BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22309_g1_i1 len=514 path=[1491:0-83 1575:84-132 1624:133-288
1021:289-513]

Length=514
                                                                      Score     E

ref|XP_004250994.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    251   1e-77   
emb|CAN64374.1|  hypothetical protein VITISV_018664                     250   4e-77   Vitis vinifera
ref|XP_002271797.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        250   4e-77   Vitis vinifera
ref|XP_006349128.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    249   1e-76   
ref|XP_006349129.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    247   2e-76   
ref|XP_004251370.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    244   6e-75   
ref|XP_010651746.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    242   1e-74   
ref|XP_009631310.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        243   2e-74   
ref|XP_011089978.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    242   4e-74   
ref|XP_002271961.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    242   4e-74   Vitis vinifera
emb|CBI17109.3|  unnamed protein product                                249   8e-74   
ref|XP_009785587.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    241   9e-74   
emb|CAN63232.1|  hypothetical protein VITISV_004830                     240   1e-73   Vitis vinifera
emb|CBI17112.3|  unnamed protein product                                241   7e-73   
emb|CBI17110.3|  unnamed protein product                                235   1e-72   
ref|XP_009779688.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    238   2e-72   
ref|XP_007016017.1|  Serine carboxypeptidase S28 family protein         237   3e-72   
emb|CDP17394.1|  unnamed protein product                                236   1e-71   
gb|KDO44733.1|  hypothetical protein CISIN_1g0127112mg                  228   2e-71   
ref|XP_006484933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    231   6e-70   
gb|EYU36116.1|  hypothetical protein MIMGU_mgv1a004675mg                231   8e-70   
ref|XP_006424403.1|  hypothetical protein CICLE_v10028401mg             228   3e-69   
ref|XP_002271733.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        223   7e-67   Vitis vinifera
gb|KDP43933.1|  hypothetical protein JCGZ_05400                         219   2e-66   
ref|XP_006424402.1|  hypothetical protein CICLE_v10030021mg             217   2e-65   
ref|XP_006485140.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    218   4e-65   
ref|XP_002523754.1|  Lysosomal Pro-X carboxypeptidase, putative         218   8e-65   Ricinus communis
gb|KDO44732.1|  hypothetical protein CISIN_1g010487mg                   218   9e-65   
ref|XP_002270231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        218   1e-64   Vitis vinifera
ref|XP_010267352.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    218   1e-64   
gb|KHG27095.1|  Lysosomal Pro-X carboxypeptidase                        216   8e-64   
ref|XP_006495097.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    214   2e-63   
ref|XP_002315345.1|  hypothetical protein POPTR_0010s23860g             214   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_006424415.1|  hypothetical protein CICLE_v10028929mg             208   2e-63   
gb|KDO55292.1|  hypothetical protein CISIN_1g036751mg                   212   9e-63   
emb|CAN65360.1|  hypothetical protein VITISV_036071                     214   1e-62   Vitis vinifera
ref|XP_010247711.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    212   1e-62   
ref|XP_008458664.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    210   2e-62   
gb|KHN27695.1|  Lysosomal Pro-X carboxypeptidase                        211   5e-62   
ref|XP_008458663.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    210   5e-62   
ref|XP_007016019.1|  Serine carboxypeptidase S28 family protein, ...    209   7e-62   
ref|XP_007016018.1|  Serine carboxypeptidase S28 family protein         209   1e-61   
ref|XP_006573176.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    207   3e-61   
gb|KHN44803.1|  Lysosomal Pro-X carboxypeptidase                        207   3e-61   
ref|XP_003539445.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    208   4e-61   
ref|XP_004145770.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    208   4e-61   
ref|XP_003517871.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    208   4e-61   
ref|XP_011005419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    207   6e-61   
ref|XP_011036743.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    207   9e-61   
ref|XP_007150128.1|  hypothetical protein PHAVU_005G129100g             207   1e-60   
ref|XP_006424417.1|  hypothetical protein CICLE_v10028252mg             207   1e-60   
emb|CDP14439.1|  unnamed protein product                                205   5e-60   
ref|XP_009591854.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    202   7e-60   
ref|XP_010247724.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    204   1e-59   
ref|XP_002324914.2|  hypothetical protein POPTR_0018s02600g             204   1e-59   Populus trichocarpa [western balsam poplar]
gb|KDP43936.1|  hypothetical protein JCGZ_05403                         204   2e-59   
ref|XP_002523752.1|  Lysosomal Pro-X carboxypeptidase, putative         203   3e-59   Ricinus communis
emb|CDP07008.1|  unnamed protein product                                201   2e-58   
ref|XP_008226847.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    201   2e-58   
gb|KEH38910.1|  lysosomal pro-X carboxypeptidase-like protein           201   3e-58   
ref|XP_004295650.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    200   4e-58   
ref|XP_006436581.1|  hypothetical protein CICLE_v10033696mg             200   6e-58   
ref|XP_006485332.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    200   7e-58   
ref|XP_009356965.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    197   2e-57   
ref|XP_009356983.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    198   2e-57   
ref|XP_006378926.1|  hypothetical protein POPTR_0009s00740g             196   4e-57   
ref|XP_009356964.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    197   4e-57   
ref|XP_010100142.1|  Lysosomal Pro-X carboxypeptidase                   198   6e-57   
ref|XP_002313555.2|  hypothetical protein POPTR_0009s00740g             196   9e-57   Populus trichocarpa [western balsam poplar]
ref|XP_006487982.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    196   1e-56   
ref|XP_007153468.1|  hypothetical protein PHAVU_003G038000g             196   1e-56   
ref|XP_006388621.1|  hypothetical protein POPTR_0135s00200g             196   2e-56   
ref|XP_002874100.1|  hypothetical protein ARALYDRAFT_910290             194   4e-56   
gb|KCW50727.1|  hypothetical protein EUGRSUZ_J00403                     194   5e-56   
emb|CDP07009.1|  unnamed protein product                                193   6e-56   
ref|XP_008458666.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    191   6e-56   
gb|KDP43937.1|  hypothetical protein JCGZ_05404                         194   8e-56   
gb|KCW50732.1|  hypothetical protein EUGRSUZ_J00405                     193   9e-56   
ref|XP_010034183.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    194   9e-56   
ref|XP_010031429.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    194   9e-56   
ref|XP_006369365.1|  hypothetical protein POPTR_0001s220902g            193   1e-55   
ref|XP_006369368.1|  hypothetical protein POPTR_0001s220902g            193   1e-55   
ref|XP_010535638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        193   2e-55   
ref|XP_006369367.1|  hypothetical protein POPTR_0001s220902g            193   3e-55   
ref|XP_004145824.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    192   3e-55   
ref|XP_004160098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    192   3e-55   
gb|KGN46898.1|  hypothetical protein Csa_6G149390                       192   4e-55   
gb|KFK27606.1|  hypothetical protein AALP_AA8G405500                    192   5e-55   
ref|XP_011005420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    192   5e-55   
gb|KFK27605.1|  hypothetical protein AALP_AA8G405500                    192   6e-55   
ref|XP_007150133.1|  hypothetical protein PHAVU_005G129500g             190   6e-55   
ref|XP_007207893.1|  hypothetical protein PRUPE_ppa021011mg             191   8e-55   
ref|XP_007208680.1|  hypothetical protein PRUPE_ppa025450mg             192   9e-55   
emb|CBI17114.3|  unnamed protein product                                189   9e-55   
ref|XP_008458665.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    191   1e-54   
ref|XP_006369363.1|  hypothetical protein POPTR_0001s22060g             192   2e-54   
ref|XP_002272152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        190   3e-54   Vitis vinifera
ref|XP_008228032.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    190   4e-54   
ref|XP_006408695.1|  hypothetical protein EUTSA_v10001967mg             189   8e-54   
ref|XP_006424410.1|  hypothetical protein CICLE_v10030022mg             187   9e-54   
ref|XP_009126572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        189   1e-53   
gb|KCW50731.1|  hypothetical protein EUGRSUZ_J004041                    184   2e-53   
ref|XP_006287573.1|  hypothetical protein CARUB_v10000783mg             187   2e-53   
ref|XP_004487553.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   3e-53   
gb|KCW50737.1|  hypothetical protein EUGRSUZ_J00408                     187   5e-53   
gb|KCW84338.1|  hypothetical protein EUGRSUZ_B01187                     186   5e-53   
ref|XP_010493392.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    183   5e-53   
ref|XP_010031434.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   6e-53   
ref|XP_002874097.1|  serine carboxypeptidase S28 family protein         186   6e-53   
ref|XP_006488629.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    186   7e-53   
ref|XP_010036093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    186   8e-53   
emb|CAN64373.1|  hypothetical protein VITISV_018663                     189   8e-53   Vitis vinifera
ref|NP_197677.2|  Serine carboxypeptidase S28 family protein            185   9e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010260171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    186   1e-52   
ref|XP_010493397.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    184   1e-52   
gb|KCW50735.1|  hypothetical protein EUGRSUZ_J00406                     181   1e-52   
ref|XP_008360161.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    179   1e-52   
ref|XP_010651835.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    182   1e-52   
ref|XP_002523751.1|  lysosomal pro-X carboxypeptidase, putative         185   1e-52   Ricinus communis
ref|XP_010527988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    185   2e-52   
ref|XP_010454563.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    185   2e-52   
ref|XP_003596267.1|  Lysosomal Pro-X carboxypeptidase                   185   2e-52   
ref|XP_010421084.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    184   2e-52   
ref|XP_010493394.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    185   2e-52   
gb|AAM61502.1|  prolylcarboxypeptidase-like protein                     185   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851059.1|  Serine carboxypeptidase S28 family protein            185   3e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KCW50736.1|  hypothetical protein EUGRSUZ_J00407                     180   4e-52   
ref|XP_002523750.1|  Lysosomal Pro-X carboxypeptidase, putative         184   4e-52   Ricinus communis
ref|XP_010421083.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    184   5e-52   
ref|XP_010100139.1|  Lysosomal Pro-X carboxypeptidase                   186   5e-52   
ref|XP_002313554.2|  hypothetical protein POPTR_0009s00750g             184   6e-52   Populus trichocarpa [western balsam poplar]
ref|XP_006287572.1|  hypothetical protein CARUB_v10000782mg             184   7e-52   
ref|XP_006424411.1|  hypothetical protein CICLE_v10028519mg             181   9e-52   
ref|XP_010493391.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    183   1e-51   
ref|XP_010031432.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    182   3e-51   
gb|KDP45057.1|  hypothetical protein JCGZ_01557                         179   4e-51   
emb|CBI17113.3|  unnamed protein product                                183   5e-51   
ref|XP_008458662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    181   7e-51   
ref|XP_006484928.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    173   7e-51   
ref|XP_011004990.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    181   1e-50   
ref|XP_010031433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    180   1e-50   
emb|CDX71016.1|  BnaC03g11000D                                          178   1e-50   
ref|XP_006424416.1|  hypothetical protein CICLE_v10028929mg             173   2e-50   
ref|XP_011005221.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    180   2e-50   
ref|XP_010267351.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    178   4e-50   
emb|CDY09173.1|  BnaA02g05990D                                          179   4e-50   
ref|XP_010034145.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    175   1e-48   
ref|XP_004160099.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    175   1e-48   
ref|XP_006436577.1|  hypothetical protein CICLE_v10033555mg             170   2e-48   
emb|CDY09174.1|  BnaA02g06000D                                          174   3e-48   
ref|XP_004145825.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    174   3e-48   
ref|XP_006485136.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    174   4e-48   
ref|XP_002874098.1|  serine carboxypeptidase S28 family protein         172   5e-48   
gb|KDO44737.1|  hypothetical protein CISIN_1g038117mg                   173   5e-48   
ref|XP_006485335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    172   9e-48   
ref|XP_006436579.1|  hypothetical protein CICLE_v10033867mg             170   2e-47   
ref|XP_010031430.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    170   8e-47   
ref|XP_006424406.1|  hypothetical protein CICLE_v10030241mg             170   8e-47   
ref|XP_010100140.1|  Lysosomal Pro-X carboxypeptidase                   169   1e-46   
ref|XP_004139566.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    166   1e-46   
ref|XP_007150129.1|  hypothetical protein PHAVU_005G1292001g            163   2e-46   
ref|XP_010031431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    169   2e-46   
ref|XP_004295648.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    169   2e-46   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                    173   3e-46   
gb|KCW50722.1|  hypothetical protein EUGRSUZ_J00400                     169   3e-46   
ref|XP_006286678.1|  hypothetical protein CARUB_v10002667mg             166   7e-46   
gb|ABR17702.1|  unknown                                                 167   1e-45   Picea sitchensis
ref|XP_004172321.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    166   2e-45   
gb|KCW50493.1|  hypothetical protein EUGRSUZ_J00219                     164   1e-44   
gb|KDP32459.1|  hypothetical protein JCGZ_13384                         164   1e-44   
gb|KCW50433.1|  hypothetical protein EUGRSUZ_J00172                     163   4e-44   
ref|XP_010034149.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    164   5e-44   
ref|XP_006369369.1|  hypothetical protein POPTR_0001s220902g            159   3e-43   
gb|KCW50728.1|  hypothetical protein EUGRSUZ_J00403                     159   4e-43   
ref|XP_007016020.1|  Serine carboxypeptidase S28 family protein, ...    159   4e-43   
ref|XP_007155791.1|  hypothetical protein PHAVU_003G232100g             154   4e-41   
gb|KDP32128.1|  hypothetical protein JCGZ_12589                         155   4e-41   
ref|XP_007155790.1|  hypothetical protein PHAVU_003G232100g             154   6e-41   
gb|KDO78803.1|  hypothetical protein CISIN_1g0096312mg                  152   2e-40   
ref|XP_010910623.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    150   3e-40   
ref|XP_006466409.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    152   3e-40   
ref|XP_004509045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    152   5e-40   
ref|XP_010254367.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    151   5e-40   
ref|XP_006426159.1|  hypothetical protein CICLE_v10025375mg             151   9e-40   
ref|XP_010683431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        150   1e-39   
ref|XP_003549991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    150   1e-39   
ref|XP_001776094.1|  predicted protein                                  150   2e-39   
ref|XP_010943424.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        149   3e-39   
ref|XP_009406760.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    149   3e-39   
gb|KCW50734.1|  hypothetical protein EUGRSUZ_J00406                     149   4e-39   
emb|CDY45627.1|  BnaCnng13350D                                          148   1e-38   
emb|CDM83096.1|  unnamed protein product                                147   2e-38   
ref|XP_010254368.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    147   2e-38   
ref|XP_008798888.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    147   2e-38   
ref|XP_002310325.2|  hypothetical protein POPTR_0007s14600g             147   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006380821.1|  hypothetical protein POPTR_0007s14600g             147   2e-38   
ref|XP_006408697.1|  hypothetical protein EUTSA_v10002179mg             145   3e-38   
ref|XP_010254366.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    146   4e-38   
ref|XP_010932236.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    145   5e-38   
ref|XP_004293172.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    146   5e-38   
gb|EMT33353.1|  Lysosomal Pro-X carboxypeptidase                        144   5e-38   
ref|XP_011031335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        146   5e-38   
ref|XP_006280309.1|  hypothetical protein CARUB_v10026232mg             146   6e-38   
ref|XP_004970093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    146   6e-38   
gb|EMS49104.1|  Lysosomal Pro-X carboxypeptidase                        146   7e-38   
ref|XP_010023346.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    145   8e-38   
ref|XP_006436573.1|  hypothetical protein CICLE_v10033642mg             142   8e-38   
ref|NP_001136852.1|  uncharacterized protein LOC100217003               142   8e-38   Zea mays [maize]
ref|XP_009150668.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        145   9e-38   
emb|CDY08753.1|  BnaA06g24710D                                          145   9e-38   
gb|AIA26578.1|  serine protease                                         144   9e-38   
gb|KFK28424.1|  hypothetical protein AALP_AA8G512800                    145   9e-38   
ref|XP_006424409.1|  hypothetical protein CICLE_v10030113mg             145   1e-37   
ref|XP_002864979.1|  serine carboxypeptidase S28 family protein         144   2e-37   
ref|XP_010932235.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    144   2e-37   
ref|NP_001044360.1|  Os01g0767100                                       144   2e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010444594.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    144   3e-37   
gb|EAY75958.1|  hypothetical protein OsI_03875                          144   3e-37   Oryza sativa Indica Group [Indian rice]
gb|EAZ13666.1|  hypothetical protein OsJ_03583                          144   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009390988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        144   4e-37   
ref|XP_006393989.1|  hypothetical protein EUTSA_v10003988mg             144   4e-37   
dbj|BAB10683.1|  lysosomal Pro-X carboxypeptidase                       143   6e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201377.2|  Serine carboxypeptidase S28 family protein            143   6e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAL77662.1|  AT5g65760/MPA24_11                                      143   6e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406759.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    143   7e-37   
ref|XP_010463531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    143   7e-37   
ref|XP_008654499.1|  PREDICTED: uncharacterized protein LOC100217...    143   8e-37   
gb|AFW84965.1|  putative serine peptidase S28 family protein            143   8e-37   
ref|XP_002458558.1|  hypothetical protein SORBIDRAFT_03g035680          142   9e-37   Sorghum bicolor [broomcorn]
ref|XP_009342192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    142   1e-36   
ref|XP_006646360.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    142   1e-36   
gb|AGT17295.1|  hypothetical protein SHCRBa_168_J15_F_160               142   2e-36   
dbj|BAK01568.1|  predicted protein                                      142   2e-36   
gb|ABR16397.1|  unknown                                                 140   6e-36   Picea sitchensis
ref|XP_006657192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    140   6e-36   
ref|XP_006404933.1|  hypothetical protein EUTSA_v10000143mg             140   6e-36   
gb|EEC81080.1|  hypothetical protein OsI_23902                          140   7e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_002878742.1|  serine carboxypeptidase S28 family protein         139   1e-35   
gb|EEE66119.1|  hypothetical protein OsJ_22160                          138   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010275727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   2e-35   
ref|XP_010429398.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   2e-35   
ref|XP_007205162.1|  hypothetical protein PRUPE_ppa005445mg             138   2e-35   
ref|XP_010275726.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   2e-35   
ref|XP_010472431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   2e-35   
ref|XP_010023342.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   2e-35   
ref|XP_002438750.1|  hypothetical protein SORBIDRAFT_10g025520          139   2e-35   Sorghum bicolor [broomcorn]
ref|NP_850050.1|  alpha/beta-Hydrolases superfamily protein             138   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009140531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   3e-35   
emb|CDY20293.1|  BnaC04g36630D                                          138   3e-35   
ref|XP_010518734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        138   3e-35   
ref|XP_004288288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    138   3e-35   
ref|XP_006294084.1|  hypothetical protein CARUB_v10023078mg             138   3e-35   
ref|XP_006343677.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    138   4e-35   
ref|NP_001058206.1|  Os06g0647400                                       138   5e-35   Oryza sativa Japonica Group [Japonica rice]
gb|KFK32665.1|  serine carboxypeptidase s28 family protein              137   5e-35   
ref|XP_008237071.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        137   6e-35   
ref|XP_002523506.1|  lysosomal pro-X carboxypeptidase, putative         137   8e-35   Ricinus communis
emb|CBI18675.3|  unnamed protein product                                137   9e-35   
ref|XP_004242567.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        137   9e-35   
ref|XP_010419296.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    137   1e-34   
emb|CDY46135.1|  BnaA04g14230D                                          137   1e-34   
ref|XP_003633162.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        137   1e-34   
gb|KCW59597.1|  hypothetical protein EUGRSUZ_H02342                     136   2e-34   
gb|AGV54352.1|  lysosomal Pro-X carboxypeptidase-like protein           136   2e-34   
ref|XP_010026544.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    136   2e-34   
ref|XP_010099406.1|  Lysosomal Pro-X carboxypeptidase                   136   2e-34   
ref|XP_002263389.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   2e-34   Vitis vinifera
gb|KEH31545.1|  serine carboxypeptidase S28 family protein              135   3e-34   
ref|XP_002324555.2|  serine carboxypeptidase S28 family protein         135   5e-34   Populus trichocarpa [western balsam poplar]
gb|EMS54705.1|  Lysosomal Pro-X carboxypeptidase                        135   5e-34   
ref|XP_010419297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    137   6e-34   
gb|KCW50724.1|  hypothetical protein EUGRSUZ_J00402                     134   6e-34   
gb|ACG41459.1|  lysosomal Pro-X carboxypeptidase precursor              134   8e-34   Zea mays [maize]
ref|NP_001142279.1|  uncharacterized protein LOC100274448 precursor     134   8e-34   Zea mays [maize]
ref|XP_009767201.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   9e-34   
ref|XP_011017986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    133   1e-33   
gb|EMT13135.1|  Lysosomal Pro-X carboxypeptidase                        134   2e-33   
ref|XP_007047632.1|  Serine carboxypeptidase S28 family protein i...    133   2e-33   
ref|XP_003569899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   3e-33   
ref|XP_002869352.1|  serine carboxypeptidase S28 family protein         133   3e-33   
ref|XP_009617834.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        132   3e-33   
ref|XP_011017985.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    132   4e-33   
ref|XP_006841179.1|  hypothetical protein AMTR_s00086p00173170          132   5e-33   
ref|XP_010432914.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    131   8e-33   
ref|XP_010525816.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        131   9e-33   
ref|XP_011046918.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    131   9e-33   
dbj|BAJ92142.1|  predicted protein                                      131   9e-33   
gb|KDP38645.1|  hypothetical protein JCGZ_03998                         131   1e-32   
gb|EMT03388.1|  Lysosomal Pro-X carboxypeptidase                        131   1e-32   
dbj|BAJ87416.1|  predicted protein                                      131   1e-32   
ref|XP_008661011.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    131   1e-32   
ref|XP_003563318.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        131   2e-32   
ref|XP_002962799.1|  hypothetical protein SELMODRAFT_78251              130   2e-32   
ref|XP_002962483.1|  hypothetical protein SELMODRAFT_78660              130   3e-32   
ref|XP_010245640.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    130   4e-32   
ref|XP_007011977.1|  Alpha/beta-Hydrolases superfamily protein is...    129   4e-32   
ref|XP_010047139.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        129   7e-32   
ref|XP_008457347.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        129   8e-32   
gb|AFW87518.1|  putative serine peptidase S28 family protein            132   8e-32   
dbj|BAJ86079.1|  predicted protein                                      128   1e-31   
gb|KHG29529.1|  Lysosomal Pro-X carboxypeptidase                        128   1e-31   
gb|KHG26338.1|  Lysosomal Pro-X carboxypeptidase                        127   2e-31   
ref|XP_006285773.1|  hypothetical protein CARUB_v10007247mg             127   2e-31   
ref|XP_004139280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    127   3e-31   
emb|CDP10629.1|  unnamed protein product                                127   3e-31   
ref|XP_002308456.2|  hypothetical protein POPTR_0006s22440g             127   3e-31   
gb|EYU25337.1|  hypothetical protein MIMGU_mgv1a004964mg                127   4e-31   
emb|CDP02648.1|  unnamed protein product                                126   5e-31   
ref|XP_008798889.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    126   5e-31   
ref|XP_010246130.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    126   6e-31   
gb|EMT03389.1|  Lysosomal Pro-X carboxypeptidase                        126   8e-31   
ref|XP_004965729.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    126   1e-30   
emb|CDP10200.1|  unnamed protein product                                125   1e-30   
ref|XP_004246480.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    125   1e-30   
gb|EPS59259.1|  hypothetical protein M569_15548                         125   1e-30   
ref|XP_010680789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    124   4e-30   
ref|XP_006341228.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    123   6e-30   
gb|EMS54706.1|  Lysosomal Pro-X carboxypeptidase                        124   6e-30   
gb|KEH24169.1|  lysosomal pro-X carboxypeptidase-like protein           123   7e-30   
ref|XP_006363792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    123   8e-30   
ref|XP_008799734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    122   1e-29   
ref|XP_009773191.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        123   1e-29   
gb|EMT22761.1|  Lysosomal Pro-X carboxypeptidase                        123   1e-29   
emb|CDX68714.1|  BnaC01g07390D                                          122   1e-29   
ref|XP_010316042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    122   2e-29   
gb|KDO78806.1|  hypothetical protein CISIN_1g0096312mg                  122   2e-29   
gb|AFK45793.1|  unknown                                                 118   2e-29   
gb|ABK95653.1|  unknown                                                 118   2e-29   
gb|EMT22762.1|  Lysosomal Pro-X carboxypeptidase                        119   2e-29   
ref|XP_003521479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    122   2e-29   
ref|XP_004231954.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    122   2e-29   
ref|XP_002438753.1|  hypothetical protein SORBIDRAFT_10g025550          121   5e-29   
ref|XP_009372536.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    120   6e-29   
ref|XP_004306148.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    122   6e-29   
ref|XP_009592890.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        120   9e-29   
ref|XP_011073662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        120   1e-28   
gb|KCW59600.1|  hypothetical protein EUGRSUZ_H023452                    119   2e-28   
ref|XP_008659849.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    119   2e-28   
ref|XP_004305645.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    119   2e-28   
gb|KFK43799.1|  hypothetical protein AALP_AA1G174100                    119   3e-28   
gb|KDP36180.1|  hypothetical protein JCGZ_08824                         118   4e-28   
ref|XP_006436575.1|  hypothetical protein CICLE_v10033480mg             116   5e-28   
emb|CBI30345.3|  unnamed protein product                                117   6e-28   
ref|XP_002281618.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    118   6e-28   
ref|XP_010931151.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    118   6e-28   
ref|XP_008243494.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        117   9e-28   
emb|CDY09175.1|  BnaA02g06010D                                          116   1e-27   
ref|XP_009383556.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    117   2e-27   
emb|CAN61013.1|  hypothetical protein VITISV_036738                     117   3e-27   
gb|AFW87517.1|  putative serine peptidase S28 family protein            116   3e-27   
ref|XP_006854747.1|  hypothetical protein AMTR_s00030p00247420          116   3e-27   
ref|XP_009801420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    115   4e-27   
ref|XP_009127344.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    115   7e-27   
gb|ABR17682.1|  unknown                                                 115   8e-27   
gb|KCW59601.1|  hypothetical protein EUGRSUZ_H023452                    114   9e-27   
ref|XP_007027867.1|  Alpha/beta-Hydrolases superfamily protein is...    114   1e-26   
ref|XP_008344905.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    113   1e-26   
ref|XP_006494706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    113   1e-26   
ref|XP_006494702.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    113   1e-26   
ref|XP_008350184.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    114   2e-26   
gb|AFW87519.1|  putative serine peptidase S28 family protein            114   2e-26   
gb|KCW90505.1|  hypothetical protein EUGRSUZ_A02624                     113   3e-26   
ref|XP_006388623.1|  prolylcarboxypeptidase-related family protein      108   3e-26   
ref|XP_002438751.1|  hypothetical protein SORBIDRAFT_10g025530          109   3e-26   
ref|XP_010059402.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    113   3e-26   
gb|EYU18082.1|  hypothetical protein MIMGU_mgv1a005183mg                113   3e-26   
ref|XP_006369374.1|  hypothetical protein POPTR_0001s221001g            107   4e-26   
ref|XP_011094280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        112   5e-26   
gb|AAM15096.1|  putative prolylcarboxypeptidase                         111   1e-25   
ref|XP_004489068.1|  PREDICTED: uncharacterized protein LOC101510196    109   1e-25   
ref|XP_008344907.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    110   1e-25   
ref|XP_006481710.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    110   5e-25   
gb|EAZ17490.1|  hypothetical protein OsJ_33021                          107   5e-25   
ref|XP_006430123.1|  hypothetical protein CICLE_v10011529mg             110   6e-25   
gb|KHN02193.1|  Lysosomal Pro-X carboxypeptidase                        109   7e-25   
ref|XP_002530520.1|  lysosomal pro-X carboxypeptidase, putative         109   8e-25   
ref|XP_010093782.1|  Lysosomal Pro-X carboxypeptidase                   108   8e-25   
ref|XP_008464256.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    108   9e-25   
ref|XP_009624783.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    109   9e-25   
ref|XP_010675578.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    108   9e-25   
gb|KDP43934.1|  hypothetical protein JCGZ_05401                         106   1e-24   
ref|XP_002530593.1|  lysosomal pro-X carboxypeptidase, putative         107   1e-24   
ref|XP_010245641.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    108   2e-24   
ref|XP_006604647.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    108   2e-24   
ref|XP_006388622.1|  hypothetical protein POPTR_0135s002102g            107   2e-24   
gb|EAY80009.1|  hypothetical protein OsI_35177                          108   2e-24   
ref|NP_001065793.1|  Os11g0156200                                       107   4e-24   
ref|XP_010245642.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    106   4e-24   
gb|KCW90503.1|  hypothetical protein EUGRSUZ_A02623                     106   5e-24   
gb|KHN33177.1|  Lysosomal Pro-X carboxypeptidase                        107   6e-24   
ref|XP_010675581.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    106   8e-24   
gb|KDO59435.1|  hypothetical protein CISIN_1g044064mg                   105   8e-24   
ref|XP_007205161.1|  hypothetical protein PRUPE_ppa005445mg             105   8e-24   
gb|KHN29944.1|  Lysosomal Pro-X carboxypeptidase                        105   9e-24   
ref|XP_006484929.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    101   9e-24   
ref|XP_007011978.1|  Alpha/beta-Hydrolases superfamily protein is...    105   9e-24   
ref|XP_006577088.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    106   1e-23   
ref|XP_010024706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    106   1e-23   
gb|EYU30781.1|  hypothetical protein MIMGU_mgv1a0254691mg               101   3e-23   
ref|XP_006378927.1|  hypothetical protein POPTR_0009s00740g             103   4e-23   
gb|EPS74090.1|  hypothetical protein M569_00662                         104   4e-23   
gb|KEH24167.1|  lysosomal pro-X carboxypeptidase-like protein           104   7e-23   
ref|XP_010683638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    103   8e-23   
ref|XP_004494225.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    103   1e-22   
ref|XP_010424236.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    101   2e-22   
ref|XP_007162943.1|  hypothetical protein PHAVU_001G193200g             102   3e-22   
ref|XP_010676045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    101   3e-22   
gb|KCW50729.1|  hypothetical protein EUGRSUZ_J00403                     100   6e-22   
ref|XP_008442879.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    101   9e-22   
ref|XP_002299661.1|  hypothetical protein POPTR_0001s22070g             100   1e-21   
gb|KDO37776.1|  hypothetical protein CISIN_1g032719mg                 95.5    1e-21   
ref|XP_004136495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    100   2e-21   
emb|CBI17111.3|  unnamed protein product                              95.5    2e-21   
gb|KHN29945.1|  Lysosomal Pro-X carboxypeptidase                      95.5    2e-21   
ref|XP_008349805.1|  PREDICTED: uncharacterized protein LOC103413093    102   2e-21   
ref|XP_006663226.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  99.0    3e-21   
ref|XP_003576298.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  99.8    4e-21   
ref|XP_011004991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  97.4    1e-20   
dbj|BAK05623.1|  predicted protein                                    97.1    3e-20   
ref|XP_006369373.1|  hypothetical protein POPTR_0001s221002g          95.1    3e-20   
ref|XP_011005222.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  96.3    4e-20   
ref|XP_008590288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      94.4    9e-20   
ref|XP_004434101.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  95.5    9e-20   
gb|KFB48883.1|  AGAP000994-PA-like protein                            95.5    9e-20   
ref|XP_006369370.1|  hypothetical protein POPTR_0001s220902g          94.0    1e-19   
ref|XP_309189.4|  AGAP000994-PA                                       94.7    2e-19   
ref|XP_004167790.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  94.7    2e-19   
gb|AJC98202.1|  AGAP000994                                            94.4    2e-19   
ref|XP_003468571.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      94.4    2e-19   
ref|XP_008261572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      93.6    3e-19   
gb|AJC98200.1|  AGAP000994                                            94.0    3e-19   
ref|XP_004980174.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  94.4    3e-19   
ref|XP_006197540.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...  94.4    3e-19   
ref|XP_010988501.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  94.0    3e-19   
ref|XP_010988491.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  94.0    3e-19   
ref|XP_009351278.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  89.4    4e-19   
ref|XP_010971745.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  94.0    4e-19   
ref|XP_010971744.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  94.0    4e-19   
ref|XP_006186742.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      94.0    4e-19   
ref|XP_002450303.1|  hypothetical protein SORBIDRAFT_05g003460        94.0    4e-19   
ref|XP_004901739.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  93.2    5e-19   
ref|XP_004473934.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  92.0    7e-19   
ref|XP_004901733.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  92.8    7e-19   
ref|XP_004901738.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  93.2    8e-19   
ref|XP_003293764.1|  hypothetical protein DICPUDRAFT_158674           92.4    1e-18   
gb|EFA80247.1|  peptidase S28 family protein                          92.0    1e-18   
ref|XP_003129755.3|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  92.0    1e-18   
ref|XP_008385479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  87.0    2e-18   
ref|XP_003992730.2|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  92.0    2e-18   
ref|XP_006936943.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  91.7    2e-18   
ref|XP_004473933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  91.3    3e-18   
ref|XP_004473932.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  91.3    3e-18   
ref|XP_004473931.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  91.3    3e-18   
ref|XP_008537200.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      90.9    4e-18   
ref|XP_006747630.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      90.9    4e-18   
ref|XP_006035578.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      90.5    4e-18   
ref|XP_007664991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  90.5    5e-18   
gb|ETN60051.1|  lysosomal Pro-X carboxypeptidase                      90.5    5e-18   
ref|XP_010203661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      90.1    5e-18   
ref|XP_006369362.1|  hypothetical protein POPTR_0001s22050g           87.4    6e-18   
gb|KFP28018.1|  Lysosomal Pro-X carboxypeptidase                      89.7    6e-18   
ref|XP_004621226.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      89.4    6e-18   
gb|AAH26424.1|  Prcp protein                                          89.7    7e-18   
ref|XP_001863632.1|  lysosomal Pro-X carboxypeptidase                 90.1    7e-18   
ref|XP_005074170.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  90.1    8e-18   
ref|XP_007079027.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      89.7    9e-18   
gb|AAH55022.1|  Prcp protein                                          89.7    1e-17   
ref|XP_004385551.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      89.7    1e-17   
ref|NP_082519.1|  lysosomal Pro-X carboxypeptidase precursor          89.7    1e-17   
ref|XP_006273509.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  89.4    1e-17   
ref|XP_010629189.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  89.4    1e-17   
ref|XP_006991950.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      89.4    1e-17   
ref|XP_008702603.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      89.4    1e-17   
ref|XP_004324072.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  88.2    1e-17   
ref|XP_010343917.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  88.2    1e-17   
ref|XP_010629188.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  89.4    1e-17   
ref|XP_007236792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      89.4    1e-17   
ref|XP_005612064.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      89.4    2e-17   
ref|NP_001033253.1|  lysosomal Pro-X carboxypeptidase precursor       89.0    2e-17   
ref|XP_003764661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      88.6    2e-17   
emb|CCQ71326.1|  hypothetical Pro-X carboxypeptidase-like protein...  89.0    2e-17   
ref|XP_006388624.1|  hypothetical protein POPTR_0135s00220g           87.0    2e-17   
ref|XP_010851518.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      88.6    2e-17   
ref|XP_006145040.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  88.6    3e-17   
gb|EDL06718.1|  prolylcarboxypeptidase (angiotensinase C)             87.8    3e-17   
ref|XP_006926718.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  88.6    3e-17   
ref|XP_007187662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      88.2    4e-17   
ref|XP_003935096.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  87.8    4e-17   
ref|XP_011024297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...  83.6    4e-17   
ref|XP_005226767.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  87.8    4e-17   
ref|XP_007447423.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      87.8    5e-17   
ref|XP_008056303.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      86.7    5e-17   
ref|XP_005579271.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  86.7    5e-17   
ref|XP_005975526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  87.8    5e-17   
ref|XP_004271881.1|  PREDICTED: lysosomal Pro-X carboxypeptidase      87.8    5e-17   
ref|XP_005975525.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  87.8    5e-17   
ref|XP_007120155.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  87.8    5e-17   
ref|XP_002108777.1|  hypothetical protein TRIADDRAFT_19181            87.4    6e-17   
ref|XP_004763526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  87.8    6e-17   
ref|XP_007664992.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...  87.0    6e-17   



