BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22289_g5_i1 len=1483 path=[4739:0-677 3148:678-704 6821:705-715
6832:716-825 6942:826-860 7994:861-1247 8381:1248-1482]

Length=1483
                                                                      Score     E

ref|XP_006363711.1|  PREDICTED: putative DNA-binding protein ESCA...    303   2e-95   
ref|XP_009613223.1|  PREDICTED: putative DNA-binding protein ESCA...    294   4e-92   
ref|XP_009613222.1|  PREDICTED: putative DNA-binding protein ESCA...    288   7e-90   
ref|XP_004245690.1|  PREDICTED: putative DNA-binding protein ESCA...    286   7e-89   
ref|XP_009763803.1|  PREDICTED: putative DNA-binding protein ESCA...    285   1e-88   
ref|XP_009763802.1|  PREDICTED: putative DNA-binding protein ESCA...    280   1e-86   
ref|XP_010325447.1|  PREDICTED: putative DNA-binding protein ESCA...    278   5e-86   
ref|XP_011081090.1|  PREDICTED: putative DNA-binding protein ESCA...    271   2e-83   
gb|ABL63118.1|  AT-hook DNA-binding protein                             269   2e-82   Catharanthus roseus [chatas]
ref|XP_002509637.1|  ESC, putative                                      269   3e-82   Ricinus communis
ref|XP_011033866.1|  PREDICTED: putative DNA-binding protein ESCA...    269   3e-82   
ref|XP_002303540.1|  DNA-binding family protein                         268   5e-82   Populus trichocarpa [western balsam poplar]
ref|XP_002281296.1|  PREDICTED: putative DNA-binding protein ESCA...    267   2e-81   Vitis vinifera
ref|XP_003538721.1|  PREDICTED: putative DNA-binding protein ESCA...    265   5e-81   
ref|XP_002299584.2|  DNA-binding family protein                         265   6e-81   Populus trichocarpa [western balsam poplar]
gb|KDP25577.1|  hypothetical protein JCGZ_20733                         265   8e-81   
ref|XP_010053390.1|  PREDICTED: putative DNA-binding protein ESCA...    265   9e-81   
ref|XP_011029110.1|  PREDICTED: putative DNA-binding protein ESCA...    263   4e-80   
ref|XP_011014152.1|  PREDICTED: putative DNA-binding protein ESCA...    263   4e-80   
ref|XP_008373872.1|  PREDICTED: putative DNA-binding protein ESCA...    262   1e-79   
ref|XP_009594477.1|  PREDICTED: putative DNA-binding protein ESCA...    256   2e-78   
ref|XP_006440441.1|  hypothetical protein CICLE_v10021296mg             259   2e-78   
ref|XP_006477312.1|  PREDICTED: putative DNA-binding protein ESCA...    259   3e-78   
ref|XP_002511734.1|  ESC, putative                                      258   5e-78   Ricinus communis
ref|XP_008238673.1|  PREDICTED: putative DNA-binding protein ESCA...    258   6e-78   
ref|XP_007040019.1|  AT-hook DNA-binding family protein                 257   1e-77   
ref|XP_011017502.1|  PREDICTED: putative DNA-binding protein ESCA...    257   1e-77   
ref|XP_008364289.1|  PREDICTED: putative DNA-binding protein ESCA...    256   2e-77   
ref|XP_008346594.1|  PREDICTED: putative DNA-binding protein ESCA...    256   2e-77   
ref|XP_002279636.1|  PREDICTED: putative DNA-binding protein ESCA...    255   4e-77   Vitis vinifera
gb|KDP28740.1|  hypothetical protein JCGZ_14511                         256   4e-77   
ref|XP_011034536.1|  PREDICTED: putative DNA-binding protein ESCA...    255   6e-77   
ref|XP_009788952.1|  PREDICTED: putative DNA-binding protein ESCA...    251   9e-77   
emb|CDP09863.1|  unnamed protein product                                254   1e-76   
ref|XP_002301300.1|  DNA-binding family protein                         253   2e-76   Populus trichocarpa [western balsam poplar]
ref|XP_010108102.1|  hypothetical protein L484_023188                   253   2e-76   
ref|XP_002320066.1|  DNA-binding family protein                         253   3e-76   Populus trichocarpa [western balsam poplar]
ref|XP_007155606.1|  hypothetical protein PHAVU_003G216200g             252   4e-76   
ref|XP_004298711.1|  PREDICTED: putative DNA-binding protein ESCA...    253   5e-76   
emb|CBI34813.3|  unnamed protein product                                250   6e-76   
ref|XP_010324605.1|  PREDICTED: putative DNA-binding protein ESCA...    252   1e-75   
gb|EYU43510.1|  hypothetical protein MIMGU_mgv1a017700mg                251   3e-75   
ref|XP_010276261.1|  PREDICTED: putative DNA-binding protein ESCA...    250   3e-75   
gb|EYU40549.1|  hypothetical protein MIMGU_mgv1a021038mg                250   4e-75   
ref|XP_006358367.1|  PREDICTED: putative DNA-binding protein ESCA...    250   4e-75   
ref|XP_010940981.1|  PREDICTED: putative DNA-binding protein ESCA...    249   1e-74   
ref|XP_003549894.1|  PREDICTED: putative DNA-binding protein ESCA...    248   1e-74   
ref|XP_006851807.1|  hypothetical protein AMTR_s00041p00025000          248   3e-74   
gb|KEH19036.1|  AT hook motif DNA-binding family protein                248   4e-74   
ref|XP_008804006.1|  PREDICTED: putative DNA-binding protein ESCA...    247   7e-74   
ref|XP_009778295.1|  PREDICTED: putative DNA-binding protein ESCA...    246   1e-73   
ref|XP_009799054.1|  PREDICTED: putative DNA-binding protein ESCA...    246   2e-73   
ref|XP_007158420.1|  hypothetical protein PHAVU_002G151600g             246   2e-73   
ref|XP_003525782.1|  PREDICTED: putative DNA-binding protein ESCA...    245   2e-73   
ref|XP_009604907.1|  PREDICTED: putative DNA-binding protein ESCA...    245   5e-73   
ref|XP_007052032.1|  AT-hook motif nuclear-localized protein 22         245   7e-73   
ref|NP_001141263.1|  hypothetical protein                               243   2e-72   Zea mays [maize]
ref|XP_006339443.1|  PREDICTED: putative DNA-binding protein ESCA...    243   4e-72   
ref|XP_009621304.1|  PREDICTED: putative DNA-binding protein ESCA...    243   5e-72   
gb|KFK37336.1|  hypothetical protein AALP_AA4G243300                    242   1e-71   
ref|XP_004242015.1|  PREDICTED: putative DNA-binding protein ESCA...    237   3e-71   
ref|XP_006851806.1|  hypothetical protein AMTR_s00041p00022450          240   4e-71   
gb|EYU30571.1|  hypothetical protein MIMGU_mgv1a010755mg                239   7e-71   
emb|CDX94128.1|  BnaC07g37620D                                          239   1e-70   
ref|XP_004510939.1|  PREDICTED: putative DNA-binding protein ESCA...    238   1e-70   
ref|NP_001046754.1|  Os02g0448000                                       239   1e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006363907.1|  PREDICTED: putative DNA-binding protein ESCA...    235   2e-70   
emb|CDY41289.1|  BnaA01g12500D                                          238   3e-70   
emb|CDX98771.1|  BnaA03g45560D                                          238   5e-70   
ref|XP_004306909.1|  PREDICTED: putative DNA-binding protein ESCA...    238   6e-70   
ref|XP_009344356.1|  PREDICTED: putative DNA-binding protein ESCA...    237   7e-70   
emb|CDX82978.1|  BnaC01g14280D                                          237   8e-70   
ref|XP_011070911.1|  PREDICTED: putative DNA-binding protein ESCA...    234   1e-69   
ref|XP_004952401.1|  PREDICTED: putative DNA-binding protein ESCA...    236   1e-69   
ref|XP_002451872.1|  hypothetical protein SORBIDRAFT_04g009050          236   1e-69   Sorghum bicolor [broomcorn]
ref|XP_003516470.1|  PREDICTED: putative DNA-binding protein ESCA...    235   2e-69   
ref|XP_004172826.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    235   2e-69   
ref|XP_004147565.1|  PREDICTED: putative DNA-binding protein ESCA...    235   2e-69   
dbj|BAK03205.1|  predicted protein                                      235   3e-69   
ref|XP_007134900.1|  hypothetical protein PHAVU_010G085300g             235   3e-69   
ref|XP_008437165.1|  PREDICTED: putative DNA-binding protein ESCA...    235   4e-69   
ref|XP_003521618.1|  PREDICTED: putative DNA-binding protein ESCA...    234   5e-69   
ref|XP_006445233.1|  hypothetical protein CICLE_v10024070mg             234   6e-69   
ref|XP_004511639.1|  PREDICTED: putative DNA-binding protein ESCA...    231   1e-68   
ref|XP_009137280.1|  PREDICTED: putative DNA-binding protein ESCA...    234   1e-68   
ref|XP_004511638.1|  PREDICTED: putative DNA-binding protein ESCA...    234   1e-68   
ref|XP_003517441.1|  PREDICTED: putative DNA-binding protein ESCA...    233   2e-68   
ref|XP_010277406.1|  PREDICTED: putative DNA-binding protein ESCA...    232   2e-68   
ref|XP_009136213.1|  PREDICTED: putative DNA-binding protein ESCA...    232   7e-68   
ref|XP_009379269.1|  PREDICTED: putative DNA-binding protein ESCA...    232   9e-68   
ref|XP_003573204.1|  PREDICTED: putative DNA-binding protein ESCA...    231   9e-68   
ref|NP_001146992.1|  DNA binding protein                                231   1e-67   Zea mays [maize]
ref|XP_006402533.1|  hypothetical protein EUTSA_v10006144mg             230   1e-67   
ref|XP_002876587.1|  hypothetical protein ARALYDRAFT_486561             229   2e-67   
ref|XP_010676637.1|  PREDICTED: putative DNA-binding protein ESCA...    230   4e-67   
ref|XP_011090893.1|  PREDICTED: putative DNA-binding protein ESCA...    229   7e-67   
ref|XP_010092850.1|  hypothetical protein L484_022445                   229   1e-66   
gb|EYU29016.1|  hypothetical protein MIMGU_mgv1a023550mg                228   1e-66   
ref|XP_011093194.1|  PREDICTED: putative DNA-binding protein ESCA...    228   1e-66   
ref|XP_010934543.1|  PREDICTED: putative DNA-binding protein ESCA...    228   2e-66   
ref|XP_010523691.1|  PREDICTED: putative DNA-binding protein ESCA...    226   5e-66   
ref|XP_008791267.1|  PREDICTED: putative DNA-binding protein ESCA...    227   5e-66   
ref|XP_008343156.1|  PREDICTED: putative DNA-binding protein ESCA...    226   9e-66   
ref|XP_009382863.1|  PREDICTED: putative DNA-binding protein ESCA...    226   1e-65   
ref|XP_006296351.1|  hypothetical protein CARUB_v10025523mg             226   1e-65   
ref|NP_182067.1|  AT-hook motif nuclear-localized protein 22            226   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880179.1|  hypothetical protein ARALYDRAFT_903987             226   2e-65   
ref|XP_006397724.1|  hypothetical protein EUTSA_v10001760mg             225   2e-65   
ref|XP_010469137.1|  PREDICTED: putative DNA-binding protein ESCA...    223   4e-65   
ref|XP_010538771.1|  PREDICTED: putative DNA-binding protein ESCA...    224   5e-65   
ref|XP_010518160.1|  PREDICTED: putative DNA-binding protein ESCA...    224   5e-65   
ref|XP_010508171.1|  PREDICTED: putative DNA-binding protein ESCA...    224   6e-65   
ref|XP_010506485.1|  PREDICTED: putative DNA-binding protein ESCA...    224   6e-65   
ref|XP_009393002.1|  PREDICTED: putative DNA-binding protein ESCA...    224   7e-65   
ref|XP_010917984.1|  PREDICTED: putative DNA-binding protein ESCA...    223   8e-65   
gb|KDO85858.1|  hypothetical protein CISIN_1g047830mg                   223   2e-64   
ref|XP_008811429.1|  PREDICTED: putative DNA-binding protein ESCA...    222   3e-64   
ref|XP_004305833.1|  PREDICTED: putative DNA-binding protein ESCA...    220   4e-64   
ref|XP_007220373.1|  hypothetical protein PRUPE_ppa018314mg             222   4e-64   
ref|XP_002874744.1|  hypothetical protein ARALYDRAFT_490024             222   6e-64   
ref|XP_006292551.1|  hypothetical protein CARUB_v10018786mg             219   1e-63   
ref|XP_010540129.1|  PREDICTED: putative DNA-binding protein ESCA...    221   1e-63   
ref|XP_006647239.1|  PREDICTED: putative DNA-binding protein ESCA...    221   2e-63   
ref|XP_002279677.2|  PREDICTED: putative DNA-binding protein ESCA...    219   2e-63   Vitis vinifera
ref|XP_004229823.1|  PREDICTED: putative DNA-binding protein ESCA...    220   2e-63   
emb|CDY27387.1|  BnaC04g50180D                                          220   2e-63   
ref|XP_009142337.1|  PREDICTED: putative DNA-binding protein ESCA...    220   2e-63   
ref|XP_008229461.1|  PREDICTED: putative DNA-binding protein ESCA...    218   2e-63   
emb|CDY37040.1|  BnaA04g26180D                                          219   2e-63   
ref|NP_194012.1|  putative AT-hook DNA-binding family protein           219   4e-63   Arabidopsis thaliana [mouse-ear cress]
gb|KCW77938.1|  hypothetical protein EUGRSUZ_D02188                     218   4e-63   
ref|XP_004145056.1|  PREDICTED: putative DNA-binding protein ESCA...    218   4e-63   
ref|XP_008467078.1|  PREDICTED: putative DNA-binding protein ESCA...    218   5e-63   
ref|XP_002869805.1|  hypothetical protein ARALYDRAFT_492588             219   7e-63   
ref|XP_009420779.1|  PREDICTED: putative DNA-binding protein ESCA...    218   9e-63   
ref|XP_002527105.1|  DNA binding protein, putative                      217   1e-62   Ricinus communis
ref|XP_010439279.1|  PREDICTED: putative DNA-binding protein ESCA...    218   1e-62   
ref|XP_010053603.1|  PREDICTED: putative DNA-binding protein ESCA...    217   2e-62   
gb|EYU40290.1|  hypothetical protein MIMGU_mgv1a019526mg                217   2e-62   
ref|XP_010102152.1|  hypothetical protein L484_021386                   216   2e-62   
gb|KDP46909.1|  hypothetical protein JCGZ_10400                         215   2e-62   
ref|XP_009373365.1|  PREDICTED: putative DNA-binding protein ESCA...    214   3e-62   
ref|XP_009377422.1|  PREDICTED: putative DNA-binding protein ESCA...    215   3e-62   
ref|XP_010448831.1|  PREDICTED: putative DNA-binding protein ESCA...    217   4e-62   
ref|XP_003539199.1|  PREDICTED: putative DNA-binding protein ESCA...    214   5e-62   
ref|XP_007039519.1|  AT-hook DNA-binding family protein                 216   5e-62   
ref|XP_006366237.1|  PREDICTED: putative DNA-binding protein ESCA...    215   5e-62   
dbj|BAF02122.1|  putative DNA binding protein                           216   6e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008668970.1|  PREDICTED: putative DNA-binding protein ESCA...    216   6e-62   
tpg|DAA36260.1|  TPA: hypothetical protein ZEAMMB73_652841              217   6e-62   
ref|XP_008353637.1|  PREDICTED: putative DNA-binding protein ESCA...    213   1e-61   
ref|XP_010433987.1|  PREDICTED: putative DNA-binding protein ESCA...    216   1e-61   
gb|KCW71795.1|  hypothetical protein EUGRSUZ_E00284                     214   1e-61   
ref|XP_008356452.1|  PREDICTED: putative DNA-binding protein ESCA...    215   1e-61   
ref|XP_010055327.1|  PREDICTED: putative DNA-binding protein ESCA...    214   1e-61   
ref|XP_007048865.1|  AT-hook DNA-binding family protein                 213   2e-61   
gb|KFK28863.1|  hypothetical protein AALP_AA7G058200                    215   2e-61   
gb|KDO60958.1|  hypothetical protein CISIN_1g040216mg                   213   3e-61   
ref|NP_001056730.1|  Os06g0136900                                       215   3e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010422173.1|  PREDICTED: putative DNA-binding protein ESCA...    215   3e-61   
ref|XP_009356620.1|  PREDICTED: putative DNA-binding protein ESCA...    213   4e-61   
ref|XP_010908279.1|  PREDICTED: putative DNA-binding protein ESCA...    213   4e-61   
ref|XP_010433825.1|  PREDICTED: putative DNA-binding protein ESCA...    214   5e-61   
ref|XP_006437176.1|  hypothetical protein CICLE_v10032444mg             212   5e-61   
ref|XP_010275243.1|  PREDICTED: putative DNA-binding protein ESCA...    213   5e-61   
emb|CAN83987.1|  hypothetical protein VITISV_032602                     213   5e-61   Vitis vinifera
ref|XP_008342359.1|  PREDICTED: putative DNA-binding protein ESCA...    211   6e-61   
ref|XP_010544659.1|  PREDICTED: putative DNA-binding protein ESCA...    213   6e-61   
ref|XP_011093448.1|  PREDICTED: putative DNA-binding protein ESCA...    212   7e-61   
ref|XP_008362336.1|  PREDICTED: putative DNA-binding protein ESCA...    211   7e-61   
ref|XP_010692273.1|  PREDICTED: putative DNA-binding protein ESCA...    214   7e-61   
ref|XP_003524711.1|  PREDICTED: putative DNA-binding protein ESCA...    212   9e-61   
ref|XP_003516633.1|  PREDICTED: putative DNA-binding protein ESCA...    211   9e-61   
ref|XP_002281411.1|  PREDICTED: putative DNA-binding protein ESCA...    212   9e-61   Vitis vinifera
ref|XP_010035901.1|  PREDICTED: putative DNA-binding protein ESCA...    211   1e-60   
ref|XP_002448423.1|  hypothetical protein SORBIDRAFT_06g026940          213   1e-60   Sorghum bicolor [broomcorn]
ref|XP_006413619.1|  hypothetical protein EUTSA_v10025672mg             213   2e-60   
emb|CDP09327.1|  unnamed protein product                                212   2e-60   
ref|XP_008805810.1|  PREDICTED: putative DNA-binding protein ESCA...    212   2e-60   
ref|XP_008380207.1|  PREDICTED: putative DNA-binding protein ESCA...    211   2e-60   
ref|XP_003617443.1|  hypothetical protein MTR_5g091630                  210   2e-60   
ref|XP_010455638.1|  PREDICTED: putative DNA-binding protein ESCA...    213   2e-60   
ref|NP_192942.1|  putative AT-hook DNA-binding family protein           213   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010257112.1|  PREDICTED: putative DNA-binding protein ESCA...    214   2e-60   
ref|XP_008377132.1|  PREDICTED: putative DNA-binding protein ESCA...    211   3e-60   
ref|XP_006368407.1|  DNA-binding family protein                         211   3e-60   
ref|XP_003611214.1|  AT-hook DNA-binding protein                        212   3e-60   
emb|CDY18931.1|  BnaC04g04190D                                          211   4e-60   
ref|XP_004491337.1|  PREDICTED: putative DNA-binding protein ESCA...    209   4e-60   
ref|XP_010262258.1|  PREDICTED: putative DNA-binding protein ESCA...    209   4e-60   
ref|XP_009411479.1|  PREDICTED: putative DNA-binding protein ESCA...    211   5e-60   
ref|XP_010053890.1|  PREDICTED: putative DNA-binding protein ESCA...    211   5e-60   
gb|EPS64135.1|  hypothetical protein M569_10646                         211   6e-60   
ref|XP_007139682.1|  hypothetical protein PHAVU_008G050100g             209   7e-60   
ref|XP_006284928.1|  hypothetical protein CARUB_v10006227mg             211   7e-60   
gb|KCW61537.1|  hypothetical protein EUGRSUZ_H04257                     209   9e-60   
ref|XP_008786310.1|  PREDICTED: putative DNA-binding protein ESCA...    210   1e-59   
ref|XP_004976643.1|  PREDICTED: putative DNA-binding protein ESCA...    210   1e-59   
emb|CDO99189.1|  unnamed protein product                                209   1e-59   
ref|XP_007211085.1|  hypothetical protein PRUPE_ppa016700mg             206   1e-59   
ref|XP_010262897.1|  PREDICTED: putative DNA-binding protein ESCA...    211   1e-59   
emb|CDP17786.1|  unnamed protein product                                210   1e-59   
ref|XP_010097716.1|  hypothetical protein L484_023857                   210   1e-59   
ref|XP_006436718.1|  hypothetical protein CICLE_v10032253mg             209   1e-59   
ref|XP_002312579.2|  hypothetical protein POPTR_0008s16440g             209   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006420137.1|  hypothetical protein CICLE_v10005603mg             208   2e-59   
emb|CDX74739.1|  BnaA05g04850D                                          209   2e-59   
gb|KDP22981.1|  hypothetical protein JCGZ_01738                         209   2e-59   
ref|XP_006601994.1|  PREDICTED: putative DNA-binding protein ESCA...    209   2e-59   
ref|XP_010024974.1|  PREDICTED: putative DNA-binding protein ESCA...    208   3e-59   
ref|XP_009143141.1|  PREDICTED: putative DNA-binding protein ESCA...    209   3e-59   
gb|EYU41285.1|  hypothetical protein MIMGU_mgv1a025243mg                208   4e-59   
ref|XP_011029905.1|  PREDICTED: putative DNA-binding protein ESCA...    207   6e-59   
ref|XP_009794976.1|  PREDICTED: putative DNA-binding protein ESCA...    207   6e-59   
ref|XP_002307550.2|  hypothetical protein POPTR_0005s22440g             206   7e-59   Populus trichocarpa [western balsam poplar]
ref|XP_007035040.1|  AT-hook motif nuclear localized protein 20         207   8e-59   
ref|XP_011044786.1|  PREDICTED: putative DNA-binding protein ESCA...    206   8e-59   
ref|XP_006289235.1|  hypothetical protein CARUB_v10002691mg             209   8e-59   
ref|XP_006396802.1|  hypothetical protein EUTSA_v10029174mg             209   8e-59   
ref|XP_002314642.2|  hypothetical protein POPTR_0010s08500g             207   9e-59   Populus trichocarpa [western balsam poplar]
ref|XP_007218339.1|  hypothetical protein PRUPE_ppa008610mg             208   9e-59   
ref|XP_007156666.1|  hypothetical protein PHAVU_002G006900g             206   1e-58   
ref|XP_009377073.1|  PREDICTED: putative DNA-binding protein ESCA...    207   1e-58   
ref|XP_009347388.1|  PREDICTED: putative DNA-binding protein ESCA...    206   1e-58   
ref|XP_004296621.1|  PREDICTED: putative DNA-binding protein ESCA...    206   1e-58   
ref|XP_006477506.1|  PREDICTED: putative DNA-binding protein ESCA...    208   2e-58   
ref|XP_008238264.1|  PREDICTED: putative DNA-binding protein ESCA...    206   2e-58   
ref|XP_007210169.1|  hypothetical protein PRUPE_ppa019786mg             206   2e-58   
ref|XP_008799381.1|  PREDICTED: putative DNA-binding protein ESCA...    206   3e-58   
ref|XP_007226723.1|  hypothetical protein PRUPE_ppa019745mg             206   3e-58   
ref|XP_007144108.1|  hypothetical protein PHAVU_007G129400g             206   3e-58   
ref|XP_008224392.1|  PREDICTED: putative DNA-binding protein ESCA...    205   4e-58   
ref|XP_004974243.1|  PREDICTED: putative DNA-binding protein ESCA...    204   4e-58   
ref|XP_011026257.1|  PREDICTED: putative DNA-binding protein ESCA...    204   5e-58   
ref|XP_011030530.1|  PREDICTED: putative DNA-binding protein ESCA...    205   5e-58   
gb|ABL63119.1|  AT-hook DNA-binding protein                             204   5e-58   Catharanthus roseus [chatas]
ref|XP_009351431.1|  PREDICTED: putative DNA-binding protein ESCA...    205   7e-58   
ref|XP_009589802.1|  PREDICTED: putative DNA-binding protein ESCA...    204   9e-58   
ref|XP_008788674.1|  PREDICTED: putative DNA-binding protein ESCA...    205   9e-58   
ref|XP_007220428.1|  hypothetical protein PRUPE_ppa009347mg             204   9e-58   
gb|ADY38789.1|  DNA-binding protein                                     204   9e-58   
ref|XP_009379018.1|  PREDICTED: putative DNA-binding protein ESCA...    204   1e-57   
ref|XP_007144002.1|  hypothetical protein PHAVU_007G120900g             204   1e-57   
ref|XP_009391843.1|  PREDICTED: putative DNA-binding protein ESCA...    205   1e-57   
ref|XP_002312113.2|  hypothetical protein POPTR_0008s05890g             206   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_007141856.1|  hypothetical protein PHAVU_008G231500g             202   1e-57   
