W
Sbjct  426  SNGMQDPWSRGGVLKNISSSIVALVTEKGAHHVDFRSATNKDPEWLIDQRRQEVEIIQKW  485

Query  183  ITKYYAD  203
            + +YYAD
Sbjct  486  LQEYYAD  492



>ref|XP_010932236.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Elaeis 
guineensis]
Length=400

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL NIS +I+A+ T  G+H LD+   +K DP WL EQRK+E++II+ W
Sbjct  331  SNGMRDPWSRGGVLRNISSSIIALVTEKGAHHLDLRYATKDDPKWLLEQRKQEIDIIQSW  390

Query  183  ITKYYADLQ  209
            I +Y+ D +
Sbjct  391  IDQYHIDFK  399



>ref|XP_006481710.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=505

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS T+LA+  + G+H +D+   +K DP WL + R+REVEII +WI
Sbjct  437  NGLRDPWSGGGVLKNISKTVLALVEKEGAHHVDLRFSTKEDPQWLKDVRRREVEIIGKWI  496

Query  186  TKYYADL  206
            ++Y+ DL
Sbjct  497  SQYFQDL  503



>gb|KHN33176.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=420

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS+TI+A+  + G+H +D+   +  DP+WL + RKRE++II  WI
Sbjct  351  NGLRDPWSGGGVLKNISETIVAIVAKEGAHHVDLRFSTTEDPEWLKDIRKREIKIIANWI  410

Query  186  TKYYADL  206
            ++YY DL
Sbjct  411  SQYYQDL  417



>emb|CBI18675.3| unnamed protein product [Vitis vinifera]
Length=502

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S G VL+NIS +I+A+ T+ G+H +D    +K DPDWL EQR++EVEI+++W
Sbjct  433  SNGMQDPWSRGSVLKNISASIVALVTKKGAHHVDFRFATKEDPDWLIEQRRQEVEILQKW  492

Query  183  ITKYYADLQ  209
            I  Y ADL+
Sbjct  493  IHDYNADLK  501



>ref|XP_003633162.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=488

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S G VL+NIS +I+A+ T+ G+H +D    +K DPDWL EQR++EVEI+++W
Sbjct  419  SNGMQDPWSRGSVLKNISASIVALVTKKGAHHVDFRFATKEDPDWLIEQRRQEVEILQKW  478

Query  183  ITKYYADLQ  209
            I  Y ADL+
Sbjct  479  IHDYNADLK  487



>ref|XP_011017985.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Populus 
euphratica]
Length=500

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +++A+ T  G+H +D    +K DP+WL E R++EVEII+ W
Sbjct  427  SNGMQDPWSRGGVLKNISSSVIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGW  486

Query  183  ITKYYADLQALKK  221
            I +YY DL+   K
Sbjct  487  IDQYYPDLKRTNK  499



>ref|XP_011046918.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=504

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVLENIS +I+A+  + G+H +D+   +  DP WL + RKREV II +W+
Sbjct  434  NGLRDPWSGGGVLENISSSIVAIVAKQGAHHVDLRFATSEDPKWLQDVRKREVSIIAKWL  493

Query  186  TKYYADL  206
            +KYY DL
Sbjct  494  SKYYDDL  500



>ref|XP_010932235.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Elaeis 
guineensis]
Length=525

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG+RDP+S GGVL NIS +I+A+ T  G+H LD+   +K DP WL EQRK+E++II+ W
Sbjct  456  SNGMRDPWSRGGVLRNISSSIIALVTEKGAHHLDLRYATKDDPKWLLEQRKQEIDIIQSW  515

Query  183  ITKYYADLQ  209
            I +Y+ D +
Sbjct  516  IDQYHIDFK  524



>ref|XP_006430123.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
 gb|ESR43363.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
Length=505

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS T+LA+  + G+H +D+   +K DP WL + R+REVEI+ +WI
Sbjct  437  NGLRDPWSGGGVLKNISKTVLALVEKEGAHHVDLRFSTKEDPQWLKDVRRREVEIVGKWI  496

Query  186  TKYYADL  206
            ++Y+ DL
Sbjct  497  SQYFQDL  503



>ref|XP_006404933.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
 dbj|BAJ33970.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46386.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
Length=494

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T+ G+H  D+   SK DP+WL EQR++EV II +W
Sbjct  423  SNGMQDPWSRGGVLKNISSSIIALVTKKGAHHADLRAASKGDPEWLKEQRRQEVAIIEKW  482