>ref|XP_004250994.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=504

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 136/174 (78%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIAS  NGLS LSRKFK C  LN  +ELK+YL   YS+AAQY++PP YPVT VCGGIDGA
Sbjct  261  KIASGKNGLSYLSRKFKTCSKLNDPFELKNYLDTMYSVAAQYNSPPSYPVTIVCGGIDGA  320

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
            PKG+HILDRIFAG+    GN SCY++   P+ T++ GW WQ+CSEM  PIGRG  DTMFF
Sbjct  321  PKGSHILDRIFAGIVEFNGNSSCYNMNPMPSETSL-GWRWQTCSEMVMPIGRGKNDTMFF  379

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             APFNL  F KNC  ++GV PRPHW+TTYYGGQDIKL+  +F SNIIFSNGLRD
Sbjct  380  SAPFNLNNFIKNCKKMYGVSPRPHWVTTYYGGQDIKLIFQRFASNIIFSNGLRD  433



>emb|CAN64374.1| hypothetical protein VITISV_018664 [Vitis vinifera]
Length=502

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 138/174 (79%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+PNGLSILS+KF+ C +LN S ELKDYL   Y++AAQY+ PP YPVT VCGGIDGA
Sbjct  257  RVASEPNGLSILSKKFRTCAELNKSNELKDYLETMYAVAAQYNHPPRYPVTVVCGGIDGA  316

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
            P+G+ IL RIFAGV A  GN SCY+    PT T+  GW WQ+CSEM  PIGRGD DTMF 
Sbjct  317  PEGSDILSRIFAGVVAYRGNSSCYNTSVNPTETS-EGWRWQTCSEMVMPIGRGDNDTMFP  375

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P+PFNL  F + C +L+ VPPRPHWITTYYGG DIKL+L++F SNIIFSNGLRD
Sbjct  376  PSPFNLTTFIQACTSLYDVPPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRD  429



>ref|XP_002271797.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=510

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 138/174 (79%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+PNGLSILS+KF+ C +LN S ELKDYL   Y++AAQY+ PP YPVT VCGGIDGA
Sbjct  265  RVASEPNGLSILSKKFRTCAELNKSNELKDYLETMYAVAAQYNHPPRYPVTVVCGGIDGA  324

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
            P+G+ IL RIFAGV A  GN SCY+    PT T+  GW WQ+CSEM  PIGRGD DTMF 
Sbjct  325  PEGSDILSRIFAGVVAYRGNSSCYNTSVNPTETS-EGWRWQTCSEMVMPIGRGDNDTMFP  383

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P+PFNL  F + C +L+ VPPRPHWITTYYGG DIKL+L++F SNIIFSNGLRD
Sbjct  384  PSPFNLTTFIQACTSLYDVPPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRD  437



>ref|XP_006349128.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=504

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 136/174 (78%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIAS+ +GLS LSRKFK C  LN  +ELKDYL   YS+AAQY++PP YPVT VCGGIDGA
Sbjct  261  KIASRKSGLSYLSRKFKTCSKLNDPFELKDYLDSMYSVAAQYNSPPSYPVTIVCGGIDGA  320

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
            PKG+HILDRIFAG+ A  G  SCY++   P+ T + GW WQ+CSEM  PIGRG+ DTMFF
Sbjct  321  PKGSHILDRIFAGIVAYSGTSSCYNMNPKPSETGL-GWRWQTCSEMVMPIGRGENDTMFF  379

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             APFNL  F  +C   +GV PRPHWITTYYGG+DIKL+L +F SNIIFSNGLRD
Sbjct  380  SAPFNLNNFITDCKKKYGVSPRPHWITTYYGGKDIKLILQRFASNIIFSNGLRD  433



>ref|XP_006349129.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=453

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 137/174 (79%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIAS+ NGLS LSRKFK C  LN  +ELKDYL   YS AAQY++PP YPVT VCGGIDGA
Sbjct  210  KIASRKNGLSYLSRKFKTCSKLNDPFELKDYLDSMYSEAAQYNSPPNYPVTIVCGGIDGA  269

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
            PKG+H+LDRIFAG+ A +GN SC+++   P+ T + GW WQ+C+EM  P+GRG+ DTMF+
Sbjct  270  PKGSHMLDRIFAGIVAYKGNSSCHNMNPKPSETDL-GWRWQTCTEMVMPVGRGENDTMFY  328

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              PFNL  F K+C   +GV PRPHWITTYYGGQDIKL+L +F SNIIFSNGLRD
Sbjct  329  SDPFNLNNFIKDCKKKYGVSPRPHWITTYYGGQDIKLILQRFASNIIFSNGLRD  382



>ref|XP_004251370.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=504

 Score =   244 bits (623),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 134/174 (77%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIAS  NGLS LSRKFK C  LN  +ELKDYL   YS AAQY++PP YPVT VCGGIDGA
Sbjct  261  KIASGKNGLSYLSRKFKTCSKLNDPFELKDYLDSMYSEAAQYNSPPSYPVTIVCGGIDGA  320

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
            PKG+HILDRIFAG+ A +GN SCY++   P+   + GW WQ+CSEM  PIGRG+ DTMF+
Sbjct  321  PKGSHILDRIFAGIVAYKGNSSCYNMNPMPSEEDL-GWRWQTCSEMVMPIGRGENDTMFY  379

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              PFNL  F K+C   +GV PR HWITTYYGGQDIKL+L +F SNIIFSNGLRD
Sbjct  380  SDPFNLNNFIKDCKKKYGVSPRSHWITTYYGGQDIKLILQRFASNIIFSNGLRD  433



>ref|XP_010651746.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Vitis 
vinifera]
Length=465

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 135/176 (77%), Gaps = 5/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+PNGLSILS+KF++C  LN+S ELK++L   YSIAAQYD PP YPVT VCGGIDGA
Sbjct  263  RVASEPNGLSILSKKFRICGQLNNSDELKEFLERTYSIAAQYDAPPSYPVTVVCGGIDGA  322

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGT-----AIWGWSWQSCSEMAFPIGRGDGDTM  169
            P+G+ IL RIFAGV A  GN SCY     T      I GW WQ+CSE+  PIGRG  DTM
Sbjct  323  PEGSDILSRIFAGVVAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVIPIGRGVNDTM  382

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  APFNL  FS++C +L+GV PRPHWITTYYGG DI+L+L +F SNIIFSNGLRD
Sbjct  383  FPLAPFNLTTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIFSNGLRD  438



>ref|XP_009631310.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=523

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 136/176 (77%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIAS+ NGLS LSRKFK C  LNSS ELKDYL   Y+ AAQY+ PP YPVT VCGGIDGA
Sbjct  278  KIASRNNGLSYLSRKFKTCSHLNSSSELKDYLDSIYATAAQYNKPPTYPVTVVCGGIDGA  337

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             KG+H+LDRI AG+ AS+GN +CY+      P+ T++ GW WQ+CSEM  PIGRG  DTM
Sbjct  338  HKGSHVLDRIHAGIVASQGNLTCYNTNFYNQPSETSM-GWRWQTCSEMVMPIGRGKNDTM  396

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F+ APFNL +F   C + +GV PRPHWITTYYGG D+KL+L++F SNIIFSNGLRD
Sbjct  397  FYSAPFNLDEFIDACKSNYGVSPRPHWITTYYGGHDVKLILHRFASNIIFSNGLRD  452



>ref|XP_011089978.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Sesamum indicum]
Length=501

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 138/176 (78%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+ASKP GLSILS++FK C  LN+S ELKD+L   YS+AAQY+ PP YPVT VC GIDGA
Sbjct  260  KVASKPKGLSILSQRFKTCSHLNNSDELKDFLDTMYSVAAQYNHPPTYPVTVVCKGIDGA  319

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
            P G  ++ RIFAGV +  GN++CY       P+ T++ GW WQ+CSE+  PIGRG+ DTM
Sbjct  320  PAGTDVIGRIFAGVVSYRGNRTCYDTNAYNYPSETSV-GWEWQTCSEIVIPIGRGENDTM  378

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  APF+L +F+K+C + +GVPPRPHWITTYYGG DIKLVLN+FGSNIIFSNGLRD
Sbjct  379  FPAAPFDLHEFAKSCKDFYGVPPRPHWITTYYGGHDIKLVLNRFGSNIIFSNGLRD  434



>ref|XP_002271961.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Vitis 
vinifera]
Length=505

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 135/176 (77%), Gaps = 5/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+PNGLSILS+KF++C  LN+S ELK++L   YSIAAQYD PP YPVT VCGGIDGA
Sbjct  263  RVASEPNGLSILSKKFRICGQLNNSDELKEFLERTYSIAAQYDAPPSYPVTVVCGGIDGA  322

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGT-----AIWGWSWQSCSEMAFPIGRGDGDTM  169
            P+G+ IL RIFAGV A  GN SCY     T      I GW WQ+CSE+  PIGRG  DTM
Sbjct  323  PEGSDILSRIFAGVVAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVIPIGRGVNDTM  382

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  APFNL  FS++C +L+GV PRPHWITTYYGG DI+L+L +F SNIIFSNGLRD
Sbjct  383  FPLAPFNLTTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIFSNGLRD  438



>emb|CBI17109.3| unnamed protein product [Vitis vinifera]
Length=975

 Score =   249 bits (636),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 138/174 (79%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+PNGLSILS+KF+ C +LN S ELKDYL   Y++AAQY+ PP YPVT VCGGIDGA
Sbjct  237  RVASEPNGLSILSKKFRTCAELNKSNELKDYLETMYAVAAQYNHPPRYPVTVVCGGIDGA  296

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
            P+G+ IL RIFAGV A  GN SCY+    PT T+  GW WQ+CSEM  PIGRGD DTMF 
Sbjct  297  PEGSDILSRIFAGVVAYRGNSSCYNTSVNPTETS-EGWRWQTCSEMVMPIGRGDNDTMFP  355

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P+PFNL  F + C +L+ VPPRPHWITTYYGG DIKL+L++F SNIIFSNGLRD
Sbjct  356  PSPFNLTTFIQACTSLYDVPPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRD  409


 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 127/176 (72%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +IASKPNGLSILS++FK C  L SS+ELKDYL   Y+ AAQY+ PP YPVT VC GI+GA
Sbjct  735  RIASKPNGLSILSKRFKTCAHLESSFELKDYLDSIYAEAAQYNEPPTYPVTVVCKGINGA  794

Query  333  PKGAHILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             K    L RIF G+ A  G +SCY     + PT T + GW WQ CSEM  PIG    DTM
Sbjct  795  SKRTDTLGRIFHGLVAIAGKRSCYDTKEFNYPTETYL-GWRWQKCSEMVLPIGHATNDTM  853

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F P PFNL +F K C +L+ V PRPHW+TTYYGG+DIKL+L++F SNIIFSNGLRD
Sbjct  854  FQPEPFNLNRFIKECNSLYSVSPRPHWVTTYYGGRDIKLILHRFASNIIFSNGLRD  909



>ref|XP_009785587.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=504

 Score =   241 bits (615),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIAS  +GLS LS+KFK C  LN+S +LK YL   Y++AAQYD PP YPVT +CGGIDGA
Sbjct  263  KIASTKDGLSYLSQKFKTCSPLNNSSDLKGYLDSTYAVAAQYDDPPRYPVTLICGGIDGA  322

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFFPAP  154
              G+ +LDRIFAG+ A EGN+SCY+I  G    GW WQ+CSEM  PIGRG+ DTMF+ +P
Sbjct  323  TNGSDVLDRIFAGIVAYEGNKSCYNILPGQPDLGWDWQTCSEMVMPIGRGENDTMFYSSP  382

Query  153  FNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            FNL QF ++C + +GV PRPHW+TTYYGG DIKL+L++F SNIIFSNGLRD
Sbjct  383  FNLDQFIEDCKSDYGVSPRPHWVTTYYGGHDIKLILHRFASNIIFSNGLRD  433



>emb|CAN63232.1| hypothetical protein VITISV_004830 [Vitis vinifera]
Length=468

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 134/176 (76%), Gaps = 5/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+PNGLSILS+KF++C  LN+S ELK++L   YSIAAQYD PP YPVT VCGGIDGA
Sbjct  263  RVASEPNGLSILSKKFRICGQLNNSDELKEFLERTYSIAAQYDAPPSYPVTVVCGGIDGA  322

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGT-----AIWGWSWQSCSEMAFPIGRGDGDTM  169
            P+G+ IL RIFAGV A  GN SCY     T      I GW WQ+CSE+  PIGR   DTM
Sbjct  323  PEGSDILSRIFAGVVAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVIPIGRXVNDTM  382

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  APFNL  FS++C +L+GV PRPHWITTYYGG DI+L+L +F SNIIFSNGLRD
Sbjct  383  FPLAPFNLTTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIFSNGLRD  438



>emb|CBI17112.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 135/176 (77%), Gaps = 5/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+PNGLSILS+KF++C  LN+S ELK++L   YSIAAQYD PP YPVT VCGGIDGA
Sbjct  382  RVASEPNGLSILSKKFRICGQLNNSDELKEFLERTYSIAAQYDAPPSYPVTVVCGGIDGA  441

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGT-----AIWGWSWQSCSEMAFPIGRGDGDTM  169
            P+G+ IL RIFAGV A  GN SCY     T      I GW WQ+CSE+  PIGRG  DTM
Sbjct  442  PEGSDILSRIFAGVVAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVIPIGRGVNDTM  501

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  APFNL  FS++C +L+GV PRPHWITTYYGG DI+L+L +F SNIIFSNGLRD
Sbjct  502  FPLAPFNLTTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIFSNGLRD  557


 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  222  QSCSEMAFPIGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLN  43
            Q C+E   P+ RGD DTMF   PFNL  F + CI+++GV P PHW TTYYGG +I+L+L+
Sbjct  2    QRCNETVMPLRRGDSDTMFPLVPFNLTTFIQECISIYGVSPWPHWATTYYGGHNIELILH  61

Query  42   KFGSNIIFSNGLRD  1
            +F SNIIFSNGLRD
Sbjct  62   RFASNIIFSNGLRD  75



>emb|CBI17110.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 134/174 (77%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+PNG+SILS+KF+ C  LN+S ELKDYL   Y  AAQY+ PP YPVT  C GIDGA
Sbjct  166  RVASEPNGISILSKKFRTCDRLNNSDELKDYLDTIYCTAAQYNDPPMYPVTMACSGIDGA  225

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
            P+G+ IL RIFAGV A  GN SCY+    PT T+  GW+WQ+CSEM  PIGRGD DTMF 
Sbjct  226  PEGSDILSRIFAGVVAYGGNSSCYTTSHNPTETS-EGWAWQTCSEMVMPIGRGDNDTMFP  284

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            PAPFNL  F + C +++GV PRPHW+TTYYGG +I+L+L +F SNIIFSNGLRD
Sbjct  285  PAPFNLTTFIQECTSIYGVSPRPHWVTTYYGGHNIELILRRFASNIIFSNGLRD  338



>ref|XP_009779688.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=509

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 133/176 (76%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIAS+ NGLS LSRKFK C  LN+S ELKDYL   Y+ AAQY+TPP YPVT VCGGIDGA
Sbjct  264  KIASRKNGLSYLSRKFKTCSHLNNSSELKDYLDSIYATAAQYNTPPTYPVTVVCGGIDGA  323

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             KG+H+LDRI+AG+ A +G   CY+      P+ T + GW WQ+CSEM  PIGRG  +TM
Sbjct  324  HKGSHVLDRIYAGIVAFQGKLKCYNTNLYNQPSETYM-GWRWQTCSEMVMPIGRGKNETM  382

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F+  PFNL +F   C + +GV PRPHWITTYYGG DIKL+L++F SNIIFSNGLRD
Sbjct  383  FYSDPFNLDEFVDACKSYYGVSPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRD  438



>ref|XP_007016017.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33636.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=505

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 133/176 (76%), Gaps = 5/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+ASK NGLSILS KFK C+ L  +++LKDYL   YS AAQYD PP YP++ VCGGIDGA
Sbjct  261  KVASKSNGLSILSMKFKTCKKLKRTFDLKDYLDSIYSEAAQYDHPPTYPLSIVCGGIDGA  320

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
            PKG  IL RIFAGV A  GN+SCY +     P+     GW WQ+CSEM  PIG G+ D+M
Sbjct  321  PKGTDILGRIFAGVVAYVGNKSCYDMNAYNHPSDETYMGWRWQTCSEMVMPIGHGNNDSM  380

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F PAPFNL +F + C +LFGV P+PHW+TTYYGG D+KL+L++F SNIIFSNGLRD
Sbjct  381  FPPAPFNLNRFIRKCKSLFGVQPQPHWVTTYYGGHDLKLILHRFASNIIFSNGLRD  436



>emb|CDP17394.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 134/176 (76%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+ASKPNGLSILS++FK C  LNSS +LKDYL   +S AAQY++PP+YPVTEVC GID A
Sbjct  265  KVASKPNGLSILSKRFKTCTPLNSSSQLKDYLDSMFSSAAQYNSPPKYPVTEVCSGIDKA  324

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
            PKG  IL R FAGV + + ++SCY +      T T + GW WQ+CSEM  PIGRG  DTM
Sbjct  325  PKGTDILGRTFAGVVSYKKDESCYDMLEYARSTETNV-GWQWQTCSEMVMPIGRGSNDTM  383

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F P+PFNL  F KNC + +GV PRPHWITTYYGG D+KLV  +FGSNIIFSNGL+D
Sbjct  384  FPPSPFNLPDFIKNCKSSYGVSPRPHWITTYYGGHDMKLVFQRFGSNIIFSNGLKD  439



>gb|KDO44733.1| hypothetical protein CISIN_1g0127112mg, partial [Citrus sinensis]
Length=264

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 135/176 (77%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+AS+PNGLS+LS+KF+ C+ L  + EL+D+L   Y+  AQYD PP YP++ VCGGIDGA
Sbjct  19   KVASRPNGLSMLSKKFRTCKPLKKTSELEDFLDSLYTDVAQYDDPPTYPLSIVCGGIDGA  78

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
            P G  +L +IF GV A +GN+SCY +     PT T + GW WQ+CSEM  PIG G  DTM
Sbjct  79   PTGIDVLGKIFKGVVAYKGNRSCYDMDEYIRPTETNV-GWRWQTCSEMVMPIGHGHKDTM  137

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F PAPF+L +F+K+C   FGV P+PHW+TTYYGG+D+KL+L++FGSNIIFSNGLRD
Sbjct  138  FPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRD  193



>ref|XP_006484933.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=502

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 136/176 (77%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+AS+PNGLS+LS+KF+ C+ L  + EL+D+L   Y+  AQYD PP YP++ VCGGIDGA
Sbjct  257  KVASRPNGLSMLSKKFRTCKPLKKTSELEDFLDSLYTDVAQYDDPPTYPLSIVCGGIDGA  316

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
            PKG  +L +IF GV A +GN+SCY +     PT T + GW WQ+CSEM  PIG G  DTM
Sbjct  317  PKGIDVLGKIFKGVVAYKGNRSCYDMDEYIRPTETNV-GWRWQTCSEMVMPIGHGHKDTM  375

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F PAPF+L +F+K+C   FGV P+PHW+TTYYGG+D+KL+L++FGSNIIFSNGLRD
Sbjct  376  FPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRD  431



>gb|EYU36116.1| hypothetical protein MIMGU_mgv1a004675mg [Erythranthe guttata]
Length=515

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 135/178 (76%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKPNGL ILS++FK C  LN++ ELKDYL   Y++AAQY+ PP YPVT VC GIDG 
Sbjct  272  RVASKPNGLDILSQRFKTCSKLNNAEELKDYLETIYAVAAQYNRPPNYPVTMVCRGIDGV  331

Query  333  PKGAH--ILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGD  175
              G+   ++ RIFAGV + +GN++CY +     P+ T+I GW WQ+CSEM  PIGRG  +
Sbjct  332  HNGSDGDVIGRIFAGVVSYKGNKTCYDMNTYNYPSETSI-GWQWQTCSEMVMPIGRGQNE  390

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF  APFNL +F K C  ++GVPPRPHWITTYYGG DIKL LN+FGSNIIFSNGLRD
Sbjct  391  TMFPAAPFNLDEFIKICSEIYGVPPRPHWITTYYGGHDIKLALNRFGSNIIFSNGLRD  448



>ref|XP_006424403.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
 gb|ESR37643.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
Length=458

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 134/176 (76%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+AS+PNGLS+LS+ F+ C+ L  + ELKD+L   Y+  AQYD PP YP++ VCGGIDGA
Sbjct  213  KVASRPNGLSMLSKTFRTCKPLKETSELKDFLDSLYTDVAQYDDPPTYPLSIVCGGIDGA  272

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
            P G  +L +IF GV A +GN+SCY +     PT T + GW WQ+CSEM  PIG G  DTM
Sbjct  273  PTGIDVLGKIFKGVVAYKGNRSCYDMDEYIRPTETNV-GWRWQTCSEMVMPIGHGHKDTM  331

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F PAPF+L +F+K+C   FGV P+PHW+TTYYGG+D+KL+L++FGSNIIFSNGLRD
Sbjct  332  FPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRD  387



>ref|XP_002271733.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=505

 Score =   223 bits (568),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 127/176 (72%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +IASKPNGLSILS++FK C  L SS+ELKDYL   Y+ AAQY+ PP YPVT VC GI+GA
Sbjct  265  RIASKPNGLSILSKRFKTCAHLESSFELKDYLDSIYAEAAQYNEPPTYPVTVVCKGINGA  324

Query  333  PKGAHILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             K    L RIF G+ A  G +SCY     + PT T + GW WQ CSEM  PIG    DTM
Sbjct  325  SKRTDTLGRIFHGLVAIAGKRSCYDTKEFNYPTETYL-GWRWQKCSEMVLPIGHATNDTM  383

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F P PFNL +F K C +L+ V PRPHW+TTYYGG+DIKL+L++F SNIIFSNGLRD
Sbjct  384  FQPEPFNLNRFIKECNSLYSVSPRPHWVTTYYGGRDIKLILHRFASNIIFSNGLRD  439



>gb|KDP43933.1| hypothetical protein JCGZ_05400 [Jatropha curcas]
Length=419

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 129/176 (73%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K ASKPNGLSILS+KF  C  L  ++ELKDYL   Y+ AAQY+ PP YPV+ VC GID A
Sbjct  176  KAASKPNGLSILSKKFNTCSPLKRTFELKDYLDSIYAEAAQYNDPPNYPVSIVCDGIDRA  235

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
            P+G  IL RIFAGV A  G++SCY +     PT      W WQ+CSE+  PIG  D +TM
Sbjct  236  PEGTDILGRIFAGVVAYMGHKSCYDMNEFNDPTDQTSLAWRWQTCSELVMPIGH-DRNTM  294

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F PAPFNL+ + K C +LFG+ P+PHW+TTYYGGQD+KL+L++F SNIIFSNGLRD
Sbjct  295  FPPAPFNLKSYIKECKSLFGILPQPHWVTTYYGGQDLKLILHRFASNIIFSNGLRD  350



>ref|XP_006424402.1| hypothetical protein CICLE_v10030021mg, partial [Citrus clementina]
 gb|ESR37642.1| hypothetical protein CICLE_v10030021mg, partial [Citrus clementina]
Length=429

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 128/176 (73%), Gaps = 7/176 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ S+PNGLSILS+KF+ C  LNS+ ELKDYL   Y+ AAQYD PP+YPV+ VCG IDGA
Sbjct  179  EVGSRPNGLSILSKKFRTCNPLNSTSELKDYLDSLYTDAAQYDEPPKYPVSRVCGAIDGA  238

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             +G   LD+IFA V    GN SCY +     PT T    ++WQ C+E+ FPIG G  DTM
Sbjct  239  -EGTDTLDKIFAAVVTYMGNTSCYDMEEFGSPTSTYDM-FTWQVCTELVFPIGHGHNDTM  296

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  APF+L  FSK C  LFGV P+PHW+TTYYGGQDIKL+L+ F SNIIFSNGLRD
Sbjct  297  FPLAPFDLSSFSKTCEGLFGVQPKPHWVTTYYGGQDIKLILHNFASNIIFSNGLRD  352



>ref|XP_006485140.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=463

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 128/176 (73%), Gaps = 7/176 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ S+PNGLSILS+KF+ C  LNS+ ELKDYL   Y+ AAQYD PP+YPV+ VCG IDGA
Sbjct  213  EVGSRPNGLSILSKKFRTCNPLNSTSELKDYLDSLYTDAAQYDEPPKYPVSRVCGAIDGA  272

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             +G   LD+IFA V    GN SCY +     PT T    ++WQ C+E+ FPIG G  DTM
Sbjct  273  -EGTDTLDKIFAAVVTYMGNTSCYDMKEFGSPTSTFDM-FTWQVCTELVFPIGHGHNDTM  330

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  APF+L  FSK C  LFGV P+PHW+TTYYGGQDIKL+L+ F SNIIFSNGLRD
Sbjct  331  FPLAPFDLSSFSKTCEGLFGVQPKPHWVTTYYGGQDIKLILHNFASNIIFSNGLRD  386



>ref|XP_002523754.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38694.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=517

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 128/176 (73%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+ASK NGLSILS+KFK C  L  ++ELKDYL   YS AAQY+ PP YPVT VCGGIDGA
Sbjct  271  KVASKRNGLSILSKKFKTCNPLKRTFELKDYLDSIYSEAAQYNDPPRYPVTIVCGGIDGA  330

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
            PKG  +L RIFAGV A  G++SCY +     PT      W WQ+CSE+  PIG  + +TM
Sbjct  331  PKGTDVLGRIFAGVVAYMGDRSCYDVNGYNHPTDATSLAWRWQTCSELVMPIGH-ERNTM  389

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  +PFNL  +++ C  L+GV P+PHW+T YYGG D+KL+L++F SNIIFSNGL+D
Sbjct  390  FPTSPFNLNSYTQKCKALYGVLPQPHWVTNYYGGHDLKLILHRFASNIIFSNGLKD  445



>gb|KDO44732.1| hypothetical protein CISIN_1g010487mg [Citrus sinensis]
Length=509

 Score =   218 bits (555),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 128/176 (73%), Gaps = 7/176 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ S+PNGLSILS+KF+ C  LNS+ ELKDYL   Y+ AAQYD PP+YPV+ VCG IDGA
Sbjct  259  EVGSRPNGLSILSKKFRTCNPLNSTSELKDYLDSLYTDAAQYDEPPKYPVSRVCGAIDGA  318

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             +G   LD+IFA V    GN SCY +     PT T    ++WQ C+E+ FPIG G  DTM
Sbjct  319  -EGTDTLDKIFAAVVTYMGNTSCYDMKEFGSPTST-FDMFTWQVCTELVFPIGHGHNDTM  376

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  APF+L  FSK C  LFGV P+PHW+TTYYGGQDIKL+L+ F SNIIFSNGLRD
Sbjct  377  FPLAPFDLSSFSKTCEGLFGVQPKPHWVTTYYGGQDIKLILHNFASNIIFSNGLRD  432



>ref|XP_002270231.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
 emb|CBI23429.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 130/176 (74%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K A++ NGL  LS+KF+ C+ L S+ +LKDYL   YSIAAQYD PP YPVT VC GIDG 
Sbjct  263  KAAAEANGLLNLSKKFRTCKPLESASQLKDYLETMYSIAAQYDRPPMYPVTVVCNGIDGG  322

Query  333  PKGAHILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             +G  ILDRIF+G+ AS GN+SCY     S P+ T   GW+WQ CSE+  PIGRG  DTM
Sbjct  323  LQGTDILDRIFSGIVASRGNKSCYDMGQSSFPSETE-EGWNWQVCSELVIPIGRGSNDTM  381

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  APF+ ++++ +C   +GV PRPHWIT+YYGG +IKL+L +FGSNIIFSNGLRD
Sbjct  382  FPAAPFDFKEYADSCKYSYGVTPRPHWITSYYGGHNIKLILKRFGSNIIFSNGLRD  437



>ref|XP_010267352.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=514

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 131/176 (74%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+AS+ +GLS+LS+KFK C  LN+S+ELKDYL   Y+  AQ++ PPE  V ++C  IDGA
Sbjct  264  KVASQADGLSVLSQKFKTCSPLNTSFELKDYLDSIYAETAQFNRPPENIVNKICDVIDGA  323

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
            PKG  IL R+FAGV A  GN+SCY       PT    +GW WQ+CSE+  PIGRG  DTM
Sbjct  324  PKGTDILSRVFAGVVAYMGNRSCYDTNYYNYPT-QGYFGWRWQTCSELVMPIGRGSNDTM  382

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  +PF+L+ ++K+C +L+GVPPRPHWITT +GG DI+LVL KF SNIIFSNGL+D
Sbjct  383  FPSSPFDLKNYTKSCQDLYGVPPRPHWITTQFGGHDIRLVLQKFASNIIFSNGLKD  438



>gb|KHG27095.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=537

 Score =   216 bits (550),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIAS+PNGLS LS  FK C+ LN S ELK+ L   Y+ AAQYD+PP YPVT VC GIDGA
Sbjct  296  KIASQPNGLSSLSMIFKTCKPLNKSSELKNALENMYASAAQYDSPPRYPVTVVCRGIDGA  355

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
             +   IL +IFAGV A  GN+SCY  P         GW WQ+CSEM  PIG G+  TMF 
Sbjct  356  NEKQDILSKIFAGVVAYRGNRSCYINPPTNESETTVGWRWQTCSEMVIPIGIGN-RTMFQ  414

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PF+L  F + C  +FGVPPRPHW+T+YYGG DIKL+L +FGSNIIFSNGLRD
Sbjct  415  PEPFDLNSFIQQCKTIFGVPPRPHWVTSYYGGHDIKLILQRFGSNIIFSNGLRD  468



>ref|XP_006495097.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Citrus 
sinensis]
Length=502

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 128/177 (72%), Gaps = 8/177 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+ASKP+GLSILS+KF+ C+ L   +EL+DYL   Y+ AAQY+ PP+YPV  +CGGIDG 
Sbjct  261  KVASKPDGLSILSKKFRTCKPLKDLYELEDYLELVYADAAQYNQPPKYPVNMLCGGIDGV  320

Query  333  PKGAH--ILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDT  172
              G    IL +IFAGV A EGN SC+    +I T T + GW WQ+CSEM  PIG  D  T
Sbjct  321  ALGIDNDILSKIFAGVVAYEGNMSCFVNPPTIETETTV-GWRWQTCSEMVIPIGT-DNTT  378

Query  171  MFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            MF PAPFNL  F   C +L+GV PRPHW+TTYYGG DIKL+L +F SNIIFSNGLRD
Sbjct  379  MFQPAPFNLSSFIDRCESLYGVSPRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRD  435



>ref|XP_002315345.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
 gb|EEF01516.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
Length=513

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 128/174 (74%), Gaps = 3/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+A+K +GLSIL +KF  C+ L ++ ELK++L   +S+AAQYD PP YPV  VC GID A
Sbjct  267  KVAAKADGLSILQKKFNTCKPLEAATELKNFLDSLFSVAAQYDRPPRYPVDLVCKGIDSA  326

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
            P+G+ +LDRIF+G+ A  G + CY++    +   + GW+WQ+CSE+  PIGRG  DTMF 
Sbjct  327  PEGSDVLDRIFSGIVAYFGKKPCYNLDAFFSSETLEGWTWQTCSELVIPIGRGSNDTMFP  386

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              PF+L+++ + C + FGVPPRPHWITTYYGG   K VL +FGSNIIFSNGLRD
Sbjct  387  AEPFDLKEYIEECKSAFGVPPRPHWITTYYGGHHFKEVLRRFGSNIIFSNGLRD  440



>ref|XP_006424415.1| hypothetical protein CICLE_v10028929mg [Citrus clementina]
 gb|ESR37655.1| hypothetical protein CICLE_v10028929mg [Citrus clementina]
Length=303

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 126/175 (72%), Gaps = 6/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P+GL+ILS KF+ C+ L  S+ELK YL   Y+ AAQY+ PP+YPV+ VCGGIDGA
Sbjct  64   EVASQPDGLAILSNKFRTCRPLGDSYELKGYLRLMYAHAAQYNHPPDYPVSMVCGGIDGA  123

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIP----TGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G  I+ +IFAGV A +GN SCY  P    T T + GW WQ CSEM  PIG  +  TMF
Sbjct  124  AFGNDIISKIFAGVVAYKGNMSCYVNPPTNETETTV-GWRWQRCSEMVIPIGTVN-TTMF  181

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PFNL  F   C +L+GV PRPHW+TTYYGG DIKL+L +F SNIIFSNGLRD
Sbjct  182  QPTPFNLSSFIDRCESLYGVSPRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRD  236



>gb|KDO55292.1| hypothetical protein CISIN_1g036751mg [Citrus sinensis]
Length=492

 Score =   212 bits (540),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 124/174 (71%), Gaps = 3/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K  +K NGL+ LS+KFK C+ L S  ELKDYL   Y++AAQYD PP YPV +VC GIDGA
Sbjct  265  KAGAKRNGLAFLSKKFKTCKPLKSVSELKDYLENMYTVAAQYDRPPNYPVNQVCNGIDGA  324

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
             +G   + RIF+G+ AS G +SCY+I    +   + GW WQ+CSE+  PIG G   TMF 
Sbjct  325  SQGTDTVARIFSGIVASRGKKSCYNIGEFFSDETLNGWGWQTCSEIVMPIGIGKNKTMFP  384

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              PFNL+++  +C N +GV PRPHWITTYYGG DI++VL  FGSNIIFSNGLRD
Sbjct  385  ADPFNLKEYMDSCENSYGVVPRPHWITTYYGGLDIRVVLKSFGSNIIFSNGLRD  438



>emb|CAN65360.1| hypothetical protein VITISV_036071 [Vitis vinifera]
Length=580

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 128/176 (73%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K A++ NGL  LS+KF+ C+ L S+ +LKDYL   YSIAAQYD PP YPVT VC GIDG 
Sbjct  263  KAAAEANGLLNLSKKFRTCKPLESASQLKDYLETMYSIAAQYDRPPMYPVTIVCNGIDGG  322

Query  333  PKGAHILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             +G  IL RIF+G+ AS GN+SCY     S P+ T   GW+WQ CSE+  PIGRG  DTM
Sbjct  323  LQGTDILGRIFSGIVASRGNKSCYDMGQSSFPSETE-EGWNWQVCSELVIPIGRGSNDTM  381

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  APF+ +++  +C   +GV PRPHWIT+YYGG +IKL+L +FGSNIIFSNGLRD
Sbjct  382  FPAAPFDFKEYDDSCKYSYGVTPRPHWITSYYGGHNIKLILKRFGSNIIFSNGLRD  437



>ref|XP_010247711.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=505

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 122/175 (70%), Gaps = 4/175 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K AS+PNGLS+L++KFK C  LN S ELKDYL   Y+ AAQYD PP +PV+ +C  ID  
Sbjct  265  KTASQPNGLSVLTKKFKTCFPLNLSSELKDYLETIYNSAAQYDRPPTFPVSAICSAIDNT  324

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIP----TGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
             KGA +L ++FAG+ A +GNQSCY       +     GW+WQ CSEM  PIGRG  DTMF
Sbjct  325  SKGADLLSKVFAGLVAYKGNQSCYDTKEFKYSTETKRGWNWQRCSEMVMPIGRGSNDTMF  384

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              APFNL  F + C  L+G+ PR +WITT +GG DI+LVL +FG NIIFSNGLRD
Sbjct  385  QAAPFNLTNFKQRCKRLYGISPRSNWITTQFGGHDIELVLKRFGGNIIFSNGLRD  439



>ref|XP_008458664.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Cucumis 
melo]
Length=436

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 127/174 (73%), Gaps = 6/174 (3%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            IASKPNGLSILS++FK C  LNSS +L+DYL   Y+ AAQY+ PP YPVT +CGGIDGA 
Sbjct  259  IASKPNGLSILSKEFKTCSPLNSSSQLEDYLWSMYAGAAQYNHPPRYPVTRICGGIDGAS  318