ref|XP_006588553.1|  PREDICTED: putative DNA-binding protein ESCA...    202   1e-57   
gb|ABZ89182.1|  putative protein                                        204   1e-57   Coffea canephora [robusta coffee]
ref|NP_191646.1|  AT-hook motif nuclear-localized protein 18            203   1e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDP06170.1|  unnamed protein product                                203   1e-57   
ref|XP_010524099.1|  PREDICTED: putative DNA-binding protein ESCA...    202   1e-57   
dbj|BAK02723.1|  predicted protein                                      204   1e-57   
ref|XP_008391057.1|  PREDICTED: putative DNA-binding protein ESCA...    203   2e-57   
ref|XP_004302076.1|  PREDICTED: putative DNA-binding protein ESCA...    204   2e-57   
ref|XP_011002630.1|  PREDICTED: putative DNA-binding protein ESCA...    205   2e-57   
ref|XP_002519826.1|  ESC, putative                                      203   2e-57   Ricinus communis
gb|KHN11964.1|  Putative DNA-binding protein ESCAROLA                   202   2e-57   
ref|XP_008233653.1|  PREDICTED: putative DNA-binding protein ESCA...    204   2e-57   
ref|XP_002529315.1|  DNA binding protein, putative                      203   3e-57   Ricinus communis
emb|CDY04391.1|  BnaC02g28570D                                          204   3e-57   
ref|XP_006595755.1|  PREDICTED: putative DNA-binding protein ESCA...    202   3e-57   
ref|XP_008371927.1|  PREDICTED: putative DNA-binding protein ESCA...    204   3e-57   
ref|XP_002284519.1|  PREDICTED: putative DNA-binding protein ESCA...    202   3e-57   Vitis vinifera
gb|KFK31952.1|  hypothetical protein AALP_AA6G181300                    204   3e-57   
ref|XP_011033055.1|  PREDICTED: putative DNA-binding protein ESCA...    204   3e-57   
gb|KHN01050.1|  Putative DNA-binding protein ESCAROLA                   203   4e-57   
ref|XP_004229513.1|  PREDICTED: putative DNA-binding protein ESCA...    202   4e-57   
ref|XP_008663461.1|  PREDICTED: putative DNA-binding protein ESCA...    203   4e-57   
ref|XP_002524209.1|  ESC, putative                                      204   4e-57   Ricinus communis
ref|XP_002315208.2|  hypothetical protein POPTR_0010s20780g             204   4e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004503162.1|  PREDICTED: putative DNA-binding protein ESCA...    203   5e-57   
ref|XP_009394683.1|  PREDICTED: putative DNA-binding protein ESCA...    201   6e-57   
ref|XP_006589299.1|  PREDICTED: putative DNA-binding protein ESCA...    203   6e-57   
ref|XP_011094152.1|  PREDICTED: putative DNA-binding protein ESCA...    201   8e-57   
ref|XP_006606853.1|  PREDICTED: putative DNA-binding protein ESCA...    204   8e-57   
ref|XP_010274873.1|  PREDICTED: putative DNA-binding protein ESCA...    204   9e-57   
ref|XP_004153985.1|  PREDICTED: putative DNA-binding protein ESCA...    200   1e-56   
ref|XP_004145070.1|  PREDICTED: putative DNA-binding protein ESCA...    200   1e-56   
ref|NP_001151240.1|  DNA-binding protein                                201   1e-56   Zea mays [maize]
ref|XP_004307477.1|  PREDICTED: putative DNA-binding protein ESCA...    202   1e-56   
gb|KDP23697.1|  hypothetical protein JCGZ_23530                         201   1e-56   
ref|XP_008232681.1|  PREDICTED: putative DNA-binding protein ESCA...    202   1e-56   
gb|KHN30735.1|  Putative DNA-binding protein ESCAROLA                   201   1e-56   
ref|XP_010243718.1|  PREDICTED: putative DNA-binding protein ESCA...    201   1e-56   
ref|XP_006410687.1|  hypothetical protein EUTSA_v10017027mg             201   2e-56   
ref|XP_006846339.1|  hypothetical protein AMTR_s00012p00257450          201   2e-56   
ref|XP_004173725.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    200   2e-56   
ref|XP_008466998.1|  PREDICTED: putative DNA-binding protein ESCA...    200   2e-56   
ref|XP_009343806.1|  PREDICTED: putative DNA-binding protein ESCA...    202   2e-56   
ref|XP_004133907.1|  PREDICTED: putative DNA-binding protein ESCA...    200   2e-56   
emb|CBI35166.3|  unnamed protein product                                200   2e-56   
ref|XP_003556450.2|  PREDICTED: putative DNA-binding protein ESCA...    200   2e-56   
ref|XP_006606925.1|  PREDICTED: putative DNA-binding protein ESCA...    203   3e-56   
ref|XP_008460074.1|  PREDICTED: putative DNA-binding protein ESCA...    201   3e-56   
ref|XP_008794313.1|  PREDICTED: putative DNA-binding protein ESCA...    200   3e-56   
gb|KHN38329.1|  Putative DNA-binding protein ESCAROLA                   201   3e-56   
gb|KDP44918.1|  hypothetical protein JCGZ_01418                         202   3e-56   
ref|XP_002319649.1|  DNA-binding family protein                         200   3e-56   
ref|XP_004133943.1|  PREDICTED: putative DNA-binding protein ESCA...    199   4e-56   
ref|XP_010516702.1|  PREDICTED: putative DNA-binding protein ESCA...    200   4e-56   
ref|XP_008453469.1|  PREDICTED: putative DNA-binding protein ESCA...    199   4e-56   
ref|XP_010509635.1|  PREDICTED: putative DNA-binding protein ESCA...    200   4e-56   
ref|XP_011038532.1|  PREDICTED: putative DNA-binding protein ESCA...    200   4e-56   
ref|XP_010525495.1|  PREDICTED: putative DNA-binding protein ESCA...    199   4e-56   
ref|XP_006385649.1|  DNA-binding family protein                         200   4e-56   
ref|XP_002300879.2|  hypothetical protein POPTR_0002s06030g             199   4e-56   
ref|XP_010531743.1|  PREDICTED: putative DNA-binding protein ESCA...    199   5e-56   
ref|XP_003536146.1|  PREDICTED: putative DNA-binding protein ESCA...    199   5e-56   
ref|XP_004148482.1|  PREDICTED: putative DNA-binding protein ESCA...    199   5e-56   
ref|XP_003518506.2|  PREDICTED: putative DNA-binding protein ESCA...    198   5e-56   
ref|XP_004160444.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    199   6e-56   
ref|XP_002969614.1|  hypothetical protein SELMODRAFT_71342              197   6e-56   
ref|XP_010940763.1|  PREDICTED: putative DNA-binding protein ESCA...    201   6e-56   
ref|XP_008465963.1|  PREDICTED: putative DNA-binding protein ESCA...    199   6e-56   
ref|XP_011028186.1|  PREDICTED: putative DNA-binding protein ESCA...    199   7e-56   
ref|NP_181070.1|  protein GIANT KILLER                                  199   7e-56   
ref|XP_006296261.1|  hypothetical protein CARUB_v10025435mg             199   7e-56   
ref|XP_002879544.1|  hypothetical protein ARALYDRAFT_482492             199   7e-56   
gb|KFK36425.1|  hypothetical protein AALP_AA4G122700                    199   8e-56   
ref|XP_010505030.1|  PREDICTED: putative DNA-binding protein ESCA...    199   8e-56   
ref|XP_003581586.1|  PREDICTED: putative DNA-binding protein ESCA...    200   9e-56   
ref|XP_010102254.1|  hypothetical protein L484_024535                   199   9e-56   
ref|XP_009775204.1|  PREDICTED: putative DNA-binding protein ESCA...    198   1e-55   
ref|XP_010104063.1|  hypothetical protein L484_008144                   200   1e-55   
ref|XP_007030480.1|  AT-hook motif nuclear localized protein 20         199   1e-55   
ref|XP_009336832.1|  PREDICTED: putative DNA-binding protein ESCA...    199   1e-55   
ref|XP_004247701.1|  PREDICTED: putative DNA-binding protein ESCA...    199   1e-55   
ref|XP_004243206.1|  PREDICTED: putative DNA-binding protein ESCA...    197   1e-55   
gb|KFK22136.1|  hypothetical protein AALP_AAs47043U000100               198   2e-55   
ref|XP_006487869.1|  PREDICTED: putative DNA-binding protein ESCA...    199   2e-55   
ref|XP_004249915.1|  PREDICTED: putative DNA-binding protein ESCA...    198   2e-55   
ref|XP_006350955.1|  PREDICTED: putative DNA-binding protein ESCA...    198   2e-55   
ref|XP_008370731.1|  PREDICTED: putative DNA-binding protein ESCA...    199   2e-55   
ref|XP_009141480.1|  PREDICTED: putative DNA-binding protein ESCA...    198   2e-55   
ref|XP_011091221.1|  PREDICTED: putative DNA-binding protein ESCA...    196   2e-55   
ref|XP_004964470.1|  PREDICTED: putative DNA-binding protein ESCA...    199   2e-55   
ref|XP_006442718.1|  hypothetical protein CICLE_v10023369mg             198   2e-55   
gb|KFK37136.1|  hypothetical protein AALP_AA4G217700                    197   2e-55   
ref|XP_006435633.1|  hypothetical protein CICLE_v10032034mg             199   3e-55   
tpg|DAA48555.1|  TPA: hypothetical protein ZEAMMB73_420043              197   3e-55   
ref|NP_001053704.1|  Os04g0590200                                       198   3e-55   
ref|XP_004137338.1|  PREDICTED: uncharacterized protein LOC101219306    200   3e-55   
ref|XP_010026866.1|  PREDICTED: putative DNA-binding protein ESCA...    198   3e-55   
ref|XP_009372143.1|  PREDICTED: putative DNA-binding protein ESCA...    198   3e-55   
ref|XP_002521959.1|  DNA binding protein, putative                      197   4e-55   
ref|XP_007145832.1|  hypothetical protein PHAVU_007G271800g             196   4e-55   
ref|XP_008375698.1|  PREDICTED: putative DNA-binding protein ESCA...    197   5e-55   
ref|XP_008780228.1|  PREDICTED: putative DNA-binding protein ESCA...    196   6e-55   
ref|XP_009143684.1|  PREDICTED: putative DNA-binding protein ESCA...    196   8e-55   
emb|CAN61523.1|  hypothetical protein VITISV_016751                     196   8e-55   
ref|XP_004956262.1|  PREDICTED: putative DNA-binding protein ESCA...    195   8e-55   
ref|XP_009623613.1|  PREDICTED: putative DNA-binding protein ESCA...    197   8e-55   
ref|XP_006285829.1|  hypothetical protein CARUB_v10007306mg             196   9e-55   
ref|XP_009373988.1|  PREDICTED: putative DNA-binding protein ESCA...    197   1e-54   
ref|XP_002881881.1|  DNA-binding family protein                         195   1e-54   
ref|XP_002271606.1|  PREDICTED: putative DNA-binding protein ESCA...    196   1e-54   
ref|XP_006414705.1|  hypothetical protein EUTSA_v10025929mg             196   1e-54   
ref|XP_006295752.1|  hypothetical protein CARUB_v10024872mg             195   1e-54   
ref|XP_010506133.1|  PREDICTED: putative DNA-binding protein ESCA...    195   1e-54   
ref|NP_181822.1|  AT-hook motif nuclear-localized protein 16            195   1e-54   
ref|XP_008232226.1|  PREDICTED: putative DNA-binding protein ESCA...    196   1e-54   
gb|KGN56590.1|  hypothetical protein Csa_3G126060                       194   2e-54   
ref|XP_010435119.1|  PREDICTED: putative DNA-binding protein ESCA...    196   2e-54   
ref|XP_004300243.1|  PREDICTED: putative DNA-binding protein ESCA...    196   2e-54   
ref|XP_010552065.1|  PREDICTED: putative DNA-binding protein ESCA...    198   2e-54   
ref|XP_006847733.1|  hypothetical protein AMTR_s00149p00093420          195   2e-54   
ref|XP_007009270.1|  AT-hook protein of GA feedback 2                   197   2e-54   
ref|XP_009351025.1|  PREDICTED: putative DNA-binding protein ESCA...    196   2e-54   
ref|XP_009364460.1|  PREDICTED: putative DNA-binding protein ESCA...    195   3e-54   
ref|XP_010933490.1|  PREDICTED: putative DNA-binding protein ESCA...    195   3e-54   
ref|XP_006411566.1|  hypothetical protein EUTSA_v10017103mg             194   4e-54   
ref|XP_008354801.1|  PREDICTED: putative DNA-binding protein ESCA...    195   4e-54   
ref|XP_010052700.1|  PREDICTED: putative DNA-binding protein ESCA...    194   4e-54   
ref|XP_009616004.1|  PREDICTED: putative DNA-binding protein ESCA...    194   4e-54   
gb|EPS68305.1|  hypothetical protein M569_06465                         191   8e-54   
ref|XP_010530021.1|  PREDICTED: putative DNA-binding protein ESCA...    193   1e-53   
gb|EYU18229.1|  hypothetical protein MIMGU_mgv1a020284mg                192   1e-53   
ref|XP_008801301.1|  PREDICTED: putative DNA-binding protein ESCA...    192   1e-53   
ref|XP_008438225.1|  PREDICTED: putative DNA-binding protein ESCA...    192   1e-53   
ref|XP_009401827.1|  PREDICTED: putative DNA-binding protein ESCA...    192   1e-53   
ref|XP_010508503.1|  PREDICTED: putative DNA-binding protein ESCA...    192   2e-53   
ref|XP_010506134.1|  PREDICTED: putative DNA-binding protein ESCA...    192   2e-53   
ref|XP_008388703.1|  PREDICTED: putative DNA-binding protein ESCA...    193   2e-53   
emb|CDX79599.1|  BnaC03g19350D                                          192   2e-53   
ref|XP_004497856.1|  PREDICTED: putative DNA-binding protein ESCA...    194   2e-53   
ref|XP_006348956.1|  PREDICTED: putative DNA-binding protein ESCA...    191   3e-53   
gb|AGC22550.1|  male sterility related AT-hook DNA binding protein      191   3e-53   
ref|XP_010104316.1|  hypothetical protein L484_023266                   192   3e-53   
ref|NP_567432.1|  AT-hook motif nuclear-localized protein 20            192   3e-53   
ref|XP_010440458.1|  PREDICTED: putative DNA-binding protein ESCA...    192   4e-53   
ref|XP_003590930.1|  DNA-binding protein                                192   4e-53   
ref|XP_010935866.1|  PREDICTED: putative DNA-binding protein ESCA...    192   5e-53   
ref|XP_006354520.1|  PREDICTED: putative DNA-binding protein ESCA...    191   5e-53   
ref|XP_009133171.1|  PREDICTED: putative DNA-binding protein ESCA...    190   5e-53   
gb|AFK41919.1|  unknown                                                 192   5e-53   
ref|XP_002870310.1|  hypothetical protein ARALYDRAFT_493459             191   5e-53   
emb|CDY72485.1|  BnaCnng77890D                                          191   7e-53   
ref|XP_004495563.1|  PREDICTED: putative DNA-binding protein ESCA...    192   7e-53   
gb|ACU24276.1|  unknown                                                 190   8e-53   
ref|XP_010450033.1|  PREDICTED: putative DNA-binding protein ESCA...    191   8e-53   
ref|XP_009142892.1|  PREDICTED: putative DNA-binding protein ESCA...    190   8e-53   
gb|KEH42696.1|  AT hook motif DNA-binding family protein                192   8e-53   
emb|CDX79838.1|  BnaA05g03180D                                          190   9e-53   
emb|CDY53650.1|  BnaC04g52840D                                          190   9e-53   
ref|XP_010269998.1|  PREDICTED: putative DNA-binding protein ESCA...    191   9e-53   
gb|ABL63117.1|  AT-hook DNA-binding protein                             189   1e-52   
ref|XP_008787555.1|  PREDICTED: putative DNA-binding protein ESCA...    192   1e-52   
ref|XP_006827517.1|  hypothetical protein AMTR_s00009p00189120          190   1e-52   
ref|XP_003534486.1|  PREDICTED: putative DNA-binding protein ESCA...    190   1e-52   
gb|AFK38460.1|  unknown                                                 190   1e-52   
ref|XP_004492894.1|  PREDICTED: putative DNA-binding protein ESCA...    190   2e-52   
ref|XP_009589526.1|  PREDICTED: putative DNA-binding protein ESCA...    193   2e-52   
gb|AES80473.2|  AT hook motif DNA-binding family protein                190   2e-52   
gb|AAM65129.1|  putative DNA-binding protein                            190   2e-52   
ref|XP_010669276.1|  PREDICTED: putative DNA-binding protein ESCA...    189   2e-52   
ref|XP_009784464.1|  PREDICTED: putative DNA-binding protein ESCA...    190   2e-52   
ref|XP_008439362.1|  PREDICTED: putative DNA-binding protein ESCA...    190   2e-52   
ref|XP_004495454.1|  PREDICTED: putative DNA-binding protein ESCA...    191   3e-52   
emb|CDY12779.1|  BnaC04g28620D                                          189   3e-52   
ref|XP_009409024.1|  PREDICTED: putative DNA-binding protein ESCA...    191   3e-52   
ref|XP_009142094.1|  PREDICTED: putative DNA-binding protein ESCA...    189   3e-52   
ref|XP_004134419.1|  PREDICTED: putative DNA-binding protein ESCA...    190   3e-52   
ref|XP_009123977.1|  PREDICTED: putative DNA-binding protein ESCA...    190   3e-52   
gb|KHN22151.1|  Putative DNA-binding protein ESCAROLA                   187   3e-52   
emb|CDP13007.1|  unnamed protein product                                190   3e-52   
ref|XP_004171657.1|  PREDICTED: putative DNA-binding protein ESCA...    190   4e-52   
gb|KGN56888.1|  hypothetical protein Csa_3G141840                       190   4e-52   
emb|CDY49327.1|  BnaA05g32890D                                          190   4e-52   
ref|XP_008218304.1|  PREDICTED: putative DNA-binding protein ESCA...    190   4e-52   
ref|XP_003552472.1|  PREDICTED: putative DNA-binding protein ESCA...    188   5e-52   
ref|XP_008461695.1|  PREDICTED: putative DNA-binding protein ESCA...    188   5e-52   
gb|ACU24278.1|  unknown                                                 188   5e-52   
emb|CDY64701.1|  BnaCnng44570D                                          190   5e-52   
ref|XP_003624255.1|  AT-hook DNA-binding protein                        190   5e-52   
ref|XP_009762421.1|  PREDICTED: putative DNA-binding protein ESCA...    188   5e-52   
ref|NP_001061043.1|  Os08g0159700                                       189   6e-52   
ref|XP_004161914.1|  PREDICTED: putative DNA-binding protein ESCA...    188   6e-52   
ref|XP_007206474.1|  hypothetical protein PRUPE_ppa018950mg             189   6e-52   
gb|EAZ05670.1|  hypothetical protein OsI_27898                          189   6e-52   
ref|XP_010527388.1|  PREDICTED: putative DNA-binding protein ESCA...    188   7e-52   
ref|XP_007155775.1|  hypothetical protein PHAVU_003G230600g             189   7e-52   
gb|KEH41146.1|  AT hook motif DNA-binding family protein                190   1e-51   
ref|XP_011040836.1|  PREDICTED: putative DNA-binding protein ESCA...    188   1e-51   
ref|XP_002445098.1|  hypothetical protein SORBIDRAFT_07g004070          188   1e-51   
ref|XP_011040834.1|  PREDICTED: putative DNA-binding protein ESCA...    188   1e-51   
ref|XP_004972782.1|  PREDICTED: putative DNA-binding protein ESCA...    187   2e-51   
ref|XP_009413235.1|  PREDICTED: putative DNA-binding protein ESCA...    187   2e-51   
ref|XP_011086333.1|  PREDICTED: putative DNA-binding protein ESCA...    187   2e-51   
ref|XP_011018582.1|  PREDICTED: putative DNA-binding protein ESCA...    187   2e-51   
ref|XP_009133560.1|  PREDICTED: putative DNA-binding protein ESCA...    186   3e-51   
ref|XP_009383960.1|  PREDICTED: putative DNA-binding protein ESCA...    186   3e-51   
ref|XP_004147679.1|  PREDICTED: putative DNA-binding protein ESCA...    186   3e-51   
gb|KFK23205.1|  hypothetical protein AALP_AAs54797U000100               187   3e-51   
ref|XP_006384872.1|  hypothetical protein POPTR_0004s21840g             187   3e-51   
ref|XP_007043111.1|  AT-hook DNA-binding family protein, putative       187   4e-51   
ref|XP_010923237.1|  PREDICTED: putative DNA-binding protein ESCA...    187   5e-51   
ref|XP_004509027.1|  PREDICTED: putative DNA-binding protein ESCA...    187   5e-51   
gb|EPS65852.1|  hypothetical protein M569_08925                         186   5e-51   
ref|XP_009611172.1|  PREDICTED: putative DNA-binding protein ESCA...    186   6e-51   
emb|CDY54780.1|  BnaAnng13510D                                          186   8e-51   
emb|CDY42810.1|  BnaC03g23960D                                          192   8e-51   
emb|CDY23160.1|  BnaA04g05990D                                          186   8e-51   
ref|XP_009399398.1|  PREDICTED: putative DNA-binding protein ESCA...    185   8e-51   
ref|XP_009757136.1|  PREDICTED: putative DNA-binding protein ESCA...    186   9e-51   
gb|ABD65635.1|  hypothetical protein 23.t00073                          186   1e-50   
ref|NP_193515.1|  putative AT-hook DNA-binding family protein           186   1e-50   
ref|XP_009130966.1|  PREDICTED: putative DNA-binding protein ESCA...    186   1e-50   
ref|XP_002868035.1|  hypothetical protein ARALYDRAFT_493093             186   1e-50   
emb|CDX78802.1|  BnaA01g08690D                                          186   1e-50   
emb|CDX83510.1|  BnaA03g19960D                                          191   1e-50   
ref|XP_009776190.1|  PREDICTED: putative DNA-binding protein ESCA...    185   1e-50   
ref|XP_009139507.1|  PREDICTED: putative DNA-binding protein ESCA...    185   1e-50   
ref|XP_003576887.1|  PREDICTED: putative DNA-binding protein ESCA...    184   2e-50   
ref|XP_009399397.1|  PREDICTED: putative DNA-binding protein ESCA...    185   2e-50   
gb|EMS64253.1|  hypothetical protein TRIUR3_00437                       185   2e-50   
ref|XP_006285880.1|  hypothetical protein CARUB_v10007383mg             185   2e-50   
ref|XP_006408178.1|  hypothetical protein EUTSA_v10021166mg             185   3e-50   
emb|CDX90445.1|  BnaA03g43360D                                          184   3e-50   
ref|XP_002510734.1|  DNA binding protein, putative                      184   4e-50   
gb|ABD65169.1|  hypothetical protein 40.t00056                          184   4e-50   
ref|XP_004307301.1|  PREDICTED: putative DNA-binding protein ESCA...    184   4e-50   
ref|XP_004954422.1|  PREDICTED: putative DNA-binding protein ESCA...    183   6e-50   
ref|XP_002273442.1|  PREDICTED: putative DNA-binding protein ESCA...    184   6e-50   
emb|CDY14862.1|  BnaC04g48590D                                          182   7e-50   
gb|KFK37871.1|  hypothetical protein AALP_AA3G040100                    184   7e-50   
ref|XP_007163438.1|  hypothetical protein PHAVU_001G234600g             183   8e-50   
ref|XP_001763021.1|  predicted protein                                  179   9e-50   
ref|XP_006591349.1|  PREDICTED: putative DNA-binding protein ESCA...    183   1e-49   
ref|XP_010677251.1|  PREDICTED: putative DNA-binding protein ESCA...    183   1e-49   
ref|XP_001765845.1|  predicted protein                                  179   1e-49   
ref|XP_006354677.1|  PREDICTED: putative DNA-binding protein ESCA...    182   1e-49   
emb|CDP00129.1|  unnamed protein product                                183   1e-49   
ref|XP_009607803.1|  PREDICTED: putative DNA-binding protein ESCA...    183   1e-49   
ref|XP_003608618.1|  AT-hook DNA-binding protein                        182   2e-49   
ref|XP_006414185.1|  hypothetical protein EUTSA_v10025859mg             182   2e-49   
ref|XP_009597193.1|  PREDICTED: putative DNA-binding protein ESCA...    182   2e-49   
gb|AES90815.2|  AT hook motif DNA-binding family protein                182   3e-49   
ref|XP_009400746.1|  PREDICTED: putative DNA-binding protein ESCA...    182   3e-49   
gb|KEH34733.1|  AT hook motif DNA-binding family protein                182   3e-49   
ref|XP_009774038.1|  PREDICTED: putative DNA-binding protein ESCA...    182   3e-49   