Query  183  ITKYYADLQ  209
            I++Y+  L+
Sbjct  483  ISEYHRALR  491



>ref|XP_003521479.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=504

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS+TI+A+  + G+H +D+   +  DP+WL + RKRE++II  WI
Sbjct  435  NGLRDPWSGGGVLKNISETIVAIVAKEGAHHVDLRFSTTEDPEWLKDIRKREIKIIANWI  494

Query  186  TKYYADL  206
            ++YY DL
Sbjct  495  SQYYQDL  501



>ref|XP_009767201.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=497

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T+ G+H +D   E+K DP WL  QRK+E  II++W
Sbjct  427  SNGMQDPWSRGGVLKNISASIVALVTQKGAHHVDFRSETKNDPGWLIMQRKQEAAIIQKW  486

Query  183  ITKYYADLQ  209
            + +YY DL+
Sbjct  487  LEEYYRDLK  495



>ref|XP_008350184.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=514

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS +I+A+  + G+H +D+  ++  DPDWL E RK+E+ II  WI
Sbjct  444  NGLRDPWSGGGVLKNISKSIVAIVAKEGAHHVDLRFKNSEDPDWLKEVRKQEINIIGNWI  503

Query  186  TKYYADLQAL  215
            ++YY DL  L
Sbjct  504  SQYYHDLAQL  513



>ref|XP_010093782.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB54615.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=400

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS +I+A+  + G+H +D+   +K DP+WL E RK+E+ II  WI
Sbjct  329  NGLRDPWSGGGVLKNISRSIVAIVAKEGAHHVDLRFSTKEDPEWLKEVRKQEINIIAGWI  388

Query  186  TKYYADLQAL  215
            ++YY DL  L
Sbjct  389  SQYYHDLAHL  398



>gb|KEH24169.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS T++A+  + G+H +D+   +K DP+WL + RK+EV+II  WI
Sbjct  432  NGLRDPWSGGGVLKNISKTLIAIVAKEGAHHVDLRFSTKEDPEWLKDVRKQEVKIITSWI  491

Query  186  TKYYADL  206
            ++YY DL
Sbjct  492  SQYYQDL  498



>gb|EYU25337.1| hypothetical protein MIMGU_mgv1a004964mg [Erythranthe guttata]
Length=502

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNGL+DP+S G VL+NIS +I+A+    G+H  D+   ++ DPDWL EQRK+E+EII++W
Sbjct  431  SNGLQDPWSRGSVLKNISTSIVALVAEKGAHHTDLRRATRKDPDWLIEQRKQEIEIIQKW  490

Query  183  ITKYYADLQ  209
            I+ YY D++
Sbjct  491  ISDYYIDIK  499



>gb|KHN02193.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=506

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S+GGVL+ IS TI+A+  + G+H +D+   SK DP WL + RK+EV II  WI
Sbjct  436  NGLRDPWSAGGVLKTISKTIVAIVAKKGAHHVDLRYSSKEDPQWLKDVRKQEVNIIASWI  495

Query  186  TKYYADLQA  212
            ++Y+ DLQ+
Sbjct  496  SQYHQDLQS  504



>ref|XP_006604647.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=508

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S+GGVL+ IS TI+A+  + G+H +D+   SK DP WL + RK+EV II  WI
Sbjct  438  NGLRDPWSAGGVLKTISKTIVAIVAKKGAHHVDLRYSSKEDPQWLKDVRKQEVNIIASWI  497

Query  186  TKYYADLQA  212
            ++Y+ DLQ+
Sbjct  498  SQYHQDLQS  506



>gb|KEH24168.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=467

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS TI+A+  + G+H +D+   +K DP WL + RK+EV+II  WI
Sbjct  398  NGLRDPWSGGGVLKNISKTIIAIVAKEGAHHVDLRYSTKEDPKWLKDVRKQEVKIIESWI  457

Query  186  TKYYADL  206
            ++Y+ DL
Sbjct  458  SQYHQDL  464



>ref|XP_009372536.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=514

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS +I+A+  + G+H +D+  ++  DP+WL E RK+E+ II  WI
Sbjct  444  NGLRDPWSGGGVLKNISKSIVAIVAKEGAHHVDLRFKNSEDPEWLKEVRKQEINIIGNWI  503