Query  330  KGAHILDRIFAGVFASEGNQSCYSI----PTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
             G+ I+ ++ AGVFA +GN  CY+I     T T + GW WQ CSEM  P+   + DTMF 
Sbjct  319  PGSGIISKVAAGVFAYKGNLPCYNIGPRNDTETDV-GWRWQRCSEMVMPMSTSN-DTMFP  376

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P  F+L+ F   C  L+GV PRPHW+TTYYGG DIKL+L +FGSNIIFSNGLRD
Sbjct  377  PITFDLRSFIDYCYQLYGVSPRPHWVTTYYGGNDIKLILQRFGSNIIFSNGLRD  430



>gb|KHN27695.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=511

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P GLSILS++F  C+ LN S ELKDYL+  Y+ +AQY+ PP YPVT +CGGID A
Sbjct  263  RVASQPKGLSILSQRFNTCRPLNESSELKDYLINMYASSAQYNHPPRYPVTVICGGIDRA  322

Query  333  PKGAHILDRIFAGVFASEGNQSCYS---IPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
              G+ IL +I+AG+ A  GN +C     I       GW WQ+CSEM  PIG G+ +TMF 
Sbjct  323  SFGSDILSKIYAGLVALRGNTTCKVNGPIIVSETTLGWRWQTCSEMVIPIGIGN-NTMFQ  381

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PF+L+ ++K+C   FGV PRPHW+TTYYGG  I+LVL KFGSNIIFSNGLRD
Sbjct  382  PDPFSLKSYAKDCKKQFGVSPRPHWVTTYYGGHSIELVLQKFGSNIIFSNGLRD  435



>ref|XP_008458663.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Cucumis 
melo]
Length=499

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 127/174 (73%), Gaps = 6/174 (3%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            IASKPNGLSILS++FK C  LNSS +L+DYL   Y+ AAQY+ PP YPVT +CGGIDGA 
Sbjct  259  IASKPNGLSILSKEFKTCSPLNSSSQLEDYLWSMYAGAAQYNHPPRYPVTRICGGIDGAS  318

Query  330  KGAHILDRIFAGVFASEGNQSCYSI----PTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
             G+ I+ ++ AGVFA +GN  CY+I     T T + GW WQ CSEM  P+   + DTMF 
Sbjct  319  PGSGIISKVAAGVFAYKGNLPCYNIGPRNDTETDV-GWRWQRCSEMVMPMSTSN-DTMFP  376

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P  F+L+ F   C  L+GV PRPHW+TTYYGG DIKL+L +FGSNIIFSNGLRD
Sbjct  377  PITFDLRSFIDYCYQLYGVSPRPHWVTTYYGGNDIKLILQRFGSNIIFSNGLRD  430



>ref|XP_007016019.1| Serine carboxypeptidase S28 family protein, putative [Theobroma 
cacao]
 gb|EOY33638.1| Serine carboxypeptidase S28 family protein, putative [Theobroma 
cacao]
Length=468

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 127/174 (73%), Gaps = 5/174 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIASK +GLS LS+KFK C+ L SS E K+YL   Y+ AAQYD PP YPV EVC GIDG+
Sbjct  229  KIASKHHGLSTLSKKFKTCEPLTSSSEFKNYLDTMYTGAAQYDRPPSYPVNEVCRGIDGS  288

Query  333  PKGAHILDRIFAGVFASEGNQSCY-SIPTGTAI--WGWSWQSCSEMAFPIGRGDGDTMFF  163
             K   IL +IF GV A  GN++CY + PT  +    GW WQ+CSEM  PIG G+ +TMF 
Sbjct  289  KK-QDILSKIFDGVVAYYGNRTCYLNQPTSDSETDQGWRWQTCSEMVMPIGVGE-NTMFQ  346

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PF+L  F KNC   +GVP RPHWIT+YYGGQDIKL+L +FGSNIIFSNGLRD
Sbjct  347  PDPFDLDSFIKNCKGYYGVPARPHWITSYYGGQDIKLILQRFGSNIIFSNGLRD  400



>ref|XP_007016018.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33637.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=500

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 126/176 (72%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKP+GLS LS+KFK C  L SS ELK +L   Y+  AQY+ PP YPV+ VCGGIDGA
Sbjct  259  RVASKPHGLSTLSKKFKTCYPLTSSSELKSFLRLMYAYTAQYNRPPRYPVSVVCGGIDGA  318

Query  333  PKGAH--ILDRIFAGVFASEGNQSCYSIPTGTAI---WGWSWQSCSEMAFPIGRGDGDTM  169
              G+   IL +IF+GV A  GN+SCY  P   A     GWSWQ CSEM  PIG G+G TM
Sbjct  319  SFGSQDDILTKIFSGVVAYYGNRSCYVNPETNASEIEIGWSWQRCSEMVIPIGIGNG-TM  377

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
               +PFNL  F K C + +GVP RPHW+T+YYGG DIKL+L++FGSNIIFSNGLRD
Sbjct  378  LEASPFNLTSFIKQCESFYGVPSRPHWVTSYYGGHDIKLILHRFGSNIIFSNGLRD  433



>ref|XP_006573176.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Glycine 
max]
Length=444

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +IAS+PNGL  LS++F  C  LN S+EL DYL   Y  AAQY+ PP YPV+ +CGGIDG 
Sbjct  198  RIASQPNGLVTLSQRFNTCHTLNQSYELIDYLRSTYVYAAQYNQPPRYPVSMICGGIDGE  257

Query  333  PKGAHILDRIFAGVFASEGNQSC-YSIPTGTA--IWGWSWQSCSEMAFPIGRGDGDTMFF  163
              G+ IL +I+AG+ A  GN +C  + PT  +    GW WQ+CSEM  PIG G+ DTMF 
Sbjct  258  SLGSDILSKIYAGIVALRGNSTCKVNGPTNVSETTVGWRWQTCSEMVIPIGIGN-DTMFE  316

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PFNL ++++ C   +GV PRPHW+TTYYGG +IKLVL + GSNIIFSNGLRD
Sbjct  317  PIPFNLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRD  370



>gb|KHN44803.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=471

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +IAS+PNGL  LS++F  C  LN S+EL DYL   Y  AAQY+ PP YPV+ +CGGIDG 
Sbjct  225  RIASQPNGLVTLSQRFNTCHTLNQSYELIDYLRSTYVYAAQYNQPPRYPVSMICGGIDGE  284

Query  333  PKGAHILDRIFAGVFASEGNQSC-YSIPTGTA--IWGWSWQSCSEMAFPIGRGDGDTMFF  163
              G+ IL +I+AG+ A  GN +C  + PT  +    GW WQ+CSEM  PIG G+ DTMF 
Sbjct  285  SLGSDILSKIYAGIVALRGNSTCKVNGPTNVSETTVGWRWQTCSEMVIPIGIGN-DTMFE  343

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PFNL ++++ C   +GV PRPHW+TTYYGG +IKLVL + GSNIIFSNGLRD
Sbjct  344  PIPFNLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRD  397



>ref|XP_003539445.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN27694.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 128/176 (73%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A KPNGLSILS++FK C  LN S++LKDYL   Y+ AAQY+ P E+PV  VCG ID A
Sbjct  258  RVAKKPNGLSILSKRFKTCDKLNKSFDLKDYLDSLYTDAAQYNYPSEHPVKIVCGAIDAA  317

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             K   IL +IF GV A + ++SCY +     PT + + GW WQ+CSE+  PIG    D+M
Sbjct  318  AKKTDILGQIFEGVVAYKQHRSCYDMNEYNHPTESFL-GWRWQTCSEIIMPIGHEKNDSM  376

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F PAPFN++ F + C +L+GV P+PHW+TTYYGG D+KL+L++F SNIIFSNGLRD
Sbjct  377  FPPAPFNMKTFVQECRSLYGVLPQPHWVTTYYGGPDLKLILHRFASNIIFSNGLRD  432



>ref|XP_004145770.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 ref|XP_004160074.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46900.1| hypothetical protein Csa_6G149410 [Cucumis sativus]
Length=499

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 126/174 (72%), Gaps = 6/174 (3%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            I SKPNGLSILS++FK C  LNSS +L+DYL   Y+ AAQY+ PP YPVT +CGGIDGA 
Sbjct  259  IGSKPNGLSILSKEFKTCSPLNSSSQLEDYLWSMYAGAAQYNHPPRYPVTRICGGIDGAS  318

Query  330  KGAHILDRIFAGVFASEGNQSCYSI----PTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
             G+ I+ ++ AGVFA +GN SCY+I     T T + GW WQ CSEM  P+   + DTMF 
Sbjct  319  PGSGIISKVAAGVFAYKGNLSCYNIGPRSETETDV-GWRWQRCSEMVMPLSTTN-DTMFP  376

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P  F+L+ F   C  L+GV  RPHW+TTYYGG DIKL+L +FGSNIIFSNGLRD
Sbjct  377  PITFDLKSFVDYCYQLYGVSSRPHWVTTYYGGNDIKLILQRFGSNIIFSNGLRD  430



>ref|XP_003517871.2| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=503

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +IAS+PNGL  LS++F  C  LN S+EL DYL   Y  AAQY+ PP YPV+ +CGGIDG 
Sbjct  257  RIASQPNGLVTLSQRFNTCHTLNQSYELIDYLRSTYVYAAQYNQPPRYPVSMICGGIDGE  316

Query  333  PKGAHILDRIFAGVFASEGNQSC-YSIPTGTA--IWGWSWQSCSEMAFPIGRGDGDTMFF  163
              G+ IL +I+AG+ A  GN +C  + PT  +    GW WQ+CSEM  PIG G+ DTMF 
Sbjct  317  SLGSDILSKIYAGIVALRGNSTCKVNGPTNVSETTVGWRWQTCSEMVIPIGIGN-DTMFE  375

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PFNL ++++ C   +GV PRPHW+TTYYGG +IKLVL + GSNIIFSNGLRD
Sbjct  376  PIPFNLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRD  429



>ref|XP_011005419.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=500

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 128/175 (73%), Gaps = 5/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIASKPNGL+ILS+KFK C  LN ++EL+D+L   Y  AAQYD PPE+PV+ VCGGI+ A
Sbjct  256  KIASKPNGLAILSKKFKTCYPLNRTFELEDFLDSIYCEAAQYDYPPEFPVSTVCGGINKA  315

Query  333  PKGAH-ILDRIFAGVFASEGNQSCYSIPT---GTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
                  ILDRIFAGV A  GN SCY +           W WQ+CSE+  PIG  + ++MF
Sbjct  316  SAARTGILDRIFAGVVAYMGNISCYDMNAFNYQDKTEEWRWQTCSELVMPIGH-ESNSMF  374

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             PAPFNL+ + K+C +LFGV P+P WITTYYGG D+KL+L++FGSNIIFSNGLRD
Sbjct  375  PPAPFNLKNYIKDCKSLFGVLPQPRWITTYYGGHDLKLILHRFGSNIIFSNGLRD  429



>ref|XP_011036743.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=514

 Score =   207 bits (527),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 125/175 (71%), Gaps = 6/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIASKP+GLSILS+KFK C+ LN+S ELKDYL G Y  AAQYD PP YPVT +C  ID  
Sbjct  271  KIASKPDGLSILSKKFKTCKPLNNSSELKDYLAGIYMAAAQYDAPPSYPVTVICRSIDEP  330

Query  333  PKGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G  IL RIFAG+ A  G   CY    +  T T + GWSWQ+C++M  P G  + D+MF
Sbjct  331  SFGNDILGRIFAGMVAYRGELPCYVNKPTKETETDV-GWSWQTCADMVIPFGISN-DSMF  388

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PF+L  +  +C + +GVPPRPHW+TTY+GG DIKL+L +FGSNIIFSNGLRD
Sbjct  389  QPYPFDLNVYINDCKDEYGVPPRPHWVTTYFGGHDIKLILKRFGSNIIFSNGLRD  443



>ref|XP_007150128.1| hypothetical protein PHAVU_005G129100g [Phaseolus vulgaris]
 gb|ESW22122.1| hypothetical protein PHAVU_005G129100g [Phaseolus vulgaris]
Length=511

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 125/176 (71%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A KPNGLSILS++FK C+ L+ S+ELKDYL   Y+ AAQY+ P E PV  +C  ID A
Sbjct  260  RVAEKPNGLSILSKRFKTCEKLSKSFELKDYLDSLYTDAAQYNFPSENPVKVICSAIDAA  319

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             K   IL +IF GV A   + SCY +     PT T + GW WQ+CSEM  PIG    D+M
Sbjct  320  AKKTDILGQIFEGVVAFMRHHSCYDMNGYNHPTETNL-GWRWQTCSEMVMPIGHERNDSM  378

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F PAPFN+++F   C +L+GV P+PHW+TTYYGG D+KL+L++F SNIIFSNGLRD
Sbjct  379  FPPAPFNMKRFVHECRSLYGVLPQPHWVTTYYGGPDLKLILHRFASNIIFSNGLRD  434



>ref|XP_006424417.1| hypothetical protein CICLE_v10028252mg [Citrus clementina]
 gb|ESR37657.1| hypothetical protein CICLE_v10028252mg [Citrus clementina]
Length=502

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 125/176 (71%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K AS+P+GLSILS+KF+ C+ L  S+EL+DYL   Y+ AAQY+ PP+YPV  +CGGIDGA
Sbjct  261  KFASEPDGLSILSKKFRTCKPLKDSYELEDYLELVYADAAQYNQPPKYPVNMLCGGIDGA  320

Query  333  PKGAH--ILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
              G    IL +IFAGV AS+GN++CY  P         G+ WQ+CSEM  PIG  D  TM
Sbjct  321  ALGTDNDILSKIFAGVVASKGNKTCYVNPPINESETTVGYRWQTCSEMVMPIGI-DNTTM  379

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F P PF L  +  +C  L+GV PRPHW+TTYYGG DIKL+L +F SNIIFSNGLRD
Sbjct  380  FPPDPFELSNYIDDCKKLYGVSPRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRD  435



>emb|CDP14439.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 127/179 (71%), Gaps = 10/179 (6%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+ASKPNGLSILS++FK C  LNSS ELKDYL   Y++AAQY++P  YPVTE+C GID  
Sbjct  247  KVASKPNGLSILSKRFKTCSPLNSSSELKDYLNYVYTLAAQYNSPSNYPVTEICNGIDKV  306

Query  333  PKGAHILDRIFAGVFASEGNQSC-----YSIPTGTAIWGWSWQSCSEMAFPIGR---GDG  178
            PKG  +L RIF GV + +G+ SC     Y+ P+   I GW+WQ+CSE+  PIG+      
Sbjct  307  PKGTDLLGRIFVGVVSYKGDNSCYDPLEYAYPSEACI-GWTWQTCSEIVMPIGKSHLSSN  365

Query  177  DTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            DTMF P+PF L  F + C + +GV PRPHWIT  YG  DIKLV  +FGSNIIFSNGLRD
Sbjct  366  DTMFPPSPFILLDFIEYCESSYGVSPRPHWITN-YGCHDIKLVFQRFGSNIIFSNGLRD  423



>ref|XP_009591854.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Nicotiana 
tomentosiformis]
Length=412

 Score =   202 bits (515),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 114/150 (76%), Gaps = 0/150 (0%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIAS  +GL+ LS+KFK C  LN+S +LK YL   Y++AAQYD PP YPVT +CGGIDGA
Sbjct  263  KIASTKDGLAYLSQKFKTCSPLNNSSDLKGYLDSTYAVAAQYDDPPRYPVTVICGGIDGA  322

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFFPAP  154
              G+ +LDRIFAG+ A EGN+SCY+I  G    GW WQ+CSEM  PIGRG+ DTMF+ AP
Sbjct  323  TNGSDVLDRIFAGIVAYEGNKSCYNILPGQTDLGWDWQTCSEMVMPIGRGENDTMFYSAP  382

Query  153  FNLQQFSKNCINLFGVPPRPHWITTYYGGQ  64
            F+L +F ++C + +GV PRPHW+TTYYGG 
Sbjct  383  FSLDEFIEDCKSDYGVSPRPHWVTTYYGGH  412



>ref|XP_010247724.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=501

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 122/177 (69%), Gaps = 7/177 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+ NGLS+LS+KF+ C  LN S ELK YL   Y+ AAQY+ PPEYPV  +C  IDGA
Sbjct  260  ELASQSNGLSLLSQKFQTCSALNKSSELKGYLEYVYTDAAQYNAPPEYPVDRICSAIDGA  319

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             +G  IL RIFAGV AS  N SCY       PT T + GW WQ+CSEM FPI  G   T 
Sbjct  320  SEGTDILSRIFAGVVASRVNSSCYDTNEYNYPTETFV-GWDWQTCSEMVFPIDHGRDPTS  378

Query  168  FFPA-PFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             FPA  F L+ + ++C   +GVPPRPHWITT +GG DIKLVL +F SNIIFSNGLRD
Sbjct  379  MFPASTFVLRDYIEDCNRSYGVPPRPHWITTEFGGHDIKLVLKRFASNIIFSNGLRD  435



>ref|XP_002324914.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
 gb|EEF03479.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
Length=510

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 125/175 (71%), Gaps = 6/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KIAS+P+GLSILS+KF+ C+ LN+S EL DYL G Y  AAQYD PP YPVT VC  ID  
Sbjct  267  KIASEPDGLSILSKKFETCKPLNNSSELTDYLAGIYMAAAQYDAPPSYPVTMVCKSIDEP  326

Query  333  PKGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G  IL RIFAG+ A +G   CY    +  T T + GWSWQ+C++M  P G  + D+MF
Sbjct  327  SFGNDILGRIFAGMVAYQGELPCYVNEPTKETETDV-GWSWQTCADMVIPFGISN-DSMF  384

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PF+L  +  +C + +GVPPRPHW+TTY+GG DIKL+L +FGSNIIFSNGLRD
Sbjct  385  QPYPFDLNAYINDCKDEYGVPPRPHWVTTYFGGHDIKLILKRFGSNIIFSNGLRD  439



>gb|KDP43936.1| hypothetical protein JCGZ_05403 [Jatropha curcas]
Length=503

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 127/177 (72%), Gaps = 7/177 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+PNGL+ILS+KFK C+ L    ELKDYL   YS AAQY+ PP+YPVT VC GIDG+
Sbjct  261  QLASQPNGLAILSKKFKTCKPLTDVDELKDYLDTMYSGAAQYNKPPKYPVTVVCNGIDGS  320

Query  333  ---PKGAHILDRIFAGVFASEGNQSCY-SIPTGTA--IWGWSWQSCSEMAFPIGRGDGDT  172
                 G   L +IF GV A  GN++CY + PT  +    GW WQ+CSEM  PIGRG+ DT
Sbjct  321  NTDSDGNDTLSKIFGGVVAYRGNRTCYINSPTNVSETSVGWRWQTCSEMVIPIGRGN-DT  379

Query  171  MFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            MF P PF+L  + ++C   +GVPPRP W+TTYYGG  IKL+L +FGSNIIFSNGLRD
Sbjct  380  MFPPDPFDLNAYVQDCKASYGVPPRPRWVTTYYGGHSIKLILQRFGSNIIFSNGLRD  436



>ref|XP_002523752.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38692.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 127/175 (73%), Gaps = 7/175 (4%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            +AS P GL +LS+KFK C+ L  S ELKD L   YS AAQY+ PP YPV  +C GIDGA 
Sbjct  260  VASMPKGLDVLSKKFKTCKPLTDSDELKDRLDSMYSGAAQYNKPPTYPVNIICSGIDGAA  319

Query  330  KGAH-ILDRIFAGVFASEGNQSCYSIP----TGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              ++  LD+IFAGV A  GN+SCY  P    + T++ GW WQ+CSEM  PIGRG+ DTMF
Sbjct  320  SSSNDTLDKIFAGVVAYRGNRSCYINPPTNLSETSV-GWRWQTCSEMVIPIGRGN-DTMF  377

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P+PF+L  + ++C  ++GV PRPHW+TTYYGG  IKL+L +FGSNIIFSNG+RD
Sbjct  378  PPSPFDLNGYVQDCNAIYGVRPRPHWVTTYYGGHSIKLILQRFGSNIIFSNGIRD  432



>emb|CDP07008.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 125/183 (68%), Gaps = 12/183 (7%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASK NGLSILS++FK C  L+S  EL DYL   +++AAQY+ PP YPV E+C GID A
Sbjct  264  EVASKTNGLSILSKRFKTCAPLSSPSELADYLASMFTMAAQYNAPPRYPVAELCSGIDKA  323

Query  333  PKGAHILDRIFAGVFASEGNQSCYS--IPTGTAIWGWSWQS----------CSEMAFPIG  190
            P+G  IL RIFAGV +   ++SCY   I +G+    W  +S          CSEM  P+G
Sbjct  324  PEGTDILGRIFAGVVSFRKDESCYDGIIISGSLRIKWQSRSLVCLLFPLLTCSEMVMPMG  383

Query  189  RGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNG  10
             G  DT+F  +PFNL  F K+C + +GV PRPHWITTYYGG DIKL+  +FGSNIIFSNG
Sbjct  384  HGSNDTIFPSSPFNLPDFIKDCKSSYGVSPRPHWITTYYGGHDIKLIFQRFGSNIIFSNG  443

Query  9    LRD  1
            L+D
Sbjct  444  LKD  446



>ref|XP_008226847.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=521

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +IAS+P GLS+LSRKF+ C  L  S  L+DYL+  Y+ AAQY+ PP YPVT VCGGIDGA
Sbjct  266  EIASQPEGLSVLSRKFQTCSQLLKSSVLEDYLMLMYTGAAQYNRPPRYPVTVVCGGIDGA  325

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
              G   L +IFAGV A  GN+SCY  P         GW WQ+CS+M  PIG  + D+MF 
Sbjct  326  SHGNDTLSKIFAGVVAYRGNESCYVNPPKNKSETDVGWRWQTCSDMVMPIGISN-DSMFP  384

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
               F+L+++ ++C   +GVPPRPHW TTY+GG DIKLVL++F SNIIFSNGLRD
Sbjct  385  ANQFDLKEYVESCKAQYGVPPRPHWATTYFGGHDIKLVLSRFASNIIFSNGLRD  438



>gb|KEH38910.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=510

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+AS+PNGLSILS++F  C+ LN S+EL + L   Y+ AAQY+ PP+YPVT +C GID A
Sbjct  258  KVASQPNGLSILSQRFNTCRPLNHSFELSEDLESMYTSAAQYNHPPDYPVTVICSGIDKA  317

Query  333  PKGAHILDRIFAGVFASEGNQSC-YSIPTGTAIW--GWSWQSCSEMAFPIGRGDGDTMFF  163
              G +ILD+I++GV A +GN +C  + P   +    GW WQ+CSEM  P   G+ DTMF 
Sbjct  318  SFGNNILDKIYSGVVAYKGNGTCKVNNPKNISETDVGWRWQTCSEMVMPFAIGN-DTMFQ  376

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P+PF+L++F + C   +GV PRPHWITTYYGG DIK VL KFGSNIIFSNGL+D
Sbjct  377  PSPFDLKRFVERCKKKYGVSPRPHWITTYYGGHDIKRVLQKFGSNIIFSNGLKD  430



>ref|XP_004295650.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 123/174 (71%), Gaps = 6/174 (3%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            IAS P GLS LS+KF+ C+ LN S ELKDYL   YS AAQYD PP YPVT VCGGIDGA 
Sbjct  266  IASTPGGLSFLSKKFQTCRPLNKSSELKDYLDTMYSTAAQYDRPPRYPVTVVCGGIDGAS  325

Query  330  KGAHILDRIFAGVFASEGNQSCYSIP----TGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
                 L +IFAGV A  GN+SCY  P    T T + GW+WQ+CS+M  PI   + DTMF 
Sbjct  326  STDDTLTKIFAGVVAYTGNRSCYVNPPRNLTETDV-GWAWQTCSDMVIPINVSN-DTMFP  383

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P  F+  +++K+CI  +GVPPR +W+TTY+GG DIKL L++F  NIIFSNGLRD
Sbjct  384  PYKFDSDEYTKDCIATYGVPPRLNWVTTYFGGHDIKLGLSRFAGNIIFSNGLRD  437



>ref|XP_006436581.1| hypothetical protein CICLE_v10033696mg [Citrus clementina]
 gb|ESR49821.1| hypothetical protein CICLE_v10033696mg [Citrus clementina]
Length=506

 Score =   200 bits (508),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 123/174 (71%), Gaps = 3/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K  +K NGL+ LS+KFK C+ L S  ELKDYL   Y++AAQYD PP YPV +VC GIDGA
Sbjct  265  KTGAKRNGLAFLSKKFKTCKPLKSVSELKDYLENMYTVAAQYDRPPNYPVNQVCNGIDGA  324

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
             +G   + RIF+G+ AS G +SCY+I    +   + GW W++CSE+  PIG G   +MF 
Sbjct  325  SQGTDTVARIFSGIVASWGKKSCYNIGEFFSDETLNGWGWKTCSEIVMPIGIGKNKSMFP  384

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              PFNL+++  +C + +GV PR HWITTYYGG DI++VL +FGSNIIFS+GL D
Sbjct  385  AEPFNLKEYMDSCKSSYGVVPRTHWITTYYGGLDIRVVLKRFGSNIIFSSGLHD  438



>ref|XP_006485332.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=511

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 123/174 (71%), Gaps = 3/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K  +K NGL+ LS+KFK C+ L S  ELKDYL   Y++AAQYD PP YPV +VC GIDGA
Sbjct  265  KTGAKRNGLAFLSKKFKTCKPLKSVSELKDYLENMYTVAAQYDRPPNYPVNQVCNGIDGA  324

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
             +G   + RIF+G+ AS G +SCY+I    +   + GW W++CSE+  PIG G   +MF 
Sbjct  325  SQGTDTVARIFSGIVASWGKKSCYNIGEFFSDETLNGWGWKTCSEIVMPIGIGKNKSMFP  384

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              PFNL+++  +C + +GV PR HWITTYYGG DI++VL +FGSNIIFS+GL D
Sbjct  385  AEPFNLKEYMDSCKSSYGVVPRTHWITTYYGGLDIRVVLKRFGSNIIFSSGLHD  438



>ref|XP_009356965.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Pyrus 
x bretschneideri]
Length=445

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            IASKP GLS LS KF+ C  L  S ELKDYL   Y  AAQY++PP YPVT VCGGIDG  
Sbjct  268  IASKPEGLSFLSNKFRTCSPLTKSSELKDYLDSLYCEAAQYNSPPSYPVTVVCGGIDGVS  327

Query  330  KGAHILDRIFAGVFASEGNQSCY-SIPTGTAIW--GWSWQSCSEMAFPIGRGDGDTMFFP  160
             G   L +IFAGV A  GN+SCY + P   +    GWSWQ+CS++  P+G  + ++MF P
Sbjct  328  SGNDTLSKIFAGVVAYYGNRSCYVNEPRNLSETDVGWSWQTCSDLVIPMGVSN-ESMFPP  386

Query  159  APFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              F+LQ++  +C  L+GVPPRPHW TTY+GG DIKL L +F SNIIFSNGLRD
Sbjct  387  YQFDLQEYIDSCKALYGVPPRPHWATTYFGGHDIKLALYRFASNIIFSNGLRD  439



>ref|XP_009356983.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=507

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 117/173 (68%), Gaps = 4/173 (2%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            IASKP GLS LS KF  C  L +S ELK+YL G Y  AAQY++PP YPVT  CGGIDG  
Sbjct  268  IASKPEGLSFLSNKFHTCSPLTTSSELKNYLDGLYCGAAQYNSPPSYPVTVFCGGIDGVS  327

Query  330  KGAHILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTMFFP  160
             G   L +IFAGV A  GN+SCY            GWSWQ+CS+M  PI   + D+MF P
Sbjct  328  SGNDTLSKIFAGVVAYSGNRSCYVNEPRNLSETDVGWSWQTCSDMVIPISVSN-DSMFPP  386

Query  159  APFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              F+LQ++  NC  ++GVPPRPHW+T Y+GG DIKL L +F SNIIFSNGLRD
Sbjct  387  YQFDLQEYIDNCKAIYGVPPRPHWVTAYFGGHDIKLALYRFASNIIFSNGLRD  439



>ref|XP_006378926.1| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
 gb|ERP56723.1| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
Length=456

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 129/175 (74%), Gaps = 6/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKP+GLSILS+KFK C  L  + ELK++L   Y+ AAQY+ PP YPV +VCGGIDG 
Sbjct  258  EVASKPDGLSILSKKFKTCNPLTDASELKNHLDSMYANAAQYNKPPTYPVNKVCGGIDGC  317

Query  333  PKGAHILDRIFAGVFASEGNQSCY-SIPTG---TAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G  +L R+F G+ A +GN+SCY + PT    T++ GW WQ+CSEM  PIG G+ D+MF
Sbjct  318  GFGDDLLGRVFGGLVAYKGNRSCYVNEPTNQSETSV-GWRWQTCSEMVMPIGYGN-DSMF  375

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PF+L+ + ++C +L+ V PR HW+TTYYGG  I+L+L +F SNIIFSNGLRD
Sbjct  376  PPDPFDLKAYIEDCKSLYDVTPRFHWVTTYYGGHSIRLILQRFASNIIFSNGLRD  430



>ref|XP_009356964.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Pyrus 
x bretschneideri]
Length=506

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 118/173 (68%), Gaps = 4/173 (2%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            IASKP GLS LS KF+ C  L  S ELKDYL   Y  AAQY++PP YPVT VCGGIDG  
Sbjct  268  IASKPEGLSFLSNKFRTCSPLTKSSELKDYLDSLYCEAAQYNSPPSYPVTVVCGGIDGVS  327

Query  330  KGAHILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTMFFP  160
             G   L +IFAGV A  GN+SCY            GWSWQ+CS++  P+G  + ++MF P
Sbjct  328  SGNDTLSKIFAGVVAYYGNRSCYVNEPRNLSETDVGWSWQTCSDLVIPMGVSN-ESMFPP  386

Query  159  APFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              F+LQ++  +C  L+GVPPRPHW TTY+GG DIKL L +F SNIIFSNGLRD
Sbjct  387  YQFDLQEYIDSCKALYGVPPRPHWATTYFGGHDIKLALYRFASNIIFSNGLRD  439



>ref|XP_010100142.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81593.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=544

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 122/176 (69%), Gaps = 5/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P+GLSILSRKFK C  L +S +LKDYL   Y  AAQY+ P   P++ +C  IDGA
Sbjct  267  RVASEPSGLSILSRKFKTCGKLKTSADLKDYLDTVYCGAAQYNGPSTRPLSHLCNAIDGA  326

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIP----TGTAIWGWSWQSCSEMAFPIGRG-DGDTM  169
            P     L ++FAGV A  GN+SCY+I     +   + GW WQSCSEM  PI  G D D+M
Sbjct  327  PNNTDTLGKLFAGVSAYRGNRSCYNISGNNLSDQLLDGWYWQSCSEMVMPIAHGSDEDSM  386

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F    F+L+ ++ +C  L+GV PRPHW+TTYYGG DIKLV ++F SNIIFSNGLRD
Sbjct  387  FPKDHFDLESYTNDCKRLYGVVPRPHWVTTYYGGHDIKLVFHEFASNIIFSNGLRD  442



>ref|XP_002313555.2| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
 gb|EEE87510.2| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
Length=495

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 129/175 (74%), Gaps = 6/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKP+GLSILS+KFK C  L  + ELK++L   Y+ AAQY+ PP YPV +VCGGIDG 
Sbjct  258  EVASKPDGLSILSKKFKTCNPLTDASELKNHLDSMYANAAQYNKPPTYPVNKVCGGIDGC  317

Query  333  PKGAHILDRIFAGVFASEGNQSCY-SIPTG---TAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G  +L R+F G+ A +GN+SCY + PT    T++ GW WQ+CSEM  PIG G+ D+MF
Sbjct  318  GFGDDLLGRVFGGLVAYKGNRSCYVNEPTNQSETSV-GWRWQTCSEMVMPIGYGN-DSMF  375

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PF+L+ + ++C +L+ V PR HW+TTYYGG  I+L+L +F SNIIFSNGLRD
Sbjct  376  PPDPFDLKAYIEDCKSLYDVTPRFHWVTTYYGGHSIRLILQRFASNIIFSNGLRD  430



>ref|XP_006487982.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=502

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 121/176 (69%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+ASK +GLSILS+KF+ C+ L   +EL+DYL   Y+ AAQY+ PP+YPV  +CGGIDGA
Sbjct  261  KVASKLDGLSILSKKFRTCKPLKDLYELEDYLELVYADAAQYNQPPKYPVNMLCGGIDGA  320

Query  333  PKGAH--ILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
              G     L +IFAGV AS+GN++CY  P         G+ WQ CSEM  PIG  D  TM
Sbjct  321  ALGTDNDTLSKIFAGVVASKGNKTCYVNPPINESETTVGYRWQRCSEMVMPIGI-DNTTM  379

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F P PF+   +  +C  L+GV  RPHW+TTYYGG DIKL+L +F SNIIFSNGLRD
Sbjct  380  FPPDPFDRSNYIDDCKKLYGVSSRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRD  435



>ref|XP_007153468.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
 gb|ESW25462.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
Length=496

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+PNGL  LS+ F  C  LN    L DYL   Y+ AAQY+ PP+YPV  +CGGIDGA
Sbjct  250  RVASQPNGLVTLSQIFNTCHSLNQVESLIDYLRLMYASAAQYNHPPKYPVNVICGGIDGA  309

Query  333  PKGAHILDRIFAGVFASEGNQSC-YSIPTGTA--IWGWSWQSCSEMAFPIGRGDGDTMFF  163
              G+ IL +I+AGV A +GN +C  + PT  +    GW WQ+CSEM  PIG  + DTMF 
Sbjct  310  SDGSDILSKIYAGVVALKGNTTCTINGPTNVSETTVGWRWQTCSEMVIPIGI-EKDTMFE  368

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PF+L+++ + C   FGV PRPHW+TTYYG  +IKLVL +FGSNIIFSNGL+D
Sbjct  369  PNPFSLKRYVEGCKTTFGVSPRPHWVTTYYGAHNIKLVLGRFGSNIIFSNGLKD  422



>ref|XP_006388621.1| hypothetical protein POPTR_0135s00200g [Populus trichocarpa]
 gb|ERP47535.1| hypothetical protein POPTR_0135s00200g [Populus trichocarpa]
Length=496

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 127/175 (73%), Gaps = 6/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKP+GLS+LS+KFK C  L  + ELKD+L   Y+ AAQY+ PP YPV EVC GIDG 
Sbjct  259  ELASKPDGLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGG  318

Query  333  PKGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G   L RIF G+ A  GN SCY    + P+ T + GW WQ+CSEMA PIG G+ ++MF
Sbjct  319  GFGDDTLSRIFGGLVAYNGNLSCYVNAHTDPSETTV-GWQWQTCSEMAIPIGVGN-NSMF  376

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PF+L+ + +NC +L+GVP RPHWITTYYGG  IKL+L +F SNIIFSNGLRD
Sbjct  377  PPDPFDLEDYIENCKSLYGVPTRPHWITTYYGGHSIKLILQRFASNIIFSNGLRD  431



>ref|XP_002874100.1| hypothetical protein ARALYDRAFT_910290 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50359.1| hypothetical protein ARALYDRAFT_910290 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +IA+KPNGLSILS+KFKLC  LN + ELK YL   Y+  AQY+  P Y V  +C  I+ +
Sbjct  257  RIAAKPNGLSILSKKFKLCNPLNDTIELKSYLSNIYAGTAQYNNNP-YSVASLCEAINTS  315

Query  333  P--KGAHILDRIFAGVFASEGNQSCYSIPTGTA-IWGWSWQSCSEMAFPIGRGDGDTMFF  163
            P    + +LD+IFAGV AS GN SCY +   T     W+WQSCSEM  PIG    DTMF 
Sbjct  316  PPNTKSDLLDQIFAGVVASGGNISCYGMDQITNDARAWTWQSCSEMVMPIGYEKEDTMFQ  375

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PFN+  F+KNC + +GV PRPHW+T Y+G QD+KL+  +FG+NIIFSNGL D
Sbjct  376  PKPFNMSSFTKNCESQYGVSPRPHWVTAYFGSQDVKLIFRRFGNNIIFSNGLLD  429