>ref|XP_006363711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=293

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 189/293 (65%), Positives = 223/293 (76%), Gaps = 27/293 (9%)
 Frame = +2

Query  305   MDSQLPPPFHTSRDFNFHPQQFHEQSGQKQRDPEEVN---QQDDGNDGGES---------  448
             M+  LPPPFHT RDFN H  QFH+ S  +Q     +N   Q+ D +D   +         
Sbjct  4     MNHSLPPPFHT-RDFNLH--QFHQNSEDEQSGTSGLNMSGQKRDRDDNNNNNNENSNGGE  60

Query  449   -KNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVA  625
              K+GLG +GEGE+SRRPRGRP+GSKNKPKPPIIITRDSANALRTH+MEIADGCD+M+S++
Sbjct  61    SKDGLGNSGEGEMSRRPRGRPSGSKNKPKPPIIITRDSANALRTHVMEIADGCDIMESIS  120

Query  626   AFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATG  805
              FA+RRQRGVC++SG GIVTNV LRQPASPGA+VTLHGRFEILSLAGSFLPPPAPP+ +G
Sbjct  121   NFARRRQRGVCIMSGTGIVTNVNLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPTTSG  180

Query  806   LTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP--------  961
             LTIYLAGGQGQVVGGSVVGAL+A+GPVVIM+ASFSNAAYERLPLEED+ N P        
Sbjct  181   LTIYLAGGQGQVVGGSVVGALMASGPVVIMSASFSNAAYERLPLEEDNQNHPLPVVPGGG  240

Query  962   ---PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                   G      G    Q++A+  +F G+PPNL+NSIQLP++ YW   RPPF
Sbjct  241   SLGSPPGNIGGQGGQQQQQMMADPSLFHGMPPNLLNSIQLPSEPYWATGRPPF  293



>ref|XP_009613223.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
tomentosiformis]
Length=296

 Score =   294 bits (753),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 200/299 (67%), Positives = 232/299 (78%), Gaps = 33/299 (11%)
 Frame = +2

Query  305   MDS---QLPPPFHTSRDFNFHPQQFHEQSGQ-KQRDPEEVN------QQDDGND------  436
             MDS    LPPPFHT RDFN H  QFH+Q+ + +Q     +N      ++DD N       
Sbjct  1     MDSVNHSLPPPFHT-RDFNLH--QFHQQTSEDEQSGTSGLNMSGLKRERDDNNMNNNNNE  57

Query  437   ---GGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCD  607
                GGESK+GLG +GEGEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIADGCD
Sbjct  58    NPNGGESKDGLGNSGEGEINRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIADGCD  117

Query  608   VMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPA  787
             +M+S++ FA+RRQRGVC++SG GIVTNV LRQPASPGA+VTLHGRFEILSLAGSFLPPPA
Sbjct  118   IMESISNFARRRQRGVCIMSGTGIVTNVNLRQPASPGAIVTLHGRFEILSLAGSFLPPPA  177

Query  788   PPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGN----  955
             PP+A+GLTIYLAGGQGQVVGGSVVGAL+A+GPVVIMAASFSNAAYERLPLEEDD N    
Sbjct  178   PPAASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEEDDQNPLPV  237

Query  956   -------APPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                    +PP   GG         QL+A+  +F G+ PNL+NSIQLP+++YW   RPPF
Sbjct  238   PGGGTLGSPPGNIGGQGRQQQQQQQLMADPSLFHGMQPNLLNSIQLPSESYWATGRPPF  296



>ref|XP_009613222.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
tomentosiformis]
Length=299

 Score =   288 bits (738),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 200/302 (66%), Positives = 232/302 (77%), Gaps = 36/302 (12%)
 Frame = +2

Query  305   MDS---QLPPPFHTSRDFNFHPQQFHEQSGQ-KQRDPEEVN------QQDDGND------  436
             MDS    LPPPFHT RDFN H  QFH+Q+ + +Q     +N      ++DD N       
Sbjct  1     MDSVNHSLPPPFHT-RDFNLH--QFHQQTSEDEQSGTSGLNMSGLKRERDDNNMNNNNNE  57

Query  437   ---GGESKNGLG---GAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIAD  598
                GGESK+GLG    +GEGEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIAD
Sbjct  58    NPNGGESKDGLGITGNSGEGEINRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIAD  117

Query  599   GCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLP  778
             GCD+M+S++ FA+RRQRGVC++SG GIVTNV LRQPASPGA+VTLHGRFEILSLAGSFLP
Sbjct  118   GCDIMESISNFARRRQRGVCIMSGTGIVTNVNLRQPASPGAIVTLHGRFEILSLAGSFLP  177

Query  779   PPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGN-  955
             PPAPP+A+GLTIYLAGGQGQVVGGSVVGAL+A+GPVVIMAASFSNAAYERLPLEEDD N 
Sbjct  178   PPAPPAASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEEDDQNP  237

Query  956   ----------APPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRP  1105
                       +PP   GG         QL+A+  +F G+ PNL+NSIQLP+++YW   RP
Sbjct  238   LPVPGGGTLGSPPGNIGGQGRQQQQQQQLMADPSLFHGMQPNLLNSIQLPSESYWATGRP  297

Query  1106  PF  1111
             PF
Sbjct  298   PF  299



>ref|XP_004245690.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Solanum 
lycopersicum]
Length=292

 Score =   286 bits (731),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 187/292 (64%), Positives = 223/292 (76%), Gaps = 26/292 (9%)
 Frame = +2

Query  305   MDSQLPPPFHTSRDFNFHPQQFHEQSGQKQRDPEEVN---QQDDGNDGGES---------  448
             M+  LPPPFHT RDFN H  QFH+ S  +Q     +N   Q+ D +D   +         
Sbjct  4     MNHSLPPPFHT-RDFNLH--QFHQNSEDEQSGTSGLNMSGQKRDRDDNNNNNNNNENSNG  60

Query  449   ---KNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDS  619
                K+GLG +G+GE+SRRPRGRP+GSKNKPKPPIIITRDSANALRTH+MEIADGCD+M+S
Sbjct  61    GESKDGLGNSGDGEMSRRPRGRPSGSKNKPKPPIIITRDSANALRTHVMEIADGCDIMES  120

Query  620   VAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSA  799
             ++ FA+RRQRGVC++SG G+VTNV LRQPASPGA+VTLHGRFEILSLAGSFLPPPAPP+A
Sbjct  121   ISNFARRRQRGVCIMSGTGVVTNVNLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAA  180

Query  800   TGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP------  961
             +GLTIYLAGGQGQVVGGSVVGAL+A+GPVVIM+ASFSNAAYERLPLEEDD N P      
Sbjct  181   SGLTIYLAGGQGQVVGGSVVGALMASGPVVIMSASFSNAAYERLPLEEDDQNHPLPIVPG  240

Query  962   --PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                      +       Q++A+  +F G+PPNL+NSIQLP++ YW   RPPF
Sbjct  241   GGSLGSPPGNIGQQQQQQIMADPSLFHGMPPNLLNSIQLPSEPYWATGRPPF  292



>ref|XP_009763803.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
sylvestris]
Length=291

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 199/292 (68%), Positives = 231/292 (79%), Gaps = 27/292 (9%)
 Frame = +2

Query  305   MDSQLPPPFHTSRDFNFHPQQFHEQ--------------SGQKQRDPEEVNQQDDGNDGG  442
             ++  LPPPFHT RDFN H  QFH+Q              SGQK R+ ++ N  ++ ++GG
Sbjct  4     LNHSLPPPFHT-RDFNLH--QFHQQNSEDEQSGTSGLNMSGQK-RERDDNNNNNENSNGG  59

Query  443   ESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSV  622
             ESK+GLG +GEGEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIADGCD+MDS+
Sbjct  60    ESKDGLGNSGEGEINRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIADGCDIMDSI  119

Query  623   AAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSAT  802
             + FA+RRQRGVC++SG GIVTNV LRQPASPGA+VTLHGRFEILSLAGSFLPPPAPP+A+
Sbjct  120   SNFARRRQRGVCIMSGTGIVTNVNLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAAS  179

Query  803   GLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggm  982
             GLTIYLAGGQGQVVGGSVVGAL+A+GPVVIMAASFSNAAYERLPLEED+ N  P  GGG 
Sbjct  180   GLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEEDEQNPLPVPGGGT  239

Query  983   dsp---------gaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                              QL+A+  +F G+PPNL+NSIQLP + YW   RPPF
Sbjct  240   LGSPPGNIGGPGQQQQQQLMADPSLFHGMPPNLLNSIQLPTEPYWATGRPPF  291



>ref|XP_009763802.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
Length=294

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 199/295 (67%), Positives = 231/295 (78%), Gaps = 30/295 (10%)
 Frame = +2

Query  305   MDSQLPPPFHTSRDFNFHPQQFHEQ--------------SGQKQRDPEEVNQQDDGNDGG  442
             ++  LPPPFHT RDFN H  QFH+Q              SGQK R+ ++ N  ++ ++GG
Sbjct  4     LNHSLPPPFHT-RDFNLH--QFHQQNSEDEQSGTSGLNMSGQK-RERDDNNNNNENSNGG  59

Query  443   ESKNGLG---GAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVM  613
             ESK+GLG    +GEGEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIADGCD+M
Sbjct  60    ESKDGLGITGNSGEGEINRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIADGCDIM  119

Query  614   DSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP  793
             DS++ FA+RRQRGVC++SG GIVTNV LRQPASPGA+VTLHGRFEILSLAGSFLPPPAPP
Sbjct  120   DSISNFARRRQRGVCIMSGTGIVTNVNLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPP  179

Query  794   SATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQg  973
             +A+GLTIYLAGGQGQVVGGSVVGAL+A+GPVVIMAASFSNAAYERLPLEED+ N  P  G
Sbjct  180   AASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEEDEQNPLPVPG  239

Query  974   ggmdsp---------gaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
             GG                  QL+A+  +F G+PPNL+NSIQLP + YW   RPPF
Sbjct  240   GGTLGSPPGNIGGPGQQQQQQLMADPSLFHGMPPNLLNSIQLPTEPYWATGRPPF  294



>ref|XP_010325447.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Solanum 
lycopersicum]
Length=289

 Score =   278 bits (711),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 186/292 (64%), Positives = 221/292 (76%), Gaps = 29/292 (10%)
 Frame = +2

Query  305   MDSQLPPPFHTSRDFNFHPQQFHEQSGQKQRDPEEVN---QQDDGNDGGES---------  448
             M+  LPPPFHT RDFN H  QFH+ S  +Q     +N   Q+ D +D   +         
Sbjct  4     MNHSLPPPFHT-RDFNLH--QFHQNSEDEQSGTSGLNMSGQKRDRDDNNNNNNNNENSNG  60

Query  449   ---KNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDS  619
                K+GLG   +GE+SRRPRGRP+GSKNKPKPPIIITRDSANALRTH+MEIADGCD+M+S
Sbjct  61    GESKDGLG---DGEMSRRPRGRPSGSKNKPKPPIIITRDSANALRTHVMEIADGCDIMES  117

Query  620   VAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSA  799
             ++ FA+RRQRGVC++SG G+VTNV LRQPASPGA+VTLHGRFEILSLAGSFLPPPAPP+A
Sbjct  118   ISNFARRRQRGVCIMSGTGVVTNVNLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAA  177

Query  800   TGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP------  961
             +GLTIYLAGGQGQVVGGSVVGAL+A+GPVVIM+ASFSNAAYERLPLEEDD N P      
Sbjct  178   SGLTIYLAGGQGQVVGGSVVGALMASGPVVIMSASFSNAAYERLPLEEDDQNHPLPIVPG  237

Query  962   --PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                      +       Q++A+  +F G+PPNL+NSIQLP++ YW   RPPF
Sbjct  238   GGSLGSPPGNIGQQQQQQIMADPSLFHGMPPNLLNSIQLPSEPYWATGRPPF  289



>ref|XP_011081090.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=285

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 186/287 (65%), Positives = 215/287 (75%), Gaps = 20/287 (7%)
 Frame = +2

Query  305   MDSQ-LPPPFHTSRDFNFHPQQFHEQSGQKQRDPE-------EVNQQDDGNDGGESKNGL  460
             MD+  LPPPFHT RDFN      H+    +    E       +   +D+G      K+G 
Sbjct  1     MDNHSLPPPFHT-RDFNLQHHLHHQNQNSEDEQSETTGLNMGQKRNRDEGKSDSAGKDGG  59

Query  461   GGAGEGEIS--RRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFA  634
              GA EGE+S  RRPRGRPAGSKNKP PPIIITRDSANALRTH+MEI+DGCD+MD VA FA
Sbjct  60    SGAAEGEMSANRRPRGRPAGSKNKPIPPIIITRDSANALRTHVMEISDGCDIMDCVANFA  119

Query  635   QRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTI  814
             + RQRGVC++SG+G VTNVTLRQPASPG VVTLHGRFEILSLAGSFLPPPAPP+ATGLTI
Sbjct  120   RSRQRGVCIMSGSGNVTNVTLRQPASPGQVVTLHGRFEILSLAGSFLPPPAPPAATGLTI  179

Query  815   YlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQggg-----  979
             YLAGGQGQVVGGSVVG LLA+GPV+IMAASFSNAAYERLP+EE++ NA P QGG      
Sbjct  180   YLAGGQGQVVGGSVVGQLLASGPVMIMAASFSNAAYERLPIEEEE-NAIPVQGGSLGSPP  238

Query  980   ---mdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                         Q+L +  +FQG+PPNL+NSIQ+PN+A+W   RPPF
Sbjct  239   PPGSVGGQQQQQQILPDPSLFQGMPPNLLNSIQMPNEAFWATGRPPF  285



>gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus]
Length=293

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 222/295 (75%), Gaps = 28/295 (9%)
 Frame = +2

Query  305   MDSQLPPPFHTSRDFNFHPQQFHEQSGQKQRDPEEVN----QQDDGNDGGESKNGLGGAG  472
             MD  LPPPF+T RDFN    QFH Q+   + +    +     +D+ ND G+ K+G G  G
Sbjct  1     MDHSLPPPFNT-RDFNLQ-HQFHHQNHNSEDEQSGTSGLKRDRDEKNDSGDGKDGGGDPG  58

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
              GE++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIADGCD+M+SVA FA+RRQRG
Sbjct  59    SGEMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIADGCDIMESVATFARRRQRG  118

Query  653   VCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggq  832
             VC++SG+G VTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP+AT LTIYLAGGQ
Sbjct  119   VCIMSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAATSLTIYLAGGQ  178

Query  833   gqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggql  1012
             GQVVGGSVVGALLA+GPVVIMAASFSNAAYERLPL+E++ + P   GG + SPG  GG  
Sbjct  179   GQVVGGSVVGALLASGPVVIMAASFSNAAYERLPLDEEENSIPLQSGGSLGSPGGGGGGN  238

Query  1013  lae----------------------qgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                                        +F G+PPNL+NSIQLPN+AYW   RPPF
Sbjct  239   GGVPGQQQQQGGQQQQQLLGGGGDPSALFHGMPPNLLNSIQLPNEAYWATGRPPF  293



>ref|XP_002509637.1| ESC, putative [Ricinus communis]
 gb|EEF51024.1| ESC, putative [Ricinus communis]
Length=298

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 183/289 (63%), Positives = 207/289 (72%), Gaps = 25/289 (9%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQFH---------------EQSGQKQRDPEEVNQQDDGNDGGESK  451
             LPPPFHT RDF  H  Q                 EQSG         +Q+ + ++G E K
Sbjct  11    LPPPFHT-RDFQLHHHQQQQQQFSHHHQQQNSEDEQSGSSSGAGLNKSQKRERDEGSEGK  69

Query  452   NGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAF  631
               +   G GEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTHLME+ADGCD+++SVA F
Sbjct  70    ELIPSGGSGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATF  129

Query  632   AQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLT  811
             A+RRQRGV ++SG G VTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP+ATGLT
Sbjct  130   ARRRQRGVSIMSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAATGLT  189

Query  812   IYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGN---------APP  964
             IYLAGGQGQVVGGSVVG L+A+GPVVIMAASFSNAAYERLPLEE+D           +P 
Sbjct  190   IYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEEDAQLPMQGGAIGSPG  249

Query  965   FQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
               G              A   +FQG+ PNL+NSIQLP +AYW   RPP+
Sbjct  250   AVGQQQQHQQQQQVLGEANAQLFQGLQPNLLNSIQLPAEAYWATGRPPY  298



>ref|XP_011033866.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=303

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 208/294 (71%), Gaps = 30/294 (10%)
 Frame = +2

Query  317   LPPPFHTSRDF-------------------NFHPQQFHEQSGQKQRDPEEVNQQDDGNDG  439
             LPPPFHT RDF                   N   +Q    SG  +    E ++ ++    
Sbjct  11    LPPPFHT-RDFQLHHHQQQQQHQFHHQQQQNSEDEQSGSSSGLNKSLKRERDENNNSMGN  69

Query  440   GESKNGL-GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMD  616
              E K  +  G+GEGEI+RRPRGRP+GSKNKPKPPIIITRDSANALRTHLME+ADGCD+++
Sbjct  70    SEGKELMTSGSGEGEITRRPRGRPSGSKNKPKPPIIITRDSANALRTHLMEVADGCDIVE  129

Query  617   SVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPS  796
             SVA FA+RRQRGVC++SG G VTNVTLRQPASPGA+VTLHGRFEILSLAGSFLPPPAPP+
Sbjct  130   SVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPA  189

Query  797   ATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD---------  949
             ATGLTIYLAGGQGQVVGGSVVG L A+GPVVIMAASFSNAAYERLPLEE+D         
Sbjct  190   ATGLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLEEEDPQMPMQGGE  249

Query  950   GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
               +P   G     P            +F G+PPNL+NSIQLP +AYW   RPP+
Sbjct  250   MGSPGAVGQQQQQPQQQQVMAEQNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY  303



>ref|XP_002303540.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE78519.1| DNA-binding family protein [Populus trichocarpa]
Length=303

 Score =   268 bits (686),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 208/294 (71%), Gaps = 30/294 (10%)
 Frame = +2

Query  317   LPPPFHTSRDF-------------------NFHPQQFHEQSGQKQRDPEEVNQQDDGNDG  439
             LPPPFHT RDF                   N   +Q    SG  +    E ++ ++    
Sbjct  11    LPPPFHT-RDFQLHHHQQQQQHQFHHQQQQNSEDEQSGSSSGLNKSLKRERDENNNSMGN  69

Query  440   GESKNGL-GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMD  616
              E K  +  G+GEGEI+RRPRGRP+GSKNKPKPPIIITRDSANALRTHLME+ADGCD+++
Sbjct  70    SEGKELITSGSGEGEITRRPRGRPSGSKNKPKPPIIITRDSANALRTHLMEVADGCDIVE  129

Query  617   SVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPS  796
             SVA FA+RRQRGVC++SG G VTNVTLRQPASPGA+VTLHGRFEILSLAGSFLPPPAPP+
Sbjct  130   SVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPA  189

Query  797   ATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD---------  949
             ATGLTIYLAGGQGQVVGGSVVG L A+GPVVIMAASFSNAAYERLPLEE+D         
Sbjct  190   ATGLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLEEEDPQMPMQGGE  249

Query  950   GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
               +P   G     P            +F G+PPNL+NSIQLP +AYW   RPP+
Sbjct  250   MGSPGAVGQQQQQPQQQQVMAEQNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY  303



>ref|XP_002281296.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=302

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 214/294 (73%), Gaps = 29/294 (10%)
 Frame = +2

Query  314   QLPPPFHTSRDFNFHPQQF-----------HEQSGQKQRDPEEVNQQDDGND----GGES  448
              LPPPFHT RD + H QQ             EQSG    +  +   +DD N+    G E 
Sbjct  10    SLPPPFHT-RDLHLHHQQQHQFHPQQQNSEDEQSGSSGLNRGQKRDRDDNNENTNGGSEG  68

Query  449   KNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAA  628
                +G +G+GEISRRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIADGCD+++SVA 
Sbjct  69    NEMVGLSGDGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVAT  128

Query  629   FAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGL  808
             FA+RRQRGVC++SG G VTNVTLRQPASPGA+VTLHGRFEILSL+GSFLPPPAPP+ATGL
Sbjct  129   FARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLSGSFLPPPAPPAATGL  188

Query  809   TIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmds  988
             TIYLAGGQGQVVGGSVVG LLA+GPVVIMAASFSNAAYERLPLEE+D   P   G     
Sbjct  189   TIYLAGGQGQVVGGSVVGQLLASGPVVIMAASFSNAAYERLPLEEEDPALPMPGGSLGSP  248