Query  186  TKYYADLQAL  215
            ++YY DL  L
Sbjct  504  SQYYHDLAQL  513



>dbj|BAJ86079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=526

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SN +RDP+S GGVL+NIS +I+A+ T  G+H LD    +K DPDW+ EQR++EVEII  W
Sbjct  456  SNEMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGW  515

Query  183  ITKYYADLQAL  215
            I +Y  D+  +
Sbjct  516  IDQYNKDIAQM  526



>ref|XP_002308456.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
 gb|EEE91979.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
Length=504

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVLENIS +I+A+  + G+H +D+   +  DP WL + RKREV II +W+
Sbjct  434  NGLRDPWSGGGVLENISSSIVAIIAKQGAHHVDLRFATSEDPKWLQDVRKREVSIIAKWL  493

Query  186  TKYYADL  206
            ++YY DL
Sbjct  494  SEYYDDL  500



>gb|KDP38645.1| hypothetical protein JCGZ_03998 [Jatropha curcas]
Length=501

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S GGVL+NIS +I+A+ T  G+H +D     K DP WL E R +EVEII +W
Sbjct  427  SNGMQDPWSRGGVLKNISSSIIALVTDKGAHHVDFRSSMKDDPYWLRELRSQEVEIISKW  486

Query  183  ITKYYADLQ  209
            I +YYADL+
Sbjct  487  IDEYYADLK  495



>ref|XP_007162943.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
 gb|ESW34937.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
Length=506

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS TI+A+  + G+H +D+   +K DP WL + R++EV II  WI
Sbjct  436  NGLRDPWSGGGVLKNISKTIVAIVEKRGAHHVDLRYSAKEDPKWLKDVRRQEVNIIASWI  495

Query  186  TKYYADLQA  212
            ++YY DL +
Sbjct  496  SQYYQDLHS  504



>emb|CBI30345.3| unnamed protein product [Vitis vinifera]
Length=485

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVLE+IS +I+A+  ++G+H +D+   +  DP+WL + RKREV+II +W 
Sbjct  414  NGLRDPWSGGGVLESISKSIVAIVAKDGAHHVDLRFATSEDPEWLQDVRKREVKIITKWF  473

Query  186  TKYYADL  206
            ++YY DL
Sbjct  474  SEYYHDL  480



>gb|KEH24167.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    NGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRWI  185
            NGLRDP+S GGVL+NIS TI+A+  + G+H +D+   +K DP WL + RK+EV+II  WI
Sbjct  432  NGLRDPWSGGGVLKNISKTIIAIVAKEGAHHVDLRYSTKEDPKWLKDVRKQEVKIIESWI  491

Query  186  TKYYADL  206
            ++Y+ DL
Sbjct  492  SQYHQDL  498



>gb|KDO39485.1| hypothetical protein CISIN_1g0453072mg, partial [Citrus sinensis]
Length=61

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = +3

Query  39   VLENISDTILAVYTRNGSHCLDIL-GESKTDPDWLTEQRKREVEIIRRWITKYYADLQAL  215
            VLE+IS++++A++T N SHCLDIL     +DPDWL  +RK EVEII  WI+KYY DL+A+
Sbjct  1    VLEDISESVVAIHTVNCSHCLDILRANQDSDPDWLVMRRKAEVEIIEGWISKYYVDLKAV  60

Query  216  K  218
            +
Sbjct  61   Q  61



>ref|XP_002869352.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45611.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=497

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG++DP+S  GVL+NIS +I+A  T+ G+H  D+   +K DP+WL EQR++EV  I +W
Sbjct  423  SNGMQDPWSREGVLKNISSSIIAFVTKKGAHHTDLRAATKDDPEWLKEQRRQEVAEIEKW  482

Query  183  ITKYYADLQ  209
            I++YY+DL+
Sbjct  483  ISEYYSDLR  491



>ref|XP_004293172.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=522

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    SNGLRDPFSSGGVLENISDTILAVYTRNGSHCLDILGESKTDPDWLTEQRKREVEIIRRW  182
            SNG RDPFS+ GVL NIS +++AV T  GSHCLDIL     DP WL  QR  E+ II  W
Sbjct  448  SNGRRDPFSAAGVLTNISPSVVAVTTSQGSHCLDILPARINDPRWLVLQRNIELGIIAGW  507

Query  183  ITKYYADLQ  209
            I  YY DL+
Sbjct  508  IRNYYNDLR  516



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 546027848226