>gb|KCW50727.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
Length=458

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 118/175 (67%), Gaps = 5/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A +PNG S LS  FK C+ L S  ELK+YL+  Y+ AAQYD PP YPVT +C GIDGA
Sbjct  256  RVAQEPNGTSNLSEMFKTCKPLESGDELKNYLMSLYAYAAQYDDPPRYPVTVICNGIDGA  315

Query  333  PKGAH-ILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
                + IL +IFAGV A +GN +CY  P         GW WQ CSEM  PIG  + ++MF
Sbjct  316  NTTENGILGKIFAGVVAYKGNSACYVNPPTNVSQTDLGWGWQRCSEMVMPIGITN-NSMF  374

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
               PFNL  F   C + +GV PRPHWITTYYGG DI+L+L +FGSNIIFSNGLRD
Sbjct  375  QSYPFNLSSFIDECNDQYGVTPRPHWITTYYGGHDIELILLRFGSNIIFSNGLRD  429



>emb|CDP07009.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 121/177 (68%), Gaps = 7/177 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
             IAS+P GLSILS++FK C  LNS  ELK++LV   + +AQY+ PP+YP+T +C  ID A
Sbjct  184  NIASQPGGLSILSQRFKTCSHLNSGVELKNFLVSMCASSAQYNHPPDYPLTVLCEAIDRA  243

Query  333  PKGAHILDRIFAGVFASEG-NQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDT  172
                 I  +IFAGV ++ G N SCY +     PT T   GW WQ CSEM  PIGR     
Sbjct  244  GSRTDIFGQIFAGVESAFGKNSSCYDVNYFHRPTETN-EGWGWQVCSEMVMPIGRTVEAH  302

Query  171  MFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            MF PAPFNL +F++ C  ++GVPPRPHWITTYYGG DIKL L KF SNIIFSNG +D
Sbjct  303  MFQPAPFNLTEFTQYCKLVYGVPPRPHWITTYYGGHDIKLTLQKFASNIIFSNGRKD  359



>ref|XP_008458666.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Cucumis 
melo]
Length=365

 Score =   191 bits (485),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 117/174 (67%), Gaps = 7/174 (4%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            +AS+PNGLSIL ++FK C+ L   +EL+DYL   Y+ AAQY+ PP+YPVT +C  IDG  
Sbjct  128  VASQPNGLSILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTY  187

Query  330  KGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
                 L +I AGVFA  G+ SCY       T T + GW WQSCSEM  PI     D MF 
Sbjct  188  SVNGTLSKIAAGVFAFRGSISCYINEPRNETETDV-GWRWQSCSEMVMPIS--SDDDMFP  244

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PF+LQ     C  L+GVPPRPHW TTYYGG DI+LVL +FGSNIIFSNGL+D
Sbjct  245  PYPFDLQSVINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKD  298



>gb|KDP43937.1| hypothetical protein JCGZ_05404 [Jatropha curcas]
Length=491

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 119/173 (69%), Gaps = 3/173 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A++PNGL  LS KF  C+ LNSS ELKD L   Y  AAQYD PP YPV  +C  IDGA
Sbjct  251  RVAAEPNGLLTLSNKFNTCRTLNSSKELKDRLAISYISAAQYDNPPYYPVQNICHAIDGA  310

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTG--TAIWGWSWQSCSEMAFPIGRGDGDTMFFP  160
            P+G  IL R+ AG+    G Q C +I +   +   GW WQ+C+E+  PIG GD +TMF  
Sbjct  311  PEGTDILGRVAAGLHRYPG-QGCVNIFSFELSNKSGWDWQTCTEIVMPIGYGDNETMFQA  369

Query  159  APFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             PF+L+ ++++C+N FGV PRPHW+TT +GG DIK VL  F SNIIFSNGLRD
Sbjct  370  EPFDLKNYTRDCVNCFGVVPRPHWVTTEFGGHDIKTVLGNFASNIIFSNGLRD  422



>gb|KCW50732.1| hypothetical protein EUGRSUZ_J00405 [Eucalyptus grandis]
Length=476

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 123/171 (72%), Gaps = 5/171 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P+GL+ LS  FK C+ L SS +LKD+L+  Y  AAQY+ PP   V E+C  IDGA
Sbjct  244  RVASEPHGLTKLSNTFKTCRPLQSSSQLKDHLIYAYEGAAQYNDPP---VKEICNAIDGA  300

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFFPAP  154
                 IL +IFAG+ AS+GN  CY  P+ T + GWSWQ+CSEM  PIG  + +TMF P P
Sbjct  301  SPRNDILGKIFAGLVASDGNLPCYVNPSQTDL-GWSWQTCSEMVMPIGITE-NTMFQPEP  358

Query  153  FNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F+L  ++ +C   +G+ PRPHWITTYYGG DIKLVL++F SNIIFSNGL+D
Sbjct  359  FDLNSYNNDCKRSYGITPRPHWITTYYGGHDIKLVLHRFASNIIFSNGLQD  409



>ref|XP_010034183.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=497

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 123/171 (72%), Gaps = 5/171 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P+GL+ LS  FK C+ L SS +LKD+L+  Y  AAQY+ PP   V E+C  IDGA
Sbjct  265  RVASEPHGLTKLSNTFKTCRPLQSSSQLKDHLIYAYEGAAQYNDPP---VKEICNAIDGA  321

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFFPAP  154
                 IL +IFAG+ AS+GN  CY  P+ T + GWSWQ+CSEM  PIG  + +TMF P P
Sbjct  322  SPRNDILGKIFAGLVASDGNLPCYVNPSQTDL-GWSWQTCSEMVMPIGITE-NTMFQPEP  379

Query  153  FNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F+L  ++ +C   +G+ PRPHWITTYYGG DIKLVL++F SNIIFSNGL+D
Sbjct  380  FDLNSYNNDCKRSYGITPRPHWITTYYGGHDIKLVLHRFASNIIFSNGLQD  430



>ref|XP_010031429.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50725.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
 gb|KCW50726.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
Length=496

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 118/175 (67%), Gaps = 5/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A +PNG S LS  FK C+ L S  ELK+YL+  Y+ AAQYD PP YPVT +C GIDGA
Sbjct  256  RVAQEPNGTSNLSEMFKTCKPLESGDELKNYLMSLYAYAAQYDDPPRYPVTVICNGIDGA  315

Query  333  PKGAH-ILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
                + IL +IFAGV A +GN +CY  P         GW WQ CSEM  PIG  + ++MF
Sbjct  316  NTTENGILGKIFAGVVAYKGNSACYVNPPTNVSQTDLGWGWQRCSEMVMPIGITN-NSMF  374

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
               PFNL  F   C + +GV PRPHWITTYYGG DI+L+L +FGSNIIFSNGLRD
Sbjct  375  QSYPFNLSSFIDECNDQYGVTPRPHWITTYYGGHDIELILLRFGSNIIFSNGLRD  429



>ref|XP_006369365.1| hypothetical protein POPTR_0001s220902g, partial [Populus trichocarpa]
 ref|XP_006369366.1| hypothetical protein POPTR_0001s220902g, partial [Populus trichocarpa]
 gb|ERP65934.1| hypothetical protein POPTR_0001s220902g, partial [Populus trichocarpa]
 gb|ERP65935.1| hypothetical protein POPTR_0001s220902g, partial [Populus trichocarpa]
Length=474

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 126/175 (72%), Gaps = 6/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKP+GLS+LS+KFK C  L  + ELKD+L   Y+ AAQY+ PP YPV EVC GIDG 
Sbjct  280  ELASKPDGLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGG  339

Query  333  PKGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G   L RIF G+ A  GN SCY    + P+ T + GW WQ CSEMA PIG G+ ++MF
Sbjct  340  GFGDDTLSRIFGGLVAYNGNLSCYVNAHTDPSETTV-GWQWQKCSEMAIPIGVGN-NSMF  397

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PF+L+ + ++C +L+GVP RPHW+TTYYGG  IKL+L +F SNIIFSNGLRD
Sbjct  398  PPDPFDLKDYIEHCKSLYGVPTRPHWVTTYYGGHSIKLILQRFASNIIFSNGLRD  452



>ref|XP_006369368.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
 gb|ERP65937.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
Length=486

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 126/175 (72%), Gaps = 6/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKP+GLS+LS+KFK C  L  + ELKD+L   Y+ AAQY+ PP YPV EVC GIDG 
Sbjct  280  ELASKPDGLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGG  339

Query  333  PKGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G   L RIF G+ A  GN SCY    + P+ T + GW WQ CSEMA PIG G+ ++MF
Sbjct  340  GFGDDTLSRIFGGLVAYNGNLSCYVNAHTDPSETTV-GWQWQKCSEMAIPIGVGN-NSMF  397

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PF+L+ + ++C +L+GVP RPHW+TTYYGG  IKL+L +F SNIIFSNGLRD
Sbjct  398  PPDPFDLKDYIEHCKSLYGVPTRPHWVTTYYGGHSIKLILQRFASNIIFSNGLRD  452



>ref|XP_010535638.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=507

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 120/179 (67%), Gaps = 9/179 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDG-  337
            ++AS+PNGLS LS KFK C  LN S++LKD+L   Y+ A QY+  P YPVT +C  ID  
Sbjct  262  RVASQPNGLSFLSEKFKTCAPLNGSFDLKDFLDSVYAEAVQYNRHPNYPVTSICKAIDSE  321

Query  336  APKGAH--ILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDG  178
            +P+G    +L RIFAGV A  GN+SCY     S PT   +  W WQSCSE+  PIG    
Sbjct  322  SPRGKKKDLLGRIFAGVVAYIGNRSCYDTTMFSQPTNNNL-AWRWQSCSELVMPIGHDKQ  380

Query  177  DTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            DT++   P+N+  +   C +++GV PRPHWI TYYGGQD KL+L +FGSNIIFSNGL D
Sbjct  381  DTLYQTMPYNISNYISECKSMYGVSPRPHWINTYYGGQDFKLILRRFGSNIIFSNGLSD  439



>ref|XP_006369367.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
 gb|ERP65936.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
Length=517

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 126/175 (72%), Gaps = 6/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKP+GLS+LS+KFK C  L  + ELKD+L   Y+ AAQY+ PP YPV EVC GIDG 
Sbjct  280  ELASKPDGLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGG  339

Query  333  PKGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G   L RIF G+ A  GN SCY    + P+ T + GW WQ CSEMA PIG G+ ++MF
Sbjct  340  GFGDDTLSRIFGGLVAYNGNLSCYVNAHTDPSETTV-GWQWQKCSEMAIPIGVGN-NSMF  397

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PF+L+ + ++C +L+GVP RPHW+TTYYGG  IKL+L +F SNIIFSNGLRD
Sbjct  398  PPDPFDLKDYIEHCKSLYGVPTRPHWVTTYYGGHSIKLILQRFASNIIFSNGLRD  452



>ref|XP_004145824.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=507

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            +A +PNGLSIL ++FK C+ L   +EL+DYL   Y+ AAQY+ PP+YPVT +C  IDG  
Sbjct  270  VAYQPNGLSILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTY  329

Query  330  KGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
                 L +I AGVFA  G+ SCY       T T + GW WQSCSEM  PIG    D MF 
Sbjct  330  SVNGTLSKIAAGVFAFRGSVSCYINEPRNETETDV-GWRWQSCSEMVMPIG--SDDDMFP  386

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P+PF+LQ     C  L+GVPPRPHW TTYYGG DI+LVL +FGSNIIFSNGL+D
Sbjct  387  PSPFDLQSVINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKD  440



>ref|XP_004160098.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=514

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            +A +PNGLSIL ++FK C+ L   +EL+DYL   Y+ AAQY+ PP+YPVT +C  IDG  
Sbjct  277  VAYQPNGLSILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTY  336

Query  330  KGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
                 L +I AGVFA  G+ SCY       T T + GW WQSCSEM  PIG  D   MF 
Sbjct  337  SVNGTLSKIAAGVFAFRGSVSCYINEPRNETETDV-GWRWQSCSEMVMPIGSDDD--MFP  393

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P+PF+LQ     C  L+GVPPRPHW TTYYGG DI+LVL +FGSNIIFSNGL+D
Sbjct  394  PSPFDLQSVINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKD  447



>gb|KGN46898.1| hypothetical protein Csa_6G149390 [Cucumis sativus]
Length=511

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            +A +PNGLSIL ++FK C+ L   +EL+DYL   Y+ AAQY+ PP+YPVT +C  IDG  
Sbjct  274  VAYQPNGLSILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTY  333

Query  330  KGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
                 L +I AGVFA  G+ SCY       T T + GW WQSCSEM  PIG    D MF 
Sbjct  334  SVNGTLSKIAAGVFAFRGSVSCYINEPRNETETDV-GWRWQSCSEMVMPIG--SDDDMFP  390

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P+PF+LQ     C  L+GVPPRPHW TTYYGG DI+LVL +FGSNIIFSNGL+D
Sbjct  391  PSPFDLQSVINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKD  444



>gb|KFK27606.1| hypothetical protein AALP_AA8G405500 [Arabis alpina]
Length=499

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 118/178 (66%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+KPNGL  L +KFK C  LN S+ +KD+L   Y+ A QY+  P Y VT VC GI+  
Sbjct  254  RVAAKPNGLLTLGKKFKTCAPLNGSFNIKDFLDSIYAEAVQYNRGPSYWVTNVCNGINAN  313

Query  333  PKGAHI--LDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGD  175
            P    I  LDRIFAGV A  GN+SCY       PT   +  W WQSC+E+  P+G    D
Sbjct  314  PSNRKIDLLDRIFAGVVALVGNRSCYDTNMFAQPTNNNL-AWRWQSCTEIVMPVGYDKQD  372

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF  APFN+  F   C + +GVPPRPHW+TTY+G QD+KL+L +FGSNIIFSNGL+D
Sbjct  373  TMFPTAPFNMTSFIAGCESYYGVPPRPHWVTTYFGIQDVKLILRRFGSNIIFSNGLKD  430



>ref|XP_011005420.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
 ref|XP_011005421.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
 ref|XP_011005422.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=496

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 129/175 (74%), Gaps = 6/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKP+GLS+LS+KFK C  L  + +LKD+L   Y+ AAQY+ PP YP+ EVC GIDG 
Sbjct  259  ELASKPDGLSMLSKKFKTCNPLTDASKLKDHLDTMYASAAQYNRPPTYPINEVCKGIDGG  318

Query  333  PKGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G  IL RIF G+ A  GN SCY    + P+ TA+ GW WQ+CSEMA PIG G+ ++MF
Sbjct  319  GFGDDILSRIFGGLVAYNGNLSCYVNARTDPSETAV-GWRWQTCSEMAIPIGVGN-NSMF  376

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PF+L+ + ++C +++GVP RPHW+TTYYGG  IKL+L +F SNIIFSNGLRD
Sbjct  377  PPDPFDLEDYIEHCKSMYGVPTRPHWVTTYYGGHSIKLILQRFASNIIFSNGLRD  431



>gb|KFK27605.1| hypothetical protein AALP_AA8G405500 [Arabis alpina]
Length=509

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 118/178 (66%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+KPNGL  L +KFK C  LN S+ +KD+L   Y+ A QY+  P Y VT VC GI+  
Sbjct  264  RVAAKPNGLLTLGKKFKTCAPLNGSFNIKDFLDSIYAEAVQYNRGPSYWVTNVCNGINAN  323

Query  333  PKGAHI--LDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGD  175
            P    I  LDRIFAGV A  GN+SCY       PT   +  W WQSC+E+  P+G    D
Sbjct  324  PSNRKIDLLDRIFAGVVALVGNRSCYDTNMFAQPTNNNL-AWRWQSCTEIVMPVGYDKQD  382

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF  APFN+  F   C + +GVPPRPHW+TTY+G QD+KL+L +FGSNIIFSNGL+D
Sbjct  383  TMFPTAPFNMTSFIAGCESYYGVPPRPHWVTTYFGIQDVKLILRRFGSNIIFSNGLKD  440



>ref|XP_007150133.1| hypothetical protein PHAVU_005G129500g [Phaseolus vulgaris]
 gb|ESW22127.1| hypothetical protein PHAVU_005G129500g [Phaseolus vulgaris]
Length=440

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            + AS+P+G ++LS++F  C+ LN S ELK+YL   Y+ AAQY+ P   PV+ +CGGID  
Sbjct  262  RTASQPSGKTLLSQRFNTCRPLNESLELKEYLESMYASAAQYNDPARNPVSVICGGIDRG  321

Query  333  PKGAHILDRIFAGVFASEGNQSC-YSIPT--GTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
              G+ +L +I+AGV A  GN +C  + PT       GW WQ+CSEM  PIG G+ ++MF 
Sbjct  322  SFGSDVLSKIYAGVVALRGNTTCKVNAPTIVSETTLGWRWQTCSEMVIPIGIGN-NSMFQ  380

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PF+ + F+  C  L+GV PRPHW+TTYYGG +IKL+L KFGSNIIF NGLRD
Sbjct  381  PQPFSFKSFANGCKKLYGVSPRPHWVTTYYGGHNIKLILQKFGSNIIFYNGLRD  434



>ref|XP_007207893.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
 gb|EMJ09092.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
Length=503

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 117/174 (67%), Gaps = 6/174 (3%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            IAS+P GLS LS KF  C+ L  S ELK+YL   Y  AAQY++PP YPVT VCG IDGA 
Sbjct  264  IASQPEGLSFLSEKFHTCRPLKKSSELKNYLDNLYCNAAQYNSPPSYPVTVVCGAIDGA-  322

Query  330  KGAHILDRIFAGVFASEGNQSCYSIP----TGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
             G   L +IFAGV A  GN SCY       T T + GWSWQ+CS+M  P+     D+MF 
Sbjct  323  SGNDTLTKIFAGVVAFSGNTSCYVNQPRNLTETDM-GWSWQTCSDMVIPMASVSNDSMFP  381

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
               F+L+ + K+C   +GVPPRPHW+TTY+GG DIKL L +F SNIIFSNGLRD
Sbjct  382  AYQFDLKDYIKSCKAQYGVPPRPHWVTTYFGGHDIKLALERFASNIIFSNGLRD  435



>ref|XP_007208680.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
 gb|EMJ09879.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
Length=521

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 121/175 (69%), Gaps = 6/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +IAS+P GLSILSRKF+ C  L +S  L++YL+  Y+ AAQY+ PP YPVT VCGGIDGA
Sbjct  266  EIASQPEGLSILSRKFQTCSQLLTSSVLENYLMLMYTGAAQYNRPPRYPVTVVCGGIDGA  325

Query  333  PKGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G   L +IFAGV A  GN+SCY       + T + GW WQ+CS+M  PIG  + D+MF
Sbjct  326  SHGNDTLSKIFAGVVAYRGNKSCYVNEPKNKSETDV-GWGWQTCSDMVIPIGISN-DSMF  383

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
                F+L  + + C   +GVPPRPHW TTY+GG DIKL L+ F SNIIFSNGLRD
Sbjct  384  PANEFDLNDYIETCKAQYGVPPRPHWATTYFGGHDIKLALSGFASNIIFSNGLRD  438



>emb|CBI17114.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 120/175 (69%), Gaps = 7/175 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+A++PNGL+ LS+ F  C+ LNSS ELK YL  CY ++AQ D PP YPV +VC  IDGA
Sbjct  251  KVAAEPNGLANLSQIFMTCEPLNSSQELKYYLALCYVVSAQNDNPPAYPVKKVCDAIDGA  310

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI----PTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
            P+G  I+ R+ AG+ AS G   C+ +    P+  +   W+WQ+C+EM  PIG G  DTMF
Sbjct  311  PEGTDIIGRVAAGLNASVG-PPCHFVYDFKPSNRS--EWTWQTCTEMVMPIGHGANDTMF  367

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
               PF+L   +K C +LFGV PRPHWITT +GG DIK V+  F SNIIFSNGLRD
Sbjct  368  QAWPFDLNNHTKTCQDLFGVTPRPHWITTEFGGHDIKSVVGNFASNIIFSNGLRD  422



>ref|XP_008458665.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Cucumis 
melo]
Length=511

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 117/174 (67%), Gaps = 7/174 (4%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            +AS+PNGLSIL ++FK C+ L   +EL+DYL   Y+ AAQY+ PP+YPVT +C  IDG  
Sbjct  274  VASQPNGLSILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTY  333

Query  330  KGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
                 L +I AGVFA  G+ SCY       T T + GW WQSCSEM  PI     D MF 
Sbjct  334  SVNGTLSKIAAGVFAFRGSISCYINEPRNETETDV-GWRWQSCSEMVMPIS--SDDDMFP  390

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PF+LQ     C  L+GVPPRPHW TTYYGG DI+LVL +FGSNIIFSNGL+D
Sbjct  391  PYPFDLQSVINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKD  444



>ref|XP_006369363.1| hypothetical protein POPTR_0001s22060g [Populus trichocarpa]
 gb|ERP65932.1| hypothetical protein POPTR_0001s22060g [Populus trichocarpa]
Length=576

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 120/176 (68%), Gaps = 7/176 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKPNGLS+LS K K C +L  +  LKDYL   Y+ AAQY++PP YPV EVC GID  
Sbjct  318  ELASKPNGLSMLSDKLKTC-NLTDASTLKDYLRIMYANAAQYNSPPTYPVNEVCKGIDDD  376

Query  333  PKGAHILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
              G  IL RIF GV A  GN++CY           A   WSWQ+CSEM   +G G+ ++M
Sbjct  377  ASGDDILSRIFRGVVAYYGNRTCYFNNNAYAYQSEATLDWSWQTCSEMVMSLGVGN-NSM  435

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F P PF+ + +   C +L+GV PRPHW+TTYYGG DIKL+L +FGSNIIFSNGLRD
Sbjct  436  FEPDPFDWKDYIDRCKSLYGVRPRPHWVTTYYGGHDIKLILQRFGSNIIFSNGLRD  491



>ref|XP_002272152.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=493

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 120/175 (69%), Gaps = 7/175 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+A++PNGL+ LS+ F  C+ LNSS ELK YL  CY ++AQ D PP YPV +VC  IDGA
Sbjct  251  KVAAEPNGLANLSQIFMTCEPLNSSQELKYYLALCYVVSAQNDNPPAYPVKKVCDAIDGA  310

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI----PTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
            P+G  I+ R+ AG+ AS G   C+ +    P+  +   W+WQ+C+EM  PIG G  DTMF
Sbjct  311  PEGTDIIGRVAAGLNASVG-PPCHFVYDFKPSNRS--EWTWQTCTEMVMPIGHGANDTMF  367

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
               PF+L   +K C +LFGV PRPHWITT +GG DIK V+  F SNIIFSNGLRD
Sbjct  368  QAWPFDLNNHTKTCQDLFGVTPRPHWITTEFGGHDIKSVVGNFASNIIFSNGLRD  422



>ref|XP_008228032.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=503

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 117/174 (67%), Gaps = 6/174 (3%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            IAS+P GLS LS KF  C+ L  S ELK+YL   Y  AAQY++PP YPVT VCGGIDGA 
Sbjct  264  IASQPEGLSFLSEKFHTCRPLIKSSELKNYLDNLYCNAAQYNSPPTYPVTAVCGGIDGA-  322

Query  330  KGAHILDRIFAGVFASEGNQSCYSIP----TGTAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
             G   L +IFAGV A  GN SCY       T T + GWSWQ+CS+M  P+     D+MF 
Sbjct  323  SGNDTLTKIFAGVVAFSGNTSCYVNHPRNLTETDM-GWSWQTCSDMVIPMTSVSNDSMFP  381

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
               F+L+ + K+C   +GVPPRPHW TTY+GG DIKL L +F SNIIFSNGLRD
Sbjct  382  AYQFDLKDYIKSCQAQYGVPPRPHWATTYFGGHDIKLALERFASNIIFSNGLRD  435



>ref|XP_006408695.1| hypothetical protein EUTSA_v10001967mg [Eutrema salsugineum]
 gb|ESQ50148.1| hypothetical protein EUTSA_v10001967mg [Eutrema salsugineum]
Length=502

 Score =   189 bits (479),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 119/178 (67%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+KPNGL ILS+KFK C  LN S ++KD+L   Y+ A QY+  P Y VT VC  ID  
Sbjct  257  RVAAKPNGLLILSQKFKTCGPLNGSSDIKDFLGTIYAEAVQYNRGPSYWVTSVCHAIDAN  316

Query  333  P--KGAHILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDGD  175
            P      +L+R+FAG  A  GN++CY     S PT  +I  W WQSCSE+  PIG    D
Sbjct  317  PPTHKNDLLNRVFAGAVALIGNRTCYDTNMFSQPTNNSI-AWRWQSCSEIVMPIGYDKQD  375

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF  APFN+  F + C + +GVPPRPHWI TY+G QDIKL+L +FGSNIIFSNGL D
Sbjct  376  TMFQLAPFNMTSFIEGCKSYYGVPPRPHWIMTYFGTQDIKLILKRFGSNIIFSNGLSD  433



>ref|XP_006424410.1| hypothetical protein CICLE_v10030022mg [Citrus clementina]
 gb|ESR37650.1| hypothetical protein CICLE_v10030022mg [Citrus clementina]
Length=436

 Score =   187 bits (475),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 120/179 (67%), Gaps = 10/179 (6%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A + NGL+ LS  F+ C  LNSS ELKD+L   Y I+AQ D PP  PV++VCG IDGA
Sbjct  254  RVAGQTNGLTTLSNIFQTCSPLNSSKELKDHLGMIYVISAQNDNPPYNPVSKVCGAIDGA  313

Query  333  PKGAHILDRIFAGVFAS--------EGNQSCYSIPTGTAIWGWSWQSCSEMAFPIGRGDG  178
            PKG  IL ++ AG+ AS        + N      P  T+  GW+WQ+C+EM  PIG G+ 
Sbjct  314  PKGTDILGKVAAGLNASLLRGGPEAQCNHIIDFTPKNTS--GWTWQTCTEMVMPIGHGEN  371

Query  177  DTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            DTMF  +PF+L  ++K+C  LFGV P+PHWITT +GG DIK VL  F SNIIFSNGLRD
Sbjct  372  DTMFQGSPFDLNNYTKSCQALFGVTPKPHWITTEFGGHDIKSVLGNFSSNIIFSNGLRD  430



>ref|XP_009126572.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=502

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 117/178 (66%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+KPNGL ILS++FK C  LN+S+++KD+L   Y+ A QY+  P Y VT VC  ID  
Sbjct  257  RVAAKPNGLLILSKQFKTCAPLNASFDIKDFLSTIYAEAVQYNRGPSYSVTNVCNAIDNN  316

Query  333  PKGAH--ILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGD  175
            P  +   +LDRIFAG  A  GNQSCY       PT      W WQ+CSE+  P+G    D
Sbjct  317  PPNSKKGLLDRIFAGAVALLGNQSCYDTNMFAHPTNNN-KAWRWQTCSEIVMPVGYDKQD  375

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF   PFN+  + + C   +GV PRPHWITTY+G QD+KL+L KFGSNIIFSNGL D
Sbjct  376  TMFPTTPFNMTSYIERCKADYGVTPRPHWITTYFGIQDVKLILRKFGSNIIFSNGLSD  433



>gb|KCW50731.1| hypothetical protein EUGRSUZ_J004041, partial [Eucalyptus grandis]
Length=346

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 115/176 (65%), Gaps = 7/176 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +IA  PNG S LS+ FK C+ L S  ELKDYL+  Y  AAQYD PP YP + +C  IDGA
Sbjct  127  RIAQNPNGTSKLSKMFKTCKPLESGDELKDYLISMYEGAAQYDLPPTYPASVICNAIDGA  186

Query  333  PKGAH-ILDRIFAGVFASEGNQSCYSIPTGTAI----WGWSWQSCSEMAFPIGRGDGDTM  169
                + IL ++FAGV A   N +CY  P  TAI     GW WQ CSEM  P G  + ++M
Sbjct  187  NTTENGILGKVFAGVIAYNTNSACYVNPP-TAISQSSLGWGWQRCSEMVMPKGVTN-NSM  244

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F P PF L  F+  C + +GV PRPHWITTYYG  DI+L+L +FGSNIIFSNGLRD
Sbjct  245  FQPDPFILSSFTDECNHQYGVVPRPHWITTYYGAHDIELILCRFGSNIIFSNGLRD  300



>ref|XP_006287573.1| hypothetical protein CARUB_v10000783mg [Capsella rubella]
 gb|EOA20471.1| hypothetical protein CARUB_v10000783mg [Capsella rubella]
Length=502

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 119/177 (67%), Gaps = 8/177 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+KPNGL ILS+KFK C  LN S++LKD+L   Y  + QYD      VT+VC  I+  
Sbjct  258  RVAAKPNGLLILSKKFKTCTPLNKSFDLKDFLDTIYVESVQYDEGSW--VTDVCDAINAG  315

Query  333  P--KGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDT  172
            P  +   ILDRIFAGV AS GNQSCY    S+   +    +SWQ CSE+  PIG    DT
Sbjct  316  PPNRKIDILDRIFAGVVASHGNQSCYDTNYSVLVASDAMAYSWQCCSEIVIPIGHDKQDT  375

Query  171  MFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            MF  +PFN+  + + C + +GV PRPHWITTY+G QDIKL+L +FGSNIIFSNGL D
Sbjct  376  MFQTSPFNMTSYIEGCKSQYGVIPRPHWITTYFGIQDIKLILRRFGSNIIFSNGLSD  432



>ref|XP_004487553.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=506

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 119/176 (68%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +I+S+ +GLSILS +F  C+ L    +L +YL   Y+ A QY+ P    V+E+C GIDGA
Sbjct  261  RISSQSDGLSILSERFNTCRPLKQYSDLSEYLESMYTAAVQYNGPTSSRVSEICRGIDGA  320

Query  333  PKGAHILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
              G  IL +I++G+ A EGN +C      S  +     GWSWQ CSEM  PIG G+ DTM
Sbjct  321  SFGNDILSKIYSGLVAYEGNGTCKINYAPSNISDEVYEGWSWQRCSEMVMPIGTGN-DTM  379

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F P PFNL+++ + C   +GV PRPHW+TTYYGG +IKLVL KFGSNIIFSNGL+D
Sbjct  380  FQPDPFNLKRYVEECKKQYGVSPRPHWVTTYYGGHNIKLVLQKFGSNIIFSNGLKD  435



>gb|KCW50737.1| hypothetical protein EUGRSUZ_J00408 [Eucalyptus grandis]
Length=500

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 119/176 (68%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+AS+P GL+ LS  FK C  L SS ELK YL   Y+   QY+ P   P+  +C  ++G 
Sbjct  259  KVASEPRGLTKLSNTFKTCSPLQSSSELKKYLRFLYAQVVQYNDPSTQPLKLMCDAVNGV  318

Query  333  PKGAHILDRIFAGVFASEGNQSCY--SIPTGT---AIWGWSWQSCSEMAFPIGRGDGDTM  169
            P    +L +IFAG+ A  GN +CY  + P+GT    + GWSWQ+C+EM  P+G    +TM
Sbjct  319  PPRKGLLQKIFAGLVAINGNLTCYVNAPPSGTFAQTLLGWSWQTCTEMVIPMGITR-NTM  377

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F P PFNL  FS  C ++FGVPPRPHW+TTY+GG DIKL+L++F SNIIFSNGL+D
Sbjct  378  FPPKPFNLNSFSNACKSVFGVPPRPHWVTTYFGGHDIKLILHRFASNIIFSNGLQD  433



>gb|KCW84338.1| hypothetical protein EUGRSUZ_B01187, partial [Eucalyptus grandis]
Length=478

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 121/178 (68%), Gaps = 9/178 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ SKP+GLS LS+ FK C+ L S  ELK+YL+  Y+ AAQYD PP YPV  VC GIDGA
Sbjct  256  RVISKPSGLSRLSKIFKTCRPLKSGDELKNYLILRYAAAAQYDDPPRYPVEIVCRGIDGA  315

Query  333  -PKGAHILDRIFAGVFASEGNQSCY------SIPTGTAIWGWSWQSCSEMAFPIGRGDGD  175
               G  IL +IFAGV A + N +CY      + PT T + G+SWQ CSEM   IG  + +
Sbjct  316  NASGKGILKKIFAGVVALDRNSTCYIVPPNGTTPTQTEL-GYSWQRCSEMVMGIGITN-N  373

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             MF   PFNL  F   C + +GV PRPHWITTYYGG DI+ VL++FGSNIIFSNGLRD
Sbjct  374  AMFQAYPFNLTDFINGCNSSYGVVPRPHWITTYYGGHDIERVLHRFGSNIIFSNGLRD  431



>ref|XP_010493392.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=353

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 115/177 (65%), Gaps = 8/177 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+A+KPNGL IL +KFK C  LN S++LKD+L   Y+ A QY+      V+ VC  I+  
Sbjct  110  KVAAKPNGLLILGKKFKTCAPLNRSFDLKDFLDTIYAEAVQYNEG--ILVSNVCNAINAN  167

Query  333  P--KGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDT  172
            P  +   ILDRIFAGV A  GNQSCY    S+        W WQ CSE+  P+G    DT
Sbjct  168  PPNRKIDILDRIFAGVVALTGNQSCYDTNYSVLVANDDMAWRWQGCSEIVIPVGHDKQDT  227

Query  171  MFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            MF  +PFN+  F + C + +GV PRPHWITTYYG QDIKL+L +FGSNIIFSNGL D
Sbjct  228  MFPTSPFNMTSFIEGCESNYGVSPRPHWITTYYGIQDIKLILRRFGSNIIFSNGLSD  284



>ref|XP_010031434.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=506

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 119/176 (68%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+AS+P GL+ LS  FK C  L SS ELK YL   Y+   QY+ P   P+  +C  ++G 
Sbjct  265  KVASEPRGLTKLSNTFKTCSPLQSSSELKKYLRFLYAQVVQYNDPSTQPLKLMCDAVNGV  324

Query  333  PKGAHILDRIFAGVFASEGNQSCY--SIPTGT---AIWGWSWQSCSEMAFPIGRGDGDTM  169
            P    +L +IFAG+ A  GN +CY  + P+GT    + GWSWQ+C+EM  P+G    +TM
Sbjct  325  PPRKGLLQKIFAGLVAINGNLTCYVNAPPSGTFAQTLLGWSWQTCTEMVIPMGITR-NTM  383

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F P PFNL  FS  C ++FGVPPRPHW+TTY+GG DIKL+L++F SNIIFSNGL+D
Sbjct  384  FPPKPFNLNSFSNACKSVFGVPPRPHWVTTYFGGHDIKLILHRFASNIIFSNGLQD  439



>ref|XP_002874097.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50356.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=501

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 117/178 (66%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A KPNGLSILS+ FK C  LN S+ +KD+L   Y+ A QY+  P Y V  VC  I+  
Sbjct  257  RVAVKPNGLSILSKTFKTCAPLNGSFNIKDFLDTIYAEAVQYNRGPTYWVANVCNAINAN  316

Query  333  P--KGAHILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDGD  175
               +   +LDRIFAGV A  GN++CY     S PT   I  W WQSCSE+  P+G    D
Sbjct  317  TPNRKDTLLDRIFAGVVALIGNRTCYDTNMFSQPTNNHI-AWRWQSCSEIVIPVGYDKQD  375

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF  APFN+  +   C + +GVPPRPHWITTY+G QD+KL+L +FGSNIIFSNGL D
Sbjct  376  TMFPTAPFNMTSYIDGCESYYGVPPRPHWITTYFGIQDVKLILRRFGSNIIFSNGLSD  433



>ref|XP_006488629.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=494

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 109/158 (69%), Gaps = 8/158 (5%)
 Frame = -2

Query  456  QDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAPKGAH--ILDRIFAGVFAS  283
            + L  S+EL+ YL   Y+ AAQY+ PPEYPV  +CGGIDGA  G    IL +IFAGV A 
Sbjct  272  EPLKDSYELEGYLKSVYADAAQYNQPPEYPVNMLCGGIDGAALGIDNDILSKIFAGVVAY  331

Query  282  EGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFFPAPFNLQQFSKNCINL  115
            EGN SCY    +I T T + GW WQ CSEM  PIG  D  TMF P PFNL  F   C +L
Sbjct  332  EGNMSCYVNPPTIETETTV-GWRWQRCSEMVMPIGT-DNTTMFQPTPFNLSSFIDGCESL  389