Query  989   pgaaggqllaeqg-------------MFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
              G    Q   +Q              +F G+PPNL+NSIQLP +AYW   RPP+
Sbjct  249   GGVGQHQPPQQQPQQPQQLLADPNAPLFHGLPPNLLNSIQLPAEAYWATGRPPY  302



>ref|XP_003538721.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=298

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 210/295 (71%), Gaps = 36/295 (12%)
 Frame = +2

Query  314   QLPPPFHTSRDFNFHPQQFH---------EQSGQK--------QRDPEEVNQQDDGNDGG  442
              LPPPFHT+RD + H QQ           EQSG          +R+ EE N   DG +GG
Sbjct  10    SLPPPFHTARDLHLHHQQQQHQFHSLQEDEQSGSSGGLNLAAHKREREE-NNNSDGKEGG  68

Query  443   ESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSV  622
                    G+ E EISRRPRGRPAGSKNKPKPPIIITRDSANAL+TH+ME+ADGCD+++SV
Sbjct  69    ------AGSAETEISRRPRGRPAGSKNKPKPPIIITRDSANALKTHVMEVADGCDIVESV  122

Query  623   AAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSAT  802
             +AFA+RRQRGVC++SG G VTNVTLRQPAS GAVVTLHGRFEILSLAGSFLPPPAPP A+
Sbjct  123   SAFARRRQRGVCIMSGTGTVTNVTLRQPASSGAVVTLHGRFEILSLAGSFLPPPAPPEAS  182

Query  803   GLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD-----------  949
             GLTIYLAGGQGQVVGGSVVGAL+A+GPVVIM+ASFSNAAYERLPLE+++           
Sbjct  183   GLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPLEDEEPSIGLQGGGSI  242

Query  950   GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPN-DAYWGGSRPPF  1111
             G+     G G                +F G+ PNL+NS+Q+P+ + +W   R P+
Sbjct  243   GSPGGGGGVGQSQAPHQLMGDSTTAPLFHGLNPNLLNSVQMPSTETFWATGRSPY  297



>ref|XP_002299584.2| DNA-binding family protein [Populus trichocarpa]
 gb|EEE84389.2| DNA-binding family protein [Populus trichocarpa]
Length=302

 Score =   265 bits (678),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 206/295 (70%), Gaps = 33/295 (11%)
 Frame = +2

Query  317   LPPPFHTSRDF------------------NFHPQQFHEQSGQKQ---RDPEEVNQQDDGN  433
             LPPPFHT RDF                  N   +Q    SG  +   R+ +E N      
Sbjct  11    LPPPFHT-RDFQLHHQQQQQHQFHHQQQQNSEDEQSGSSSGLNKSLKRERDESNNSMGNR  69

Query  434   DGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVM  613
             +G E      G G+GEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTHLME+ADGCD++
Sbjct  70    EGQELITS--GDGDGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEVADGCDIV  127

Query  614   DSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP  793
             +SVA FA+RRQRGVC++SG G VTNVTLRQPASPGA+VTLHGRFEILSLAGSFLPPPAPP
Sbjct  128   ESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPP  187

Query  794   SATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP----  961
             +ATGLTIYLAGGQGQVVGGSVVG L A+GPVVIMAASFSNAAYERLPLEE+D   P    
Sbjct  188   AATGLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLEEEDPQMPMQGG  247

Query  962   -----PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                     G     P            +F G+PPNL+NSIQLP +AYW   RPP+
Sbjct  248   GMGSPGGVGQQQQQPQQHQVMAEQNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY  302



>gb|KDP25577.1| hypothetical protein JCGZ_20733 [Jatropha curcas]
Length=295

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 182/288 (63%), Positives = 207/288 (72%), Gaps = 26/288 (9%)
 Frame = +2

Query  317   LPPPFHTSRDF--------------NFHPQQFHEQSGQKQRDPEEVNQQDDGNDGGESKN  454
             LPPPFHT RDF              N   +Q    SG    +  +  ++D+GN+  E K 
Sbjct  11    LPPPFHT-RDFQLHHQFPHHQQHNNNSEDEQSGSSSGAAGLNKSQKRERDEGNNS-EGKE  68

Query  455   GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFA  634
              +    +GEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTHLME+ADGCD+++SVA FA
Sbjct  69    LIPTGSQGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFA  128

Query  635   QRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTI  814
             +RRQRGV ++SG G VTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP+ATGLTI
Sbjct  129   RRRQRGVSIMSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAATGLTI  188

Query  815   YlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQ--------  970
             YLAGGQGQVVGGSVVG L A+GPVVIMAASFSNAAYERLPLEE+D   P  Q        
Sbjct  189   YLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLEEEDPQLP-MQGGGIGSPG  247

Query  971   gggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWG-GSRPPF  1111
               G            A   +F G+ PNL+NSIQLP +AYW  G RPP+
Sbjct  248   AVGQQQQQPQQVLGEANAQLFHGLQPNLLNSIQLPTEAYWATGGRPPY  295



>ref|XP_010053390.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW77667.1| hypothetical protein EUGRSUZ_D01968 [Eucalyptus grandis]
Length=303

 Score =   265 bits (677),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 184/294 (63%), Positives = 213/294 (72%), Gaps = 30/294 (10%)
 Frame = +2

Query  317   LPPPFHTSRDFNFH----------PQQFHEQSG---QKQRDPEEVNQQDDGNDGGESKNG  457
             LPPPFHT RDF             P    E+SG     +R+ +E N  ++   G   K+ 
Sbjct  11    LPPPFHT-RDFQLQQQQHQFLHHPPSSEDERSGGSGSLKRERDESNGDNNPKGGEFGKDQ  69

Query  458   LGG--AGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAF  631
             L G   GEGEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIADGCD+++SVA F
Sbjct  70    LLGDQGGEGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATF  129

Query  632   AQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLT  811
             A+RRQRGVC++SG+G VTNVTLRQPASPGA+VTLHGRFEILSLAGSFLPPPAPP+A+GLT
Sbjct  130   ARRRQRGVCIMSGSGTVTNVTLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAASGLT  189

Query  812   IYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGN------------  955
             IYLAGGQGQVVGGSVVG L+A+GPVVIMAASFSNAAYERLPLEEDD              
Sbjct  190   IYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEDDAGIQVQGGSMGSPG  249

Query  956   --APPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                          P           G+F G+PPNL+NSIQ+P++AYW G+RPP+
Sbjct  250   SGVGGQTPQQQQQPPPQLLGDPNNAGLFHGLPPNLLNSIQMPSEAYWSGARPPY  303



>ref|XP_011029110.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=302

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 206/295 (70%), Gaps = 33/295 (11%)
 Frame = +2

Query  317   LPPPFHTSRDF------------------NFHPQQFHEQSGQKQ---RDPEEVNQQDDGN  433
             LPPPFHT RDF                  N   +Q    SG  +   R+ +E N      
Sbjct  11    LPPPFHT-RDFQLHHQQQQQHQFHHQQQQNSEDEQSGSSSGLNKSLKRERDESNNSMGNR  69

Query  434   DGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVM  613
             +G E      G G+GEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTHLME+ADGCD++
Sbjct  70    EGQELITS--GDGDGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEVADGCDIV  127

Query  614   DSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP  793
             +SVA FA+RRQRGVC++SG G VTNVTLRQPASPGA+VTLHGRFEILSLAGSFLPPPAPP
Sbjct  128   ESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPP  187

Query  794   SATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP----  961
             +ATGLTIYLAGGQGQVVGGSVVG L A+GPVVIMAASFSNAAYERLPLEE+D   P    
Sbjct  188   AATGLTIYLAGGQGQVVGGSVVGPLTASGPVVIMAASFSNAAYERLPLEEEDPQMPMQGG  247

Query  962   -----PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                     G     P            +F G+PPNL+NSIQLP +AYW   RPP+
Sbjct  248   GMGSPGGVGQQQQQPQQHQVMAEPNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY  302



>ref|XP_011014152.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=302

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 207/295 (70%), Gaps = 33/295 (11%)
 Frame = +2

Query  317   LPPPFHTSRDF------------------NFHPQQFHEQSGQKQ---RDPEEVNQQDDGN  433
             LPPPFHT RDF                  N   +Q    SG  +   R+ +E N      
Sbjct  11    LPPPFHT-RDFQLHHQQQQQHQFHHQQQQNSEDEQSGSSSGLNKSLKRERDESNNSMGNR  69

Query  434   DGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVM  613
             +G E      G G+GEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTHLME+ADGCD++
Sbjct  70    EGQELITS--GDGDGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEVADGCDIV  127

Query  614   DSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP  793
             +SVA FA+RRQRGVC++SG G VTNVTLRQPASPGA+VTLHGRFEILSLAGSFLPPPAPP
Sbjct  128   ESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPP  187

Query  794   SATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD--------  949
             +ATGLTIYLAGGQGQVVGGSVVG L A+GPVVIMAASFSNAAYERLPLEE+D        
Sbjct  188   AATGLTIYLAGGQGQVVGGSVVGPLTASGPVVIMAASFSNAAYERLPLEEEDPQMPMQGG  247

Query  950   -GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                +P   G     P            +F G+PPNL+NSIQLP +AYW   RPP+
Sbjct  248   GMGSPEGVGQQQQQPQQHQVMAEQNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY  302



>ref|XP_008373872.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=310

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 187/311 (60%), Positives = 216/311 (69%), Gaps = 43/311 (14%)
 Frame = +2

Query  305   MDSQ-LPPPFHTSRDFNFHPQQFH------------EQSG-----QKQRDPEEVNQQDDG  430
             MD+  LPPPFHT RDF+ H QQ H            EQ+G     + Q+   +++  D G
Sbjct  1     MDTHSLPPPFHT-RDFHLHHQQQHPQFHHQQQNSEDEQTGSSGLNKGQKRERDIDNNDSG  59

Query  431   NDGGESKNGL----GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIAD  598
              +GGE    L     GA   E++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIAD
Sbjct  60    GNGGELGKELNVTMSGADGSEMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIAD  119

Query  599   GCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLP  778
             GCD+++SVA FA+RRQRGVC++SG G VTNVTLRQPASPG++VTLHGRFEILSLAGSFLP
Sbjct  120   GCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGSIVTLHGRFEILSLAGSFLP  179

Query  779   PPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNA  958
             PPAPP+ATGLTIYLAGGQGQVVGGSVVG L A+GPVVIMAASFSNAAYERLPLEED+G  
Sbjct  180   PPAPPAATGLTIYLAGGQGQVVGGSVVGTLXASGPVVIMAASFSNAAYERLPLEEDEGQL  239

Query  959   P-------------------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPND  1081
             P                     Q               +   +F G+PPNL+NS+QLP +
Sbjct  240   PMQGGGGGSLGSPSGVGHQNQQQQQQQQQQQLMAEAANSNPPLFHGLPPNLLNSMQLPAE  299

Query  1082  -AYWGGSRPPF  1111
              AYW   RPPF
Sbjct  300   AAYWATGRPPF  310



>ref|XP_009594477.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=219

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 178/216 (82%), Gaps = 3/216 (1%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             EGE+ RRPRGRP GSKN+PKPPIII RDSANALRTHLMEIADGCD+M+SV+ F++RRQRG
Sbjct  4     EGEMGRRPRGRPTGSKNRPKPPIIINRDSANALRTHLMEIADGCDIMESVSNFSRRRQRG  63

Query  653   VCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggq  832
             VC++SG G VTNV L+QPASPG + TLHGRFEILSL+GSFLPPPAP +A+GLTIYLAGGQ
Sbjct  64    VCIMSGTGNVTNVNLKQPASPGEIATLHGRFEILSLSGSFLPPPAPSAASGLTIYLAGGQ  123

Query  833   gqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPF---Qgggmdspgaag  1003
             GQVVGGSVVGAL+A+GPVVIMAASFSNAAYERLPLEEDD N  P       G        
Sbjct  124   GQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEEDDQNPHPVAPGDSPGATGGHGQQ  183

Query  1004  gqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
              QLLA+  +  G+PPNL+NSIQLP + YW   RPPF
Sbjct  184   QQLLADGSILHGMPPNLLNSIQLPPEGYWATGRPPF  219



>ref|XP_006440441.1| hypothetical protein CICLE_v10021296mg [Citrus clementina]
 gb|ESR53681.1| hypothetical protein CICLE_v10021296mg [Citrus clementina]
Length=308

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 172/254 (68%), Positives = 202/254 (80%), Gaps = 19/254 (7%)
 Frame = +2

Query  407   EVNQQDDGND--GGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTH  580
             ++++ DD N+    E K    G+GEGEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTH
Sbjct  55    KLDRGDDNNNNSSSEGKELFQGSGEGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTH  114

Query  581   LMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSL  760
             +MEIADGCD+++SVA FA+RRQRGVC+LSG G VTNVTLRQPASPGA+V+LHGRFEILSL
Sbjct  115   VMEIADGCDIVESVATFARRRQRGVCILSGTGTVTNVTLRQPASPGAIVSLHGRFEILSL  174

Query  761   AGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLE  940
             +GSFLPPPAPP+A+GLTIYLAGGQGQVVGGSVVG L+ +GPVVIMAASFSNAAYERLPLE
Sbjct  175   SGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLMTSGPVVIMAASFSNAAYERLPLE  234

Query  941   EDDGNAPPFQgggmdspgaaggqllaeqg----------------MFQGVPPNLINSIQL  1072
             E++G  P   G      G AG  ++A+Q                 +F G+PPNL+NSIQL
Sbjct  235   EEEGQLPMQGGSIGSPGGGAGAGVVAQQQPQQQQPVMGDANNNGPLFHGLPPNLLNSIQL  294

Query  1073  PNDAYWG-GSRPPF  1111
             P +AYW  G RPP+
Sbjct  295   PTEAYWATGGRPPY  308



>ref|XP_006477312.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|KDO63720.1| hypothetical protein CISIN_1g021751mg [Citrus sinensis]
Length=308

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 171/254 (67%), Positives = 201/254 (79%), Gaps = 19/254 (7%)
 Frame = +2

Query  407   EVNQQDDGND--GGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTH  580
             ++++ DD N+    E K    G+GEGEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTH
Sbjct  55    KLDRGDDNNNNSSSEGKELFQGSGEGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTH  114

Query  581   LMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSL  760
             +MEIADGCD+++SVA FA+RRQRGVC+LSG G VTNVTLRQPASPGA+V+LHGRFEILSL
Sbjct  115   VMEIADGCDIVESVATFARRRQRGVCILSGTGTVTNVTLRQPASPGAIVSLHGRFEILSL  174

Query  761   AGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLE  940
             +GSFLPPPAPP+A+GLTIYLAGGQGQVVGGSVVG L+ +GPVVIMAASFSNAAYERLPLE
Sbjct  175   SGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLMTSGPVVIMAASFSNAAYERLPLE  234

Query  941   EDDGNAPPFQgggmdspgaaggqllaeqg----------------MFQGVPPNLINSIQL  1072
             E++G  P   G      G AG  ++ +Q                 +F G+PPNL+NSIQL
Sbjct  235   EEEGQLPMQGGSIGSPGGGAGAGVVGQQQPQQQQPLMGDANNNGPLFHGLPPNLLNSIQL  294

Query  1073  PNDAYWG-GSRPPF  1111
             P +AYW  G RPP+
Sbjct  295   PTEAYWATGGRPPY  308



>ref|XP_002511734.1| ESC, putative [Ricinus communis]
 gb|EEF50403.1| ESC, putative [Ricinus communis]
Length=299

 Score =   258 bits (658),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 210/291 (72%), Gaps = 28/291 (10%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQF---------------HEQSGQKQRDPEEVNQQDDGN--DGGE  445
             LPPPFHT RD + HP                   EQ+G    +  +  + D+    +G E
Sbjct  11    LPPPFHT-RDLHLHPHHQFQHHHQQQQQQQNSEDEQTGNGSINRGQKREHDEITTPEGKE  69

Query  446   SKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVA  625
                  GG G+GE++RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA+G D+M+SV+
Sbjct  70    LVPTTGG-GDGEMTRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIANGSDIMESVS  128

Query  626   AFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATG  805
              FA+RRQRGVC+LSG G VTNVTLRQPASPGAVVTLHGRFEILSL+GSFLPPPAPP+A+G
Sbjct  129   TFARRRQRGVCILSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASG  188

Query  806   LTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP--------  961
             LTIYLAGGQGQVVGGSVVG LLA+GPVVIMAASF NAAYERLPLEEDDG  P        
Sbjct  189   LTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEEDDGQVPVPGSGPLD  248

Query  962   -PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
              P   G                 +FQG+PPNL+NS+QLP +AYWG +RPPF
Sbjct  249   SPGVVGQTQPQQPQQLMQDPNPPLFQGLPPNLLNSVQLPAEAYWGAARPPF  299



>ref|XP_008238673.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=309

 Score =   258 bits (658),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 209/310 (67%), Gaps = 42/310 (14%)
 Frame = +2

Query  305   MDSQ-LPPPFHTSRDF--------------NFHPQQ-----FHEQSGQKQRDPEEVNQQD  424
             MD+  LPPPFHT RDF              N   +Q      + +  +++RD +  +  +
Sbjct  1     MDTHSLPPPFHT-RDFHLQHHPQFHHQQQQNSEDEQTGSSGLNNKGQKRERDIDNDSGGN  59

Query  425   DGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGC  604
              G+ G E    + G    E++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIADGC
Sbjct  60    GGDLGKELNVTISGGDGSEMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIADGC  119

Query  605   DVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP  784
             D+++SVA FA+RRQRGVC++SG G VTNVT+RQPASPG++VTLHGRFEILSLAGSFLPPP
Sbjct  120   DIVESVATFARRRQRGVCIMSGTGTVTNVTIRQPASPGSIVTLHGRFEILSLAGSFLPPP  179

Query  785   APPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP-  961
             APP+ATGLTIYLAGG GQVVGGSVVG L+A+GPVVIMAASFSNAAYERLPLEED+G  P 
Sbjct  180   APPAATGLTIYLAGGGGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEDEGQLPM  239

Query  962   -------------------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPND-  1081
                                                      +F G+PPNL+NS+QLP + 
Sbjct  240   QGGGGGSLGSPSGVGHQQQQQHQQQQQQQQLLAEAANTNAPLFHGLPPNLLNSMQLPAEA  299

Query  1082  AYWGGSRPPF  1111
             AYW   RPP+
Sbjct  300   AYWATGRPPY  309



>ref|XP_007040019.1| AT-hook DNA-binding family protein [Theobroma cacao]
 gb|EOY24520.1| AT-hook DNA-binding family protein [Theobroma cacao]
Length=302

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 211/294 (72%), Gaps = 29/294 (10%)
 Frame = +2

Query  314   QLPPPFHTSRDFNF-----------------HPQQFHEQSGQKQRDPEEVNQQDDGNDGG  442
              LPPPF+  RDFN                    +Q    SG ++RD ++ N  ++ +   
Sbjct  10    SLPPPFNI-RDFNLHHQQQQQQEHQFHHQNSEDEQSGSSSGLRKRDRDDSNNINNSSSAN  68

Query  443   ESK-NGLG--GAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVM  613
              ++ N L   G+GEGEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEI DGCD++
Sbjct  69    NNEGNELSFPGSGEGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIGDGCDIV  128

Query  614   DSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP  793
             +SVA FA+RRQRGVC++SG G VTNVTLRQPAS GA+VTLHGRFEILSLAGSFLPPPAPP
Sbjct  129   ESVATFARRRQRGVCIMSGTGTVTNVTLRQPASAGAIVTLHGRFEILSLAGSFLPPPAPP  188

Query  794   SATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDG-------  952
             +ATGLTIYLAGGQGQVVGGSVVG L+ +GPVVIMAASFSNAAYERLPLEE++        
Sbjct  189   AATGLTIYLAGGQGQVVGGSVVGTLICSGPVVIMAASFSNAAYERLPLEEEEQLPMQGGA  248

Query  953   -NAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
               +P   GG             +   +F G+PPNL+NSIQLP +A+W   RPPF
Sbjct  249   IGSPGAIGGQQQQQQQQQVLAESNAPLFHGLPPNLLNSIQLPTEAFWATGRPPF  302



>ref|XP_011017502.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=298

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 180/289 (62%), Positives = 210/289 (73%), Gaps = 25/289 (9%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQF-------HEQSGQ------KQRDPEEVNQQDDGNDGGESKNG  457
             LPPPFHT RDF+ H  Q         EQSG       ++R+  E+   ++    G+    
Sbjct  11    LPPPFHT-RDFHLHQFQHQQQQNSEDEQSGSGNLNRGQKREHAEIATNNNNTAEGKELVP  69

Query  458   LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
                 GEGEI+RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA GCD+M+SV+ FA 
Sbjct  70    SSAGGEGEITRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIASGCDIMESVSTFAG  129

Query  638   RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
             RRQRGVC+LSG G VTNVTL+QPASPGAVVTLHGRFEILSL+GSFLPPPAPP+A+GLTIY
Sbjct  130   RRQRGVCILSGTGTVTNVTLKQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIY  189

Query  818   laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGN----------APPF  967
             LAGGQGQVVGGSVVG LLA+GPVVIMAASF NAAYERLPLEED+            +P  
Sbjct  190   LAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEEDESQTPVPGTGPLGSPGV  249

Query  968   QgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWG-GSRPPF  1111
                G  +             +FQG+P NL+NS+QLP++AYWG G RPP+
Sbjct  250   NSIGQQNQQQHQLMQDPNTSLFQGLPQNLLNSVQLPSEAYWGTGGRPPY  298



>ref|XP_008364289.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=308

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 217/310 (70%), Gaps = 43/310 (14%)
 Frame = +2

Query  305   MDSQ-LPPPFHTSRDFNFHPQQF------------HEQSG-----QKQRDPEEVNQQDDG  430
             MD+  LPPPFHT RDF+ H QQ              EQ+G     + Q+   +++  D G
Sbjct  1     MDTHSLPPPFHT-RDFHLHHQQQHPQFLHQQQNSEDEQTGSSGLNKGQKRERDIDNNDSG  59

Query  431   NDGGESKNGL-----GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIA  595
              +GGE    L     GG G  E++RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA
Sbjct  60    GNGGELGKELNVTMSGGDGS-EMTRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIA  118

Query  596   DGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFL  775
             DGCD+++SVA FA+RRQRGVC++SG G VTNVTLRQPASPG+VVTLHGRFEILSLAGSFL
Sbjct  119   DGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGSVVTLHGRFEILSLAGSFL  178

Query  776   PPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGN  955
             PPPAPP+ATGLTIYLAGGQGQVVGGSVVG L+A+GPVVIMAASFSNAAYERLPLEED+G 
Sbjct  179   PPPAPPAATGLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEDEGQ  238

Query  956   AP-----------------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPND-  1081
              P                   Q               +   +F G+ PNL+NS++LP + 
Sbjct  239   LPMQGGGGSVGSPTGVGHQNQQQQQPQHQQLLAEAANSNAPLFHGLHPNLLNSMELPAEA  298

Query  1082  AYWGGSRPPF  1111
             AYW  SRPPF
Sbjct  299   AYWATSRPPF  308



>ref|XP_008346594.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=310

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 186/311 (60%), Positives = 214/311 (69%), Gaps = 43/311 (14%)
 Frame = +2

Query  305   MDSQ-LPPPFHTSRDFNFHPQQFH------------EQSG-----QKQRDPEEVNQQDDG  430
             MD+  LPPPFHT RDF+ H QQ H            EQ+G     + Q+   + +  D G
Sbjct  1     MDTHSLPPPFHT-RDFHLHHQQQHPQFLHQQQNSEDEQTGSSGLNKGQKRERDXDNNDSG  59