Query  114  FGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            +GV PRPHW+TTYYGG DIKL+L +F SNIIFSNGLRD
Sbjct  390  YGVSPRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRD  427



>ref|XP_010036093.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=509

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 121/178 (68%), Gaps = 9/178 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ SKP+GLS LS+ FK C+ L S  ELK+YL+  Y+ AAQYD PP YPV  VC GIDGA
Sbjct  256  RVISKPSGLSRLSKIFKTCRPLKSGDELKNYLILRYAAAAQYDDPPRYPVEIVCRGIDGA  315

Query  333  -PKGAHILDRIFAGVFASEGNQSCY------SIPTGTAIWGWSWQSCSEMAFPIGRGDGD  175
               G  IL +IFAGV A + N +CY      + PT T + G+SWQ CSEM   IG  + +
Sbjct  316  NASGKGILKKIFAGVVALDRNSTCYIVPPNGTTPTQTEL-GYSWQRCSEMVMGIGITN-N  373

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             MF   PFNL  F   C + +GV PRPHWITTYYGG DI+ VL++FGSNIIFSNGLRD
Sbjct  374  AMFQAYPFNLTDFINGCNSSYGVVPRPHWITTYYGGHDIERVLHRFGSNIIFSNGLRD  431



>emb|CAN64373.1| hypothetical protein VITISV_018663 [Vitis vinifera]
Length=702

 Score =   189 bits (479),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 107/157 (68%), Gaps = 6/157 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +IASKPNGLSILS++FK C  L SS+ELKDYL   Y+ AAQY+ PP YPVT VC GI+GA
Sbjct  265  RIASKPNGLSILSKRFKTCAHLESSFELKDYLDSIYAEAAQYNEPPTYPVTVVCKGINGA  324

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             K    L RIF G+ A  G +SCY       PT T + GW WQ CSEM  PIG    DTM
Sbjct  325  SKRTDTLGRIFHGLVAIAGKRSCYDTKEFNYPTETYL-GWRWQKCSEMVLPIGHATNDTM  383

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDI  58
            F P PFNL +F K C +L+ V PRPHW+TTYYGG+ +
Sbjct  384  FQPEPFNLNRFIKECNSLYSVSPRPHWVTTYYGGRTL  420



>ref|NP_197677.2| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 gb|AED93089.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=439

 Score =   185 bits (469),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 119/178 (67%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A KPNGLSILS++FK C  LN S+++KD+L   Y+ A QY+  P + V +VC  I+  
Sbjct  257  RVAGKPNGLSILSKQFKTCAPLNGSFDIKDFLDTIYAEAVQYNRGPNFWVAKVCNAINAN  316

Query  333  P--KGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGD  175
            P  +  ++LDRIFAGV A  GN++CY       PT   I  W WQSCSE+  P+G    D
Sbjct  317  PPNRRYNLLDRIFAGVVALVGNRTCYDTKMFAQPTNNNI-AWRWQSCSEIVMPVGYDKQD  375

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF  APFN+  +   C +  GV PRPHWITTY+G Q++KL+L KFGSNIIFSNGL D
Sbjct  376  TMFPTAPFNMTSYIDGCKSYHGVTPRPHWITTYFGIQEVKLILQKFGSNIIFSNGLSD  433



>ref|XP_010260171.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=506

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 115/179 (64%), Gaps = 8/179 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +++S+PNGLSILS++F  C  + S+ +LKDYL   Y  AAQY  P +  V ++C  IDG 
Sbjct  262  RVSSEPNGLSILSKQFMTCNPITSASQLKDYLEYMYCEAAQYAFPSDDSVLKICNAIDGT  321

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGT--------AIWGWSWQSCSEMAFPIGRGDG  178
                 I+ ++ AGV +  GN SCY +               GW WQ+CSEM  P+GRG  
Sbjct  322  SNNTDIIGKVVAGVVSYNGNSSCYDLNASNNPSDSDEETDDGWDWQTCSEMVMPMGRGSN  381

Query  177  DTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            DTMF  APF+L+ F + C + + V PRPHWITT +GG DIKL+L +FGSNIIFSNGLRD
Sbjct  382  DTMFEAAPFDLEAFIQGCKSAYSVSPRPHWITTQFGGHDIKLILERFGSNIIFSNGLRD  440



>ref|XP_010493397.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X3 [Camelina 
sativa]
Length=439

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 118/178 (66%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+KP GL ILS+KFK C  LN S  +KD+L   Y+ + QY+  P Y VT VC  I+  
Sbjct  257  RVAAKPQGLLILSKKFKTCAPLNGSSNIKDFLNTIYAESVQYNRGPSYWVTNVCNAINAN  316

Query  333  PKGAH--ILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDGD  175
            P  +   +LDRIFAGV A  GN++CY     + PT   I  W WQSCSE+  P+G    D
Sbjct  317  PPNSKHDLLDRIFAGVVALVGNRTCYDPNMFAQPTNNVI-AWRWQSCSEIVMPVGYDKQD  375

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF  APFN+  + + C + +GVPPR HWITTY+G QD+KL+L KFGSNIIFSNGL D
Sbjct  376  TMFPTAPFNMTSYIEGCESNYGVPPRQHWITTYFGIQDVKLILRKFGSNIIFSNGLSD  433



>gb|KCW50735.1| hypothetical protein EUGRSUZ_J00406 [Eucalyptus grandis]
Length=312

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 115/174 (66%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P GL+ LS  FK C  L SS ELK YL   Y    QY+ P   P+  +C  I+GA
Sbjct  73   RVASEPRGLTKLSNAFKTCSPLQSSSELKKYLKLLYVQVVQYNDPSAQPLKLMCDAINGA  132

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGTAIW---GWSWQSCSEMAFPIGRGDGDTMFF  163
            P    +L +IFAG+ A  GN +CY  P+G+      GW WQ+C+EMAFPIG    +TMF 
Sbjct  133  PPRKGLLQKIFAGLVAINGNLTCYVNPSGSDAQTPSGWFWQTCTEMAFPIGITR-NTMFP  191

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PFNL  FS  C + FGVP RP W+TTY+GG DIKL+L++F SNIIFSNGL+D
Sbjct  192  PEPFNLNSFSNACKSEFGVPARPRWVTTYFGGHDIKLILHRFASNIIFSNGLQD  245



>ref|XP_008360161.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=254

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = -2

Query  450  LNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAPKGAHILDRIFAGVFASEGNQ  271
            LN+S ELKDYL   Y+ AAQYD PP YPVT VCGGIDGA  G   L +IFAG+ A  GN+
Sbjct  36   LNNSSELKDYLQSVYAXAAQYDXPPRYPVTVVCGGIDGASSGNDTLSKIFAGLVAYXGNR  95

Query  270  SCYSIPTGT---AIWGWSWQSCSEMAFPIGRGDGDTMFFPAPFNLQQFSKNCINLFGVPP  100
            SCY    G       GW WQ+CS+M  PI   +G TMF P  F+L+ + K+C   +GVPP
Sbjct  96   SCYVNQPGNLSETDIGWRWQTCSDMVIPISISNG-TMFQPDLFDLEAYIKSCKAKYGVPP  154

Query  99   RPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            RP W+TTY+GG DIKL L++F SNIIFSNGLRD
Sbjct  155  RPRWVTTYFGGHDIKLALHRFASNIIFSNGLRD  187



>ref|XP_010651835.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=376

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 121/177 (68%), Gaps = 9/177 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A +PNGL+ LS+ F+ C+ LNSS +LK YL   Y  +AQYD PP + V+++C  IDGA
Sbjct  138  EVAGQPNGLANLSQIFRTCEPLNSSQQLKLYLEYTYEASAQYDNPPAHYVSDICNAIDGA  197

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI----PTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
            P+G  IL R+  GV AS G   C+ I    P+  +  GW WQ+C+EM  P GRG+ DTMF
Sbjct  198  PEGTSILGRVAEGVNASAG-PPCHRIYDFQPSNMS--GWLWQTCTEMVMPFGRGENDTMF  254

Query  165  FPAPFNLQQFSKNCINLFG--VPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              +PF+L  ++K C ++FG  V PRPHWITT +GG +IK VL  F SNIIFSNGLRD
Sbjct  255  QASPFDLNNYTKTCQDIFGASVTPRPHWITTEFGGHNIKSVLGNFASNIIFSNGLRD  311



>ref|XP_002523751.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38691.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=489

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 114/174 (66%), Gaps = 3/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A++PNGL  LS  F  C+ L SS E K+YL   Y  AAQYD PP+ PV   C GIDGA
Sbjct  251  RVAAQPNGLLTLSNMFNTCRPLVSSAEFKEYLELLYITAAQYDNPPDNPVQSTCRGIDGA  310

Query  333  PKGAHILDRIFAGVFAS-EGNQSCYSIPTG--TAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
            P G  IL RI  G+     G  SC+ I T   +    W WQ+C+EM FPIG GD +TMF 
Sbjct  311  PPGTDILGRIVEGLNGRIPGWSSCHDIFTLELSNNGSWDWQTCTEMVFPIGYGDNETMFQ  370

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P+PF++  + K C+ +FG+ PRPHW+TT +GG DIK VL  F SNIIF+NGLRD
Sbjct  371  PSPFDINNYKKECLQVFGIKPRPHWVTTEFGGHDIKTVLGNFASNIIFANGLRD  424



>ref|XP_010527988.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Tarenaya hassleriana]
Length=493

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 113/177 (64%), Gaps = 6/177 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDG-  337
            ++A  PNGLSILS KFK C  LN S +LKDYL   YS+  QY+  P Y V   C  ID  
Sbjct  252  RVAWHPNGLSILSEKFKTCAPLNRSSDLKDYLESMYSLVVQYNGLPYYSVDATCKAIDSE  311

Query  336  APKGAH-ILDRIFAGVFASEGNQSCYSIPTGT----AIWGWSWQSCSEMAFPIGRGDGDT  172
            +PK    +LDRIFAGV A  GNQ CY I  G+    +   W WQ CSE+  PIG    DT
Sbjct  312  SPKDTEDLLDRIFAGVVAQFGNQVCYDISIGSPPTNSELAWMWQICSELVMPIGLDKQDT  371

Query  171  MFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            +F   PFN+  ++  C +++G+ PRPHWI+ YYGG+D KL L +FGSNIIFSNGL D
Sbjct  372  LFQTNPFNMSDYTSKCESMYGISPRPHWISAYYGGEDFKLSLRRFGSNIIFSNGLSD  428



>ref|XP_010454563.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=502

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 118/178 (66%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+KP GL ILS+KFK C  LN S  +KD+L   Y+ + QY+  P Y VT VC  I+  
Sbjct  257  RVAAKPQGLLILSKKFKTCAPLNGSSNIKDFLDTIYAESVQYNRGPSYSVTNVCNAINAN  316

Query  333  PKGAH--ILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDGD  175
            P  +   +LDRIFAGV A  GN++CY     + PT   I  W WQSCSE+  P+G    D
Sbjct  317  PPNSKHDLLDRIFAGVVALVGNRTCYDPNMFAQPTNNII-AWRWQSCSEIVMPVGFDKQD  375

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF  APFN+  + + C + +GVPPR HWITTY+G QD+KL+L KFGSNIIFSNGL D
Sbjct  376  TMFPTAPFNMTSYIEGCESNYGVPPRQHWITTYFGIQDVKLILRKFGSNIIFSNGLSD  433



>ref|XP_003596267.1| Lysosomal Pro-X carboxypeptidase [Medicago truncatula]
 gb|AES66518.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=479

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 116/175 (66%), Gaps = 8/175 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKPNGL+ LS+KF  C  L    ELKDYL   Y  AAQY+ PP    T +C  ID A
Sbjct  245  EVASKPNGLNFLSKKFNTCYPLEQPGELKDYLGNMYQKAAQYNDPP---TTTICEAIDRA  301

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIP---TGTAIWG-WSWQSCSEMAFPIGRGDGDTMF  166
              G  IL RI+ G+ AS GN+ C   P   TG   +  W WQ+C+E+  PIG GD  ++F
Sbjct  302  SYGDDILSRIYGGMVASYGNKKCNVNPDKYTGAKPFDRWRWQTCTEIVMPIGIGDS-SLF  360

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PFN   F++NC   FGV PRPHWIT+YYGGQDI+LVL +FGSNIIFSNGLRD
Sbjct  361  QPKPFNFTSFAENCKKDFGVQPRPHWITSYYGGQDIQLVLKRFGSNIIFSNGLRD  415



>ref|XP_010421084.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=437

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 115/177 (65%), Gaps = 8/177 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+A+KPNGL IL +KFK C  LN S++LKD+L   Y+ A QY+    + VT VC  I+  
Sbjct  257  KVAAKPNGLLILGKKFKTCAPLNKSFDLKDFLDTIYAEAVQYNE--GFLVTNVCSAINAN  314

Query  333  P--KGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDT  172
            P  +   ILDRIFAGV A  GNQSCY    S+        W WQ CSE+  P+G    D 
Sbjct  315  PPNRKIDILDRIFAGVVALTGNQSCYDTNYSVLVANDDMAWRWQGCSEIVIPVGHDKQDA  374

Query  171  MFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            MF  +PFN+  F + C + +GV PRPHWITTYYG QDIKL+L +FGSNIIFSNGL D
Sbjct  375  MFPTSPFNMTSFIEGCESNYGVSPRPHWITTYYGIQDIKLILRRFGSNIIFSNGLSD  431



>ref|XP_010493394.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
 ref|XP_010493396.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=501

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 118/178 (66%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+KP GL ILS+KFK C  LN S  +KD+L   Y+ + QY+  P Y VT VC  I+  
Sbjct  257  RVAAKPQGLLILSKKFKTCAPLNGSSNIKDFLNTIYAESVQYNRGPSYWVTNVCNAINAN  316

Query  333  PKGAH--ILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDGD  175
            P  +   +LDRIFAGV A  GN++CY     + PT   I  W WQSCSE+  P+G    D
Sbjct  317  PPNSKHDLLDRIFAGVVALVGNRTCYDPNMFAQPTNNVI-AWRWQSCSEIVMPVGYDKQD  375

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF  APFN+  + + C + +GVPPR HWITTY+G QD+KL+L KFGSNIIFSNGL D
Sbjct  376  TMFPTAPFNMTSYIEGCESNYGVPPRQHWITTYFGIQDVKLILRKFGSNIIFSNGLSD  433



>gb|AAM61502.1| prolylcarboxypeptidase-like protein [Arabidopsis thaliana]
Length=502

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 119/178 (67%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A KPNGLSILS++FK C  LN S+++KD+L   Y+ A QY+  P + V +VC  I+  
Sbjct  257  RVAGKPNGLSILSKQFKTCDPLNGSFDIKDFLDTIYAEAVQYNRGPNFWVAKVCNAINAN  316

Query  333  P--KGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGD  175
            P  +  ++LDRIFAGV A  GN++CY       PT   I  W WQSCSE+  P+G    D
Sbjct  317  PPNRRYNLLDRIFAGVVALVGNRTCYDTKMFAQPTNNNI-AWRWQSCSEIVMPVGYDKQD  375

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF  APFN+  +   C +  GV PRPHWITTY+G Q++KL+L KFGSNIIFSNGL D
Sbjct  376  TMFPTAPFNMTSYIDGCKSYHGVTPRPHWITTYFGIQEVKLILQKFGSNIIFSNGLSD  433



>ref|NP_851059.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 dbj|BAB10607.1| prolylcarboxypeptidase-like protein [Arabidopsis thaliana]
 gb|AED93088.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=502

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 119/178 (67%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A KPNGLSILS++FK C  LN S+++KD+L   Y+ A QY+  P + V +VC  I+  
Sbjct  257  RVAGKPNGLSILSKQFKTCAPLNGSFDIKDFLDTIYAEAVQYNRGPNFWVAKVCNAINAN  316

Query  333  P--KGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGD  175
            P  +  ++LDRIFAGV A  GN++CY       PT   I  W WQSCSE+  P+G    D
Sbjct  317  PPNRRYNLLDRIFAGVVALVGNRTCYDTKMFAQPTNNNI-AWRWQSCSEIVMPVGYDKQD  375

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF  APFN+  +   C +  GV PRPHWITTY+G Q++KL+L KFGSNIIFSNGL D
Sbjct  376  TMFPTAPFNMTSYIDGCKSYHGVTPRPHWITTYFGIQEVKLILQKFGSNIIFSNGLSD  433



>gb|KCW50736.1| hypothetical protein EUGRSUZ_J00407, partial [Eucalyptus grandis]
Length=311

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 118/175 (67%), Gaps = 5/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A +P+GLS L++ FK C+ L S  ELK YL   Y  AAQYD PP YPVT +C GIDGA
Sbjct  116  RVAHEPDGLSNLNKLFKTCKPLESVDELKGYLKSLYWSAAQYDDPPIYPVTMICNGIDGA  175

Query  333  PKGAH-ILDRIFAGVFASEGNQSCYSIPT---GTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
                + IL +IFAGV A +GN +CY  P+        GWSWQ CSEM  PIG  + ++MF
Sbjct  176  NTIENGILGKIFAGVVAYDGNSTCYVNPSTDVSQTSLGWSWQKCSEMVMPIGITN-NSMF  234

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PF L  F   C + +GV P+ HW++TYYGG DI+L+L +FGSNIIFSNGLRD
Sbjct  235  QPHPFILSDFIDECNSSYGVLPQLHWVSTYYGGYDIELILRRFGSNIIFSNGLRD  289



>ref|XP_002523750.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38690.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=491

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 115/174 (66%), Gaps = 3/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A++PNGL  LS  F  C  LNSS EL++YL   Y  AAQYD PP  PV   C GIDGA
Sbjct  253  RVAAQPNGLLTLSNMFNTCSPLNSSTELREYLEILYVSAAQYDNPPYNPVQNTCRGIDGA  312

Query  333  PKGAHILDRIFAGVFASEGN-QSCYSIPTG--TAIWGWSWQSCSEMAFPIGRGDGDTMFF  163
            P G  IL RI AG+ +   +  SCY +PT   +    W WQ+C+EM FPIG G  +TMF 
Sbjct  313  PPGTDILGRIVAGLKSRIPSWSSCYDVPTWDLSNKSAWDWQTCTEMVFPIGYGYNETMFQ  372

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P+PF++  +++ C+ +FG+ PRP W TT +GG DIK VL  F SNIIF+NGLRD
Sbjct  373  PSPFDINNYTEACVQVFGIKPRPQWATTEFGGHDIKTVLGNFASNIIFANGLRD  426



>ref|XP_010421083.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
Length=500

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 115/177 (65%), Gaps = 8/177 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+A+KPNGL IL +KFK C  LN S++LKD+L   Y+ A QY+    + VT VC  I+  
Sbjct  257  KVAAKPNGLLILGKKFKTCAPLNKSFDLKDFLDTIYAEAVQYN--EGFLVTNVCSAINAN  314

Query  333  P--KGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDT  172
            P  +   ILDRIFAGV A  GNQSCY    S+        W WQ CSE+  P+G    D 
Sbjct  315  PPNRKIDILDRIFAGVVALTGNQSCYDTNYSVLVANDDMAWRWQGCSEIVIPVGHDKQDA  374

Query  171  MFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            MF  +PFN+  F + C + +GV PRPHWITTYYG QDIKL+L +FGSNIIFSNGL D
Sbjct  375  MFPTSPFNMTSFIEGCESNYGVSPRPHWITTYYGIQDIKLILRRFGSNIIFSNGLSD  431



>ref|XP_010100139.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81590.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=652

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 119/176 (68%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+ PNGLSILS KF  C+ L  S ELK YL   Y+ AAQY+ PP YPV+ +CGGIDGA
Sbjct  411  RVAALPNGLSILSEKFHTCRPLEKSSELKRYLRIMYATAAQYNHPPRYPVSVICGGIDGA  470

Query  333  PK--GAHILDRIFAGVFASEGNQSCY-SIPTGTAIW--GWSWQSCSEMAFPIGRGDGDTM  169
                   IL +IF G+ +   N +CY + P   +    GW+WQ+CSEM  PIG  + +TM
Sbjct  471  NDIDDHDILGKIFLGLSSYITNSTCYVNQPRNLSETDVGWNWQTCSEMVIPIGISN-NTM  529

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F  +PF LQ F   C   + VPPRPHW+TTYYGG+DIKL+L +F SNIIFSNGLRD
Sbjct  530  FSASPFELQDFINECKAAYDVPPRPHWVTTYYGGKDIKLILRRFASNIIFSNGLRD  585



>ref|XP_002313554.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
 gb|EEE87509.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
Length=494

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 113/175 (65%), Gaps = 4/175 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+ NGL  LS  F  C  LNSS +LK Y    Y  AAQ D PP YPV ++C  IDGA
Sbjct  253  RVASETNGLLNLSNIFTTCSPLNSSKDLKVYTEIAYMWAAQLDNPPSYPVNKICSAIDGA  312

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIP----TGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
            P G  IL R+ AGV AS    SC+S      +  +   W WQ+C+EM FP+G G+ +TMF
Sbjct  313  PSGTDILGRVAAGVNASVFGNSCHSASGSGLSRKSASAWEWQTCTEMVFPMGYGENETMF  372

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
               P ++  ++K C+++FG+ PRPHWITT +GG DIK VL  F SNIIFSNGLRD
Sbjct  373  QSDPLDINNYTKECVDVFGIKPRPHWITTEFGGHDIKTVLGNFASNIIFSNGLRD  427



>ref|XP_006287572.1| hypothetical protein CARUB_v10000782mg [Capsella rubella]
 gb|EOA20470.1| hypothetical protein CARUB_v10000782mg [Capsella rubella]
Length=502

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+KPNGL ILS+KFK C  LN S+++KD+L   Y+ + QY+  P Y VT+VC  I+  
Sbjct  255  RVAAKPNGLLILSKKFKTCAPLNGSFKIKDFLDSVYAESVQYNRGPSYWVTKVCNAINTN  314

Query  333  ---PKGAH-ILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGD  181
               P   H +LD+IFAGV A  GN++CY       PT   I  W WQSCSE+  P+G   
Sbjct  315  TYPPNSKHDLLDQIFAGVVALIGNRTCYDTNMFAQPTNNNI-AWRWQSCSEIVMPVGYDK  373

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             DTMF   PFN+  +   C + +GVPPR HWITTY+G QD+KL+L KFGSNIIFSNGL D
Sbjct  374  QDTMFPTTPFNMTSYISGCESYYGVPPRQHWITTYFGIQDVKLILQKFGSNIIFSNGLSD  433



>ref|XP_006424411.1| hypothetical protein CICLE_v10028519mg [Citrus clementina]
 gb|ESR37651.1| hypothetical protein CICLE_v10028519mg [Citrus clementina]
Length=418

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 110/155 (71%), Gaps = 8/155 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+ASKP+GLSILS+KF+ C+ L  S+EL+DYL   Y+ AAQY+ PP+YPV  +CGGIDGA
Sbjct  261  KVASKPDGLSILSKKFRTCKPLKDSYELEDYLELVYADAAQYNQPPKYPVNMLCGGIDGA  320

Query  333  PKGA--HILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDT  172
              G    IL +IFAGV A EGN SCY    +I + T + GW WQ+CSEM  PIG  D  T
Sbjct  321  ALGTDNDILSKIFAGVVAHEGNMSCYVNPPTIESETTV-GWRWQTCSEMVIPIGT-DNTT  378

Query  171  MFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGG  67
            MF PAPFNL  F   C +L+GV PRPHW+T YYGG
Sbjct  379  MFQPAPFNLSSFIDGCESLYGVSPRPHWVTAYYGG  413



>ref|XP_010493391.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
Length=500

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 115/177 (65%), Gaps = 8/177 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+A+KPNGL IL +KFK C  LN S++LKD+L   Y+ A QY+      V+ VC  I+  
Sbjct  257  KVAAKPNGLLILGKKFKTCAPLNRSFDLKDFLDTIYAEAVQYNEG--ILVSNVCNAINAN  314

Query  333  P--KGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDT  172
            P  +   ILDRIFAGV A  GNQSCY    S+        W WQ CSE+  P+G    DT
Sbjct  315  PPNRKIDILDRIFAGVVALTGNQSCYDTNYSVLVANDDMAWRWQGCSEIVIPVGHDKQDT  374

Query  171  MFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            MF  +PFN+  F + C + +GV PRPHWITTYYG QDIKL+L +FGSNIIFSNGL D
Sbjct  375  MFPTSPFNMTSFIEGCESNYGVSPRPHWITTYYGIQDIKLILRRFGSNIIFSNGLSD  431



>ref|XP_010031432.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50733.1| hypothetical protein EUGRSUZ_J00406 [Eucalyptus grandis]
Length=504

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 115/174 (66%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P GL+ LS  FK C  L SS ELK YL   Y    QY+ P   P+  +C  I+GA
Sbjct  265  RVASEPRGLTKLSNAFKTCSPLQSSSELKKYLKLLYVQVVQYNDPSAQPLKLMCDAINGA  324

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGTAIW---GWSWQSCSEMAFPIGRGDGDTMFF  163
            P    +L +IFAG+ A  GN +CY  P+G+      GW WQ+C+EMAFPIG    +TMF 
Sbjct  325  PPRKGLLQKIFAGLVAINGNLTCYVNPSGSDAQTPSGWFWQTCTEMAFPIGITR-NTMFP  383

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PFNL  FS  C + FGVP RP W+TTY+GG DIKL+L++F SNIIFSNGL+D
Sbjct  384  PEPFNLNSFSNACKSEFGVPARPRWVTTYFGGHDIKLILHRFASNIIFSNGLQD  437



>gb|KDP45057.1| hypothetical protein JCGZ_01557 [Jatropha curcas]
Length=391

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 116/177 (66%), Gaps = 9/177 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            + A+  NGLS+LS+KFK C++L + +ELK+ LV  Y+ +AQYD P  + V+ VC  I  A
Sbjct  152  RFAAMENGLSLLSKKFKTCKNLENVYELKEILVTTYAASAQYDKPSNH-VSRVCEAITSA  210

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGTAIW------GWSWQSCSEMAFPIGRGDGDT  172
            P+G  ILD+IF G  A  G + CY     T  W      GW+WQ CS++  P+G     T
Sbjct  211  PQGTDILDKIFLGFVAFAGKKDCYD--PNTLFWSQETTEGWNWQVCSDLVIPMGIDSNRT  268

Query  171  MFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            MF   PF ++ F+++C   +GV PRPHW+TTYYGGQ IK VL +FGSNIIFSNGLRD
Sbjct  269  MFQHDPFVMEIFTESCKESYGVLPRPHWVTTYYGGQHIKEVLRRFGSNIIFSNGLRD  325



>emb|CBI17113.3| unnamed protein product [Vitis vinifera]
Length=623

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 121/177 (68%), Gaps = 9/177 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A +PNGL+ LS+ F+ C+ LNSS +LK YL   Y  +AQYD PP + V+++C  IDGA
Sbjct  256  EVAGQPNGLANLSQIFRTCEPLNSSQQLKLYLEYTYEASAQYDNPPAHYVSDICNAIDGA  315

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI----PTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
            P+G  IL R+  GV AS G   C+ I    P+  +  GW WQ+C+EM  P GRG+ DTMF
Sbjct  316  PEGTSILGRVAEGVNASAG-PPCHRIYDFQPSNMS--GWLWQTCTEMVMPFGRGENDTMF  372

Query  165  FPAPFNLQQFSKNCINLFG--VPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              +PF+L  ++K C ++FG  V PRPHWITT +GG +IK VL  F SNIIFSNGLRD
Sbjct  373  QASPFDLNNYTKTCQDIFGASVTPRPHWITTEFGGHNIKSVLGNFASNIIFSNGLRD  429



>ref|XP_008458662.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=495

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 113/173 (65%), Gaps = 5/173 (3%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            +AS+PNGLS+L ++FK C  L SS +L++YL   Y+ AAQY+ P  YPVT +C  ID   
Sbjct  258  VASQPNGLSVLDKEFKTCSPLRSSTQLENYLWFMYASAAQYNHPSSYPVTRICDAIDRTY  317

Query  330  KGAHILDRIFAGVFASEGNQSCY---SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFFP  160
                 L +I AGVFA  GN SCY    I T     GW WQ CSEM  PI   + DTMF P
Sbjct  318  SNG-TLGKIAAGVFAYRGNLSCYINEPINTTETTVGWQWQRCSEMVMPISTSN-DTMFPP  375

Query  159  APFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              F+ + FS  C  L+GV PRPHW+TTYYGG D+ L+L++F SNIIFSNGL+D
Sbjct  376  RTFDHESFSIYCNQLYGVTPRPHWVTTYYGGDDVHLILHRFASNIIFSNGLKD  428



>ref|XP_006484928.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=206

 Score =   173 bits (439),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 100/140 (71%), Gaps = 6/140 (4%)
 Frame = -2

Query  408  YSIAAQYDTPPEYPVTEVCGGIDGAPKGAHILDRIFAGVFASEGNQSCYSIP----TGTA  241
            Y+ AAQY+ PP+YPV+ VCGGIDGA  G  IL +IFAGV A EGN SCY  P    T T 
Sbjct  2    YAYAAQYNHPPDYPVSMVCGGIDGAAFGNDILSKIFAGVVAYEGNMSCYVNPPTNETETT  61

Query  240  IWGWSWQSCSEMAFPIGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQD  61
            + GW WQ CSEM  PIG  D  TMF P PFNL  F   C +L+GV P+PHW+TTYYGG D
Sbjct  62   V-GWRWQRCSEMVIPIGT-DNTTMFQPTPFNLSSFIDWCGSLYGVSPQPHWVTTYYGGYD  119

Query  60   IKLVLNKFGSNIIFSNGLRD  1
            IKL+L +F SNIIFSNGLRD
Sbjct  120  IKLILQRFASNIIFSNGLRD  139



>ref|XP_011004990.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Populus 
euphratica]
Length=531

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKP+GLSILS+KFK C  L  + ELK++L   Y+ AAQY+ PP YPV +VCGGIDG 
Sbjct  294  EVASKPDGLSILSKKFKTCNPLTDASELKNHLDSMYANAAQYNKPPTYPVNKVCGGIDGG  353

Query  333  PKGAHILDRIFAGVFASEGNQSCY-SIPTGTA--IWGWSWQSCSEMAFPIGRGDGDTMFF  163
              G  +L R+F G+ A +GN+SCY + PT  +    GW WQ+CSEM  PIG G+ D+MF 
Sbjct  354  GFGDDLLGRVFGGLVAYKGNRSCYVNEPTNQSETSAGWRWQTCSEMVIPIGYGN-DSMFP  412

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PF+L+ + ++C +L+ V PR HW+TTYYGG  I+L+L +F SNIIFSNGLRD
Sbjct  413  PDPFDLKAYIEDCKSLYNVTPRFHWVTTYYGGHSIRLILQRFASNIIFSNGLRD  466



>ref|XP_010031433.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=496

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 118/175 (67%), Gaps = 5/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A +P+GLS L++ FK C+ L S  ELK YL   Y  AAQYD PP YPVT +C GIDGA
Sbjct  256  RVAHEPDGLSNLNKLFKTCKPLESVDELKGYLKSLYWSAAQYDDPPIYPVTMICNGIDGA  315

Query  333  PKGAH-ILDRIFAGVFASEGNQSCYSIPT---GTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
                + IL +IFAGV A +GN +CY  P+        GWSWQ CSEM  PIG  + ++MF
Sbjct  316  NTIENGILGKIFAGVVAYDGNSTCYVNPSTDVSQTSLGWSWQKCSEMVMPIGITN-NSMF  374

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             P PF L  F   C + +GV P+ HW++TYYGG DI+L+L +FGSNIIFSNGLRD
Sbjct  375  QPHPFILSDFIDECNSSYGVLPQLHWVSTYYGGYDIELILRRFGSNIIFSNGLRD  429



>emb|CDX71016.1| BnaC03g11000D [Brassica napus]
Length=407

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 118/175 (67%), Gaps = 6/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGID-G  337
            ++A KPNGL ILS+KF++C  LN+++ELK++L   Y+ AAQY++  +YPV  +C  I+ G
Sbjct  229  RVAVKPNGLLILSKKFRICNTLNNTFELKNFLDTIYASAAQYNSN-QYPVASLCEAINNG  287

Query  336  APKGAHILDRIFAGVFASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
                  +L +IFAGV    GN+SCY +   PT  +I  W WQ+CSE+  PIG  + DTMF
Sbjct  288  VNSENDLLGQIFAGVVYDRGNRSCYPLSVQPTEDSI-AWKWQTCSEIVLPIGHDEQDTMF  346

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
               PF +      C   +GVPPRPHW+T YYG QD+KL+L +FGSNIIFSNGL D
Sbjct  347  QTEPFRMDIKIDRCKLQYGVPPRPHWVTAYYGIQDVKLILRRFGSNIIFSNGLLD  401



>ref|XP_006424416.1| hypothetical protein CICLE_v10028929mg [Citrus clementina]
 gb|ESR37656.1| hypothetical protein CICLE_v10028929mg [Citrus clementina]
Length=219

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 107/153 (70%), Gaps = 6/153 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P+GL+ILS KF+ C+ L  S+ELK YL   Y+ AAQY+ PP+YPV+ VCGGIDGA
Sbjct  64   EVASQPDGLAILSNKFRTCRPLGDSYELKGYLRLMYAHAAQYNHPPDYPVSMVCGGIDGA  123

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIP----TGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G  I+ +IFAGV A +GN SCY  P    T T + GW WQ CSEM  PIG  +  TMF
Sbjct  124  AFGNDIISKIFAGVVAYKGNMSCYVNPPTNETETTV-GWRWQRCSEMVIPIGTVN-TTMF  181

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGG  67
             P PFNL  F   C +L+GV PRPHW+TTYYGG
Sbjct  182  QPTPFNLSSFIDRCESLYGVSPRPHWVTTYYGG  214



>ref|XP_011005221.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Populus 
euphratica]
Length=531

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKP+GLSILS+KFK C  L  + EL+++L   Y+ AAQY+ PP YPV +VCGGIDG 
Sbjct  294  EVASKPDGLSILSKKFKTCNPLTDASELRNHLDSMYANAAQYNKPPTYPVNKVCGGIDGG  353

Query  333  PKGAHILDRIFAGVFASEGNQSCY-SIPTGTA--IWGWSWQSCSEMAFPIGRGDGDTMFF  163
              G  +L R+F G+ A +GN+SCY + PT  +    GW WQ+CSEM  PIG G+ D+MF 
Sbjct  354  GFGDDLLGRVFGGLVAYKGNRSCYVNEPTNQSETSAGWRWQTCSEMVIPIGYGN-DSMFP  412

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P PF+L+ + ++C +L+ V PR HW+TTYYGG  I+L+L +F SNIIFSNGLRD
Sbjct  413  PDPFDLKAYIEDCKSLYNVTPRFHWVTTYYGGHSIRLILQRFASNIIFSNGLRD  466



>ref|XP_010267351.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=468

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 116/176 (66%), Gaps = 7/176 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+PNGLSILS++F  C  + S+ +LKDYL   Y  AAQY +P    V+ +C  IDG 
Sbjct  230  RVASQPNGLSILSKQFMTCSPITSASQLKDYLDSNYCEAAQYASPSGDGVSRICNAIDGT  289

Query  333  PKGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
                 IL +IF G+ +  GN +CY +     P+ T   GWSWQ+CSEM  PI  G+ DTM
Sbjct  290  SNHTDILGKIFKGLVSFNGNWTCYDVNAFNNPSETDE-GWSWQTCSEMVMPIAHGN-DTM  347

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F    F+L  F ++C N +GV PRPHWIT  +GG DIKL+L +FGSNIIFSNGL+D
Sbjct  348  FQAESFDLDAFVQDCKNAYGVSPRPHWITAEFGGDDIKLILERFGSNIIFSNGLKD  403



>emb|CDY09173.1| BnaA02g05990D [Brassica napus]
Length=517

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 117/192 (61%), Gaps = 22/192 (11%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+KPNGL ILS++FK C  LN+S+++KD+L   Y+ A QY+  P Y VT VC  ID  
Sbjct  257  RVAAKPNGLLILSKQFKTCAPLNASFDIKDFLSTIYAEAVQYNRGPSYSVTNVCNAIDNN  316

Query  333  PKGAH--ILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQ--------------S  217
            P  +   +LDRIFAG  A  GNQSCY       PT      W WQ              +
Sbjct  317  PPNSKKGLLDRIFAGAVALLGNQSCYDTNMFAHPTNNN-KAWRWQARKFTLKTMLKPDRT  375

Query  216  CSEMAFPIGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKF  37
            CSE+  P+G    DTMF   PFN+  + + C   +GV PRPHWITTY+G QD+KL+L KF
Sbjct  376  CSEIVMPVGYDKQDTMFPTTPFNMTSYIERCKADYGVTPRPHWITTYFGIQDVKLILRKF  435

Query  36   GSNIIFSNGLRD  1
            GSNIIFSNGL D
Sbjct  436  GSNIIFSNGLSD  447



>ref|XP_010034145.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=502

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 119/175 (68%), Gaps = 5/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P+GL+ LSR FK C+ L SS +LK+YL   Y+ AAQY+ P   PV  +C  I+GA
Sbjct  261  RVASEPHGLAKLSRTFKTCRPLESSSQLKEYLKLVYAEAAQYNDPLSRPVEVICNAINGA  320

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGTAI----WGWSWQSCSEMAFPIGRGDGDTMF  166
                 IL +IFAG+ +++ N +CY  P  T +     GW WQ+CSE+ F +G    +TMF
Sbjct  321  SPRNDILGKIFAGLASADRNSTCYVNPPPTPLPQTYLGWHWQTCSEILF-VGSITNNTMF  379

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             PAP  L +F  +C   FG+ PR HW++T+YGGQDIKLVL++F SNIIFSNGL+D
Sbjct  380  QPAPSGLDKFVNSCKREFGIAPRQHWVSTHYGGQDIKLVLHRFASNIIFSNGLQD  434



>ref|XP_004160099.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=491

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 110/173 (64%), Gaps = 5/173 (3%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            +AS+ NGLS+L ++FK C  L SS +L++YL   Y+ AAQY+ P  YPV  +C  ID   
Sbjct  254  VASQSNGLSVLDKEFKTCSPLRSSTQLENYLWFMYASAAQYNHPSRYPVNRICDAIDQTY  313

Query  330  KGAHILDRIFAGVFASEGNQSCY---SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFFP  160
                 L +I AGVFA  G  SCY    I T     GW WQ CSEM  PI  G+ DTMF  
Sbjct  314  SNG-TLGKIAAGVFAYRGELSCYINEPINTTETTVGWQWQRCSEMVMPISTGN-DTMFPS  371

Query  159  APFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              F+ + FS  C  L+GV PRPHW+TTYYGG DI L+L++F SNIIFSNGL+D
Sbjct  372  ETFDHESFSIYCNQLYGVTPRPHWVTTYYGGHDIHLILHRFASNIIFSNGLKD  424



>ref|XP_006436577.1| hypothetical protein CICLE_v10033555mg [Citrus clementina]
 gb|ESR49817.1| hypothetical protein CICLE_v10033555mg [Citrus clementina]
Length=294

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = -2

Query  435  ELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAPKGAHILDRIFAGVFASEGNQSCYSI  256
            ELKDYL   Y+ AAQYD P EYPV + C GIDG  +G + L RIF+G+ A  G  SC+ +
Sbjct  122  ELKDYLEFMYTGAAQYDDPQEYPVNKACEGIDGDSEGTYTLGRIFSGIVALRGENSCHDV  181

Query  255  PT----GTAIWGWSWQSCSEMAFPIGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHW  88
                   T    W WQ+CSEM  PIG G  +TMF   PF L ++  +C   FGV PRPHW
Sbjct  182  DEFFSDETLDSSWGWQTCSEMVSPIGIGKNETMFQADPFYLTEYRDSCNKSFGVVPRPHW  241

Query  87   ITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            ITTYYGG DI++VL +FGSNIIFSNG RD
Sbjct  242  ITTYYGGHDIRVVLKRFGSNIIFSNGHRD  270



>emb|CDY09174.1| BnaA02g06000D [Brassica napus]
Length=502

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 117/180 (65%), Gaps = 9/180 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+K NGL ILS+KF+ C  L+ S+++KD+L   Y+ + Q++  P   V  +C  ID  
Sbjct  255  RVAAKSNGLLILSKKFRTCAPLSRSFDIKDFLDSIYAESVQFNRNPGDWVATLCNAIDNP  314

Query  333  P-KGAHILDRIFAGVFASEGNQSCYS----IPTGTAIWGWSWQSCS----EMAFPIGRGD  181
            P +  ++LDRIFAG+ A  GNQSCY     I     +  WSWQ+C+    E+  PIG   
Sbjct  315  PNRKNYVLDRIFAGIVAYIGNQSCYDTGLFIQPSNDVIAWSWQACTLHFGEIMMPIGHDK  374

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             DTMF  APFN+     NC + +GV PRPHW+TTY+G QD+KL+L +FGSNIIFSNGL D
Sbjct  375  HDTMFQTAPFNMTSAIDNCKSSYGVSPRPHWVTTYFGIQDVKLILRRFGSNIIFSNGLAD  434



>ref|XP_004145825.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46899.1| hypothetical protein Csa_6G149400 [Cucumis sativus]
Length=491

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 109/173 (63%), Gaps = 5/173 (3%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            +AS+ NGLS+L + FK C  L SS +L++YL   Y+ AAQY+ P  YPV  +C  ID   
Sbjct  254  VASQSNGLSVLDKVFKTCSPLRSSTQLENYLWFMYASAAQYNHPSRYPVNRICDAIDQTY  313

Query  330  KGAHILDRIFAGVFASEGNQSCY---SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFFP  160
                 L +I AGVFA  G  SCY    I T     GW WQ CSEM  PI  G+ DTMF  
Sbjct  314  SNG-TLGKIAAGVFAYRGELSCYINEPINTTETTVGWQWQRCSEMVMPISTGN-DTMFPS  371

Query  159  APFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              F+ + FS  C  L+GV PRPHW+TTYYGG DI L+L++F SNIIFSNGL+D
Sbjct  372  ETFDHESFSIYCNQLYGVTPRPHWVTTYYGGHDIHLILHRFASNIIFSNGLKD  424



>ref|XP_006485136.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=498

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 116/180 (64%), Gaps = 11/180 (6%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            IASKP+GL+ILS+KFK C  L ++ ELKD L   YS AAQYDTP   PV  +C  I+ AP
Sbjct  253  IASKPDGLAILSKKFKTCTPLKNTTELKDGLDTVYSEAAQYDTPSNIPVKRICNAIENAP  312

Query  330  K-GAHILDRIFAGVFASEG------NQSCYSIPTGT---AIWGWSWQSCSEMAFPIGRGD  181
              G  IL +I AGV  ++       N  CY     T   +  GW WQSCSEM  P+G+ D
Sbjct  313  NCGDDILCKIAAGVVEADSLEYDGNNSRCYINEDKTGDESDEGWEWQSCSEMVVPMGK-D  371

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             ++M+ P P+NL ++ KNC   +GV PRP W+ TYYGG DIKL+L +  SNIIFSNG+RD
Sbjct  372  KNSMYQPEPWNLTKYIKNCKEQYGVSPRPSWVLTYYGGHDIKLILRRSTSNIIFSNGMRD  431



>ref|XP_002874098.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50357.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=427

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 116/178 (65%), Gaps = 9/178 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQD-LNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDG  337
            ++ASKPNGL ILS+KFK C   L+ S++LKD+L   Y+   QY+      VT VC  I+ 
Sbjct  184  RVASKPNGLLILSKKFKTCASPLSRSFDLKDFLDTVYAETVQYNDGVW--VTNVCNAINA  241

Query  336  AP--KGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGD  175
             P  +   ILDRIFAGV A  G+QSCY    S+        W WQ CSE+  P+G    D
Sbjct  242  NPPNRKIDILDRIFAGVVALTGSQSCYNTNYSVQVTNNDMAWRWQCCSEIVVPVGHDKQD  301

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TM+  +PFN+  + ++C + +GV PRPHWITTY+G Q++KL+L +FGSNIIFSNGL D
Sbjct  302  TMYQTSPFNMTSYIEDCESSYGVSPRPHWITTYFGIQNVKLILQRFGSNIIFSNGLSD  359



>gb|KDO44737.1| hypothetical protein CISIN_1g038117mg [Citrus sinensis]
Length=500

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 116/180 (64%), Gaps = 11/180 (6%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            IASKP+GL+ILS+KFK C  L ++ ELKD L   YS AAQYDTP   PV  +C  I+ AP
Sbjct  253  IASKPDGLAILSKKFKTCTPLKNTTELKDGLDTVYSEAAQYDTPSNIPVKRICNAIENAP  312

Query  330  K-GAHILDRIFAGVFASE------GNQSCYSIPTGT---AIWGWSWQSCSEMAFPIGRGD  181
              G  IL +I AGV  ++       N  CY     T   +  GW WQSCSEM  P+G+ D
Sbjct  313  NCGDDILCKIAAGVVEADSLEYDGNNSRCYINEDRTGDESDEGWEWQSCSEMVVPMGK-D  371

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             ++M+ P P+NL ++ KNC   +GV PRP W+ TYYGG DIKL+L +  SNIIFSNG+RD
Sbjct  372  KNSMYQPEPWNLTKYIKNCKEQYGVSPRPSWVLTYYGGHDIKLILRRSTSNIIFSNGMRD  431



>ref|XP_006485335.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=471

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 108/169 (64%), Gaps = 2/169 (1%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAPKGA  322
            K NGL+ LS+KFK C+ L    ELKDYL   Y+ AAQYD P EYPV + C GIDGA +G 
Sbjct  216  KKNGLTFLSKKFKTCKPLKDVSELKDYLESMYTSAAQYDDPQEYPVNKACNGIDGASEGT  275

Query  321  HILDRIFAGVFASEGNQSCYSIPTGTA-IWGWSWQSC-SEMAFPIGRGDGDTMFFPAPFN  148
              L RIF+G+ A  G  SCY +   ++ +  W+     SEM  PI  G  DT F   PFN
Sbjct  276  DTLGRIFSGIVALRGESSCYDVLMNSSPMKHWTPAGAGSEMVSPIKIGKNDTTFQANPFN  335

Query  147  LQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              +   +C   +GV PRPHWITTY  G DI++VLN+FGSNIIFSNGLR+
Sbjct  336  PTESMDSCNKSYGVVPRPHWITTYCSGHDIRMVLNRFGSNIIFSNGLRN  384



>ref|XP_006436579.1| hypothetical protein CICLE_v10033867mg, partial [Citrus clementina]
 gb|ESR49819.1| hypothetical protein CICLE_v10033867mg, partial [Citrus clementina]
Length=421

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 102/166 (61%), Gaps = 13/166 (8%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAPKGA  322
            K NGL+ LS+KFK C+ L    ELKDYL   Y+ AAQYD P EYPV + C GIDGA +G 
Sbjct  262  KKNGLTFLSKKFKTCKPLKDVSELKDYLESMYTSAAQYDDPQEYPVNKACNGIDGASEGT  321

Query  321  HILDRIFAGVFASEGNQSCYSIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFFPAPFNLQ  142
              L RIF+G+ A  G  SCY              +CSEM  PI  G  DT F   PFN  
Sbjct  322  DTLGRIFSGIVALRGESSCY-------------DTCSEMVSPIKIGKNDTTFQANPFNPT  368

Query  141  QFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLR  4
            +   +C   +GV PRPHWITTY  G DI++VL +FGSNIIFSNGLR
Sbjct  369  ESMDSCNKSYGVVPRPHWITTYCSGHDIRVVLKRFGSNIIFSNGLR  414



>ref|XP_010031430.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50723.1| hypothetical protein EUGRSUZ_J00402 [Eucalyptus grandis]
Length=497

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 114/173 (66%), Gaps = 3/173 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A + +GLS LS+ F  C+ L S   LK +L   Y+ AAQ D PP YPVT +C GIDGA
Sbjct  256  RVAKELDGLSNLSQIFNTCRPLESGATLKSFLKDMYTTAAQQDNPPTYPVTRICEGIDGA  315

Query  333  PKGAH-ILDRIFAGVFASEGNQSC-YSIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFFP  160
                + IL +I AGV A   N +C  + P   +  GWSWQ CSEM  P+G    ++MF P
Sbjct  316  NTTENGILGKISAGVVAYYWNSNCCLNTPLTVSPDGWSWQKCSEMVMPLGITR-NSMFPP  374

Query  159  APFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            APF L  F ++C   +GV PRPHW+TT+YGG DI+L+L +FGSNIIFSNGLRD
Sbjct  375  APFLLDDFMEHCRCEYGVVPRPHWVTTHYGGHDIELILRRFGSNIIFSNGLRD  427



>ref|XP_006424406.1| hypothetical protein CICLE_v10030241mg, partial [Citrus clementina]
 gb|ESR37646.1| hypothetical protein CICLE_v10030241mg, partial [Citrus clementina]
Length=501

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 118/180 (66%), Gaps = 11/180 (6%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            IASKP+GL+ILS+KFK C  L ++ ELKD L   YS AAQYD+P   PV  +C  I+ AP
Sbjct  256  IASKPDGLAILSKKFKTCTPLKNTTELKDGLDTVYSEAAQYDSPSNIPVKRICNAIENAP  315

Query  330  K-GAHILDRIFAGVFAS-----EGNQS-CYSIPTGT---AIWGWSWQSCSEMAFPIGRGD  181
              G  IL +I AGV  +     +GN S CY     T   +  GW WQSCSEM  P+G+ D
Sbjct  316  NCGDDILCKIAAGVVEAYLLEYDGNNSRCYINEDRTGDESDEGWEWQSCSEMVVPMGK-D  374

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             ++M+ P P+NL ++ K+C   +GV PRP W+ TYYGG DIKL+L +  SNIIFSNG+RD
Sbjct  375  KNSMYQPEPWNLTKYIKDCKEQYGVSPRPSWVLTYYGGHDIKLILRRSTSNIIFSNGMRD  434



>ref|XP_010100140.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81591.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=465

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 106/157 (68%), Gaps = 4/157 (3%)
 Frame = -2

Query  462  LCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAPKGAHILDRIFAGVFAS  283
            + +D   S ELKD+L   Y+ AAQY+ PP YPV  +CG IDGA     IL +IFAG+ + 
Sbjct  240  VTKDFIKSSELKDHLESTYATAAQYNHPPRYPVNVICGAIDGANNDDGILGKIFAGLASY  299

Query  282  EGNQSCY-SIPTGTAIW--GWSWQSCSEMAFPIGRGDGDTMFFPAPFNLQQFSKNCINLF  112
              N++CY + P   +    GW+WQ+CSEM  PIG  + +TMF  +PF LQ F   C   +
Sbjct  300  RTNRTCYVNQPRNLSETDVGWNWQTCSEMVIPIGISN-NTMFPASPFELQDFINECKAAY  358

Query  111  GVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             VPPRPHW+TTYYGG+DIKL+L +F SNIIFSNGLRD
Sbjct  359  DVPPRPHWVTTYYGGKDIKLILRRFASNIIFSNGLRD  395



>ref|XP_004139566.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=325

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 117/179 (65%), Gaps = 8/179 (4%)
 Frame = -2

Query  513  KIASKPNG-LSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDG  337
            +IA K  G LSILS++FK C  L +S E+K+ +   +++AAQY+ P E PV  +C  ID 
Sbjct  141  RIAGKTRGGLSILSKQFKTCGKLKTSSEIKNLMDSVFTMAAQYNDPYENPVRGICVAIDE  200

Query  336  -APKGAHILDRIFAGVFASEGNQSCYSIPT----GTAIWGWSWQSCSEMAFPIGRG--DG  178
             A K ++++ ++ AGV A  G + CY +         +  + WQ CSEM  PIG    D 
Sbjct  201  EAKKKSNVIKQVVAGVIAYLGERPCYDVYEFGYPNDPLNQYGWQVCSEMVMPIGSSGRDK  260

Query  177  DTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            ++MF P+PF    F   C +L+GV PRPHWITT+YGGQDIKLVL++FGSNIIFSNGL+D
Sbjct  261  NSMFPPSPFQFNDFKTMCKDLYGVTPRPHWITTFYGGQDIKLVLHRFGSNIIFSNGLKD  319



>ref|XP_007150129.1| hypothetical protein PHAVU_005G1292001g, partial [Phaseolus vulgaris]
 gb|ESW22123.1| hypothetical protein PHAVU_005G1292001g, partial [Phaseolus vulgaris]
Length=243

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 101/154 (66%), Gaps = 5/154 (3%)
 Frame = -2

Query  450  LNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAPKGAHILDRIFAGVFASEGNQ  271
            L +S ELK YL   Y  AAQY+ P   PV+ +CGGIDG   G+ +L +I++G+ A  G+ 
Sbjct  8    LTNSRELKSYLHSLYVTAAQYNDPVRNPVSVICGGIDGGAYGSDVLSKIYSGLVALRGDG  67

Query  270  SCYSIPTGTAI----WGWSWQSCSEMAFPIGRGDGDTMFFPAPFNLQQFSKNCINLFGVP  103
             C+  P  T +     GW WQ+CSE+ FPIG G  +TMF   P+N   F+ +C   + V 
Sbjct  68   ICFVNPPSTTVSETSEGWGWQTCSEIVFPIGIGS-NTMFPAQPYNFNSFATSCEKRYAVS  126

Query  102  PRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            PRPHW+TTYYGG  IKL+LNKFGSNIIF NGLRD
Sbjct  127  PRPHWVTTYYGGHSIKLILNKFGSNIIFYNGLRD  160



>ref|XP_010031431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=497

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 113/173 (65%), Gaps = 3/173 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A + +GLS LS+ F  C+ L S   LK +L G Y+ AAQ+D PP YPV  +C GIDGA
Sbjct  256  RVAKELDGLSNLSKIFNTCRPLESGATLKSFLKGLYTKAAQHDNPPTYPVRLICKGIDGA  315

Query  333  PKGAH-ILDRIFAGVFASEGNQSCYSIPTGTAI-WGWSWQSCSEMAFPIGRGDGDTMFFP  160
                + IL +I AGV A   N +CY  P       GWSWQ CSEM  P+G  + ++MF  
Sbjct  316  NTTENDILGKISAGVVAYYWNSTCYVNPLLPVTPSGWSWQRCSEMVMPLGITN-NSMFPR  374

Query  159  APFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            APF L  F + C   +GV PRPHW+TT+YGG DI+L+L +FGSNIIFSNGLRD
Sbjct  375  APFVLDDFMEQCRCQYGVVPRPHWVTTHYGGHDIELILRRFGSNIIFSNGLRD  427



>ref|XP_004295648.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 114/185 (62%), Gaps = 15/185 (8%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGAP  331
            IAS P+GLS LS+ F+ C  L ++  LK  L   Y+ AAQ+D P   PV  +C GIDGA 
Sbjct  223  IASMPDGLSNLSKIFRTCSPLRTAHHLKYSLQLMYTRAAQFDDPSTNPVNVICSGIDGAA  282

Query  330  KGAH-ILDRIFAGVFASEGNQSCY-----------SIPTGT---AIWGWSWQSCSEMAFP  196
               +  L +IFAG+ A EGN+SCY           ++P+        GWSWQ+CSEM  P
Sbjct  283  SLTNDTLAKIFAGLVAIEGNRSCYLSIAPSSSSTNALPSNANDETSEGWSWQACSEMVMP  342

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +     +TMF P  F++Q +  NC   +GVP RP+WITTYYGG DIKL L +F SNIIFS
Sbjct  343  VFAVGNNTMFQPYSFDVQSYINNCKAQYGVPSRPNWITTYYGGHDIKLTLYRFASNIIFS  402

Query  15   NGLRD  1
            NGLRD
Sbjct  403  NGLRD  407



>gb|KFK36399.1| hypothetical protein AALP_AA4G119300 [Arabis alpina]
Length=1109

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 116/178 (65%), Gaps = 8/178 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            +IA+K NGL ILS+KFK C  L+ ++++KD+L   Y+ A Q++      VT +C  I+  
Sbjct  254  RIAAKSNGLLILSKKFKTCAPLSRTFDIKDFLDSIYAEAVQFNRNTGDWVTTICNAINDN  313

Query  333  P--KGAHILDRIFAGVFASEGNQSCYSI-----PTGTAIWGWSWQSCSEMAFPIGRGDGD  175
            P  +   +LDR+ AGV A  GNQSCY       P+  +I  W WQ CSE+  PIG    D
Sbjct  314  PANRKHDVLDRVLAGVVAYIGNQSCYDTDLFVRPSNDSI-AWRWQGCSEIVMPIGYDKQD  372

Query  174  TMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF  APFN+  F  +C + +GV PRPHWITTY+G QD+KL+L +FGSNIIFSNGL D
Sbjct  373  TMFPTAPFNMTSFIDDCKSNYGVTPRPHWITTYFGIQDVKLILKRFGSNIIFSNGLAD  430



>gb|KCW50722.1| hypothetical protein EUGRSUZ_J00400 [Eucalyptus grandis]
Length=535

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 113/173 (65%), Gaps = 3/173 (2%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A + +GLS LS+ F  C+ L S   LK +L G Y+ AAQ+D PP YPV  +C GIDGA
Sbjct  294  RVAKELDGLSNLSKIFNTCRPLESGATLKSFLKGLYTKAAQHDNPPTYPVRLICKGIDGA  353

Query  333  PKGAH-ILDRIFAGVFASEGNQSCYSIPTGTAI-WGWSWQSCSEMAFPIGRGDGDTMFFP  160
                + IL +I AGV A   N +CY  P       GWSWQ CSEM  P+G  + ++MF  
Sbjct  354  NTTENDILGKISAGVVAYYWNSTCYVNPLLPVTPSGWSWQRCSEMVMPLGITN-NSMFPR  412

Query  159  APFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            APF L  F + C   +GV PRPHW+TT+YGG DI+L+L +FGSNIIFSNGLRD
Sbjct  413  APFVLDDFMEQCRCQYGVVPRPHWVTTHYGGHDIELILRRFGSNIIFSNGLRD  465



>ref|XP_006286678.1| hypothetical protein CARUB_v10002667mg [Capsella rubella]
 gb|EOA19576.1| hypothetical protein CARUB_v10002667mg [Capsella rubella]
Length=424

 Score =   166 bits (420),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 112/172 (65%), Gaps = 3/172 (2%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPP-EYPVTEVCGGIDGA  334
            IA+KP GLSILS+K KLC  L  ++ELK +L   Y+  AQY+       VT VC  I+  
Sbjct  185  IAAKPAGLSILSKKIKLCNPLKDTYELKSFLSYVYAGTAQYNNNVYSATVTSVCEAINTT  244

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGT-AIWGWSWQSCSEMAFPIGRGDGDTMFFPA  157
            P    +LD+IFAGV A  GN SCY     T +   W WQ CSE+  PIG  + D+MF   
Sbjct  245  PP-RDLLDQIFAGVVAYAGNISCYGFNQLTNSDRAWGWQVCSEIVMPIGYNEEDSMFQTR  303

Query  156  PFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            P+N+  +S++C + +GV PRPHWIT++YG QD+KL+  +FG+NIIFSNGL D
Sbjct  304  PYNMTSYSEDCQSNYGVIPRPHWITSHYGTQDVKLIFRRFGNNIIFSNGLLD  355



>gb|ABR17702.1| unknown [Picea sitchensis]
Length=509

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 114/183 (62%), Gaps = 17/183 (9%)
 Frame = -2

Query  504  SKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVC  352
             +  GL  LS+KF++C+DLNS+ E++D+L   YS  A  D P         P YP+ EVC
Sbjct  260  ERDEGLQNLSKKFRMCRDLNSTDEIEDWLNSAYSNLAMVDYPYPASFLMPLPAYPIKEVC  319

Query  351  GGIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIG  190
              ID    G  +LDRIFAGV   +   G + C+ +   P G    GW+WQ+C+EM  P+ 
Sbjct  320  KVIDSFSNGTDVLDRIFAGVSVYYNYTGEEKCFDVNDDPHGEN--GWNWQACTEMVMPMS  377

Query  189  RGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNG  10
                 ++F    F+++ ++KNC+N+FGV PRPHWITT +GGQDIK VL  +GSNIIFSNG
Sbjct  378  SNPESSIFPQFTFDIESYTKNCLNMFGVEPRPHWITTEFGGQDIKRVLKNYGSNIIFSNG  437

Query  9    LRD  1
            L D
Sbjct  438  LLD  440



>ref|XP_004172321.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal Pro-X carboxypeptidase-like 
[Cucumis sativus]
Length=440

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 117/179 (65%), Gaps = 8/179 (4%)
 Frame = -2

Query  513  KIASKPNG-LSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDG  337
            +IA K  G LSILS++FK C  L +S E+K+ +   +++AAQY+ P E PV  +C  ID 
Sbjct  256  RIAGKTQGGLSILSKQFKTCGKLKTSSEIKNLMDSVFTMAAQYNDPYENPVRGICVAIDE  315

Query  336  -APKGAHILDRIFAGVFASEGNQSCYSIPT----GTAIWGWSWQSCSEMAFPIGRG--DG  178
             A K ++++ ++ AGV A  G + CY +         +  + WQ CSEM  PIG    D 
Sbjct  316  EAKKKSNVIKQVVAGVIAYLGERPCYDVYEFGYPNDPLNQYGWQVCSEMVMPIGSSGRDK  375

Query  177  DTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            ++MF P+PF    F   C +L+GV PRPHWITT+YGGQDIKLVL++FGSNIIFSNGL+D
Sbjct  376  NSMFPPSPFQFNDFKTMCKDLYGVTPRPHWITTFYGGQDIKLVLHRFGSNIIFSNGLKD  434



>gb|KCW50493.1| hypothetical protein EUGRSUZ_J00219 [Eucalyptus grandis]
Length=503

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 116/176 (66%), Gaps = 7/176 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P+GL+ LS+ FK C+ L SS +LK+YL   Y  AAQY+ P   PV  +C  I+GA
Sbjct  262  RVASEPHGLAKLSKTFKTCRPLESSSQLKEYLKSVYVEAAQYNDPFRRPVEVICNAINGA  321

Query  333  PKGAHILDRIFAGVFASEGNQSCY-----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
                  L +IFAG+ AS+ N +CY     + P+ T + GW WQ+C+E+A  +     +TM
Sbjct  322  SPRNDTLRKIFAGLAASDRNSTCYINPPPTPPSQTEL-GWHWQTCTEIA-ALWSITNNTM  379

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F PAP  L +F   C   F + PR HW++TYYGGQDI+LVL++F SNIIFSNGL+D
Sbjct  380  FQPAPSGLDKFVTRCKRDFIIAPRQHWVSTYYGGQDIELVLHRFASNIIFSNGLQD  435



>gb|KDP32459.1| hypothetical protein JCGZ_13384 [Jatropha curcas]
Length=503

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+A++ NGL  L   F LC  L+S   LK  L   Y  +AQYD PP + V +VCG I+GA
Sbjct  244  KVAAQQNGLETLRSIFSLCDRLHSVGMLKFILRRVYLYSAQYDNPPYFYVEKVCGAINGA  303

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGTAIWG---WSWQSCSEMAFPIGRGDGDTMFF  163
            P+G   L RI AG+ AS    SC+S PT  +I     W WQ C+E+  PIG  + +TMF 
Sbjct  304  PEGTDTLGRIAAGLNASIF--SCHSNPTWKSIVDEDLWLWQVCTELVMPIGLDNNNTMFE  361

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              PF++ +    C ++FG+ PRPHWITT YGG DIK VL  F SNIIFSNGLRD
Sbjct  362  ALPFDMNRHVNMCQSIFGISPRPHWITTEYGGHDIKSVLGNFASNIIFSNGLRD  415



>gb|KCW50433.1| hypothetical protein EUGRSUZ_J00172, partial [Eucalyptus grandis]
Length=516

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 116/176 (66%), Gaps = 6/176 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P+GL+ LSR FK C+ L SS +LK+YL   Y+ AAQY+ P   PV  +C  I+GA
Sbjct  274  RVASEPHGLAKLSRTFKTCRPLESSSQLKEYLKLVYAEAAQYNDPLSRPVEVICNAINGA  333

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPT-----GTAIWGWSWQSCSEMAFPIGRGDGDTM  169
                 IL +IFAG+ +++ N +CY  P       T +     Q+CSE+ F +G    +TM
Sbjct  334  SPRNDILGKIFAGLASADRNSTCYVNPPPTPLPQTYLGCLGLQTCSEILF-VGSITNNTM  392

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F PAP  L +F  +C   FG+ PR HW++T+YGGQDIKLVL++F SNIIFSNGL+D
Sbjct  393  FQPAPSGLDKFVNSCKREFGIAPRQHWVSTHYGGQDIKLVLHRFASNIIFSNGLQD  448



>ref|XP_010034149.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=670

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 112/175 (64%), Gaps = 5/175 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P+GL+ LS+ FK C+ L SS +LK+YL   Y  AAQY+ P   PV  +C  I+GA
Sbjct  429  RVASEPHGLAKLSKTFKTCRPLESSSQLKEYLKSVYVEAAQYNDPFRRPVEVICNAINGA  488

Query  333  PKGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
                  L +IFAG+ AS+ N +CY      P      GW WQ+C+E+A  +     +TMF
Sbjct  489  SPRNDTLRKIFAGLAASDRNSTCYINPPPTPPSQTELGWHWQTCTEIA-ALWSITNNTMF  547

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             PAP  L +F   C   F + PR HW++TYYGGQDI+LVL++F SNIIFSNGL+D
Sbjct  548  QPAPSGLDKFVTRCKRDFIIAPRQHWVSTYYGGQDIELVLHRFASNIIFSNGLQD  602



>ref|XP_006369369.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
 gb|ERP65938.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
Length=435

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 108/154 (70%), Gaps = 6/154 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++ASKP+GLS+LS+KFK C  L  + ELKD+L   Y+ AAQY+ PP YPV EVC GIDG 
Sbjct  280  ELASKPDGLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGG  339

Query  333  PKGAHILDRIFAGVFASEGNQSCY----SIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
              G   L RIF G+ A  GN SCY    + P+ T + GW WQ CSEMA PIG G+ ++MF
Sbjct  340  GFGDDTLSRIFGGLVAYNGNLSCYVNAHTDPSETTV-GWQWQKCSEMAIPIGVGN-NSMF  397

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQ  64
             P PF+L+ + ++C +L+GVP RPHW+TTYYGG 
Sbjct  398  PPDPFDLKDYIEHCKSLYGVPTRPHWVTTYYGGH  431



>gb|KCW50728.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
Length=409

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A +PNG S LS  FK C+ L S  ELK+YL+  Y+ AAQYD PP YPVT +C GIDGA
Sbjct  256  RVAQEPNGTSNLSEMFKTCKPLESGDELKNYLMSLYAYAAQYDDPPRYPVTVICNGIDGA  315

Query  333  PKGAH-ILDRIFAGVFASEGNQSCYSIP---TGTAIWGWSWQSCSEMAFPIGRGDGDTMF  166
                + IL +IFAGV A +GN +CY  P         GW WQ CSEM  PIG  + ++MF
Sbjct  316  NTTENGILGKIFAGVVAYKGNSACYVNPPTNVSQTDLGWGWQRCSEMVMPIGITN-NSMF  374

Query  165  FPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQ  64
               PFNL  F   C + +GV PRPHWITTYYGG 
Sbjct  375  QSYPFNLSSFIDECNDQYGVTPRPHWITTYYGGH  408



>ref|XP_007016020.1| Serine carboxypeptidase S28 family protein, putative [Theobroma 
cacao]
 gb|EOY33639.1| Serine carboxypeptidase S28 family protein, putative [Theobroma 
cacao]
Length=465

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 108/177 (61%), Gaps = 8/177 (5%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+A +PNGL  L   F  C  L SS ELK YL   Y  +A+ D PP   V++ C  IDGA
Sbjct  219  KVAVQPNGLMNLRNIFNSCMPLYSSEELKSYLGFVYVFSARSDNPPYNSVSDACNAIDGA  278

Query  333  PKGAHILDRIFAGVFAS--EGNQSCYSI----PTGTAIWGWSWQSCSEMAFPIGRGDGDT  172
            P G  IL ++  G  AS      SC ++    P   +  GW WQ+C+E+  PIG G+  T
Sbjct  279  PAGTDILGKVVRGFNASFFGSGGSCNNVIEIKPNNGS--GWFWQTCTEIVMPIGHGENVT  336

Query  171  MFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            MF  +PF+L+ +++ C+ +FGV PRPHWI T +GG DIK VL  F SNIIFSNGLR+
Sbjct  337  MFQASPFDLENYTRTCLEIFGVSPRPHWIITEFGGHDIKYVLGNFASNIIFSNGLRN  393



>ref|XP_007155791.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
 gb|ESW27785.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
Length=444

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 104/180 (58%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            NGL  L++ F LCQ L S+ +L D+L   YS  A  + P         P +P+ EVC  I
Sbjct  261  NGLERLTKTFNLCQKLKSTVDLYDWLESAYSYLAMVNYPYPSDFLMTLPGHPIREVCKKI  320

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            DG P G +IL+RI+ GV   +   G + C+ +   P G +  GW WQ+C+EM  P+    
Sbjct  321  DGVPAGTNILERIYEGVNVYYNYTGKEKCFELDDDPHGMS--GWDWQACTEMVMPMSSNQ  378

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              +MF P  +N   F + C+N +GV PRP WITT +GG DI   L KFGSNIIFSNGL D
Sbjct  379  DSSMFPPYEYNYTSFQEECLNDYGVKPRPKWITTEFGGHDIHATLKKFGSNIIFSNGLLD  438



>gb|KDP32128.1| hypothetical protein JCGZ_12589 [Jatropha curcas]
Length=514

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 105/182 (58%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L+  F LC+ LNS+ EL ++L   YS  A  D P         P +P+ EVC 
Sbjct  267  KENGLVQLTETFHLCRKLNSTEELSNWLDSAYSYLAMVDYPYPSAFMMPLPGHPIREVCK  326

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDG+P G +IL+RIF GV   +   G+  C+ +   P G  + GW+WQ+C+EM  P+  
Sbjct  327  KIDGSPDGTNILERIFEGVSIYYNYTGDVDCFELDDDPHG--LDGWNWQACTEMVMPMAS  384

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
                +MF    FN   F + C+  FGV PRP WITT +GG DIK  L  FGSNIIFSNGL
Sbjct  385  SKDASMFLTYDFNYTSFKEECLKNFGVEPRPRWITTEFGGHDIKTALESFGSNIIFSNGL  444

Query  6    RD  1
             D
Sbjct  445  LD  446



>ref|XP_007155790.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
 gb|ESW27784.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
Length=506

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 104/180 (58%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            NGL  L++ F LCQ L S+ +L D+L   YS  A  + P         P +P+ EVC  I
Sbjct  261  NGLERLTKTFNLCQKLKSTVDLYDWLESAYSYLAMVNYPYPSDFLMTLPGHPIREVCKKI  320

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            DG P G +IL+RI+ GV   +   G + C+ +   P G +  GW WQ+C+EM  P+    
Sbjct  321  DGVPAGTNILERIYEGVNVYYNYTGKEKCFELDDDPHGMS--GWDWQACTEMVMPMSSNQ  378

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              +MF P  +N   F + C+N +GV PRP WITT +GG DI   L KFGSNIIFSNGL D
Sbjct  379  DSSMFPPYEYNYTSFQEECLNDYGVKPRPKWITTEFGGHDIHATLKKFGSNIIFSNGLLD  438



>gb|KDO78803.1| hypothetical protein CISIN_1g0096312mg, partial [Citrus sinensis]
 gb|KDO78804.1| hypothetical protein CISIN_1g0096312mg, partial [Citrus sinensis]
 gb|KDO78805.1| hypothetical protein CISIN_1g0096312mg, partial [Citrus sinensis]
Length=474

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 104/185 (56%), Gaps = 17/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTE  358
            +  K NGL  L++ F LC++LNS+ +L D+L   YS  A  D P         P YP+ E
Sbjct  270  VGQKENGLLELTKTFHLCRELNSTEDLADWLESAYSYLAMVDYPYPSDFMMPLPGYPIRE  329