Query  431   NDGGESKNGL----GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIAD  598
              +GGE    L     G    E++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIAD
Sbjct  60    GNGGELGKELNVTMSGXDGSEMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIAD  119

Query  599   GCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLP  778
             GCD+++SVA FA+RRQRGVC++SG G VTNVTLRQPASPG++VTLHGRFEILSLAGSFLP
Sbjct  120   GCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGSIVTLHGRFEILSLAGSFLP  179

Query  779   PPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNA  958
             PPAPP+ATGLTIYLAGGQGQVVGGSVVG L A+GPVVIMAASFSNAAYERLPLEED+G  
Sbjct  180   PPAPPAATGLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLEEDEGQL  239

Query  959   P-------------------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPND  1081
             P                     Q               +   +F G+PPNL+NS+QLP +
Sbjct  240   PMQGGGGGSLGSPSGVGHQNQQQQQQQQQQQLMAEAANSNPPLFHGLPPNLLNSMQLPAE  299

Query  1082  -AYWGGSRPPF  1111
              AYW   RPPF
Sbjct  300   AAYWATGRPPF  310



>ref|XP_002279636.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
 emb|CAN81187.1| hypothetical protein VITISV_029906 [Vitis vinifera]
 emb|CBI38865.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 179/297 (60%), Positives = 208/297 (70%), Gaps = 39/297 (13%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQF----------HEQSGQ------KQRDPEEVNQQD-----DGN  433
             LPPPFHT RD   H               EQSG       ++RD +E N  +     DG 
Sbjct  11    LPPPFHT-RDLQLHHHHQYQHHPQANSEDEQSGSSSLNRAQKRDRDESNATNNTSPIDGK  69

Query  434   DGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVM  613
             + G S      +G+GEI+RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA GCD+M
Sbjct  70    EFGTS------SGDGEITRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIATGCDIM  123

Query  614   DSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP  793
             DS+  FA+RRQRG+C+LSG+G VTNVTLRQPASPGAVVTLHGRFEILSL+GSFLPPPAPP
Sbjct  124   DSLNTFARRRQRGICILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLSGSFLPPPAPP  183

Query  794   SATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP----  961
             +A+GLTIYLAGGQGQVVGGSVVG LLA+GPVVIMAASF NAAYERLPLE+++   P    
Sbjct  184   AASGLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEDEEPQVPIPGS  243

Query  962   -------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                                          +FQG+PPNL+NS QLP +AYWG +RPP+
Sbjct  244   GPLGSPGMVGQQPQQQQQQQQLLPDPNASLFQGLPPNLLNSCQLPAEAYWGTARPPY  300



>gb|KDP28740.1| hypothetical protein JCGZ_14511 [Jatropha curcas]
Length=308

 Score =   256 bits (653),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 181/299 (61%), Positives = 208/299 (70%), Gaps = 35/299 (12%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQF----------HEQSGQ------KQRDPEEVNQQDDGNDGGES  448
             LPPPFHT RD + H               EQSG       ++R+ +E+      N   E 
Sbjct  11    LPPPFHT-RDLHLHTHHQFQHHQQQNSEDEQSGNGSFNRGQKREHDEITTGTANNTSVEG  69

Query  449   KNGL--GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSV  622
             K  +     GEGE+ RRPRGRPAGSKNK KPPIIITRDSANALR+H+MEIA+GCD+M+SV
Sbjct  70    KELVPANSGGEGEMGRRPRGRPAGSKNKAKPPIIITRDSANALRSHVMEIANGCDIMESV  129

Query  623   AAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSAT  802
             + FA+RRQRGVC+LSG G VTNVTLRQPASPGAVVTLHGRFEILSL+GSFLPPPAPP+A+
Sbjct  130   STFARRRQRGVCILSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAAS  189

Query  803   GLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD------GNAP-  961
             GLTIYLAGGQGQVVGGSVVG LLA+GPVVIMAASF NAAYERLPLEED+      GN P 
Sbjct  190   GLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEEDEGQVAVAGNGPL  249

Query  962   ---------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                        Q                   +FQG+PPNL+NS+QLP +AYWG  RPP+
Sbjct  250   GSPGAVGQPQQQPQQQQQTQQQQLMQDPNPSLFQGLPPNLLNSVQLPAEAYWGTGRPPY  308



>ref|XP_011034536.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=300

 Score =   255 bits (651),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 178/291 (61%), Positives = 209/291 (72%), Gaps = 27/291 (9%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQFH-------EQSGQKQRDPEEVNQQDDGNDGGESKNGL-----  460
             LPPPFHT RDF+ H  Q H       EQSG    +  +  + D+  +   +  GL     
Sbjct  11    LPPPFHT-RDFHLHQFQHHQQQNSEDEQSGNGDLNRGQKREHDEITNNNNTVEGLELVPS  69

Query  461   GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQR  640
                GEGEISRRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA GCD+M+SV+ FA+R
Sbjct  70    NSGGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIASGCDIMESVSTFARR  129

Query  641   RQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             RQRGVC+LSG G VTNVTL+QPASPGAVVTLHGRFEILSL+GSFLPPPAPP+A+GLT+YL
Sbjct  130   RQRGVCILSGTGTVTNVTLKQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTVYL  189

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPF-----------  967
             AGGQGQV+GGSV G LLA+GPVV+MAASF NAAYERLPLEED  +  P            
Sbjct  190   AGGQGQVIGGSVAGPLLASGPVVVMAASFGNAAYERLPLEEDIESQTPMLGSGPLGSPGI  249

Query  968   --QgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWG-GSRPPF  1111
                G    +          +  +FQG+P NL+NS+QLP +AYWG G RPP+
Sbjct  250   NNIGQQQQNQQQQQLMQDPKTSLFQGLPQNLLNSVQLPAEAYWGTGGRPPY  300



>ref|XP_009788952.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=219

 Score =   251 bits (642),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 177/216 (82%), Gaps = 3/216 (1%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             EGE+ RRPRGRPAGSKN+PKPPIII RDSANALRTHLMEIADGCD+M+SV+ F++RRQRG
Sbjct  4     EGEMGRRPRGRPAGSKNRPKPPIIINRDSANALRTHLMEIADGCDIMESVSNFSRRRQRG  63

Query  653   VCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggq  832
             VC++SG G VTNV L+QPASPG + TLHGRFEILSL+GSFLPPPAP +A+GLTIYLAGGQ
Sbjct  64    VCIMSGTGNVTNVNLKQPASPGEIATLHGRFEILSLSGSFLPPPAPSAASGLTIYLAGGQ  123

Query  833   gqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQ---gggmdspgaag  1003
             GQVVGGSVVGAL+A+GPVVIMAASF NAAYERLPLEEDD N  P       G        
Sbjct  124   GQVVGGSVVGALMASGPVVIMAASFGNAAYERLPLEEDDQNPLPVAPGGSPGATGGHGQQ  183

Query  1004  gqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
              QLLA+  +   +PPNL+NSIQLP + YW   RPPF
Sbjct  184   QQLLADGSILHVMPPNLLNSIQLPPEGYWATGRPPF  219



>emb|CDP09863.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 192/287 (67%), Positives = 213/287 (74%), Gaps = 30/287 (10%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQFHEQS---------------GQKQRDPEEVNQQDDGNDGGESK  451
             LPPPF+T RDFN   QQFH Q+               GQK RD EE N   D N G    
Sbjct  13    LPPPFNT-RDFNL--QQFHHQTHNSEDEHSGTSGLNMGQK-RDREEKN---DINGGDGKD  65

Query  452   NGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAF  631
              G      GEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIADGCD+M+SVA F
Sbjct  66    GGSSAGDGGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIADGCDIMESVANF  125

Query  632   AQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLT  811
             A+RRQRGVC++SG G VTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP+AT LT
Sbjct  126   ARRRQRGVCIMSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAATTLT  185

Query  812   IYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD-------GNAPPFQ  970
             IYLAGGQGQVVGGSVVGAL+A+GPVVIMAASFSNAAYERLPL+ED+       G+     
Sbjct  186   IYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLDEDESSLQMQGGSLGSPG  245

Query  971   gggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
               G         QL+A+  +F  +PPNL NS+QLPN+AYW   RPPF
Sbjct  246   AVGGQQQQQQQQQLMADPSLFS-MPPNLFNSVQLPNEAYWATGRPPF  291



>ref|XP_002301300.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE80573.1| DNA-binding family protein [Populus trichocarpa]
Length=298

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 178/289 (62%), Positives = 209/289 (72%), Gaps = 25/289 (9%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQFH-------EQSGQ------KQRDPEEVNQQDDGNDGGESKNG  457
             LPPPFHT RDF+ H  Q         EQSG       ++R+  E+   ++    G+    
Sbjct  11    LPPPFHT-RDFHLHQFQHQQQQNSEDEQSGNGNLNRGQKREHAEIATNNNNTAEGKELVP  69

Query  458   LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
                 GEGEI+RRPRGRPAGSKNKPKPPIIITRDS NALR+H+MEIA GCD+M+SV+ FA+
Sbjct  70    SSAGGEGEITRRPRGRPAGSKNKPKPPIIITRDSPNALRSHVMEIATGCDIMESVSTFAR  129

Query  638   RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
             RRQRGVC+LS  G VTNVTL+QPASPGAVVTLHGRFEILSL+GSFLPPPAPP+A+GLTIY
Sbjct  130   RRQRGVCILSATGTVTNVTLKQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIY  189

Query  818   laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGN----------APPF  967
             LAGGQGQVVGGSVVG LLA+GPVVIMAASF NAAYERLPLEED+            +P  
Sbjct  190   LAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEEDESQTPVPGTGPLGSPGV  249

Query  968   QgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWG-GSRPPF  1111
                G  +             +FQG+P NL+NS+QLP++AYWG G RPP+
Sbjct  250   SSIGQQNQQQHQLMQDPNTSLFQGLPQNLLNSVQLPSEAYWGTGGRPPY  298



>ref|XP_010108102.1| hypothetical protein L484_023188 [Morus notabilis]
 gb|EXC17834.1| hypothetical protein L484_023188 [Morus notabilis]
Length=302

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 186/232 (80%), Gaps = 15/232 (6%)
 Frame = +2

Query  461   GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQR  640
             GG    +++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIADGCD+++SV+ FA+R
Sbjct  71    GGDDHDKMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVSTFARR  130

Query  641   RQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             RQRGVC++SG G VTNVTLRQPASPGA+VTLHGRFEILSLAGSFLPPPAPP+ATGLTIYL
Sbjct  131   RQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYL  190

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaa  1000
             AGGQGQVVGGSVVG L+A+GPVV+MAASFSNAAYERLPLEEDD    P QGGG       
Sbjct  191   AGGQGQVVGGSVVGTLIASGPVVVMAASFSNAAYERLPLEEDDQTQLPLQGGGGGVGSPT  250

Query  1001  ggqllaeq---------------gMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
             GGQ                     +F G+PPNL+NSIQ+P +AYW   RPP+
Sbjct  251   GGQQQQIMAAAAAAEAANSGGAPTLFHGLPPNLLNSIQMPAEAYWASGRPPY  302



>ref|XP_002320066.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE98381.1| DNA-binding family protein [Populus trichocarpa]
Length=300

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 177/291 (61%), Positives = 208/291 (71%), Gaps = 27/291 (9%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQF-------HEQSGQKQRDPEEVNQQDDGNDGGESKNGL-----  460
             LPPPFHT RDF+ H  Q         EQSG    +  +  + D+ N+   +  GL     
Sbjct  11    LPPPFHT-RDFHLHQFQHHQQQNSEDEQSGNGDLNRGQKREHDEINNNNNTVEGLELVPS  69

Query  461   GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQR  640
                GEGEISRRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA G D+M+SV+ FA+R
Sbjct  70    SSGGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIATGSDIMESVSTFARR  129

Query  641   RQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             RQRGVC+LSG G VTNVTL+QPASPGAVVTLHGRFEILSL+GSFLPPPAPP+A+GLT+YL
Sbjct  130   RQRGVCILSGTGTVTNVTLKQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTVYL  189

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPF-----------  967
             AGGQGQV+GGSV G LLA+GPVV+MAASF NAAYERLPLEED  +  P            
Sbjct  190   AGGQGQVIGGSVAGPLLASGPVVVMAASFGNAAYERLPLEEDIESQTPMLGSGPLGSPGI  249

Query  968   --QgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWG-GSRPPF  1111
                G    +          +  +FQG+P NL+NS+QLP +AYWG G RPP+
Sbjct  250   NNIGQQQQNQQQQQLMQDPKTSLFQGLPQNLLNSVQLPAEAYWGTGGRPPY  300



>ref|XP_007155606.1| hypothetical protein PHAVU_003G216200g [Phaseolus vulgaris]
 gb|ESW27600.1| hypothetical protein PHAVU_003G216200g [Phaseolus vulgaris]
Length=284

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 170/283 (60%), Positives = 203/283 (72%), Gaps = 27/283 (10%)
 Frame = +2

Query  317   LPPPFHTSRDF------------NFHPQQFHEQSGQKQRDPEEVNQQDDGNDGGESKNGL  460
             LPPPFHT RD               +     E SG       E  + +  ND G      
Sbjct  11    LPPPFHT-RDLHLHHQPQQHQFQTLNQGTDDEHSGSSSAQKREREENNGNNDEG------  63

Query  461   GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQR  640
               AGE EI+RRPRGRPAGSKNKPKPPIIITRDSANA+RTH+ME+ADGCD+++SV+ FA++
Sbjct  64    --AGEAEITRRPRGRPAGSKNKPKPPIIITRDSANAMRTHMMEVADGCDIVESVSEFARK  121

Query  641   RQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             RQRGVC++SG G VTNVTLRQPAS GAVVTLHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  122   RQRGVCIMSGTGTVTNVTLRQPASSGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYL  181

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD------GNAPPFQgggm  982
             AGGQGQVVGGSVVG L+A+GPVVIM+ASFSNAAYERLPLE++D      G +    G   
Sbjct  182   AGGQGQVVGGSVVGTLVASGPVVIMSASFSNAAYERLPLEDEDPSLQMQGGSIGSPGASG  241

Query  983   dspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                    G   A   +F G+PPNL+NS+Q+P++ +W  +RPPF
Sbjct  242   VGQSQLLGGGDAAAPLFHGLPPNLLNSVQMPSEPFWASNRPPF  284



>ref|XP_004298711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=309

 Score =   253 bits (646),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 213/310 (69%), Gaps = 42/310 (14%)
 Frame = +2

Query  305   MDSQ-LPPPFHTSRDFNFHPQQFH----------------EQSG--------QKQRDPEE  409
             MD+  LPPPFHT RDF  H QQ                  EQ+G        +++RD + 
Sbjct  1     MDAHSLPPPFHT-RDFQLHHQQQQQQHHHQFHHQQQNSEDEQTGSSGLNKGTKRERDIDN  59

Query  410   VNQQDDGNDGGESKNGLGGAGEG-EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLM  586
              N        G  +  +  +G+G E++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+M
Sbjct  60    NNNDSGNGGEGSKELNITVSGDGSEMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVM  119

Query  587   EIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAG  766
             EIADGCD+++SVA FA+RRQRGVC++SG G VTNVTLRQPA+PG+VVTLHGRFEILSLAG
Sbjct  120   EIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPATPGSVVTLHGRFEILSLAG  179

Query  767   SFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEED  946
             SFLPPPAPP+ATGLTIYLAGGQGQVVGGSVVG LLA+GPVVIMAASFSNAAYERLPLEED
Sbjct  180   SFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLLASGPVVIMAASFSNAAYERLPLEED  239

Query  947   DGNAP--------------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPND-  1081
             +G+ P                                    +F G+PPNL+NS+QLP + 
Sbjct  240   EGSMPMPGGSMGSPTAVGQQQHQQQQQQQQLLAEAANTNAPLFHGLPPNLLNSMQLPAEA  299

Query  1082  AYWGGSRPPF  1111
             AYW   RPPF
Sbjct  300   AYWATGRPPF  309



>emb|CBI34813.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   250 bits (639),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 179/215 (83%), Gaps = 4/215 (2%)
 Frame = +2

Query  479   EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVC  658
             +ISRRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIADGCD+++SVA FA+RRQRGVC
Sbjct  26    KISRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVC  85

Query  659   VLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgq  838
             ++SG G VTNVTLRQPASPGA+VTLHGRFEILSL+GSFLPPPAPP+ATGLTIYLAGGQGQ
Sbjct  86    IMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQ  145

Query  839   vvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqlla  1018
             VVGGSVVG LLA+GPVVIMAASFSNAAYERLPLEE+D   P   G      G        
Sbjct  146   VVGGSVVGQLLASGPVVIMAASFSNAAYERLPLEEEDPALPMPGGSLGSPGGQPQQPQQL  205

Query  1019  eqg----MFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                    +F G+PPNL+NSIQLP +AYW   RPP+
Sbjct  206   LADPNAPLFHGLPPNLLNSIQLPAEAYWATGRPPY  240



>ref|XP_010324605.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=319

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 195/233 (84%), Gaps = 10/233 (4%)
 Frame = +2

Query  443   ESKNGLGGAG---EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVM  613
             ES + LG  G   EGE +RRPRGRPAGSKNKPK PIIITRDSANALRTH+MEIADGCD+M
Sbjct  87    ESTDELGVNGSHREGEFNRRPRGRPAGSKNKPKAPIIITRDSANALRTHVMEIADGCDIM  146

Query  614   DSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP  793
             +SV+ F++RRQRGVC++SG G VTNV LRQPASPGA+ TLHGRFEILSLAGSFLPPPAPP
Sbjct  147   ESVSNFSRRRQRGVCIMSGTGNVTNVNLRQPASPGAIATLHGRFEILSLAGSFLPPPAPP  206

Query  794   SATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQg  973
             +A+GLTIYLAGGQGQVVGG VVG+L+A+GPVVIMAASFSNAAYERLPLEEDD N  P QG
Sbjct  207   AASGLTIYLAGGQGQVVGGCVVGSLMASGPVVIMAASFSNAAYERLPLEEDDSNQLPVQG  266

Query  974   ggmdspgaagg-------qllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
             G + SPGA          QLL +  +F G+PPNL+N++QLP++AYW   RPPF
Sbjct  267   GSLGSPGATVAPGGPQHQQLLGDPSLFHGMPPNLLNNVQLPSEAYWATGRPPF  319



>gb|EYU43510.1| hypothetical protein MIMGU_mgv1a017700mg [Erythranthe guttata]
Length=309

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 190/305 (62%), Positives = 220/305 (72%), Gaps = 41/305 (13%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQF---------HEQS------GQKQRDPEEVNQQD--DGNDGGE  445
             LPPPFHT RDFN   Q            EQS      G ++R+ +EV + D   GNDG  
Sbjct  6     LPPPFHT-RDFNLQHQFHHHHQTHNSEDEQSETSNMGGGQKRNRDEVGRSDFDGGNDGSP  64

Query  446   SKNGLGGAGEGEI------SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCD  607
             +  G GG+GEG        +RRPRGRPAGSKNKPKPPIIITRDSANALRTH+ME++DGCD
Sbjct  65    AGGGGGGSGEGGGGGDMSGNRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEVSDGCD  124

Query  608   VMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPA  787
             +MDSVA+FA+RRQRGVCV+SG G VTNVTLRQPA+PGAV+TLHGRFEILSLAGSFLPPPA
Sbjct  125   IMDSVASFARRRQRGVCVMSGTGNVTNVTLRQPAAPGAVMTLHGRFEILSLAGSFLPPPA  184

Query  788   PPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPF  967
             PP+ATGLTIYLAGGQGQV+GGSVVG LLA+GPV+IMAASFSNAAYERLPLEED+  A   
Sbjct  185   PPAATGLTIYLAGGQGQVLGGSVVGQLLASGPVIIMAASFSNAAYERLPLEEDENAAINN  244

Query  968   Qgggmdsp-----------------gaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGG  1096
                 +                         Q+LA+  +FQG+PPNL NSIQ+PN+A+W  
Sbjct  245   NNNQVPGSSSLGSPPGGLGGSGQPPQNHQQQVLADPSLFQGMPPNLFNSIQMPNEAFWAT  304

Query  1097  SRPPF  1111
              RPPF
Sbjct  305   GRPPF  309



>ref|XP_010276261.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=295

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 174/283 (61%), Positives = 203/283 (72%), Gaps = 19/283 (7%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQFH-------EQSGQKQRDPEEVNQQDDGN-DGGESKNGLGGAG  472
             LPPPFHT RD + H            E SG    +  +   +DD N + G+    +  AG
Sbjct  14    LPPPFHT-RDLHLHHHHHQQQQNSEDEHSGSSGLNKGKKRDRDDINSNHGDGNEMIVAAG  72

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             EGE++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIA+GCDV +SVA FA+RRQRG
Sbjct  73    EGEMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIANGCDVGESVATFARRRQRG  132

Query  653   VCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggq  832
             VC+LSG+G VTNVTLRQPA+PGA+VTLHGRFEILSL+GSFLPPPAPP+ATGLTIYLAGGQ
Sbjct  133   VCILSGSGTVTNVTLRQPATPGAIVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQ  192

Query  833   gqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD----------GNAPPFQgggm  982
             GQVVGGSVVGAL+A+GPVVIMAASF NAAYERLPLE+++            +P       
Sbjct  193   GQVVGGSVVGALVASGPVVIMAASFGNAAYERLPLEDEEPPLPMQSGGPLGSPGMVDQQQ  252

Query  983   dspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                            +F G+PPNL+   QLP +AYW   RPPF
Sbjct  253   QQQQQQQLLPDPNMPLFHGLPPNLLTPCQLPAEAYWATGRPPF  295



>gb|EYU40549.1| hypothetical protein MIMGU_mgv1a021038mg [Erythranthe guttata]
Length=310

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 187/306 (61%), Positives = 216/306 (71%), Gaps = 42/306 (14%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQF---------HEQS-------GQKQRDPEEVNQQD--DGNDGG  442
             LPPPFHT RDFN   Q            EQS       G ++R+ +EV + D   GNDG 
Sbjct  6     LPPPFHT-RDFNLQHQFHHHHQTHNSEDEQSETSNMGGGGQKRNRDEVGRSDFDGGNDGS  64

Query  443   ESKNGLGGAGEGEI------SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGC  604
              +  G GG            +RRPRGRPAGSKNKPKPPIIITRDSANALRTH+ME++DGC
Sbjct  65    PAGGGGGGGSGEGGGGDMSGNRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEVSDGC  124

Query  605   DVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP  784
             D+MDSVA+FA+RRQRGVCV+SG G VTNVTLRQPA+PGAV+TLHGRFEILSLAGSFLPPP
Sbjct  125   DIMDSVASFARRRQRGVCVMSGTGNVTNVTLRQPAAPGAVMTLHGRFEILSLAGSFLPPP  184

Query  785   APPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPP  964
             APP+ATGLTIYLAGGQGQV+GGSVVG LLA+GPV+IMAASFSNAAYERLPLEED+  A  
Sbjct  185   APPAATGLTIYLAGGQGQVLGGSVVGQLLASGPVIIMAASFSNAAYERLPLEEDENAAIN  244

Query  965   FQgggmdsp-----------------gaaggqllaeqgMFQGVPPNLINSIQLPNDAYWG  1093
                  +                         Q+LA+  +FQG+PPNL NSIQ+PN+A+W 
Sbjct  245   NNNNQVPGSSSLGSPPGGLGGSGQPPQNHQQQVLADPSLFQGMPPNLFNSIQMPNEAFWA  304