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFP  196
            VC  ID AP    IL+RIF GV   +   GN  C+ +   P G    GW+WQ+C+EM  P
Sbjct  330  VCKKIDNAPDATSILERIFEGVSVYYNYTGNVDCFQLDDDPHGLD--GWNWQACTEMVMP  387

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +      +MF    +N   F + C N F V PRP WITT +GG DIK VL  FGSNIIFS
Sbjct  388  MSSSRDKSMFPAYDYNYSSFKEECWNDFNVIPRPRWITTEFGGHDIKSVLKLFGSNIIFS  447

Query  15   NGLRD  1
            NGL D
Sbjct  448  NGLLD  452



>ref|XP_010910623.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Elaeis guineensis]
Length=370

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 103/180 (57%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            + L  LSRKF LC+DLN++ EL ++L   YS  A  D P         P  P+ EVC  I
Sbjct  125  DNLVNLSRKFCLCRDLNNTTELSNWLSSAYSYLAMVDYPYPSDFLMPLPANPIKEVCTKI  184

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D  P G  +LDRIFAGV   +   G   C+ +   P G +  GW WQ+C+EM  P+    
Sbjct  185  DSYPDGTDLLDRIFAGVSVYYNYTGTVDCFDLEDDPHGMS--GWDWQACTEMVMPMSSSQ  242

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             ++MF    F+   +   C+  +GV PRP W+TT +GG DIK  LNKFGSNIIFSNGL D
Sbjct  243  ENSMFPAYNFSYAAYQDGCVQNYGVKPRPRWVTTEFGGHDIKTALNKFGSNIIFSNGLLD  302



>ref|XP_006466409.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=520

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 104/185 (56%), Gaps = 17/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTE  358
            +  K NGL  L++ F LC++LNS+ +L D+L   YS  A  D P         P YP+ E
Sbjct  270  VGQKENGLLELTKTFHLCRELNSTEDLADWLESAYSYLAMVDYPYPSDFMMPLPGYPIRE  329

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFP  196
            VC  ID AP    IL+RIF GV   +   GN  C+ +   P G    GW+WQ+C+EM  P
Sbjct  330  VCKKIDNAPDATSILERIFEGVSVYYNYTGNVDCFQLDDDPHGLD--GWNWQACTEMVMP  387

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +      +MF    +N   F + C N F V PRP WITT +GG DIK VL  FGSNIIFS
Sbjct  388  MSSSRDKSMFPAYDYNYSSFKEECWNDFNVIPRPRWITTEFGGHDIKSVLKLFGSNIIFS  447

Query  15   NGLRD  1
            NGL D
Sbjct  448  NGLLD  452



>ref|XP_004509045.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=508

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 106/189 (56%), Gaps = 20/189 (11%)
 Frame = -2

Query  513  KIASK---PNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEY  370
            +IASK    NGL +L++ FK CQ LN + +L D+L   YS  A  + P         P Y
Sbjct  254  EIASKGQTSNGLELLTKTFKFCQILNRTDDLLDWLESAYSYLAMVNYPYPSEFMMPLPGY  313

Query  369  PVTEVCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSE  208
            P+ EVC  IDG P G  IL+RI+ GV   +   G   C+ +   P G    GW+WQ+C+E
Sbjct  314  PIKEVCRRIDGGPDGTSILERIYEGVNVYYNYTGEAKCFELDDDPHGLD--GWNWQACTE  371

Query  207  MAFPIGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSN  28
            M  P+      +MF P  FN   F + C   FGV PRP WITT +GG +I   L KFGSN
Sbjct  372  MVMPMSSSQESSMFPPYEFNYLSFEEECFKNFGVKPRPKWITTEFGGHNIHAALKKFGSN  431

Query  27   IIFSNGLRD  1
            IIFSNGL D
Sbjct  432  IIFSNGLLD  440



>ref|XP_010254367.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Nelumbo 
nucifera]
Length=476

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 108/180 (60%), Gaps = 14/180 (8%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDL-NSSWELKDYLVGCYSIAAQYDTPP-EYPVTEVCGGID  340
            KIAS+ +GLS+LSR+F  C  L NSSW LKD L   Y+ AAQYD P     V  +C  ID
Sbjct  233  KIASQEDGLSVLSRRFNTCTPLENSSW-LKDALKLVYAAAAQYDAPQINQAVNLICTAID  291

Query  339  GAPKGAHILDRIFAGVFASEG-----NQSCYSIPTGTAIWGWSWQSCSEMAFPIGRGDGD  175
             A  G  +LD++ A +FA        ++ C  +      W W+WQ C+E+  P G    D
Sbjct  292  RATNGTDVLDKVIAAMFAFFSKYPGPHEYCDEMHQ----WAWNWQICTEILIPTGISGTD  347

Query  174  TMFFPAPFNLQQFSKNCINLFGVP--PRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            TMF   PFNL  + + C  L+ +   P P WIT+ +GGQD+KLVL +FGSNIIFSNGLRD
Sbjct  348  TMFQAEPFNLTSYKETCKGLYDLRLMPEPFWITSQFGGQDVKLVLGRFGSNIIFSNGLRD  407



>ref|XP_006426159.1| hypothetical protein CICLE_v10025375mg [Citrus clementina]
 gb|ESR39399.1| hypothetical protein CICLE_v10025375mg [Citrus clementina]
Length=517

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 104/185 (56%), Gaps = 17/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTE  358
            +  K NGL  L++ F LC++LNS+ +L D+L   YS  A  D P         P YP+ E
Sbjct  267  VGQKENGLLELTKTFHLCRELNSTEDLADWLESAYSYLAMVDYPYPSDFMMPLPGYPIRE  326

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFP  196
            VC  ID AP    IL+RIF GV   +   G+  C+ +   P G    GW+WQ+C+EM  P
Sbjct  327  VCKKIDNAPDATSILERIFEGVSVYYNYTGDVDCFQLDDDPHGLD--GWNWQACTEMVMP  384

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +      +MF    +N   F + C N F V PRP WITT +GG DIK VL  FGSNIIFS
Sbjct  385  MSSSRDKSMFPAYDYNYSSFKEECWNDFNVIPRPRWITTEFGGHDIKSVLKLFGSNIIFS  444

Query  15   NGLRD  1
            NGL D
Sbjct  445  NGLLD  449



>ref|XP_010683431.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 105/176 (60%), Gaps = 7/176 (4%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            KI S  +GL+ LS+KF  C  L  +  LK++L   Y   AQY      P T +C  ID  
Sbjct  262  KIGSSGDGLAYLSKKFNTCVHLADTSALKNFLQSLYDSTAQYGNLETNPST-ICKAIDEG  320

Query  333  PKGAHILDRIFAGV--FASEGNQSCYS---IPTGTAIWGWSWQSCSEMAFPIGRGDGDTM  169
             K   I+ RI+AGV  + +  +  C        G +I G+ WQ+CSEM  PIG     +M
Sbjct  321  MKTTDIVSRIYAGVLDYFNSTHHDCVDTNYFQIGESIVGYDWQTCSEMVMPIGTSKW-SM  379

Query  168  FFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F P PFNL+ F ++C N + V PRPHWIT+YYGG D+KL+  +FGSNIIFSNGL+D
Sbjct  380  FPPQPFNLRDFIQDCKNKYNVMPRPHWITSYYGGHDMKLIFGRFGSNIIFSNGLQD  435



>ref|XP_003549991.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN01721.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=513

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 99/180 (55%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            NGL +L++ F LCQ L  + +L D+    YS  A  + P         PE+P+ EVC  I
Sbjct  268  NGLELLTKTFNLCQKLKRTKDLYDWAEAAYSYLAMVNYPYPAEFMMTLPEHPIREVCRRI  327

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            DG P G  IL+RI+ GV   +   G   C+ +   P G +  GW WQ+C+EM  P+    
Sbjct  328  DGGPAGTSILERIYEGVNVYYNYTGEAKCFELDDDPHGMS--GWEWQACTEMVMPMSSSQ  385

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              +MF P  +N       C+  FGV PRP WITT +GG DI   L KFGSNIIFSNGL D
Sbjct  386  ESSMFPPYEYNYTSIQAECLKKFGVKPRPRWITTEFGGHDIHATLKKFGSNIIFSNGLLD  445



>ref|XP_001776094.1| predicted protein [Physcomitrella patens]
 gb|EDQ59139.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 113/188 (60%), Gaps = 17/188 (9%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVT  361
            KIASK  GL  LS +F +C+DLN+SWEL+++L   YS  A  D P         P YPV 
Sbjct  240  KIASKNGGLHDLSTQFHMCRDLNASWELENWLSSAYSYVAMVDYPIPTNFITPLPAYPVR  299

Query  360  EVCGGIDGAPKGAHILDRIFAGV---FASEGNQSCY--SIP--TGTAIWGWSWQ-SCSEM  205
            E+C  ID  P+G+ IL RIFAG    +   G   C+  S P      + GW WQ +C+EM
Sbjct  300  EICRVIDSLPEGSDILSRIFAGASVYYNYSGQAECFQPSDPGNDDLGVTGWDWQQACTEM  359

Query  204  AFPIGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNI  25
              P+     ++MF P  ++L+   + C+  +GV PRP+WITT YGG+DIK VL  FGSNI
Sbjct  360  IMPMSSNSSNSMFQPYDWDLEGNIQYCMKTYGVRPRPNWITTNYGGKDIKAVLKDFGSNI  419

Query  24   IFSNGLRD  1
            +FSNGL D
Sbjct  420  VFSNGLLD  427



>ref|XP_010943424.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Elaeis guineensis]
Length=509

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 103/180 (57%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            + L  LSRKF LC+DLN++ EL ++L   YS  A  D P         P  P+ EVC  I
Sbjct  264  DNLVNLSRKFCLCRDLNNTTELSNWLSSAYSYLAMVDYPYPSDFLMPLPANPIKEVCTKI  323

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D  P G  +LDRIFAGV   +   G   C+ +   P G +  GW WQ+C+EM  P+    
Sbjct  324  DSYPDGTDLLDRIFAGVSVYYNYTGTVDCFDLEDDPHGMS--GWDWQACTEMVMPMSSSQ  381

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             ++MF    F+   +   C+  +GV PRP W+TT +GG DIK  LNKFGSNIIFSNGL D
Sbjct  382  ENSMFPAYNFSYAAYQDGCVQNYGVKPRPRWVTTEFGGHDIKTALNKFGSNIIFSNGLLD  441



>ref|XP_009406760.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=498

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 104/180 (58%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            +GL  LSR F+LCQ+LN++ EL D+L   YS  A  D P         P  P+ EVC  I
Sbjct  253  DGLLKLSRDFRLCQNLNNTEELSDWLSSAYSYLAMVDYPYPSDFMMPLPANPIKEVCRKI  312

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D    G  +L+RIFAGV   +   GN  C+ +   P G +  GW+WQ+C+EM  P+    
Sbjct  313  DNYLDGTTVLERIFAGVSIYYNYTGNVDCFDLEDDPHGLS--GWNWQACTEMVMPMSSSQ  370

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             ++MF    F+   +   C+  +GV PRP WITT +GG DIK  L KFGSNIIFSNGL D
Sbjct  371  ENSMFPAYDFDYAAYQDQCLQDYGVRPRPRWITTEFGGHDIKTALKKFGSNIIFSNGLLD  430



>gb|KCW50734.1| hypothetical protein EUGRSUZ_J00406 [Eucalyptus grandis]
Length=454

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 103/172 (60%), Gaps = 5/172 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++AS+P GL+ LS  FK C  L SS ELK YL   Y    QY+ P   P+  +C  I+GA
Sbjct  265  RVASEPRGLTKLSNAFKTCSPLQSSSELKKYLKLLYVQVVQYNDPSAQPLKLMCDAINGA  324

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGTAIW---GWSWQSCSEMAFPIGRGDGDTMFF  163
            P    +L +IFAG+ A  GN +CY  P+G+      GW WQ+C+EMAFPIG    +TMF 
Sbjct  325  PPRKGLLQKIFAGLVAINGNLTCYVNPSGSDAQTPSGWFWQTCTEMAFPIGITR-NTMFP  383

Query  162  PAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
            P PFNL  FS  C + FGVP RP W+TTY+GG  +    N+    + FS+ L
Sbjct  384  PEPFNLNSFSNACKSEFGVPARPRWVTTYFGGH-VGHSANQINLAVFFSSLL  434



>emb|CDY45627.1| BnaCnng13350D [Brassica napus]
Length=506

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 103/182 (57%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  LS+ F  C+ LNS+ +L D+L   YS  A  D P         P +P+ EVC 
Sbjct  254  KENGLQQLSKTFHFCRALNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIKEVCR  313

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDGA   A IL+RI+AGV   +   G   C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  314  KIDGASSDASILERIYAGVSVYYNYTGKVGCFELDDDPHGLD--GWNWQACTEMVMPMSS  371

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
               ++MF    FN   + ++C N FGV PRP W+TT  GG DI+  L  FGSNIIFSNGL
Sbjct  372  SQENSMFTAYDFNYSSYKEDCWNTFGVNPRPRWVTTELGGHDIETALKSFGSNIIFSNGL  431

Query  6    RD  1
             D
Sbjct  432  LD  433



>emb|CDM83096.1| unnamed protein product [Triticum aestivum]
Length=515

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 105/180 (58%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            +GL  LS+ F LCQ LN++  L D+L   YS  A  D P         P  P+ EVC  I
Sbjct  260  DGLLKLSKTFHLCQTLNTTGALSDWLSSAYSYLAMVDYPMPSEFLMPLPASPIKEVCRNI  319

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D  P+G+ IL+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+   +
Sbjct  320  DKQPEGSSILERIYAGVNIYYNYTGTVDCFDLDDDPHGMG--GWDWQACTEMVMPMSSSE  377

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            G +MF P  F+ + ++ +C+  FGV PRP WI+T +GG +I  VL KFGSNIIF NGL D
Sbjct  378  GLSMFPPDEFDYELYADDCVKNFGVRPRPRWISTEFGGHNISSVLEKFGSNIIFFNGLLD  437



>ref|XP_010254368.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=508

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 110/187 (59%), Gaps = 17/187 (9%)
 Frame = -2

Query  513  KIAS---KPNGLSILSRKFKLC-QDLNSSWELKDYLV-GCYSIAAQYDTPPEYPVTEVCG  349
            K+AS   +  GLSIL  +FK C     +  ELK YL    Y+ AAQYD P    V  +C 
Sbjct  257  KVASSQPQGQGLSILHNRFKTCGVSFTNLSELKGYLTYSIYARAAQYDYP-RRSVDLICK  315

Query  348  GIDGAPKG--AHILDRIFAGVFASEGNQSCYS-IPTGTA--------IWGWSWQSCSEMA  202
             IDG PK     I+ +I AGV A +GN S  S +P+  A           W+WQ+C+EM 
Sbjct  316  AIDGTPKAGTTDIVGKIIAGVSAYKGNVSSKSNVPSALAPGNVQLNENTAWNWQTCTEMV  375

Query  201  FPIGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNII  22
             PIG G   T+F   PF+L    + C + +GV PRPHWITTY+GG DIK VL +FGSNII
Sbjct  376  MPIGGGINATLFPVPPFDLNSRIETCKSFYGVSPRPHWITTYFGGHDIKRVLKRFGSNII  435

Query  21   FSNGLRD  1
            FSNGLRD
Sbjct  436  FSNGLRD  442



>ref|XP_008798888.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Phoenix 
dactylifera]
Length=507

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 104/180 (58%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            + L  LSRKF+LC++LN++ EL ++L   YS  A  D P         P  P+ EVC  I
Sbjct  262  DNLVNLSRKFRLCRELNNTAELSNWLSSAYSYLAMVDYPYPSDFLMPLPANPIKEVCRKI  321

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D  P G  +LDRIFAGV   +   G   C+ +   P G +  GW WQ+C+EM  P+    
Sbjct  322  DSYPDGTDLLDRIFAGVSIYYNYTGTVDCFDLEDDPHGMS--GWGWQACTEMVMPMSSSQ  379

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             ++MF    F+   +   C++ +GV PRP W+TT +GG DIK  L +FGSNIIFSNGL D
Sbjct  380  ENSMFPTYNFSYAAYQDECVHNYGVRPRPRWVTTEFGGHDIKTALKEFGSNIIFSNGLLD  439



>ref|XP_002310325.2| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
 gb|EEE90775.2| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
Length=515

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 102/182 (56%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F LC++L S+ +L ++L   YS  A  D P         P YP+ EVC 
Sbjct  268  KKNGLVQLTKTFHLCRELKSTEDLANWLDSAYSYLAMVDYPYPSSFMMPLPGYPIGEVCK  327

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDG P G  IL+RIF G+   +   G   C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  328  RIDGCPDGTSILERIFEGISIYYNYTGELHCFELDDDPHGLD--GWNWQACTEMVMPMSS  385

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
                +MF    FN   + + C   FGV PRP WITT +GGQDIK  L  FGSNIIFSNGL
Sbjct  386  SHNASMFPTYDFNYSSYQEGCWEEFGVIPRPRWITTEFGGQDIKTALETFGSNIIFSNGL  445

Query  6    RD  1
             D
Sbjct  446  LD  447



>ref|XP_006380821.1| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
 gb|ERP58618.1| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
Length=463

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 102/182 (56%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F LC++L S+ +L ++L   YS  A  D P         P YP+ EVC 
Sbjct  268  KKNGLVQLTKTFHLCRELKSTEDLANWLDSAYSYLAMVDYPYPSSFMMPLPGYPIGEVCK  327

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDG P G  IL+RIF G+   +   G   C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  328  RIDGCPDGTSILERIFEGISIYYNYTGELHCFELDDDPHGLD--GWNWQACTEMVMPMSS  385

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
                +MF    FN   + + C   FGV PRP WITT +GGQDIK  L  FGSNIIFSNGL
Sbjct  386  SHNASMFPTYDFNYSSYQEGCWEEFGVIPRPRWITTEFGGQDIKTALETFGSNIIFSNGL  445

Query  6    RD  1
             D
Sbjct  446  LD  447



>ref|XP_006408697.1| hypothetical protein EUTSA_v10002179mg, partial [Eutrema salsugineum]
 gb|ESQ50150.1| hypothetical protein EUTSA_v10002179mg, partial [Eutrema salsugineum]
Length=418

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 101/165 (61%), Gaps = 18/165 (11%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++A+KPNGL ILS+KFK C  LN S ++KD+L   Y+ A QY+      VT +C  I+  
Sbjct  257  RVAAKPNGLLILSQKFKTCSPLNESSDIKDFLGTIYAEAVQYNRDW---VTNMCNAINAD  313

Query  333  P--KGAHILDRIFAGVFASEGNQSCYSI-----PTGTAI-W-------GWSWQSCSEMAF  199
            P  +   +LDRIFAGV A + NQ+CY       PT   I W        WSWQSC+E+  
Sbjct  314  PPNRKNDLLDRIFAGVVALKRNQTCYGTNMLLQPTKNNIAWNEKNNHIAWSWQSCTEIVM  373

Query  198  PIGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQ  64
            PIG    DTMF PAP+N+  F + C + +GVPPRPHWI TY+G Q
Sbjct  374  PIGYDKQDTMFQPAPYNMSSFIEGCQSYYGVPPRPHWIMTYFGIQ  418



>ref|XP_010254366.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Nelumbo 
nucifera]
Length=478

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 108/182 (59%), Gaps = 16/182 (9%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDL-NSSWELKDYLVGCYSIAAQYDTPP-EYPVTEVCGGID  340
            KIAS+ +GLS+LSR+F  C  L NSSW LKD L   Y+ AAQYD P     V  +C  ID
Sbjct  233  KIASQEDGLSVLSRRFNTCTPLENSSW-LKDALKLVYAAAAQYDAPQINQAVNLICTAID  291

Query  339  GAPKGAHILDRIFAGVFASEG-----NQSCYSIPTGTAIWGWSWQSCSEMAFPIGRGDGD  175
             A  G  +LD++ A +FA        ++ C  +      W W+WQ C+E+  P G    D
Sbjct  292  RATNGTDVLDKVIAAMFAFFSKYPGPHEYCDEMHQ----WAWNWQICTEILIPTGISGTD  347

Query  174  TMFFPAPFNLQQFSKNCINLFGVP--PRPHWITTYYGG--QDIKLVLNKFGSNIIFSNGL  7
            TMF   PFNL  + + C  L+ +   P P WIT+ +GG  QD+KLVL +FGSNIIFSNGL
Sbjct  348  TMFQAEPFNLTSYKETCKGLYDLRLMPEPFWITSQFGGQQQDVKLVLGRFGSNIIFSNGL  407

Query  6    RD  1
            RD
Sbjct  408  RD  409



>ref|XP_010932236.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Elaeis 
guineensis]
Length=400

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 109/185 (59%), Gaps = 16/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTE  358
            +A++  G+  LS+ F+ C+ L S + ++D+L   +   A  D P         P YP+ E
Sbjct  153  VAAQKGGMLELSKTFRACKSLQSVYSVRDWLWTAFVYTAMVDYPTASNFLMPLPAYPIKE  212

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFP  196
            +C  IDG P+GA  L ++F+     +   G+QSC+ I  GT    + GW WQ+C+EM  P
Sbjct  213  MCRIIDGFPQGASKLTKVFSAASLYYNYSGDQSCFDIENGTDPHGLHGWDWQACTEMVMP  272

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +   + ++MF  + ++  +F   C+  +GV PRPHWITT YGG  I  VL +FGSNIIFS
Sbjct  273  MICSN-ESMFPSSSYDYDEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLKRFGSNIIFS  331

Query  15   NGLRD  1
            NG+RD
Sbjct  332  NGMRD  336



>ref|XP_004293172.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=522

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 107/185 (58%), Gaps = 15/185 (8%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNS--SWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGID-  340
            +  + NGL +L+ KF+ C+ L      ELK YL   Y  A+QYD PP YPV+++C  I+ 
Sbjct  269  VLDQDNGLDMLTEKFRTCEPLEDGDELELKTYLENLYITASQYDDPPTYPVSQICNSIEE  328

Query  339  GAPKGAHILDRIFAGV----FASEGNQSCYSI-----PTGTAIWG--WSWQSCSEMAFPI  193
             A +G   +DRI + V       E +  C  +     P+   + G  W WQ+C+E+  PI
Sbjct  329  AAARGDDTIDRIASAVNNLTRPGENSGRCLELSSELRPSDDTVNGLNWLWQACTELLMPI  388

Query  192  GRGDGDTMFFPAPFNLQQFSKNCINLF-GVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            GR   +TMF   PF++  +S+ C  L+ G   RP+WITTYYGG  I++ L KF SNIIFS
Sbjct  389  GRETNETMFQAEPFDVDSYSRMCRQLYQGSRLRPNWITTYYGGHHIRMTLEKFASNIIFS  448

Query  15   NGLRD  1
            NG RD
Sbjct  449  NGRRD  453



>gb|EMT33353.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=347

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 103/180 (57%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            +GL  LS+   LCQ LN++  L D+L   YS  A  D P         P  P+ EVC  I
Sbjct  110  DGLLKLSKTLHLCQTLNTTGALSDWLNSAYSYLAMVDYPMPSEFLMPLPANPIKEVCRNI  169

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D  P+G+ IL+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+   +
Sbjct  170  DKQPEGSSILERIYAGVNIYYNYTGTVDCFDLDDDPHGMG--GWDWQACTEMVMPMSSSE  227

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            G +MF P  F+   ++ +C+  FGV PRP WI+T +GG +I  VL KFGSNIIF NGL D
Sbjct  228  GLSMFPPDEFDYALYADDCVKNFGVRPRPRWISTEFGGHNISSVLEKFGSNIIFFNGLLD  287



>ref|XP_011031335.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Populus euphratica]
Length=515

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 101/182 (55%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F LC++L S+ +L ++L   YS  A  D P         P YP+ EVC 
Sbjct  268  KKNGLVQLTKTFHLCRELKSTEDLANWLDSAYSYLAMVDYPYPSSFMMPLPGYPIREVCK  327

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDG P G  IL+RIF G+   +   G   C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  328  RIDGCPDGTSILERIFEGISIYYNYTGELHCFELDDDPHGLD--GWNWQACTEMVMPMSS  385

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
                +MF    FN   + + C   FGV PRP WIT  +GGQDIK  L  FGSNIIFSNGL
Sbjct  386  SHDASMFSTYDFNYSSYQEGCWEEFGVIPRPRWITMEFGGQDIKTALETFGSNIIFSNGL  445

Query  6    RD  1
             D
Sbjct  446  LD  447



>ref|XP_006280309.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
 gb|EOA13207.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
Length=518

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 103/182 (57%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F  C+ LNS+ +L D+L   YS  A  D P         P  P+ EVC 
Sbjct  266  KENGLQQLTKTFHFCRVLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGDPIREVCR  325

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDGA   A +LDRI+AGV   +   GN  C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  326  KIDGANSDATVLDRIYAGVSVYYNYTGNIDCFELDDDPHGLD--GWNWQACTEMVMPMSS  383

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
              G++MF    FN   + + C N F V PRP W+TT +GG DI+  L  FGSNIIFSNGL
Sbjct  384  SQGNSMFPADDFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIETTLKLFGSNIIFSNGL  443

Query  6    RD  1
             D
Sbjct  444  LD  445



>ref|XP_004970093.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=565

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 103/180 (57%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            +GL  LS+ F LCQ L +S +L D+L   YS  A  D P         P  P+ EVC  I
Sbjct  311  DGLLKLSKTFHLCQTLKTSGDLSDWLSSAYSYLAMVDYPIPSEFLMPLPANPIKEVCRNI  370

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D  P+G  IL+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+   +
Sbjct  371  DSQPEGTSILERIYAGVNVYYNYTGTVGCFDLNDDPHGMG--GWDWQACTEMVMPMSYSE  428

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              +M+ P  F+   +++NCI  +GV PRP WITT +GG +I  VL KFGSNIIF NGL D
Sbjct  429  DRSMYPPYKFDYASYAENCIKSYGVRPRPRWITTNFGGHNITTVLEKFGSNIIFFNGLLD  488



>gb|EMS49104.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=614

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 104/180 (58%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            +GL  LS+ F LCQ LN++  L D+L   YS  A  D P         P  P+ EVC  I
Sbjct  110  DGLLKLSKTFHLCQTLNTTGALSDWLSSAYSYLAMVDYPMPSEFLMPLPANPIKEVCRNI  169

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D  P+G+ IL+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+   +
Sbjct  170  DKQPEGSSILERIYAGVNIYYNYTGTVDCFDLDDDPHGMG--GWDWQACTEMVMPMSSSE  227

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            G +MF P  F+   ++ +C+  FGV PRP WI+T +GG +I  VL KFGSNIIF NGL D
Sbjct  228  GLSMFLPDEFDYALYADDCVKNFGVRPRPRWISTEFGGHNISSVLEKFGSNIIFFNGLLD  287



>ref|XP_010023346.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=528

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 102/182 (56%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGLS L++ F+LC++L ++ EL ++L   YS  A  D P         P YP+ EVC 
Sbjct  270  KENGLSKLTKMFRLCRELKNTEELANWLDSAYSFLAMVDYPYPSEFLMPLPGYPIREVCR  329

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDG P G  IL+R+F GV   +   G   C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  330  KIDGCPDGTSILERVFEGVSVYYNYTGEVDCFELDDDPHGMD--GWNWQACTEMVMPMSS  387

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
                +MF    FN   F + C   F V PRP WITT++GG+DI   L  FGSNIIFSNG 
Sbjct  388  SPDASMFPTYDFNFSAFQEECWTDFKVIPRPTWITTHFGGKDIMTTLKTFGSNIIFSNGF  447

Query  6    RD  1
             D
Sbjct  448  LD  449



>ref|XP_006436573.1| hypothetical protein CICLE_v10033642mg, partial [Citrus clementina]
 gb|ESR49813.1| hypothetical protein CICLE_v10033642mg, partial [Citrus clementina]
Length=280

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 101/172 (59%), Gaps = 18/172 (10%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQD-LNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDG  337
            K A++ NGL+ LS+KFK C+  L    ELKDYL   Y+ AAQYD P EYPV++ C GI G
Sbjct  47   KTAARKNGLAFLSKKFKTCKKPLKDVSELKDYLECMYTGAAQYDDPQEYPVSKACEGIHG  106

Query  336  APKGAHILDRIFAGVFASEGNQSCYSIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFFPA  157
            A +G   L RIF+G+ A     SC+              +CSEM   IG    +T+F   
Sbjct  107  ASEGTDTLGRIFSGIVALRWENSCH-------------DTCSEMVSSIGIEKNNTIFKQT  153

Query  156  PFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
                 ++  +C   +GV P PHWITTYYG   I++V+ +FGS++IFSNG RD
Sbjct  154  I----EYMNSCNKSYGVAPIPHWITTYYGSHGIRVVVKRFGSSLIFSNGFRD  201



>ref|NP_001136852.1| uncharacterized protein LOC100217003 [Zea mays]
 gb|ACF82763.1| unknown [Zea mays]
Length=319

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 104/184 (57%), Gaps = 17/184 (9%)
 Frame = -2

Query  507  ASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEV  355
            A++ +GL  LS+ F LCQ L +S +L D+L   YS  A  D P         P  P+ EV
Sbjct  61   ANEQDGLLKLSKTFHLCQTLKTSGDLSDWLSSAYSYLAMVDYPLPSEFLMPLPANPIKEV  120

Query  354  CGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPI  193
            C  ID  PKG   L+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+
Sbjct  121  CRNIDSQPKGTGTLERIYAGVNVYYNYTGTVDCFDLNDDPHGMG--GWDWQACTEMVMPM  178

Query  192  GRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSN  13
               +  +M+ P  F+   ++++CI  +GV PRP WITT +GG +I  VL  FGSNIIF N
Sbjct  179  SYSEQRSMYPPYKFDYASYAEDCIKSYGVRPRPKWITTEFGGHNITKVLENFGSNIIFFN  238

Query  12   GLRD  1
            GL D
Sbjct  239  GLLD  242



>ref|XP_009150668.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=506

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 102/182 (56%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  LS+ F  C+ LNS+ +L D+L   YS  A  D P         P +P+ EVC 
Sbjct  254  KANGLQQLSKTFHFCRALNSTNDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIKEVCR  313

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDGA   A IL+RI+AGV   +   G   C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  314  KIDGASSDASILERIYAGVSVYYNYTGKVGCFELDDDPHGLD--GWNWQACTEMVMPMSS  371

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
               ++MF    FN   + ++C N F V PRP W+TT  GG DI+  L  FGSNIIFSNGL
Sbjct  372  SQKNSMFTAYDFNYSSYKEDCWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGL  431

Query  6    RD  1
             D
Sbjct  432  LD  433



>emb|CDY08753.1| BnaA06g24710D [Brassica napus]
Length=506

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 102/182 (56%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  LS+ F  C+ LNS+ +L D+L   YS  A  D P         P +P+ EVC 
Sbjct  254  KANGLQQLSKTFHFCRALNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIKEVCR  313

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDGA   A IL+RI+AGV   +   G   C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  314  KIDGASSDASILERIYAGVSVYYNYTGKVGCFELDDDPHGLD--GWNWQACTEMVMPMSS  371

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
               ++MF    FN   + ++C N F V PRP W+TT  GG DI+  L  FGSNIIFSNGL
Sbjct  372  SQKNSMFTAYDFNYSSYKEDCWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGL  431

Query  6    RD  1
             D
Sbjct  432  LD  433



>gb|AIA26578.1| serine protease [Cicer arietinum]
Length=379

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 104/189 (55%), Gaps = 24/189 (13%)
 Frame = -2

Query  513  KIASK---PNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEY  370
            +IASK    NGL +L++ FK CQ    + +L D+L   YS  A  + P         P Y
Sbjct  129  EIASKGQTSNGLELLTKTFKFCQ----TDDLLDWLESAYSYLAMVNYPYPSEFMMPLPGY  184

Query  369  PVTEVCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSE  208
            P+ EVC  IDG P G  IL+RI+ GV   +   G   C+ +   P G    GW+WQ+C+E
Sbjct  185  PIKEVCRRIDGGPDGTSILERIYEGVNVYYNYTGEAKCFELDDDPHGLD--GWNWQACTE  242

Query  207  MAFPIGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSN  28
            M  P+      +MF P  FN   F + C   FGV PRP WITT +GG +I   L KFGSN
Sbjct  243  MVMPMSSSQESSMFPPYEFNYLSFEEECFKNFGVKPRPKWITTEFGGHNIHAALKKFGSN  302

Query  27   IIFSNGLRD  1
            IIFSNGL D
Sbjct  303  IIFSNGLLD  311



>gb|KFK28424.1| hypothetical protein AALP_AA8G512800 [Arabis alpina]
Length=513

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 101/182 (55%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L+  F+ C+ LNS+ +L D+L   YS  A  D P         P +P+ EVC 
Sbjct  261  KENGLMQLTETFRFCRLLNSTDDLSDWLDSAYSYLAMVDYPYSADFMMPLPGHPIKEVCR  320

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             ID AP  A ILDRI+AG+   +   G+  C+ +   P G    GW WQ+C+EM  P+  
Sbjct  321  KIDSAPSDASILDRIYAGISVYYNYTGDVDCFKLDDDPHGLD--GWDWQACTEMVMPMSS  378

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
               ++MF    FN   + + C N F V PRP W+TT  GG DI+  L  FGSNIIFSNGL
Sbjct  379  SQENSMFPADDFNYSSYKEECWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGL  438

Query  6    RD  1
             D
Sbjct  439  LD  440



>ref|XP_006424409.1| hypothetical protein CICLE_v10030113mg [Citrus clementina]
 gb|ESR37649.1| hypothetical protein CICLE_v10030113mg [Citrus clementina]
Length=521

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 106/191 (55%), Gaps = 21/191 (11%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            ++   P+G SILSR+FK C  L +  EL+D L G Y+  +QY  PPE P+ + C  +D A
Sbjct  257  RVGELPDGASILSRQFKTCTPLRNENELRDALAGMYASTSQYGRPPENPIEKFCSAVDRA  316

Query  333  PK-GAHILDRIFAGVFASEGNQSCY-SIPTGTAIW--GWSWQSCSEMAFPIGRGDGDTMF  166
               G   L +I A VFA +G++ CY + P        GW WQSCSEM  P+   D  TM 
Sbjct  317  TACGNDSLCKIAAAVFAQKGDRPCYINKPKNRTETDEGWPWQSCSEMVVPMSI-DEKTML  375

Query  165  FPAP-FNLQQFSKNCINLFGVPPRPHWITTYYGG---------------QDIKLVLNKFG  34
             P   FNL +    C   +GVPPRP+WITTYYGG               QDIKL L +  
Sbjct  376  RPVNLFNLTEVIDQCQQEYGVPPRPNWITTYYGGHLIINFGLLHFCEKLQDIKLTLQRST  435

Query  33   SNIIFSNGLRD  1
             NIIFSNGLRD
Sbjct  436  GNIIFSNGLRD  446



>ref|XP_002864979.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41238.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=514

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 102/182 (56%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F  C+ LNS+ +L D+L   YS  A  D P         P +P+ EVC 
Sbjct  262  KENGLLQLTKTFHFCRVLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIREVCR  321

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDGA   A ILDRIFAG+   +   GN  C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  322  KIDGAHSDASILDRIFAGISVYYNYTGNVDCFKLDDDPHGLD--GWNWQACTEMVMPMSS  379

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
                +MF    FN   + + C N F V PRP W+TT +GG DI+  L  FGSNIIFSNG+
Sbjct  380  NQEKSMFPAYDFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIETTLKLFGSNIIFSNGM  439

Query  6    RD  1
             D
Sbjct  440  LD  441



>ref|XP_010932235.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Elaeis 
guineensis]
Length=525

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 109/185 (59%), Gaps = 16/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTE  358
            +A++  G+  LS+ F+ C+ L S + ++D+L   +   A  D P         P YP+ E
Sbjct  278  VAAQKGGMLELSKTFRACKSLQSVYSVRDWLWTAFVYTAMVDYPTASNFLMPLPAYPIKE  337

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFP  196
            +C  IDG P+GA  L ++F+     +   G+QSC+ I  GT    + GW WQ+C+EM  P
Sbjct  338  MCRIIDGFPQGASKLTKVFSAASLYYNYSGDQSCFDIENGTDPHGLHGWDWQACTEMVMP  397

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +   + ++MF  + ++  +F   C+  +GV PRPHWITT YGG  I  VL +FGSNIIFS
Sbjct  398  MICSN-ESMFPSSSYDYDEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLKRFGSNIIFS  456

Query  15   NGLRD  1
            NG+RD
Sbjct  457  NGMRD  461



>ref|NP_001044360.1| Os01g0767100 [Oryza sativa Japonica Group]
 dbj|BAD53352.1| putative prolylcarboxypeptidase, isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAD53324.1| putative prolylcarboxypeptidase, isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF06274.1| Os01g0767100 [Oryza sativa Japonica Group]
Length=517

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 103/180 (57%), Gaps = 18/180 (10%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            +GL  LS+ F LC+ + ++ EL D+L   YS  A  D P         P  P+ E+C  I
Sbjct  260  DGLLKLSKTFHLCKTIKNTGELSDWLSSAYSYLAMVDYPMPADFMMPLPGNPIKELCTKI  319

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D  P G  IL+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+   +
Sbjct  320  DNQPDGTSILERIYAGVNVYYNYTGTVDCFDLNDDPHGMD--GWDWQACTEMVMPMSYSE  377

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             D+MF    FN   + K+CIN FGV PRP WITT +GG +I LVL +FGSNIIF NGL D
Sbjct  378  -DSMFPADKFNYTSYEKDCINSFGVEPRPQWITTEFGGHNISLVLERFGSNIIFFNGLLD  436



>ref|XP_010444594.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=509

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 102/182 (56%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F  C+ LNS+ +L D+L   YS  A  D P         P +P+ EVC 
Sbjct  257  KENGLQQLTKTFHFCRVLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIREVCR  316

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDGA   A ILDRI+AGV   +   GN  C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  317  KIDGANSDASILDRIYAGVSVYYNYTGNVDCFELDDDPHGLD--GWNWQACTEMVMPMSS  374

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
               ++MF    FN   + + C + F V PRP W TT +GG DI+  L  FGSNIIFSNGL
Sbjct  375  SQENSMFPADDFNYSSYKEECWDTFRVNPRPKWATTEFGGHDIETTLKSFGSNIIFSNGL  434

Query  6    RD  1
             D
Sbjct  435  LD  436



>gb|EAY75958.1| hypothetical protein OsI_03875 [Oryza sativa Indica Group]
Length=549

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 103/180 (57%), Gaps = 18/180 (10%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            +GL  LS+ F LC+ + ++ EL D+L   YS  A  D P         P  P+ E+C  I
Sbjct  292  DGLLKLSKTFHLCKTIKNTGELSDWLSSAYSYLAMVDYPMPADFMMPLPGNPIKELCTKI  351

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D  P G  IL+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+   +
Sbjct  352  DNQPDGTSILERIYAGVNVYYNYTGTVDCFDLNDDPHGMD--GWDWQACTEMVMPMSYSE  409

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             D+MF    FN   + K+CIN FGV PRP WITT +GG +I LVL +FGSNIIF NGL D
Sbjct  410  -DSMFPADKFNYTSYEKDCINSFGVEPRPQWITTEFGGHNISLVLERFGSNIIFFNGLLD  468



>gb|EAZ13666.1| hypothetical protein OsJ_03583 [Oryza sativa Japonica Group]
Length=549

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 103/180 (57%), Gaps = 18/180 (10%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            +GL  LS+ F LC+ + ++ EL D+L   YS  A  D P         P  P+ E+C  I
Sbjct  292  DGLLKLSKTFHLCKTIKNTGELSDWLSSAYSYLAMVDYPMPADFMMPLPGNPIKELCTKI  351

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D  P G  IL+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+   +
Sbjct  352  DNQPDGTSILERIYAGVNVYYNYTGTVDCFDLNDDPHGMD--GWDWQACTEMVMPMSYSE  409

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             D+MF    FN   + K+CIN FGV PRP WITT +GG +I LVL +FGSNIIF NGL D
Sbjct  410  -DSMFPADKFNYTSYEKDCINSFGVEPRPQWITTEFGGHNISLVLERFGSNIIFFNGLLD  468



>ref|XP_009390988.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Musa acuminata subsp. 
malaccensis]
Length=506

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 107/185 (58%), Gaps = 16/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTE  358
            + +K  G+  L++ F+ C+ L S + ++D+L   +   A  D P         P YPV E
Sbjct  259  VGAKKGGMLELTKTFRACKKLQSVYSVRDWLWTAFVYTAMIDYPTPANFLMPLPAYPVKE  318

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFP  196
            +C  IDG P G  IL ++F+     +      SC+ I  G+    + GW WQ+C+EM  P
Sbjct  319  MCRIIDGFPAGEDILIKVFSAASLYYNYSSTNSCFDIENGSDPHGLHGWDWQACTEMVMP  378

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +   + ++MF P+ ++ ++F   C+  + V PRPHWITT YGG  I+LVL +FGSNIIFS
Sbjct  379  MTSSN-ESMFPPSTYDYKEFGDQCMTKYEVRPRPHWITTEYGGNKIELVLKRFGSNIIFS  437

Query  15   NGLRD  1
            NG+RD
Sbjct  438  NGMRD  442



>ref|XP_006393989.1| hypothetical protein EUTSA_v10003988mg [Eutrema salsugineum]
 gb|ESQ31275.1| hypothetical protein EUTSA_v10003988mg [Eutrema salsugineum]
Length=526

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 102/182 (56%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F  C+ LNS+ +L D+L   YS  A  + P         P +P+ EVC 
Sbjct  274  KENGLQQLAKTFHFCRVLNSTDDLSDWLDSAYSYLAMVNYPYPANFMMPLPGHPIKEVCR  333

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDGA   A ILDRIFAG+   +   G+  C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  334  KIDGASSDASILDRIFAGISVYYNYTGDVDCFELDDDPHGLD--GWNWQACTEMVMPMSS  391

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
             + ++MF    FN   +   C N F V PRP W+TT  GG DI+  L  FGSNIIFSNGL
Sbjct  392  SEENSMFPAYAFNYSSYKDECWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGL  451

Query  6    RD  1
             D
Sbjct  452  LD  453



>dbj|BAB10683.1| lysosomal Pro-X carboxypeptidase [Arabidopsis thaliana]
Length=529

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 102/182 (56%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F  C+ LNS+ +L D+L   YS  A  D P         P +P+ EVC 
Sbjct  277  KENGLLQLTKTFHFCRVLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIREVCR  336

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDGA   A ILDRI+AG+   +   GN  C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  337  KIDGAGSNASILDRIYAGISVYYNYTGNVDCFKLDDDPHGLD--GWNWQACTEMVMPMSS  394

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
               ++MF    FN   + + C N F V PRP W+TT +GG DI   L  FGSNIIFSNGL
Sbjct  395  NQENSMFPGYGFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIATTLKSFGSNIIFSNGL  454

Query  6    RD  1
             D
Sbjct  455  LD  456



>ref|NP_201377.2| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 gb|ABF57288.1| At5g65760 [Arabidopsis thaliana]
 dbj|BAF00060.1| lysosomal Pro-X carboxypeptidase [Arabidopsis thaliana]
 gb|AED98102.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=515

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 102/182 (56%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F  C+ LNS+ +L D+L   YS  A  D P         P +P+ EVC 
Sbjct  263  KENGLLQLTKTFHFCRVLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIREVCR  322

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDGA   A ILDRI+AG+   +   GN  C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  323  KIDGAGSNASILDRIYAGISVYYNYTGNVDCFKLDDDPHGLD--GWNWQACTEMVMPMSS  380

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
               ++MF    FN   + + C N F V PRP W+TT +GG DI   L  FGSNIIFSNGL
Sbjct  381  NQENSMFPGYGFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIATTLKSFGSNIIFSNGL  440

Query  6    RD  1
             D
Sbjct  441  LD  442



>gb|AAL77662.1| AT5g65760/MPA24_11 [Arabidopsis thaliana]
Length=491

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 102/182 (56%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F  C+ LNS+ +L D+L   YS  A  D P         P +P+ EVC 
Sbjct  263  KENGLLQLTKTFHFCRVLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIREVCR  322

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDGA   A ILDRI+AG+   +   GN  C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  323  KIDGAGSNASILDRIYAGISVYYNYTGNVDCFKLDDDPHGLD--GWNWQACTEMVMPMSS  380

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
               ++MF    FN   + + C N F V PRP W+TT +GG DI   L  FGSNIIFSNGL
Sbjct  381  NQENSMFPGYGFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIATTLKSFGSNIIFSNGL  440

Query  6    RD  1
             D
Sbjct  441  LD  442



>ref|XP_009406759.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=500

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 104/182 (57%), Gaps = 19/182 (10%)
 Frame = -2

Query  495  NGLSILSRKFKLC--QDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            +GL  LSR F+LC  ++LN++ EL D+L   YS  A  D P         P  P+ EVC 
Sbjct  253  DGLLKLSRDFRLCHHRNLNNTEELSDWLSSAYSYLAMVDYPYPSDFMMPLPANPIKEVCR  312

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             ID    G  +L+RIFAGV   +   GN  C+ +   P G +  GW+WQ+C+EM  P+  
Sbjct  313  KIDNYLDGTTVLERIFAGVSIYYNYTGNVDCFDLEDDPHGLS--GWNWQACTEMVMPMSS  370

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
               ++MF    F+   +   C+  +GV PRP WITT +GG DIK  L KFGSNIIFSNGL
Sbjct  371  SQENSMFPAYDFDYAAYQDQCLQDYGVRPRPRWITTEFGGHDIKTALKKFGSNIIFSNGL  430

Query  6    RD  1
             D
Sbjct  431  LD  432



>ref|XP_010463531.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=505

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 101/182 (55%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F  C+ LNS+ +L D+L   YS  A  D P         P +P+ EVC 
Sbjct  253  KENGLQQLTKTFHFCRLLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIREVCR  312

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDGA   A ILDRI+AGV   +   GN  C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  313  KIDGANSDASILDRIYAGVSVYYNYTGNVDCFELDDDPHGLD--GWNWQACTEMVMPMSS  370

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
               ++MF    FN   + + C   F V PRP W TT +GG DI+  L  FGSNIIFSNGL
Sbjct  371  SQENSMFPADGFNYSSYKEECWKTFRVNPRPKWATTEFGGHDIETTLKSFGSNIIFSNGL  430

Query  6    RD  1
             D
Sbjct  431  LD  432



>ref|XP_008654499.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654500.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654501.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654502.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654503.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654504.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654505.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 gb|AFW84964.1| putative serine peptidase S28 family protein [Zea mays]
Length=517

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 104/184 (57%), Gaps = 17/184 (9%)
 Frame = -2

Query  507  ASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEV  355
            A++ +GL  LS+ F LCQ L +S +L D+L   YS  A  D P         P  P+ EV
Sbjct  259  ANEQDGLLKLSKTFHLCQTLKTSGDLSDWLSSAYSYLAMVDYPLPSEFLMPLPANPIKEV  318

Query  354  CGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPI  193
            C  ID  PKG   L+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+
Sbjct  319  CRNIDSQPKGTGTLERIYAGVNVYYNYTGTVDCFDLNDDPHGMG--GWDWQACTEMVMPM  376

Query  192  GRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSN  13
               +  +M+ P  F+   ++++CI  +GV PRP WITT +GG +I  VL  FGSNIIF N
Sbjct  377  SYSEQRSMYPPYKFDYASYAEDCIKSYGVRPRPKWITTEFGGHNITKVLENFGSNIIFFN  436

Query  12   GLRD  1
            GL D
Sbjct  437  GLLD  440



>gb|AFW84965.1| putative serine peptidase S28 family protein [Zea mays]
Length=515

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 104/184 (57%), Gaps = 17/184 (9%)
 Frame = -2

Query  507  ASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEV  355
            A++ +GL  LS+ F LCQ L +S +L D+L   YS  A  D P         P  P+ EV
Sbjct  257  ANEQDGLLKLSKTFHLCQTLKTSGDLSDWLSSAYSYLAMVDYPLPSEFLMPLPANPIKEV  316

Query  354  CGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPI  193
            C  ID  PKG   L+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+
Sbjct  317  CRNIDSQPKGTGTLERIYAGVNVYYNYTGTVDCFDLNDDPHGMG--GWDWQACTEMVMPM  374

Query  192  GRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSN  13
               +  +M+ P  F+   ++++CI  +GV PRP WITT +GG +I  VL  FGSNIIF N
Sbjct  375  SYSEQRSMYPPYKFDYASYAEDCIKSYGVRPRPKWITTEFGGHNITKVLENFGSNIIFFN  434

Query  12   GLRD  1
            GL D
Sbjct  435  GLLD  438



>ref|XP_002458558.1| hypothetical protein SORBIDRAFT_03g035680 [Sorghum bicolor]
 gb|EES03678.1| hypothetical protein SORBIDRAFT_03g035680 [Sorghum bicolor]
Length=518

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 100/179 (56%), Gaps = 17/179 (9%)
 Frame = -2

Query  492  GLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGID  340
            GL  LS+ F LCQ L +S +L D+L   YS  A  D P         P  P+ EVC  ID
Sbjct  265  GLLKLSKTFHLCQTLKTSGDLSDWLSSAYSYLAMVDYPLPSEFLMPLPANPIKEVCRNID  324

Query  339  GAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGDG  178
              P+G   L+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+   +G
Sbjct  325  SQPEGTSTLERIYAGVNVYYNYTGTVGCFDLNDDPHGMG--GWDWQACTEMVMPMSYSEG  382

Query  177  DTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
             +M+ P  F+   ++  CI  +GV PRP WITT +GG +I  VL KFGSNIIF NGL D
Sbjct  383  RSMYPPYKFDYPSYADGCIKSYGVRPRPRWITTEFGGHNITTVLEKFGSNIIFFNGLLD  441



>ref|XP_009342192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=521

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 101/181 (56%), Gaps = 15/181 (8%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F+LC++L    +L D+L   YS  A  + P         P +P+ EVC 
Sbjct  274  KDNGLVQLTKTFRLCRELKKIDDLSDWLDSAYSYLAMVNYPYPAEFVMPLPGHPIKEVCR  333

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGTAIW--GWSWQSCSEMAFPIGRG  184
             ID  P G   L+R+F GV   +   G   C+ +   +A+   GW+WQ+C+EM  P+   
Sbjct  334  KIDDCPDGTSTLERVFEGVSIFYNYTGQAECFELEDTSAVGTDGWNWQACTEMVMPMSSR  393

Query  183  DGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLR  4
            D  +MF    FNL  F + C+  + V PRP WITT YGG DIK  L  FGSNIIFSNGL 
Sbjct  394  DA-SMFPTYDFNLSSFEEECLKNYNVKPRPTWITTEYGGHDIKATLKAFGSNIIFSNGLL  452

Query  3    D  1
            D
Sbjct  453  D  453



>ref|XP_006646360.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=500

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 100/180 (56%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
             GL  LS+ F LCQ + ++ EL D+L   YS  A  D P         P  P+ EVC  I
Sbjct  245  EGLLKLSKTFHLCQTIKTTRELSDWLSSAYSYLAMVDYPMPSDFLMPLPGNPIKEVCRKI  304

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D  P G  IL+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+   +
Sbjct  305  DSQPDGTSILERIYAGVNIYYNYTGTFDCFDLNDDPHGMG--GWDWQACTEMVMPMSYSE  362

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
              +MF    F+   +  +CI+ FGV PRP WITT +GG +I LVL +FGSNIIF NGL D
Sbjct  363  DGSMFPAYKFDYASYENDCISSFGVRPRPQWITTEFGGHNISLVLERFGSNIIFFNGLLD  422



>gb|AGT17295.1| hypothetical protein SHCRBa_168_J15_F_160 [Saccharum hybrid cultivar 
R570]
Length=523

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 103/183 (56%), Gaps = 17/183 (9%)
 Frame = -2

Query  504  SKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVC  352
            +K  GL  LS+ F LCQ L +S +L D+L   YS  A  D P         P  P+ EVC
Sbjct  266  NKQGGLLKLSKTFHLCQTLKTSGDLSDWLSSAYSYLAMVDYPLPSEFLMPLPANPIKEVC  325

Query  351  GGIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIG  190
              ID  P+G   L+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+ 
Sbjct  326  RNIDSQPEGTSTLERIYAGVNVYYNYTGTVGCFDLNDDPHGMG--GWDWQACTEMVMPMS  383

Query  189  RGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNG  10
              +  +M+ P  F+   ++++CI  +GV PRP WITT +GG +I  VL KFGSNIIF NG
Sbjct  384  YSEVRSMYPPYKFDYPSYAEDCIKSYGVRPRPRWITTEFGGHNITKVLEKFGSNIIFFNG  443

Query  9    LRD  1
            L D
Sbjct  444  LLD  446



>dbj|BAK01568.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=514

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 102/180 (57%), Gaps = 17/180 (9%)
 Frame = -2

Query  495  NGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCGGI  343
            +GL  LS+ F LCQ LN++  L D+L   YS  A  D P         P  P+ EVC  I
Sbjct  259  DGLLKLSKTFHLCQTLNTTGALSDWLSSAYSYLAMVDYPMPSEFLMPLPANPIKEVCRNI  318

Query  342  DGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGRGD  181
            D  P+ + IL+RI+AGV   +   G   C+ +   P G    GW WQ+C+EM  P+   +
Sbjct  319  DKQPERSSILERIYAGVNIYYNYTGTVHCFDLDDDPHGMG--GWDWQACTEMVMPMSSSE  376

Query  180  GDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            G +MF P  F+   ++ +C+  FGV PRP WI+T +GG +I  VL KF SNIIF NGL D
Sbjct  377  GLSMFPPDEFDYALYADDCVKNFGVRPRPRWISTEFGGHNISSVLEKFSSNIIFFNGLLD  436



>gb|ABR16397.1| unknown [Picea sitchensis]
Length=508

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 101/171 (59%), Gaps = 5/171 (3%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTPPEYPVTEVCGGIDGA  334
            K+AS+P GL  L++ F  CQ L+S  +L  ++     ++AQY+      V  +C  I+  
Sbjct  281  KVASQPGGLQKLAKLFNTCQSLSSWTDLFYWIYPALQVSAQYNFAE---VKAICRVINSQ  337

Query  333  PKGAHILDRIFAGVFASEGNQSCYSIPTGTAIWGWSWQSCSEMAFPIGRGDGDTMFFPAP  154
             +G  IL R+ AG  A   N+    +   T + GW WQ+CSEM  P+      TMF  AP
Sbjct  338  ARGTDILTRLAAG--AEYANEGLGCLNLSTTLSGWDWQTCSEMVIPLAPNANTTMFPSAP  395

Query  153  FNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLRD  1
            F+L+ +   C   +GV PRP+WITT +GG +IK VL +FGSNIIFSNGLRD
Sbjct  396  FDLKSYFSGCFKTYGVLPRPYWITTEFGGHNIKRVLKRFGSNIIFSNGLRD  446



>ref|XP_006657192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=532

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 104/183 (57%), Gaps = 16/183 (9%)
 Frame = -2

Query  504  SKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVC  352
            S   GL  LS+ F+ C+ + S +  +++L   +   A  D P         P YPV E+C
Sbjct  284  STDAGLLQLSKIFRACKTVKSVYSFRNWLWTAFVYTAMVDYPTPANFLMNLPAYPVKEMC  343

Query  351  GGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTG---TAIWGWSWQSCSEMAFPIG  190
              IDG P GA I+D+ FA     +   G+Q+C+ +  G     + GW WQ+C+EM  P+ 
Sbjct  344  KIIDGFPAGADIVDKAFAAASLYYNYTGDQTCFELEDGGDPHGLSGWGWQACTEMVMPMT  403

Query  189  RGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNG  10
              + ++MF P  F  +  S +C   +GV PRPHWITT YGG  I LVL +FGSNIIFSNG
Sbjct  404  ISN-ESMFPPFTFTYEGKSDDCFQSYGVRPRPHWITTEYGGNKIDLVLKRFGSNIIFSNG  462

Query  9    LRD  1
            +RD
Sbjct  463  MRD  465



>ref|XP_006404933.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
 dbj|BAJ33970.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46386.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
Length=494

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 113/185 (61%), Gaps = 16/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGC--------YSIAAQYDTP-PEYPVTE  358
            +++  +GL  LS+KF+ C+ L+S +  +D+L+          Y+ AA +  P P YPV +
Sbjct  245  VSNMKHGLPELSKKFRTCKGLHSQYAARDWLMSAFIYTAMVNYATAANFMAPLPGYPVEQ  304

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFP  196
            +C  IDG P+G+  LDR FA     +   G++ C+ +   T    + GW WQ+C+EM  P
Sbjct  305  MCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCFELEQPTDDHGLDGWGWQACTEMVMP  364

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +   +  +MF P   + + F + C++ +GV PRPHWITT +GG+ I+ VL +FGSNIIFS
Sbjct  365  MSCSN-QSMFPPYDNDYEAFKEQCMSRYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFS  423

Query  15   NGLRD  1
            NG++D
Sbjct  424  NGMQD  428



>gb|EEC81080.1| hypothetical protein OsI_23902 [Oryza sativa Indica Group]
Length=539

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 104/183 (57%), Gaps = 16/183 (9%)
 Frame = -2

Query  504  SKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVC  352
            S   GL  LS+ F+ C+ + S +  +++L   +   A  D P         P YP+ E+C
Sbjct  291  STDAGLLQLSKTFRACKTVKSVYSFRNWLWTAFVYTAMVDYPTPANFLMNLPAYPIKEMC  350

Query  351  GGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFPIG  190
              IDG P GA I+D+ FA     +   G+Q+C+ +  G     + GW WQ+C+EM  P+ 
Sbjct  351  KIIDGFPAGADIVDKAFAAASLYYNYTGDQTCFQLEDGEDPHGLSGWGWQACTEMVMPMT  410

Query  189  RGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNG  10
              + ++MF P  F  +  S +C   +GV PRPHWITT YGG  I LVL +FGSNIIFSNG
Sbjct  411  ISN-ESMFPPFTFTYEGKSDDCFQSYGVRPRPHWITTEYGGNRIDLVLKRFGSNIIFSNG  469

Query  9    LRD  1
            +RD
Sbjct  470  MRD  472



>ref|XP_002878742.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH55001.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=495

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 109/185 (59%), Gaps = 16/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTE  358
            +++  NGL  LS+KF+ C+ L S +  +D+L G +   A  + P         P YPV +
Sbjct  245  VSTMKNGLQELSKKFRTCKGLQSKYSARDWLSGAFVYTAMVNYPTAANFMAPLPGYPVEQ  304

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFP  196
            +C  IDG P+G+  LDR FA     +   G++ C+ +   T    + GW +Q+C+EM  P
Sbjct  305  MCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCFEMEQQTDDHGLNGWQYQACTEMVMP  364

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +   +  +M  P   + + F + C++ +GV PRPHWITT +GG+ I+ VL +FGSNIIFS
Sbjct  365  MSCSN-QSMLPPYDNDYEAFQEQCMSTYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFS  423

Query  15   NGLRD  1
            NG++D
Sbjct  424  NGMQD  428



>gb|EEE66119.1| hypothetical protein OsJ_22160 [Oryza sativa Japonica Group]
Length=393

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 103/183 (56%), Gaps = 16/183 (9%)
 Frame = -2

Query  504  SKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVC  352
            S   GL  LS+ F+ C+ + S +  +++L   +   A  D P         P YP+ E+C
Sbjct  145  STDAGLLQLSKTFRACKTVKSVYSFRNWLWTAFVYTAMVDYPTPANFLMNLPAYPIKEMC  204

Query  351  GGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFPIG  190
              I G P GA I+D+ FA     +   G+Q+C+ +  G     + GW WQ+C+EM  P+ 
Sbjct  205  KIIHGFPAGADIVDKAFAAASLYYNYTGDQTCFQLEDGEDPHGLSGWGWQACTEMVMPMT  264

Query  189  RGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNG  10
              + ++MF P  F  +  S +C   +GV PRPHWITT YGG  I LVL +FGSNIIFSNG
Sbjct  265  ISN-ESMFPPFTFTYEGKSDDCFQSYGVRPRPHWITTEYGGNRIDLVLKRFGSNIIFSNG  323

Query  9    LRD  1
            +RD
Sbjct  324  MRD  326



>ref|XP_010275727.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Nelumbo 
nucifera]
Length=491

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 106/186 (57%), Gaps = 16/186 (9%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVT  361
            +  S+  GL+ LSR F+ C++L+S +  +++L   +   A  + P         P YPV 
Sbjct  244  QAVSEQKGLAELSRSFRSCENLHSMYSARNWLWTAFVYTAMVNYPTEANFMMPLPAYPVR  303

Query  360  EVCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAF  199
            E+C  IDG P  A  L R+ A     +     + C+ I   T    + GW WQ+C+EM  
Sbjct  304  EMCKIIDGFPPRATKLSRVVAAASLYYNYSRTEKCFKIENATDAHGLHGWDWQACTEMVM  363

Query  198  PIGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIF  19
            P+     D+MF P+ F+ + FS+ C+  +GV PRPHWITT +GG  I+ VL +FGSNIIF
Sbjct  364  PMT-CSKDSMFPPSTFDYKAFSEQCMRKYGVLPRPHWITTEFGGNRIEQVLKRFGSNIIF  422

Query  18   SNGLRD  1
            SNG++D
Sbjct  423  SNGMQD  428



>ref|XP_010429398.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 107/185 (58%), Gaps = 16/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTE  358
            +++K NGL  LS+KF+ C+ L S +   ++L G +   A  + P         P YPV E
Sbjct  246  VSTKKNGLQELSKKFRTCKGLQSRYSASNWLSGAFVYTAMVNYPTAANFMAPLPGYPVEE  305

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFP  196
            +C  IDG P+G+  LDR FA     +   G++ C+ +   T    + GW +Q+C+EM  P
Sbjct  306  MCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCFEMEQQTDDHGLNGWQYQACTEMVMP  365

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +   +  +M  P   + + F + C + +GV PRPHWITT +GG  I+ VL +FGSNIIFS
Sbjct  366  MSCSN-QSMLPPYDNDYEAFEEQCKSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFS  424

Query  15   NGLRD  1
            NGL+D
Sbjct  425  NGLQD  429



>ref|XP_007205162.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
 gb|EMJ06361.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
Length=461

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 99/181 (55%), Gaps = 14/181 (8%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F LC++LNS+ +L ++L   YS  A  + P         P +P+ EVC 
Sbjct  275  KQNGLRQLTKTFHLCRELNSTDDLANWLESAYSYLAMVNYPYAAEFVMPLPGHPIKEVCR  334

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGTAIW--GWSWQSCSEMAFPIGRG  184
             ID  P G   L+RIF GV   +   G   C+ +   + +   GW+WQ+C+EM  P+   
Sbjct  335  KIDCCPDGTSTLERIFEGVSIFYNYTGQAKCFELEDESDVGTDGWNWQACTEMVMPMSSS  394

Query  183  DGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGLR  4
               +MF    +NL  F + C     V PRP WITT +GG DIK  L  FGSNIIFSNGL 
Sbjct  395  RDASMFQTYDYNLSSFQEECWKDHNVKPRPTWITTEFGGHDIKATLKSFGSNIIFSNGLL  454

Query  3    D  1
            D
Sbjct  455  D  455



>ref|XP_010275726.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=525

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 106/186 (57%), Gaps = 16/186 (9%)
 Frame = -2

Query  513  KIASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVT  361
            +  S+  GL+ LSR F+ C++L+S +  +++L   +   A  + P         P YPV 
Sbjct  244  QAVSEQKGLAELSRSFRSCENLHSMYSARNWLWTAFVYTAMVNYPTEANFMMPLPAYPVR  303

Query  360  EVCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAF  199
            E+C  IDG P  A  L R+ A     +     + C+ I   T    + GW WQ+C+EM  
Sbjct  304  EMCKIIDGFPPRATKLSRVVAAASLYYNYSRTEKCFKIENATDAHGLHGWDWQACTEMVM  363

Query  198  PIGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIF  19
            P+     D+MF P+ F+ + FS+ C+  +GV PRPHWITT +GG  I+ VL +FGSNIIF
Sbjct  364  PMT-CSKDSMFPPSTFDYKAFSEQCMRKYGVLPRPHWITTEFGGNRIEQVLKRFGSNIIF  422

Query  18   SNGLRD  1
            SNG++D
Sbjct  423  SNGMQD  428



>ref|XP_010472431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 109/185 (59%), Gaps = 16/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGC--YSIAAQYDTP-------PEYPVTE  358
            +++K NGL  LS+KF+ C+ L S +   ++L G   Y+    Y TP       P YPV +
Sbjct  246  VSTKKNGLQELSKKFRTCKGLQSIYSASNWLSGAFVYTAMVNYPTPANFMAPLPGYPVEQ  305

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFP  196
            +C  IDG P+G+  LDR FA     +   G++ C+ +   T    + GW +Q+C+EM  P
Sbjct  306  MCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCFEMEQQTDDHGLNGWQYQACTEMVMP  365

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +   +  +M  P   + + F + C++ +GV PRPHWITT +GG  I+ VL +FGSNIIFS
Sbjct  366  MSCSN-QSMLPPYDNDYEAFKEQCMSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFS  424

Query  15   NGLRD  1
            NGL+D
Sbjct  425  NGLQD  429



>ref|XP_010023342.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 ref|XP_010023343.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW59598.1| hypothetical protein EUGRSUZ_H02343 [Eucalyptus grandis]
Length=532

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 101/182 (55%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGLS L+R F+LC++L ++ EL ++L   YS  A  + P         P +P+ EVC 
Sbjct  274  KENGLSQLTRMFRLCRELKNTEELVNWLDSAYSYLAMVNYPYPSDFIMPLPGHPIREVCR  333

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             IDG P G  IL+R+  GV   +   G  +C+ +   P G    GW+WQ+C+EM  P+  
Sbjct  334  KIDGCPDGTSILERVSEGVGVYYNHTGEVNCFELDDDPHGMN--GWNWQACTEMVMPLSS  391

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
                +MF    FN   F + C   F V PRP WITT +GG+DI   L  FGSNIIFSNG 
Sbjct  392  SPDTSMFPTYDFNFSAFQEECWTDFKVNPRPRWITTEFGGKDIMTDLKTFGSNIIFSNGF  451

Query  6    RD  1
             D
Sbjct  452  LD  453



>ref|XP_002438750.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
 gb|EER90117.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
Length=558

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 105/183 (57%), Gaps = 16/183 (9%)
 Frame = -2

Query  504  SKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVC  352
            S   GL  LS+ F+ C+ +  ++ ++++L   +S  A  D P         P YPV E+C
Sbjct  310  STDKGLLDLSKLFRACKTVKYAYSIRNWLWTAFSYTAMVDYPTPANFLENLPAYPVKEMC  369

Query  351  GGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFPIG  190
              IDG P GA IL++ FA     +   G+Q+C  I  G     + GW WQ+C+EM  P+ 
Sbjct  370  KIIDGFPTGADILEKAFAAASLYYNYTGDQTCNKIEDGDDPHGLDGWQWQACTEMIMPMT  429

Query  189  RGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNG  10
              + ++MF P+ F+  + S  C   +GV PRPHWITT YGG  I  VL +FGSNIIFSNG
Sbjct  430  VSN-ESMFPPSSFSYDERSDECFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNG  488

Query  9    LRD  1
            +RD
Sbjct  489  MRD  491



>ref|NP_850050.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL25591.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AAM98275.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AEC07556.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=494

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 108/185 (58%), Gaps = 16/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTE  358
            +++  NGL  LS+KF+ C+ L+S +  +D+L G +   A  + P         P YPV +
Sbjct  245  VSTMKNGLQELSKKFRTCKGLHSQYSARDWLSGAFVYTAMVNYPTAANFMAPLPGYPVEQ  304

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFP  196
            +C  IDG P+G+  LDR FA     +   G++ C+ +   T    + GW +Q+C+EM  P
Sbjct  305  MCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCFEMEQQTDDHGLDGWQYQACTEMVMP  364

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +   +  +M  P   + + F + C+  +GV PRPHWITT +GG  I+ VL +FGSNIIFS
Sbjct  365  MSCSN-QSMLPPYENDSEAFQEQCMTRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFS  423

Query  15   NGLRD  1
            NG++D
Sbjct  424  NGMQD  428



>ref|XP_009140531.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=526

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 113/185 (61%), Gaps = 16/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGC--------YSIAAQYDTP-PEYPVTE  358
            +++  +GL  LS+KF+ C+ L+S +  +D+L+G         Y+  A +  P P YPV +
Sbjct  277  VSTMKHGLPELSKKFRTCKGLHSIYSARDWLMGAFVYTAMVNYATTANFMAPLPGYPVEQ  336

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFP  196
            +C  IDG P+G+  LDR FA     +   G++ C+ +   T    + GW +Q+C+EM  P
Sbjct  337  MCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCFELEQPTDDHGLDGWGYQACTEMVMP  396

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +   +  +MF P   + + F + C++ +GV PRPHWITT +GG+ I+ VL +FGSNIIFS
Sbjct  397  MSCSN-QSMFPPYENDYEAFEEQCMSKYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFS  455

Query  15   NGLRD  1
            NGL+D
Sbjct  456  NGLQD  460



>emb|CDY20293.1| BnaC04g36630D [Brassica napus]
Length=492

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 114/185 (62%), Gaps = 16/185 (9%)
 Frame = -2

Query  510  IASKPNGLSILSRKFKLCQDLNSSWELKDYLVGC--------YSIAAQYDTP-PEYPVTE  358
            +++  +GL  LS+KF+ C+ L+S +  +D+L+G         Y+ AA +  P P YPV +
Sbjct  245  VSNMKHGLPELSKKFRTCKGLHSIYSARDWLMGAFVYTAMVNYATAANFMAPLPGYPVEQ  304

Query  357  VCGGIDGAPKGAHILDRIFAGV---FASEGNQSCYSIPTGT---AIWGWSWQSCSEMAFP  196
            +C  IDG P+G+  LDR FA     +   G++ C+ +   T    + GW +Q+C+EM  P
Sbjct  305  MCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCFELEQPTDDHGLDGWGYQACTEMVMP  364

Query  195  IGRGDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFS  16
            +   +  +MF P   + + F + C++ +GV PRPHWITT +GG+ I+ VL +FGSNIIFS
Sbjct  365  MSCSN-QSMFPPYENDYEAFEEQCMSKYGVKPRPHWITTEFGGKRIESVLKRFGSNIIFS  423

Query  15   NGLRD  1
            NG++D
Sbjct  424  NGMQD  428



>ref|XP_010518734.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=515

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 102/182 (56%), Gaps = 17/182 (9%)
 Frame = -2

Query  501  KPNGLSILSRKFKLCQDLNSSWELKDYLVGCYSIAAQYDTP---------PEYPVTEVCG  349
            K NGL  L++ F  C++L S+ +L D+L   YS  A  D P         P +P+ EVC 
Sbjct  268  KENGLQRLTKTFHFCRELKSTDDLADWLSSAYSYLAMVDYPYPANFMMPMPGHPIREVCR  327

Query  348  GIDGAPKGAHILDRIFAGV---FASEGNQSCYSI---PTGTAIWGWSWQSCSEMAFPIGR  187
             +D +  G  ILDRIFAGV   +   GN  C+ +   P G    GW +Q+C+EM  P+  
Sbjct  328  RVDESHDGTSILDRIFAGVSVYYNYTGNVGCFKLDDDPHGLD--GWDFQACTEMVMPMSS  385

Query  186  GDGDTMFFPAPFNLQQFSKNCINLFGVPPRPHWITTYYGGQDIKLVLNKFGSNIIFSNGL  7
               ++MF    FN   + + C ++F V PRP WITT +GG  I+ +L  FGSNIIFSNGL
Sbjct  386  SKENSMFPTYDFNYSSYKEECWDMFRVIPRPRWITTEFGGHGIETILKMFGSNIIFSNGL  445

Query  6    RD  1
             D
Sbjct  446  LD  447



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511043086476