Query  1094  GSRPPF  1111
               RPPF
Sbjct  305   TGRPPF  310



>ref|XP_006358367.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=311

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 196/232 (84%), Gaps = 9/232 (4%)
 Frame = +2

Query  443   ESKNGLGGAG---EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVM  613
             ES + LG  G   +GE +RRPRGRPAGSKNKPK PIIITRDSANALRTH+MEIADGCD+M
Sbjct  80    ESTDELGVNGSHRDGEFNRRPRGRPAGSKNKPKAPIIITRDSANALRTHVMEIADGCDIM  139

Query  614   DSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP  793
             +SV+ F++RRQRGVC++SG G VTNV LRQPASPGA+ TLHGRFEILSLAGSFLPPPAPP
Sbjct  140   ESVSNFSRRRQRGVCIMSGTGNVTNVNLRQPASPGAIATLHGRFEILSLAGSFLPPPAPP  199

Query  794   SATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQg  973
             +A+GLTIYLAGGQGQVVGG VVG+L+A+GPVVIMAASFSNAAYERLPL+EDD N  P QG
Sbjct  200   AASGLTIYLAGGQGQVVGGCVVGSLMASGPVVIMAASFSNAAYERLPLDEDDSNQLPVQG  259

Query  974   ggmdspgaagg------qllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
             G + SPGA         QLLA+  +F G+PPNL+N++QLP++AYW   RPPF
Sbjct  260   GSLGSPGATIAPGGQQQQLLADPSLFHGMPPNLLNNVQLPSEAYWATGRPPF  311



>ref|XP_010940981.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=317

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 216/307 (70%), Gaps = 42/307 (14%)
 Frame = +2

Query  314   QLPPPFHTSRDFNFHPQQFH-----------EQSGQ---KQRDPEEVN--QQDDGNDGGE  445
              LPPPFHT RDF+   QQ H           E  G    K+RD E++N  + +DGN G  
Sbjct  12    HLPPPFHT-RDFHHLHQQNHLTHLRPPKAEEEHGGTNHGKKRDLEDINNSKVNDGNQGDS  70

Query  446   SKNG-----------LGGAGEGEIS-RRPRGRPAGSKNKPKPPIIITRDSANALRTHLME  589
               NG            G  GEGEIS RRPRGRPAGSKNKPKPPIIITRDSANALR+H+ME
Sbjct  71    DGNGGEGKELVPAPQSGSGGEGEISTRRPRGRPAGSKNKPKPPIIITRDSANALRSHVME  130

Query  590   IADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGS  769
             IA GCD+ +SVA FA+RRQRGVC+LSG+G VTNVTLRQPASPGAVVTLHG FEILSL+GS
Sbjct  131   IAGGCDIAESVATFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGCFEILSLSGS  190

Query  770   FLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
             FLPPPAPP+ATGLT+YLAGGQGQVVGGSVVGAL+A+GPVVIMAASFSNAAYERLPL E++
Sbjct  191   FLPPPAPPAATGLTVYLAGGQGQVVGGSVVGALIASGPVVIMAASFSNAAYERLPLGEEE  250

Query  950   -------GNAPPF--QgggmdspgaaggqllaeqgMFQGVPPNLI-NSIQLPNDAY-W--  1090
                      +P    Q                 Q +F G+PPNL+ N++QLP +AY W  
Sbjct  251   PLPVSGALESPGVVGQSPPQQQQQQPQQLPDPNQPLFHGLPPNLVLNNVQLPAEAYGWAT  310

Query  1091  GGSRPPF  1111
             GG RPP+
Sbjct  311   GGGRPPY  317



>ref|XP_003549894.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=287

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 170/286 (59%), Positives = 206/286 (72%), Gaps = 30/286 (10%)
 Frame = +2

Query  317   LPPPFHTSRDF--------------NFHPQQFHEQSGQKQRDPEEVNQQDDGNDGGESKN  454
             LPPPFHT RD               + +     E SG       E  +  +GN+ G    
Sbjct  11    LPPPFHT-RDLHLHHQQQQQQHQFQSLNQATEDENSGSSGAQKREREENSNGNNEG----  65

Query  455   GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFA  634
                 AGE EI+RRPRGRPAGSKNKPKPPIIITRDSANA+RTH+ME+ADG D+++SV+ FA
Sbjct  66    ----AGEAEITRRPRGRPAGSKNKPKPPIIITRDSANAMRTHMMEVADGYDIVESVSEFA  121

Query  635   QRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTI  814
             ++RQRG+C++SG G VTNVTLRQPAS G+VVTLHGRFEILSL+GSFLPPPAPP+A+GLTI
Sbjct  122   RKRQRGICIMSGTGTVTNVTLRQPASSGSVVTLHGRFEILSLSGSFLPPPAPPAASGLTI  181

Query  815   YlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQggg-----  979
             YLAGGQGQVVGGSVVG L+A+GPVVIMAASFSNAAYERLPLE++D N+   QGG      
Sbjct  182   YLAGGQGQVVGGSVVGTLVASGPVVIMAASFSNAAYERLPLEDEDPNSLQMQGGSIGSPG  241

Query  980   -mdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGS-RPPF  1111
                   +      A   +F G+PPNL+NS+Q+P++ +W  S RPPF
Sbjct  242   ASGVGQSQLLGGDATAPLFHGLPPNLLNSVQMPSEPFWAASTRPPF  287



>ref|XP_006851807.1| hypothetical protein AMTR_s00041p00025000 [Amborella trichopoda]
 gb|ERN13274.1| hypothetical protein AMTR_s00041p00025000 [Amborella trichopoda]
Length=307

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 205/296 (69%), Gaps = 32/296 (11%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQF---------HEQSG--------QKQRDPEEVNQQDDGNDGGE  445
             LPPPFHT RDF+ H              +QSG        ++ +DP       + N    
Sbjct  13    LPPPFHT-RDFHSHHHHQHQHLHHNSEEDQSGSSDLNRGKKRDQDPNTPTNNHEENQNDS  71

Query  446   SKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVA  625
             +K      GEGEISRRPRGRPAGSKNKPKPPIIITR+SANALR H+ME+A GCDV +SVA
Sbjct  72    NKELQQSGGEGEISRRPRGRPAGSKNKPKPPIIITRESANALRAHVMEVASGCDVGESVA  131

Query  626   AFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATG  805
              FA+RRQRGVC+LSG+G VTNVTLRQPA+PGA+VTLHGRFEILSL+GSFLPPPAPP+ATG
Sbjct  132   NFARRRQRGVCILSGSGTVTNVTLRQPAAPGAIVTLHGRFEILSLSGSFLPPPAPPAATG  191

Query  806   LTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDG-----------  952
             LTIYLAGGQGQVVGGSVVGAL+A+GPV+IMAASF NAAYERLPL+ED+G           
Sbjct  192   LTIYLAGGQGQVVGGSVVGALVASGPVIIMAASFGNAAYERLPLDEDEGALQVAGGGGGG  251

Query  953   --NAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAY-WGGSRPPF  1111
                +P          G           +F  +PPNL+NS+QLP DAY W   RPP+
Sbjct  252   GMGSPGGGSQSQSQSGPQQLLSDPNAPLFHSLPPNLLNSVQLPPDAYSWATGRPPY  307



>gb|KEH19036.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=308

 Score =   248 bits (633),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 182/300 (61%), Positives = 209/300 (70%), Gaps = 36/300 (12%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQ-QFH---------EQSGQKQ--RDPEEVNQQDDGND---GGESK  451
             LPPPF T RD + HP  QFH         +QSG     R  +     +DGN+   GGE K
Sbjct  10    LPPPFLT-RDLHLHPHHQFHTNHQTNEEEQQSGNGSLSRGQKRERNNEDGNNTPTGGEGK  68

Query  452   N-----GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMD  616
             +       GG   GE+ RRPRGRPAGSKNKPKPPIIITRDSANALR+H+ME+A+GCD+M+
Sbjct  69    DDGGSGSAGGGSGGEMGRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEVANGCDIME  128

Query  617   SVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPS  796
             SV  FA+RRQRGVC+LSG+G VTNVTLRQPASPGAVVTLHGRFEILSL+GSFLPPPAPP+
Sbjct  129   SVTVFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPA  188

Query  797   ATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD---------  949
             A+GL IYLAGGQGQVVGGSVVG LLA+GPVVIMAASF NAAYERLPLE+++         
Sbjct  189   ASGLAIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEDEETPVNVPGNG  248

Query  950   -----GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGS-RPPF  1111
                  G     Q    +              +F GVP NL+NS QLP + YWGGS RPPF
Sbjct  249   GLGSPGTMGSQQQQQQNQQQQQLVADPNASSLFHGVPQNLLNSCQLPAEGYWGGSARPPF  308



>ref|XP_008804006.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=314

 Score =   247 bits (631),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 182/304 (60%), Positives = 214/304 (70%), Gaps = 39/304 (13%)
 Frame = +2

Query  314   QLPPPFHTSRDFNFHPQQFH-----------EQSGQ------KQRDPEEVNQQD--DGND  436
              LPPPFHT R F+   QQ H           E SG       ++RD E++N  +  D +D
Sbjct  12    HLPPPFHT-RGFHHLHQQKHLPHRQQPKAEEENSGSSGMNHGEKRDLEDINNSNIHDNSD  70

Query  437   --GGESKNGL-----GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIA  595
                GE K  +     G  GEGE++RRPRGRPAGSKNKPKPPIIIT+DSANALR+H+MEIA
Sbjct  71    RNSGEGKELVPAPLSGSGGEGEMTRRPRGRPAGSKNKPKPPIIITKDSANALRSHVMEIA  130

Query  596   DGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFL  775
              GCD+ ++VA FA+RRQRGVC+LSG+G VTNVTLRQPASPGAVVTLHG FEILSL+GSFL
Sbjct  131   AGCDIAETVATFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGCFEILSLSGSFL  190

Query  776   PPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGN  955
             PPPAPP+ATGLTIYLAGGQGQVVGGSVVGAL+A+GPVVIMAASFSNAAYERLPL+E++  
Sbjct  191   PPPAPPAATGLTIYLAGGQGQVVGGSVVGALIASGPVVIMAASFSNAAYERLPLDEEEPV  250

Query  956   APP---------FQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAY-W--GGS  1099
               P                        L     +  G+PPNL+N+IQLP +AY W  GG 
Sbjct  251   PVPGPLDSPGLVGDSPPPLQQQQPQQLLDPNTPLLHGLPPNLLNNIQLPAEAYSWATGGG  310

Query  1100  RPPF  1111
             RPP+
Sbjct  311   RPPY  314



>ref|XP_009778295.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=306

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 161/222 (73%), Positives = 185/222 (83%), Gaps = 9/222 (4%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +GE +RRPRGRPAGSKNKPK PIIITRDSANALRTH+MEIADGCD+M+SV+ F++RRQRG
Sbjct  85    DGEFNRRPRGRPAGSKNKPKAPIIITRDSANALRTHVMEIADGCDIMESVSNFSRRRQRG  144

Query  653   VCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggq  832
             VC++SG G VTNV LRQPASPGA  TLHGRFEILSLAGSFLPPPAP +A+GLTIYLAGGQ
Sbjct  145   VCIMSGTGNVTNVNLRQPASPGATATLHGRFEILSLAGSFLPPPAPAAASGLTIYLAGGQ  204

Query  833   gqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmds--------  988
             GQVVGG VVGAL+A+GPVVIMAASFSNAAYERLPLEEDD N+ P QGG + S        
Sbjct  205   GQVVGGCVVGALMASGPVVIMAASFSNAAYERLPLEEDDSNSLPPQGGSLGSPRAIAPGG  264

Query  989   -pgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                    QLL +  +F G+PPNL+N++QLP++AYW   RPPF
Sbjct  265   QQQQQQQQLLTDPSLFHGMPPNLLNNVQLPSEAYWATGRPPF  306



>ref|XP_009799054.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009799060.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
sylvestris]
Length=304

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 174/295 (59%), Positives = 203/295 (69%), Gaps = 31/295 (11%)
 Frame = +2

Query  317   LPPPFHTSRDFNFH------PQQFHEQSGQKQRDPEEV---NQQDDGND-----------  436
             LPPPFHT RD               +Q   K  D ++    NQ+ D +D           
Sbjct  11    LPPPFHT-RDLQLQNNPHQFHHIQQQQQQPKTEDEQQTGHRNQKRDRDDNFSISPGLNPE  69

Query  437   -GGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVM  613
              G     G  G G GE++RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA GCD+ 
Sbjct  70    SGSMDSKGNSGEGGGEVTRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIASGCDIQ  129

Query  614   DSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP  793
             +S++ FA RRQRGVC+LSG+G VTNVT+RQPASPGAVVTLHGRFEILSL+GS+LPPPAPP
Sbjct  130   ESISTFATRRQRGVCILSGSGTVTNVTIRQPASPGAVVTLHGRFEILSLSGSYLPPPAPP  189

Query  794   SATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD--------  949
             +A+GLTIYLAGGQGQVVGGSVVG L A+GPVVIMAASF NAAYERLPLE+++        
Sbjct  190   AASGLTIYLAGGQGQVVGGSVVGPLNASGPVVIMAASFGNAAYERLPLEDEESPVGQQGS  249

Query  950   GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGS-RPPF  1111
             G  P             GG       + QG+PPNL+NS QLP DAYWG + RPP+
Sbjct  250   GALPIVNNQQQHQQQIMGGNSDPNANLLQGLPPNLLNSCQLPADAYWGTAGRPPY  304



>ref|XP_007158420.1| hypothetical protein PHAVU_002G151600g [Phaseolus vulgaris]
 gb|ESW30414.1| hypothetical protein PHAVU_002G151600g [Phaseolus vulgaris]
Length=299

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 175/290 (60%), Positives = 210/290 (72%), Gaps = 26/290 (9%)
 Frame = +2

Query  317   LPPPFHTSRDF---------NFHPQQFHEQSGQK-------QRDPEEVNQQDDGNDGGES  448
             LPPPFH  RD          +       EQSG         +R+ EE N+  + N+    
Sbjct  11    LPPPFHAGRDLHLHHQHQFHSLQQNTEDEQSGSSGGLNMAHKREREE-NRTTNSNNSDGK  69

Query  449   KNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAA  628
             + G GG+GE E+SRRPRGRPAGSKNKPKPPIIITRDSANAL+TH+ME+ADGCD++DSV+ 
Sbjct  70    EGGGGGSGETEMSRRPRGRPAGSKNKPKPPIIITRDSANALKTHVMEVADGCDIVDSVST  129

Query  629   FAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGL  808
             FA+RRQRGVC++SG G VTNVTLRQPAS GAVVTLHGRFEILSLAGSFLPPPAPP+ATGL
Sbjct  130   FARRRQRGVCIMSGTGTVTNVTLRQPASSGAVVTLHGRFEILSLAGSFLPPPAPPAATGL  189

Query  809   TIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmds  988
             TIYLAGGQGQVVGGSVVGAL+A+GPVVIM+ASFSNAAYERLPLE++D + P   G     
Sbjct  190   TIYLAGGQGQVVGGSVVGALVASGPVVIMSASFSNAAYERLPLEDEDPSMPLQGGSIGSP  249

Query  989   pgaaggqll---------aeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
              G  G             +   +F G+ PNL+NS+Q+P++ +W   R P+
Sbjct  250   GGGGGVGQPQTPQQLLGDSTAPLFHGLNPNLLNSVQMPSETFWATGRSPY  299



>ref|XP_003525782.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Glycine max]
 ref|XP_006579618.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Glycine max]
 gb|KHN04317.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=283

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 172/277 (62%), Positives = 205/277 (74%), Gaps = 16/277 (6%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQFHEQSGQKQRDPEEVNQQDDGND---GGESKNGLGGAGEGEIS  487
             LPPPFHT RD + H QQ   Q     +  E+ N    G       E+ N   GAGE EI+
Sbjct  11    LPPPFHT-RDLHLHHQQQQHQFQSLNQATEDENSGSSGAQKREREENSNNNEGAGEAEIT  69

Query  488   RRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLS  667
             RRPRGRPAGSKNKPKPPIIITRDSANA+RTH+ME+ADGCD+++SV+ FA++RQRGVC++S
Sbjct  70    RRPRGRPAGSKNKPKPPIIITRDSANAMRTHMMEVADGCDIVESVSEFARKRQRGVCIMS  129

Query  668   GNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvg  847
             G G V NVTLRQPAS G+VVTLHGRFEILSL+GSFLPPPAPP+A+GLTIYLAGGQGQVVG
Sbjct  130   GTGTVNNVTLRQPASSGSVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVG  189

Query  848   gsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgg--------gmdspgaag  1003
             GSVVG L+A+GPVVIMAASFSNAAYERLPLE++D   P  Q                +  
Sbjct  190   GSVVGTLVASGPVVIMAASFSNAAYERLPLEDED---PSLQMQGGSIGSPGASGVGQSQL  246

Query  1004  gqllaeqgMFQGVPPNLINSIQLPNDAYWGGS-RPPF  1111
                 A   +F G+PPNL+NS+Q+P++ +W  S RPPF
Sbjct  247   LGGDATAPLFHGLPPNLLNSVQMPSEPFWAASARPPF  283



>ref|XP_009604907.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=304

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 173/302 (57%), Positives = 203/302 (67%), Gaps = 45/302 (15%)
 Frame = +2

Query  317   LPPPFHTSRDFNFH----------------PQQFHEQSGQKQRDPEEVNQQDDGNDGGES  448
             LPPPFHT RD                      +  +QSG +       NQ+ D +D    
Sbjct  11    LPPPFHT-RDLQLQNNPHQFHHIQQQQLQPKTEDEQQSGHR-------NQKRDRDDNFSI  62

Query  449   KNGL------------GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEI  592
               GL             G G GE++RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEI
Sbjct  63    SAGLNPESASMDSKGNSGEGGGEVTRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEI  122

Query  593   ADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSF  772
             A GCD+ +S++ FA RRQRGVC+LSG+G VTNVT+RQPASPGAVVTLHGRFEILSL+GS+
Sbjct  123   ASGCDIQESISTFATRRQRGVCILSGSGTVTNVTIRQPASPGAVVTLHGRFEILSLSGSY  182

Query  773   LPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD-  949
             LPPPAPP+A+GLTIYLAGGQGQVVGGSVVG L A+GPVVIMAASF NAAYERLPLE+++ 
Sbjct  183   LPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLNASGPVVIMAASFGNAAYERLPLEDEES  242

Query  950   -------GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGS-RP  1105
                    G  P             GG       + QG+PPNL+NS QLP +AYWG + RP
Sbjct  243   PVGQQGSGALPIVSNQQQHQQQIMGGNSDPNANLLQGLPPNLLNSCQLPAEAYWGTAGRP  302

Query  1106  PF  1111
             P+
Sbjct  303   PY  304



>ref|XP_007052032.1| AT-hook motif nuclear-localized protein 22 [Theobroma cacao]
 gb|EOX96189.1| AT-hook motif nuclear-localized protein 22 [Theobroma cacao]
Length=326

 Score =   245 bits (626),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 204/295 (69%), Gaps = 31/295 (11%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQF-----------HEQSGQKQRDPEEVNQQDDGNDGGESKNGLG  463
             LPPPF T RD + +P               EQ+  ++RD EE           ++  G  
Sbjct  33    LPPPFLT-RDLHLNPHHQFQHHHQQENSEEEQNRGQKRDREETATTTTATATTDTSEGKE  91

Query  464   GA----GEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAF  631
              A     EGEI+RRPRGRP+GSKNKPKPPIIITRDSANALR+H+MEIA+GCD+M+S++ F
Sbjct  92    LAIIPGTEGEITRRPRGRPSGSKNKPKPPIIITRDSANALRSHVMEIANGCDIMESISTF  151

Query  632   AQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLT  811
             A+RRQRGVC+LSG+G VTNVTLRQP +PGAVVTLHGRFEILSL+GSFLPPPAPP+A+GLT
Sbjct  152   ARRRQRGVCILSGSGTVTNVTLRQPGAPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLT  211

Query  812   IYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPF--------  967
             IYLAGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEE++    P         
Sbjct  212   IYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEEEEQPVAPIPGSGPLGS  271

Query  968   -------QgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                    Q      P              QG+PPNL+NS+QLP +AYWG  RPP+
Sbjct  272   PSSMVGQQQQQQQPPQQQQLLQDPNGSFVQGLPPNLLNSVQLPAEAYWGTGRPPY  326



>ref|NP_001141263.1| hypothetical protein [Zea mays]
 gb|ACF85898.1| unknown [Zea mays]
 gb|ACF88117.1| unknown [Zea mays]
 gb|AFW71087.1| hypothetical protein ZEAMMB73_730676 [Zea mays]
Length=309

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 171/216 (79%), Gaps = 0/216 (0%)
 Frame = +2

Query  452   NGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAF  631
             +G G  G     RRP+GRPAGSKNKPKPPIIITRDSAN LRTH+ME+A GCD+ +S+ AF
Sbjct  83    SGAGPEGGEPTLRRPKGRPAGSKNKPKPPIIITRDSANTLRTHVMEVASGCDISESITAF  142

Query  632   AQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLT  811
             A+RRQRGVCVLSG G VTNVTLRQPAS GAVV LHGRFEILSL+GSFLPPPAPP ATGLT
Sbjct  143   ARRRQRGVCVLSGAGTVTNVTLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLT  202

Query  812   IYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdsp  991
             +YLAGGQGQVVGGSVVGAL AAGPVVIMAASF+NA YERLPLEEDD  A   Q       
Sbjct  203   VYLAGGQGQVVGGSVVGALTAAGPVVIMAASFANAVYERLPLEEDDMLAAQAQADSAGIL  262

Query  992   gaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGS  1099
               A      +  +FQG+PPNL+ ++Q+P +A +G S
Sbjct  263   AGAQLAGAVDPSLFQGLPPNLMCNVQMPPEAAYGWS  298



>ref|XP_006339443.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=308

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 204/299 (68%), Gaps = 35/299 (12%)
 Frame = +2

Query  317   LPPPFHTSRDF-------NFHPQQFHEQSGQKQRDPEEV---NQQDDGNDGGESKNGLGG  466
             LPPPFHT RD        + H Q  H Q  QK  D ++    NQ+ D +D         G
Sbjct  11    LPPPFHT-RDLQLQNNNPHLHGQFHHIQQQQKTEDEQQSGHRNQKRDRDDNFSLNPDQSG  69

Query  467   AGEG-------------EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCD  607
             + +              E+SRRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA GCD
Sbjct  70    SMDSKGNTIGGGGDGGGEVSRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIASGCD  129

Query  608   VMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPA  787
             + +S++ FA RRQRGVC+LSG+G VTNVT+RQP SPGAVVTLHGRFEILSL+GS+LPPPA
Sbjct  130   IQESISNFATRRQRGVCILSGSGTVTNVTIRQPTSPGAVVTLHGRFEILSLSGSYLPPPA  189

Query  788   PPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD------  949
             PP+A+GLTIYLAGGQGQVVGGSVVG L A+GPVVIMAASF NAAYERLPLE+++      
Sbjct  190   PPAASGLTIYLAGGQGQVVGGSVVGPLNASGPVVIMAASFGNAAYERLPLEDEESPVGQQ  249

Query  950   ---GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQL-PNDAYWG-GSRPPF  1111
                GN P   G    +             + QG+P NL+NS QL P +AYWG G RPP+
Sbjct  250   GNGGNLPTSSGIVSTNQAQQIMGTDPNANLLQGLPQNLLNSCQLPPAEAYWGAGGRPPY  308



>ref|XP_009621304.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=307

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 186/221 (84%), Gaps = 8/221 (4%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +GE +RRPRGRPAGSKNKPK PIIITRDSANALRTH+MEIADGCD+M+SV+ F++RRQRG
Sbjct  87    DGEFNRRPRGRPAGSKNKPKAPIIITRDSANALRTHVMEIADGCDIMESVSNFSRRRQRG  146

Query  653   VCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggq  832
             VC++SG G VTNV LRQPASPGA+ TLHGRFEILSLAGSFLPPPAPP+A+GLTIYLAGGQ
Sbjct  147   VCIMSGTGNVTNVNLRQPASPGAIATLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQ  206

Query  833   gqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmds--------  988
             GQVVGG VVGAL+A+GPVVIMAASFSNAAYERLPLEEDD N+ P QGG + S        
Sbjct  207   GQVVGGCVVGALMASGPVVIMAASFSNAAYERLPLEEDDLNSLPPQGGSLGSPRAIAPGE  266

Query  989   pgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                   QLL +  +F G+PPNL+N++QLP++ YW   +PPF
Sbjct  267   RQQQQQQLLIDPSLFHGMPPNLLNNVQLPSEGYWATGQPPF  307



>gb|KFK37336.1| hypothetical protein AALP_AA4G243300 [Arabis alpina]
Length=314

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 175/308 (57%), Positives = 202/308 (66%), Gaps = 44/308 (14%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQ-QFHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGE----  481
             LPPPF  SRD + HP  QF  Q+   + D   +       D     N    AG+ +    
Sbjct  8     LPPPF-LSRDLHLHPHHQFQHQNHGHEMDQHRIGGLKRDRDAEIDPNEHSSAGKDQNTPG  66

Query  482   -----------------ISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDV  610
                              I+RRPRGRPAGSKNKPKPPIIITRDSANAL++H+ME+A+GCDV
Sbjct  67    SGGDSGGGGGTGGGDNHITRRPRGRPAGSKNKPKPPIIITRDSANALKSHVMEVANGCDV  126

Query  611   MDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLP  778
             M+SV  FA+RRQRGVCVLSGNG VTNVT+RQPAS PG   +VV LHGRFEILSL+GSFLP
Sbjct  127   MESVTVFARRRQRGVCVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEILSLSGSFLP  186

Query  779   PPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD---  949
             PPAPP+A+GLTIYLAGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEEDD   
Sbjct  187   PPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEE  246

Query  950   --------------GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAY  1087
                           GNA    G            +       QG+PPNL+NS+QLP++AY
Sbjct  247   QQTGGAVGNNNNIDGNATLGGGTQTPQTQQQQQLMQDPSSFIQGLPPNLMNSVQLPSEAY  306

Query  1088  WGGSRPPF  1111
             WG  RP F
Sbjct  307   WGAPRPSF  314



>ref|XP_004242015.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=220

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 180/217 (83%), Gaps = 4/217 (2%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             EGE+SRRPRGRPAGSKNKPKPPIII RDSANALRTH++EIADGCDVM+SV+ F++RRQRG
Sbjct  4     EGEMSRRPRGRPAGSKNKPKPPIIINRDSANALRTHIIEIADGCDVMESVSNFSRRRQRG  63

Query  653   VCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggq  832
             VC++SG G VTNV L+QPAS G +VTLHGRFEILSL+GSFLPPPAPP+A+GLTIYLAGGQ
Sbjct  64    VCIMSGTGNVTNVNLKQPASSGEIVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQ  123

Query  833   gqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggql  1012
             GQVVGGSVVGAL+A+GPVVIMAASFSNAAYERLPLEEDD N P    GG         Q 
Sbjct  124   GQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEEDDQNHPLPMPGGPLGSPGGQQQQ  183

Query  1013  laeq--gMFQGV-PPNLIN-SIQLPNDAYWGGSRPPF  1111
             L      MF G  PPNL+N S+QLP++ YW   RPPF
Sbjct  184   LLGGDPSMFHGTPPPNLLNSSMQLPHEGYWSTGRPPF  220



>ref|XP_006851806.1| hypothetical protein AMTR_s00041p00022450 [Amborella trichopoda]
 gb|ERN13273.1| hypothetical protein AMTR_s00041p00022450 [Amborella trichopoda]
Length=303

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 170/292 (58%), Positives = 206/292 (71%), Gaps = 28/292 (10%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQF-------HEQSG--------QKQRDPEE-VNQQDDGNDGGES  448
             LPPPFHT RDF+ H            EQS         ++ RDP    +  ++  +  ++
Sbjct  13    LPPPFHT-RDFHSHHHHQHLHHNSEEEQSRSSDLNRGIKRDRDPNTPTSNNEENQNSSQN  71

Query  449   KNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAA  628
                    GEGE++RRPRGRPAGSKNKP+PPIIITRDSANALR+H+ME+A GCD+++SVA 
Sbjct  72    MEVQQTGGEGEVTRRPRGRPAGSKNKPRPPIIITRDSANALRSHVMEVASGCDIVESVAN  131

Query  629   FAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGL  808
             +A+RRQRGVC+LSG+G VTNVTLRQPA+PGA+VTLHGRFEILSL+GSFLPPP PP+ATGL
Sbjct  132   YARRRQRGVCILSGSGTVTNVTLRQPAAPGAIVTLHGRFEILSLSGSFLPPPGPPAATGL  191

Query  809   TIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDG--NAPPFQgggm  982
             TIYLAGGQGQVVGG+VVGALLA+GPV+IMAASF NAA+ERLPL+ED+     P   G G 
Sbjct  192   TIYLAGGQGQVVGGTVVGALLASGPVIIMAASFGNAAFERLPLDEDEAVLQFPGGGGMGG  251

Query  983   dspgaaggqllaeqgM--------FQGVPPNLINSIQLPNDAY-WGGSRPPF  1111
                         +Q M        F G+ PN  NS QLP +AY W G RPP+
Sbjct  252   SQSSPEAQSQPQQQQMLGDPNGALFHGLLPNFTNSSQLPPEAYGWAGGRPPY  303



>gb|EYU30571.1| hypothetical protein MIMGU_mgv1a010755mg [Erythranthe guttata]
Length=302

 Score =   239 bits (610),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 184/232 (79%), Gaps = 6/232 (3%)
 Frame = +2

Query  434   DGGESKNGLGGAG--EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCD  607
             +  +SK+ + G+    GE++RRPRGRPAGSKNKPKPPIIITRDSANALR+H+ME+A+GCD
Sbjct  71    ENSDSKDLVAGSSGDHGEVTRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEVANGCD  130

Query  608   VMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPA  787
             V DS++ FA RRQRGVC+LSG G VTNVTLRQPA+PG+V+TLHGRFEILSL+GSFLPPPA
Sbjct  131   VQDSISTFATRRQRGVCILSGTGTVTNVTLRQPAAPGSVLTLHGRFEILSLSGSFLPPPA  190

Query  788   PPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPP-  964
             PP+A+GLTIYLAG QGQVVGG+VVG LLA+GPVVIMAASF NAAYERLPLE+++  A   
Sbjct  191   PPAASGLTIYLAGAQGQVVGGAVVGPLLASGPVVIMAASFGNAAYERLPLEDEEAAAVSG  250

Query  965   ---FQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                    G+   G            FQG   N++NS+QLP DAYWG +RPPF
Sbjct  251   GGQLGSPGISGGGGQQLMPDPNTNPFQGAAQNMLNSVQLPADAYWGAARPPF  302



>emb|CDX94128.1| BnaC07g37620D [Brassica napus]
Length=327

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 176/326 (54%), Positives = 203/326 (62%), Gaps = 63/326 (19%)
 Frame = +2

Query  311   SQLPPPFHTSRDFNFH--------PQQFHEQSGQKQRDPEEVNQQDDGNDGGESK-----  451
             S LPPPFH SRDF  H         Q+F     Q+QR+  +   QDD   GG ++     
Sbjct  6     SSLPPPFH-SRDFQLHLQQQQQQQQQEFFLHHHQQQRNQTD---QDDQQGGGRNRQIKMD  61

Query  452   ------------NGLGGAGEG-----------------EISRRPRGRPAGSKNKPKPPII  544
                         N  G  G+                  +++RRPRGRPAGSKNKPKPPII
Sbjct  62    REETSDSIDNMANNSGSEGKDTNQGEGGSGGGGGSGGDQMTRRPRGRPAGSKNKPKPPII  121

Query  545   ITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPA--SPG  718
             ITRDSANALRTH+MEI DGCD++DSVA FA+RRQRGVCV+SG G VTNVT+RQP   SPG
Sbjct  122   ITRDSANALRTHVMEIGDGCDLVDSVATFARRRQRGVCVMSGTGNVTNVTIRQPGSPSPG  181

Query  719   AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMA  898
             +VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL AGPVV+MA
Sbjct  182   SVVSLHGRFEILSLSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMA  241

Query  899   ASFSNAAYERLPLEEDDGNAPPFQgggmdspgaagg---------qllaeqgMFQGVPPN  1051
             ASFSNAAYERLPLEED+   P   GGG    G+                     QG+PPN
Sbjct  242   ASFSNAAYERLPLEEDEMQTPVHGGGGGGGGGSMESPPMMGGQLPHQQQAMSAHQGLPPN  301

Query  1052  LINSI------QLPNDAYWGGSRPPF  1111
             L+         Q  N  YW   RP F
Sbjct  302   LLGGSAHQGLPQHDNQPYWSTGRPSF  327



>ref|XP_004510939.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=305

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 205/302 (68%), Gaps = 43/302 (14%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQFHEQSGQKQRDPEEVNQQDDGN-------------------DG  439
             LPPPF T RD + H  QFH       +  E+  Q  +GN                    G
Sbjct  10    LPPPFLT-RDLHLH-HQFHT----NHQANEDEQQSGNGNLSRGQKRDRNNNNDDNNTPTG  63

Query  440   GESKN-----GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGC  604
             GE K+       GG   GE+ RRPRGRPAGSKNKPKPPIIITRDSANALR+H+ME+A+GC
Sbjct  64    GEGKDEGGSGSAGGGSGGEMGRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEVANGC  123

Query  605   DVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP  784
             D+M+SV  FA+RRQRGVC+LSG+G VTNVTLRQPASPGAVVTLHGRFEILSL+GSFLPPP
Sbjct  124   DIMESVTVFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLSGSFLPPP  183

Query  785   APPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD-----  949
             APP+A+GL IYLAGGQGQVVGGSVVG LLA+GPVVIMAASF NAAYERLPLE+++     
Sbjct  184   APPAASGLAIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEDEETPVNV  243

Query  950   ----GNAPPFQgggmdspgaaggqll---aeqgMFQGVPPNLINSIQLPNDAYWGGS-RP  1105
                 G   P   G           +        +F GVP NL+NS QLP + YWGGS RP
Sbjct  244   QGSGGLGSPGIVGTQQQQQQQQQLVQQDPNTSSLFHGVPQNLLNSCQLPAEGYWGGSVRP  303

Query  1106  PF  1111
             PF
Sbjct  304   PF  305



>ref|NP_001046754.1| Os02g0448000 [Oryza sativa Japonica Group]
 dbj|BAD28974.1| putative DNA-binding protein AT-hook 2 [Oryza sativa Japonica 
Group]
 dbj|BAF08668.1| Os02g0448000 [Oryza sativa Japonica Group]
 gb|EAY85693.1| hypothetical protein OsI_07061 [Oryza sativa Indica Group]
 gb|EAZ22891.1| hypothetical protein OsJ_06576 [Oryza sativa Japonica Group]
Length=316

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 171/221 (77%), Gaps = 5/221 (2%)
 Frame = +2

Query  446   SKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVA  625
             S  G  GAG    +RRPRGRPAGSKNKPKPPIIITRDSAN LRTH+ME+A GCD+ +S+ 
Sbjct  83    SGGGPDGAGSESATRRPRGRPAGSKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESIT  142

Query  626   AFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATG  805
              FA+RRQRGVCVLSG G VTNVTLRQPAS GAVV LHGRFEILSL+GSFLPPPAPP ATG
Sbjct  143   TFARRRQRGVCVLSGAGTVTNVTLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATG  202

Query  806   LTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD-----GNAPPFQ  970
             LT+YLAGGQGQVVGGSVVGAL AAGPVVIMAASF+NA YERLPLE+D+     G A    
Sbjct  203   LTVYLAGGQGQVVGGSVVGALTAAGPVVIMAASFANAVYERLPLEDDELLAAQGQADSAG  262

Query  971   gggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWG  1093
                     A       +  +FQG+PPNL+ ++QLP +A +G
Sbjct  263   LLAAGQQAAQLAGGAVDPSLFQGLPPNLLGNVQLPPEAAYG  303



>ref|XP_006363907.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=221

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 178/218 (82%), Gaps = 5/218 (2%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             EGE+SRRPRGRPAGSKNKPKPPIII RDSANALRTH++EIADGCDVM+SV+ F++RRQRG
Sbjct  4     EGEMSRRPRGRPAGSKNKPKPPIIINRDSANALRTHIIEIADGCDVMESVSNFSRRRQRG  63

Query  653   VCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggq  832
             VC++SG G VTNV L+QPAS G +VTLHGRFEILSL+GSFLPPPAPP+A+GLTIYLAGGQ
Sbjct  64    VCIMSGTGNVTNVNLKQPASSGEIVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQ  123

Query  833   gqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggql  1012
             GQVVGGSVVGAL+A+GPVVIM ASFSNAAYERLPLEEDD N  P    G       G Q 
Sbjct  124   GQVVGGSVVGALMASGPVVIMGASFSNAAYERLPLEEDDPNNHPLPMPGGPLGSPGGQQQ  183

Query  1013  laeq---gMFQGV-PPNLIN-SIQLPNDAYWGGSRPPF  1111
                     MF G  PPNL+N S+QLP++ YW   RPPF
Sbjct  184   QLLGGDPSMFHGTPPPNLLNSSMQLPHEGYWSTGRPPF  221



>emb|CDY41289.1| BnaA01g12500D [Brassica napus]
Length=315

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 202/306 (66%), Gaps = 40/306 (13%)
 Frame = +2

Query  311   SQLPPPFHTSRDFNFH------------PQQFHEQSG----QKQRDPEEVNQQDDG---N  433
             S LPP FH SRDF  H             Q  H+  G    Q + D EE +   D    N
Sbjct  11    SSLPPTFH-SRDFQLHLQQQQQQQENQPDQDDHQGGGGLNRQIKMDREETSDNMDNMANN  69

Query  434   DGGESKN-------GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEI  592
              G E K+         GG+G  +++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEI
Sbjct  70    SGSEGKDMNLGEGGSGGGSGGDQMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEI  129

Query  593   ADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPA--SPGAVVTLHGRFEILSLAG  766
              DGCD+++SVA FA+RRQRGVCV+SG G V NVT+RQP   SPG+VV+LHGRFEILSL+G
Sbjct  130   GDGCDLVESVATFARRRQRGVCVMSGTGNVMNVTIRQPGSPSPGSVVSLHGRFEILSLSG  189

Query  767   SFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEED  946
             SFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL AGPVV+MAASFSNAAYERLPLEED
Sbjct  190   SFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEED  249

Query  947   DGNAPPFQgggmdspg------aaggqllaeqgMFQGVPPNLINSI-----QLPNDAYWG  1093
             +   P   GGG  S                     QG+PPNL+        Q  N +YW 
Sbjct  250   EMQTPVHGGGGGGSMEPPPMMGGPMPHQQQAMSAHQGLPPNLLGPAHQGLPQHDNQSYWS  309

Query  1094  GSRPPF  1111
               RPP+
Sbjct  310   TGRPPY  315



>emb|CDX98771.1| BnaA03g45560D [Brassica napus]
Length=317

 Score =   238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 206/313 (66%), Gaps = 47/313 (15%)
 Frame = +2

Query  311   SQLPPPFHTSRDFNFHPQQFHEQSG-----------------QKQRDPEEVNQQDDG---  430
             S LPPPFH SRDF  H QQ  +Q                   Q + D EE +   D    
Sbjct  6     SSLPPPFH-SRDFQLHLQQQQQQQQENQTDQDDQQGGGGINRQIKMDREETSDNIDNMAN  64

Query  431   NDGGESKN---------GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHL  583
             N G E K+         G GG+G  +++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+
Sbjct  65    NSGSEGKDTNQGEGGSGGGGGSGGDQMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHV  124

Query  584   MEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPA--SPGAVVTLHGRFEILS  757
             MEI DGCD++DSVA FA+RRQRGVCV+SG G VTNVT+RQP   SPG+VV+LHGRFEILS
Sbjct  125   MEIGDGCDLVDSVATFARRRQRGVCVMSGTGNVTNVTIRQPGSPSPGSVVSLHGRFEILS  184

Query  758   LAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPL  937
             L+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL AGPVV+MAASFSNAAYERLPL
Sbjct  185   LSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPL  244

Query  938   EEDDGNAPPFQgggmdspgaaggqllaeqgM---------FQGVPPNLINSI------QL  1072
             EED+   P   GGG    G+     +    M          QG+PPNL+         Q 
Sbjct  245   EEDEMQTPVHGGGGGGGGGSMESPPMMGGQMPHQQQAMSAHQGLPPNLLGGSAHQGLPQH  304

Query  1073  PNDAYWGGSRPPF  1111
              N  YW   RP F
Sbjct  305   DNQPYWSTGRPSF  317



>ref|XP_004306909.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=325

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 173/316 (55%), Positives = 203/316 (64%), Gaps = 52/316 (16%)
 Frame = +2

Query  317   LPPPFHTSRDFNFH-----------------PQQFHEQSGQKQRDPEEVNQQDDGNDGGE  445
             LPPPF T RD + +                  +     SG   R       +DD   GG 
Sbjct  11    LPPPFLT-RDLHLNHPHHQFQHHPHLLHHQNSEDEQNSSGGLNRHRGMKRDRDDNTSGGN  69

Query  446   SKNGLGGAGE----------GEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIA  595
             + N + G  +          GEI+RRPRGRPAGSKNK KPPIIITRDSANALR+H+ME+A
Sbjct  70    TPNSMDGNKDLLGGSNSGEGGEITRRPRGRPAGSKNKAKPPIIITRDSANALRSHVMEVA  129

Query  596   DGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFL  775
             +GCD+MDSV+ FA+RRQRGVC+LSG+G VTNVTLRQPASPGAVVTLHGRFEILSL+GSFL
Sbjct  130   NGCDIMDSVSTFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLSGSFL  189

Query  776   PPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGN  955
             PPPAPP+A+GLTIYLAGGQGQVVGGSVVG LLA+GPVVIMAASF NAAYERLPLEE+D  
Sbjct  190   PPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEEEDAT  249

Query  956   A------------------------PPFQgggmdspgaaggqllaeqgMFQGVPPNLINS  1063
             A                           Q                   +F G+  NL+NS
Sbjct  250   AVTPMPGSGPLGSPGIGGGEQQQQSQVQQVQQQQQMLQDANNSSPPPSLFHGMQQNLLNS  309

Query  1064  IQLPNDAYWGGSRPPF  1111
             +QLP++AYWG +RPP+
Sbjct  310   VQLPSEAYWGTARPPY  325



>ref|XP_009344356.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
 ref|XP_009344357.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=312

 Score =   237 bits (604),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 167/305 (55%), Positives = 203/305 (67%), Gaps = 43/305 (14%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQ----QFH-----EQSGQKQRDPEEVNQQDDGNDGGESKNGLGG-  466
             LPPPF  SRD + HP+    Q H      Q+ + +++   +N+    + GG  +N  G  
Sbjct  11    LPPPF-LSRDLHLHPRHQFPQLHPHHLNHQNSEDEQNSSGINRGIKRDRGGGDENSAGAT  69

Query  467   -------------AGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCD  607
                          AGE EI+RR RGRPAGSKNK KPPIIITRDSAN LR+H+ME+A+GCD
Sbjct  70    TSLEGKDQLGYTIAGEAEITRRLRGRPAGSKNKAKPPIIITRDSANVLRSHVMEVANGCD  129

Query  608   VMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPA  787
             +MDSV+ FA+R+QRGVC+LSG+G VTNVTLRQPASPGAVVTLHGRFEILSL+GSFLPPPA
Sbjct  130   IMDSVSTFARRKQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLSGSFLPPPA  189

Query  788   PPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLP-----------  934
             PP+ +GLTIYLAGGQGQVVGG VVG LLA+GPVVIMA SF NAAYERLP           
Sbjct  190   PPATSGLTIYLAGGQGQVVGGPVVGPLLASGPVVIMAGSFGNAAYERLPLEEEEELAAAG  249

Query  935   -LEEDDGN-----APPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGG  1096
              ++   G+     +P   G           Q      +F G+P +L+N  QLP DAYWG 
Sbjct  250   QVQGIQGSGRSLGSPGVGGQEHQQQQQQLLQDPNAPSLFHGMPQSLLN--QLPADAYWGT  307

Query  1097  SRPPF  1111
             +RP +
Sbjct  308   ARPAY  312



>emb|CDX82978.1| BnaC01g14280D [Brassica napus]
Length=315

 Score =   237 bits (604),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 200/306 (65%), Gaps = 40/306 (13%)
 Frame = +2

Query  311   SQLPPPFHTSRDFNFH------------PQQFHEQSG----QKQRDPEEVNQQDDG---N  433
             S LPP FH SRDF  H             Q  H+  G    Q + D EE +   D    N
Sbjct  11    SSLPPTFH-SRDFQLHLQQQQQQQENQTDQDDHQGGGGLNRQIKMDREETSDNMDNMANN  69

Query  434   DGGESKN--------GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLME  589
              G E K+        G GG+G  +++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+ME
Sbjct  70    SGSEGKDMNLGEGGSGGGGSGGDQMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVME  129

Query  590   IADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASP--GAVVTLHGRFEILSLA  763
             I DGCD+++SVA FA+RRQRGVCV+SG G V NVT+RQP SP  G+VV+LHGRFEILSL+
Sbjct  130   IGDGCDLVESVATFARRRQRGVCVMSGTGNVMNVTIRQPGSPSPGSVVSLHGRFEILSLS  189

Query  764   GSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEE  943
             GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL AGPVV+MAASFSNAAYERLPLEE
Sbjct  190   GSFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEE  249

Query  944   DDGNAPPF-----QgggmdspgaaggqllaeqgMFQGVPPNLINSI-----QLPNDAYWG  1093
             D+   P               G             QG+PPNL+        Q  N +YW 
Sbjct  250   DEMQTPVHGGGGGSMEPPPMMGGPMPHQQQAMSAHQGLPPNLLGPAHQGLPQHDNQSYWS  309

Query  1094  GSRPPF  1111
               RPP+
Sbjct  310   TGRPPY  315



>ref|XP_011070911.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=255

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 181/224 (81%), Gaps = 15/224 (7%)
 Frame = +2

Query  317  LPPPFHTSRDFNFHPQQFHEQSGQKQRDPEEVNQQDDGN----DGGESKNGLG-------  463
            LPPPFHT RDFN    QFH Q+   + +  E +  + G     D G+S +  G       
Sbjct  6    LPPPFHT-RDFNLQ-HQFHHQAQNSEDEQSETSGLNMGQKRNRDEGKSTDSPGKDGSGAA  63

Query  464  --GAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
              G GE   +RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEI+DGCD+MD VA FA+
Sbjct  64   GSGEGEMSANRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEISDGCDIMDGVANFAR  123

Query  638  RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
            RRQRGVC++SG G VTNVTLRQPA+PGAVVTLHGRFEILSLAGSFLPPPAPP+ATGLTIY
Sbjct  124  RRQRGVCIMSGTGSVTNVTLRQPAAPGAVVTLHGRFEILSLAGSFLPPPAPPAATGLTIY  183

Query  818  laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            LAGGQGQV+GGSVVG LLA+GPV+IMAASFSNAAYERLPLEE++
Sbjct  184  LAGGQGQVLGGSVVGQLLASGPVIIMAASFSNAAYERLPLEEEE  227



>ref|XP_004952401.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=318

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 168/206 (82%), Gaps = 4/206 (2%)
 Frame = +2

Query  488   RRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLS  667
             RRPRGRPAGSKNKPKPPIIITRDSAN LRTH+ME+A GCD+ +S+ AFA+RRQRGVCVLS
Sbjct  100   RRPRGRPAGSKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITAFARRRQRGVCVLS  159

Query  668   GNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvg  847
             G G VTNVTLRQPAS GAVV LHGRFEILSL+GSFLPPPAPP ATGLT+YLAGGQGQVVG
Sbjct  160   GAGTVTNVTLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVG  219

Query  848   gsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggm----dspgaaggqll  1015
             GSVVGAL AAGPVVIMAASF+NA YERLPLEEDD  A   Q         +  AA     
Sbjct  220   GSVVGALTAAGPVVIMAASFANAVYERLPLEEDDMLAAQAQADSAGILAGAQQAAQLAGS  279

Query  1016  aeqgMFQGVPPNLINSIQLPNDAYWG  1093
              +  +FQG+PPNL+ ++QLP ++ +G
Sbjct  280   VDPSLFQGLPPNLLGNVQLPPESAYG  305



>ref|XP_002451872.1| hypothetical protein SORBIDRAFT_04g009050 [Sorghum bicolor]
 gb|EES04848.1| hypothetical protein SORBIDRAFT_04g009050 [Sorghum bicolor]
Length=327

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 165/208 (79%), Gaps = 6/208 (3%)
 Frame = +2

Query  488   RRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLS  667
             RRPRGRPAGSKNKPKPPIIITRDSAN LRTH+ME+A GCD+ +S+ AFA+RRQRGVCVLS
Sbjct  107   RRPRGRPAGSKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITAFARRRQRGVCVLS  166

Query  668   GNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvg  847
             G G VTNVTLRQPAS GAVV LHGRFEILSL+GSFLPPPAPP ATGLT+YLAGGQGQVVG
Sbjct  167   GAGTVTNVTLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVG  226

Query  848   gsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeq-  1024
             GSVVGAL AAGPVVIMAASF+NA YERLPLEEDD  A   Q         A         
Sbjct  227   GSVVGALTAAGPVVIMAASFANAVYERLPLEEDDMLAAQAQADSAGILAGAQQAAQLAAA  286

Query  1025  -----gMFQGVPPNLINSIQLPNDAYWG  1093
                   +FQG+PPNL+ ++QLP +A +G
Sbjct  287   GAVDPSLFQGLPPNLLGNVQLPPEAAYG  314



>ref|XP_003516470.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=288

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 177/222 (80%), Gaps = 14/222 (6%)
 Frame = +2

Query  488   RRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLS  667
             RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA+GCD+M+S+ AFA+RRQRGVCVLS
Sbjct  67    RRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIANGCDIMESITAFARRRQRGVCVLS  126

Query  668   GNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvg  847
             G+G VTNVTLRQPASPGAVVTLHGRFEILSL+GSFLPPPAPP+A+GL IYLAGGQGQVVG
Sbjct  127   GSGTVTNVTLRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLAIYLAGGQGQVVG  186

Query  848   gsvvgallaagpvvIMAASFSNAAYERLPLEEDD------GNA-------PPFQgggmds  988
             GSVVG L+A+GPVVIMAASF NAAYERLPLEE++      GN        P  Q      
Sbjct  187   GSVVGPLVASGPVVIMAASFGNAAYERLPLEEEETPVAVAGNGGLGSPGIPGTQQQPQQQ  246

Query  989   pgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGS-RPPF  1111
                          +F G+P NL+NS+QLP + YWGGS RPPF
Sbjct  247   QQQQLVGDPNSSSLFHGMPQNLLNSVQLPAEGYWGGSARPPF  288



>ref|XP_004172826.1| PREDICTED: LOW QUALITY PROTEIN: putative DNA-binding protein 
ESCAROLA-like [Cucumis sativus]
 gb|KGN50183.1| hypothetical protein Csa_5G157420 [Cucumis sativus]
Length=303

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 204/310 (66%), Gaps = 48/310 (15%)
 Frame = +2

Query  305   MDSQ-LPPPFHTSRDFNFHPQQFH-------------EQSGQKQRDPEEVNQQDDGNDGG  442
             MDS  LPPPFHT RDF+     FH               + + +RD ++     + N  G
Sbjct  1     MDSHSLPPPFHT-RDFHLQQHPFHTNTNNNNSEEEHSTTTTRLKRDRDDDTNNSNPNSAG  59

Query  443   ESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSV  622
             +         +GEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTH++E+ DGCD++DSV
Sbjct  60    DP------TPDGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTHVIEVTDGCDIVDSV  113

Query  623   AAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSAT  802
             A FA+RRQRGVC++SG G VTNVTLRQPASPGA+V LHGRFEILSLAGSFLPPPAPP+AT
Sbjct  114   ATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVNLHGRFEILSLAGSFLPPPAPPAAT  173

Query  803   GLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDG-NAPPFQ---  970
              LTIYLAGGQGQVVGGSVVG L+A+GPVVIMAASFSNAAYERLPLEEDD    P  Q   
Sbjct  174   TLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEDDQPQLPSLQGGG  233

Query  971   ---------------------gggmdspgaaggqllaeqgMFQGVPPNLINSIQLP--ND  1081
                                      +              +F G+PPNL+NSIQ+P    
Sbjct  234   GIGSPDEVGQSQITAQTAHHQQQQQNQQQQQQLLNDGNAPLFHGLPPNLLNSIQMPPSES  293

Query  1082  AYWGGSRPPF  1111
              YW  +RPP+
Sbjct  294   PYWATARPPY  303



>ref|XP_004147565.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=303

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 204/310 (66%), Gaps = 48/310 (15%)
 Frame = +2

Query  305   MDSQ-LPPPFHTSRDFNFHPQQFH-------------EQSGQKQRDPEEVNQQDDGNDGG  442
             MDS  LPPPFHT RDF+     FH               + + +RD ++     + N  G
Sbjct  1     MDSHSLPPPFHT-RDFHLQQHPFHTNTNNNNSEEEHSTTTTRLKRDRDDDTNNSNPNSAG  59

Query  443   ESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSV  622
             +         +GEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTH++E+ DGCD++DSV
Sbjct  60    DP------TPDGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTHVIEVTDGCDIVDSV  113

Query  623   AAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSAT  802
             A FA+RRQRGVC++SG G VTNVTLRQPASPGA+V LHGRFEILSLAGSFLPPPAPP+AT
Sbjct  114   ATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVNLHGRFEILSLAGSFLPPPAPPAAT  173

Query  803   GLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDG-NAPPFQ---  970
              LTIYLAGGQGQVVGGSVVG L+A+GPVVIMAASFSNAAYERLPLEEDD    P  Q   
Sbjct  174   TLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEDDQPQLPSLQGGG  233

Query  971   ---------------------gggmdspgaaggqllaeqgMFQGVPPNLINSIQLP--ND  1081
                                      +              +F G+PPNL+NSIQ+P    
Sbjct  234   GIGSPDEVGQSQITAQTAHHQQQQQNKQQQQQLLNDGNAPLFHGLPPNLLNSIQMPPSES  293

Query  1082  AYWGGSRPPF  1111
              YW  +RPP+
Sbjct  294   PYWATARPPY  303



>dbj|BAK03205.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=309

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 173/221 (78%), Gaps = 7/221 (3%)
 Frame = +2

Query  446   SKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVA  625
             S  GL   GE   SRRPRGRPAGSKNKPKPPIIITRDSAN LRTH+ME+A GCD+ +S+ 
Sbjct  76    SGGGLQDGGENG-SRRPRGRPAGSKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESIT  134

Query  626   AFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATG  805
             AFA+RRQRGVCVLSG G VTNVTLRQPAS GAVV LHGRFEILSL+GSFLPPPAPP ATG
Sbjct  135   AFARRRQRGVCVLSGAGTVTNVTLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATG  194

Query  806   LTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmd  985
             LT+YLAGG+GQVVGG+VVG+L AAGPVVIMAASF+NA YERLPLEED+  A   Q     
Sbjct  195   LTVYLAGGKGQVVGGTVVGSLTAAGPVVIMAASFANAVYERLPLEEDELLAAQGQADSNG  254

Query  986   spgaaggqllaeq------gMFQGVPPNLINSIQLPNDAYW  1090
                AAG Q            +F+G+PPNL+ ++QLP +A +
Sbjct  255   MLLAAGQQASQMAGGDVDPSLFEGLPPNLLGNVQLPPEAGY  295



>ref|XP_007134900.1| hypothetical protein PHAVU_010G085300g [Phaseolus vulgaris]
 gb|ESW06894.1| hypothetical protein PHAVU_010G085300g [Phaseolus vulgaris]
Length=310

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 199/301 (66%), Gaps = 37/301 (12%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQFHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGA--------G  472
             LPPPF T RD + HP    +     Q   +E         G +   G GG         G
Sbjct  11    LPPPFLT-RDLHLHPHHQFQPHHNHQNTEDEAANGRGQKRGRDENTGSGGGATTPPHAGG  69

Query  473   EG------------EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMD  616
             +G            E+ RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA+GCD+M+
Sbjct  70    DGQEPGSGDGGGGSEMGRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIANGCDIME  129

Query  617   SVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPS  796
             SV AFA+RRQRGVCVLSG+G VTNVTLRQPASPGAVVTLHGRFEILSL+GSFLPPPAPP+
Sbjct  130   SVTAFARRRQRGVCVLSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPA  189

Query  797   ATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP-----  961
             A+GL IYLAGGQGQVVGGSVVG LLA+GPVVIMAASF NAAYERLPLE+++   P     
Sbjct  190   ASGLAIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEDEETPVPVPGTG  249

Query  962   ----------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGS-RPP  1108
                         Q                   +F GVP NL+NS+QLP + YWGG+ RP 
Sbjct  250   GLGSPGIAGTQQQSQSQPQQPQQLVGDPNTSSLFHGVPQNLLNSVQLPAEGYWGGTARPS  309

Query  1109  F  1111
             F
Sbjct  310   F  310



>ref|XP_008437165.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=303

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 175/312 (56%), Positives = 205/312 (66%), Gaps = 52/312 (17%)
 Frame = +2

Query  305   MDSQ-LPPPFHTSRDFNFHPQQFH-------------EQSGQKQRDPEEVNQQDDGNDGG  442
             MDS  LPPPFHT RDF+     FH               + + +RD ++     + N  G
Sbjct  1     MDSHSLPPPFHT-RDFHLQQHPFHTNTNNNNSEEEHSTTTTRLKRDRDDDTNNSNPNSAG  59

Query  443   ESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSV  622
             +         +GEI+RRPRGRPAGSKNKPKPPIIITRDSANALRTH++E+ DGCD++DSV
Sbjct  60    DP------TPDGEITRRPRGRPAGSKNKPKPPIIITRDSANALRTHVIEVTDGCDIVDSV  113

Query  623   AAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSAT  802
             A FA+RRQRGVC++SG G VTNVTLRQPASPGA++ LHGRFEILSLAGSFLPPPAPP+AT
Sbjct  114   ATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIINLHGRFEILSLAGSFLPPPAPPAAT  173

Query  803   GLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPF-----  967
              LTIYLAGGQGQVVGGSVVG L+A+GPVVIMAASFSNAAYERLPLEEDD   PP      
Sbjct  174   TLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEDD--QPPLPSLQG  231

Query  968   ----------------------QgggmdspgaaggqllaeqgMFQGVPPNLINSIQLP--  1075
                                   Q    +              +F G+PPNL+NSIQ+P  
Sbjct  232   GGGIGSPDEVGQSQITAQTAHHQQQQQNQQQQQQLLNDGNAPLFHGLPPNLLNSIQMPPS  291

Query  1076  NDAYWGGSRPPF  1111
                YW  +RPP+
Sbjct  292   ESPYWATARPPY  303



>ref|XP_003521618.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=310

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 201/301 (67%), Gaps = 37/301 (12%)
 Frame = +2

Query  317   LPPPFHTSRDFNF----------HPQQFHEQSG----QKQRDPEEVNQQDDG----NDGG  442
             LPPPF T RD +           + Q   +++G    QK+   E V          + GG
Sbjct  11    LPPPFLT-RDLHLHPHHQFQPHHNNQNTEDEAGNGRGQKRDRDENVGGGGGATTPPHGGG  69

Query  443   ESKN-GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDS  619
             E K  G    G  ++ RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEI +GCD+M+S
Sbjct  70    EGKEPGSEDGGGSDMGRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEITNGCDIMES  129

Query  620   VAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSA  799
             V AFA+RRQRG+C+LSG+G VTNVTLRQPASP AVVTLHGRFEILSL+GSFLPPPAPP+A
Sbjct  130   VTAFARRRQRGICLLSGSGTVTNVTLRQPASPSAVVTLHGRFEILSLSGSFLPPPAPPAA  189

Query  800   TGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP------  961
             +GL IYLAGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEE++   P      
Sbjct  190   SGLAIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEEEETPVPYHGTEG  249

Query  962   ----------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGS-RPP  1108
                                             +F GVP NL+NSIQLP + YWGGS RPP
Sbjct  250   LGSPGIPGTQQQSQSQPQQQQQQLVGDPNSSSLFHGVPQNLLNSIQLPAEGYWGGSARPP  309

Query  1109  F  1111
             F
Sbjct  310   F  310



>ref|XP_006445233.1| hypothetical protein CICLE_v10024070mg [Citrus clementina]
 ref|XP_006490941.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR58473.1| hypothetical protein CICLE_v10024070mg [Citrus clementina]
Length=313

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 200/307 (65%), Gaps = 46/307 (15%)
 Frame = +2

Query  317   LPPPFHTSRDF------------------------NFHPQQFHEQSGQKQRDPEEVNQQD  424
             LPPPFHT RD                         N          GQK RD  E N  +
Sbjct  11    LPPPFHT-RDIHLQPHHHQFQQQQQHHHHHQQQQQNSEEDNSSLNRGQK-RDRNENNIAN  68

Query  425   DGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGC  604
                +G E     G  GE  I+RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA+GC
Sbjct  69    AMEEGEELAVATGEGGE--ITRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIANGC  126

Query  605   DVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP  784
             D+MDSV+ FA+RRQRG+C+LSG G VTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP
Sbjct  127   DIMDSVSNFARRRQRGICILSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP  186

Query  785   APPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD-----  949
             APP+A+GLTIYLAGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEE++     
Sbjct  187   APPAASGLTIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEEEETPVAS  246

Query  950   --GNAP----------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWG  1093
               G+ P          P Q                      G+PPNL++S+QLP + YW 
Sbjct  247   IPGSRPLGSPEVNVGQPQQQQQQSQSHQQQLLQDPNASFIHGLPPNLLSSVQLPAEPYWA  306

Query  1094  GSRP-PF  1111
               RP PF
Sbjct  307   TGRPAPF  313



>ref|XP_004511639.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Cicer arietinum]
Length=241

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 183/226 (81%), Gaps = 15/226 (7%)
 Frame = +2

Query  479   EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVC  658
             E+SRRPRGRPAGSKNKPKPPIIITRDSANAL+TH+ME+ADGCD+++SV  FA+RRQRGVC
Sbjct  16    EMSRRPRGRPAGSKNKPKPPIIITRDSANALKTHVMEVADGCDIVESVNNFARRRQRGVC  75

Query  659   VLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgq  838
             ++SG G VTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP+A+GLTIYLAGGQGQ
Sbjct  76    IMSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQ  135

Query  839   vvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDG-NAPPFQgggmds---------  988
             VVGGSVVGAL+A+GPVVIM+ASFSNAAYERLPLE+DDG N+   QGGG            
Sbjct  136   VVGGSVVGALIASGPVVIMSASFSNAAYERLPLEDDDGSNSMQLQGGGGGGSPSGGGGVP  195

Query  989   pgaaggqllaeqgMFQGVPP-----NLINSIQLPNDAYWGGSRPPF  1111
                      A   +FQ +PP     N+++S+Q+P++ +W   R P+
Sbjct  196   QQQTQLLGDATAPLFQAMPPPNPNHNILSSVQMPSETFWPTGRSPY  241



>ref|XP_009137280.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=327

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 180/323 (56%), Positives = 205/323 (63%), Gaps = 57/323 (18%)
 Frame = +2

Query  311   SQLPPPFHTSRDFNFHPQQ---------FHEQSG------------------QKQRDPEE  409
             S LPPPFH SRDF  H QQ          H                      Q + D EE
Sbjct  6     SSLPPPFH-SRDFQLHLQQQQQQQQEFFLHHHQQQRNQTDQDDQQGGGGINRQIKMDREE  64

Query  410   VNQQDDG---NDGGESKN---------GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITR  553
              +   D    N G E K+         G GG+G  +++RRPRGRPAGSKNKPKPPIIITR
Sbjct  65    TSDNIDNMANNSGSEGKDTNQGEGGSGGGGGSGGDQMTRRPRGRPAGSKNKPKPPIIITR  124

Query  554   DSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPA--SPGAVV  727
             DSANALRTH+MEI DGCD++DSVA FA+RRQRGVCV+SG G VTNVT+RQP   SPG+VV
Sbjct  125   DSANALRTHVMEIGDGCDLVDSVATFARRRQRGVCVMSGTGNVTNVTIRQPGSPSPGSVV  184

Query  728   TLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASF  907
             +LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL AGPVV+MAASF
Sbjct  185   SLHGRFEILSLSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASF  244

Query  908   SNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeqgM---------FQGVPPNLIN  1060
             SNAAYERLPLEED+   P   GGG    G+     +    M          QG+PPNL+ 
Sbjct  245   SNAAYERLPLEEDEMQTPVHGGGGGGGGGSMESPPMMGGQMPHQQQAMSAHQGLPPNLLG  304

Query  1061  SI------QLPNDAYWGGSRPPF  1111
                     Q  N  YW   RP F
Sbjct  305   GSAHQGLPQHDNQPYWSTGRPSF  327



>ref|XP_004511638.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Cicer arietinum]
Length=312

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 172/302 (57%), Positives = 207/302 (69%), Gaps = 37/302 (12%)
 Frame = +2

Query  317   LPPPFHTSRD---------------FNFHPQQFHEQSGQKQ-------RDPEEVNQQDDG  430
             LPPPFH +RD               F+   QQ H++             + EE   + + 
Sbjct  11    LPPPFHAARDLHLHHQQQQQQQHLQFHTLQQQDHDEQSGSSSGGGLNLTNREENKFKTEL  70

Query  431   NDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDV  610
                     G GG    E+SRRPRGRPAGSKNKPKPPIIITRDSANAL+TH+ME+ADGCD+
Sbjct  71    GMEEGGGGGSGGDNSNEMSRRPRGRPAGSKNKPKPPIIITRDSANALKTHVMEVADGCDI  130

Query  611   MDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAP  790
             ++SV  FA+RRQRGVC++SG G VTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAP
Sbjct  131   VESVNNFARRRQRGVCIMSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAP  190

Query  791   PSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDG-NAPPF  967
             P+A+GLTIYLAGGQGQVVGGSVVGAL+A+GPVVIM+ASFSNAAYERLPLE+DDG N+   
Sbjct  191   PAASGLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPLEDDDGSNSMQL  250

Query  968   Qgggmds---------pgaaggqllaeqgMFQGVPP-----NLINSIQLPNDAYWGGSRP  1105
             QGGG                     A   +FQ +PP     N+++S+Q+P++ +W   R 
Sbjct  251   QGGGGGGSPSGGGGVPQQQTQLLGDATAPLFQAMPPPNPNHNILSSVQMPSETFWPTGRS  310

Query  1106  PF  1111
             P+
Sbjct  311   PY  312



>ref|XP_003517441.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=300

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 179/224 (80%), Gaps = 14/224 (6%)
 Frame = +2

Query  482   ISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCV  661
             ISRRPRGRPAGSKNKPKPPIIITRDSANAL+TH+ME+ADGCD++DSV+AFA+RRQRGVC+
Sbjct  77    ISRRPRGRPAGSKNKPKPPIIITRDSANALKTHVMEVADGCDIVDSVSAFARRRQRGVCI  136

Query  662   LSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqv  841
             +SG G VTNVTLRQPAS GAVVTLHGRFEILSLAGSFLPPPAPP+A+GLTIYLAGGQGQV
Sbjct  137   MSGTGTVTNVTLRQPASSGAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQV  196

Query  842   vggsvvgallaagpvvIMAASFSNAAYERLPLEEDD--------------GNAPPFQggg  979
             VGGSVVGAL+A+GPVVIM+ASFSNAAYERLPLE++D              G      GG 
Sbjct  197   VGGSVVGALIASGPVVIMSASFSNAAYERLPLEDEDPSMALQGGGSIGSPGGGGGGGGGV  256

Query  980   mdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                  +      +   +F G+ PNL+NS+Q+P++ +W   R P+
Sbjct  257   GQQQPSQQLMGDSTAPLFHGLNPNLLNSVQMPSETFWATGRSPY  300



>ref|XP_010277406.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=282

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 171/281 (61%), Positives = 204/281 (73%), Gaps = 27/281 (10%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQF----HEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEI  484
             LPPPF+ +RD + H         EQ  +++RD        D      SK  +   GEGE 
Sbjct  13    LPPPFN-ARDLHLHHHHQQNSEDEQGMKRERDDSSNIHHSD------SKEMVVTTGEGEF  65

Query  485   SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVL  664
             +RRPRGRPAGSKNKPKPPIIITR+SAN+LR H+MEIA+GCDV +SVA FA+RRQRGVC+L
Sbjct  66    TRRPRGRPAGSKNKPKPPIIITRESANSLRAHVMEIANGCDVGESVATFARRRQRGVCIL  125

Query  665   SGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvv  844
             SG+G VTNVTLRQPA+PGA+VTLHGRFEILSL+GSFLPPPAPP+ATGLTIYL+GGQGQVV
Sbjct  126   SGSGTVTNVTLRQPAAPGAIVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLSGGQGQVV  185

Query  845   ggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP-----PFQgggmdspgaaggq  1009
             GGSVVGAL+A+GPVVIMAASFSNAAYERLPLE++D + P     P    GM        Q
Sbjct  186   GGSVVGALVASGPVVIMAASFSNAAYERLPLEDEDPSLPIQSGGPLGSPGMVGQQQNQPQ  245

Query  1010  llaeqg-------MFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                +Q        +F G+PPNL+     P +A+W  +RPPF
Sbjct  246   QQQQQLLPDPNNPLFHGLPPNLL----APAEAFWATARPPF  282



>ref|XP_009136213.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=326

 Score =   232 bits (592),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 168/225 (75%), Gaps = 14/225 (6%)
 Frame = +2

Query  479   EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVC  658
             +++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEI DGCD+++SVA FA+RRQRGVC
Sbjct  102   QMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIGDGCDLVESVATFARRRQRGVC  161

Query  659   VLSGNGIVTNVTLRQPA--SPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggq  832
             V+SG G V NVT+RQP   SPG+VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQ
Sbjct  162   VMSGTGNVMNVTIRQPGSPSPGSVVSLHGRFEILSLSGSFLPPPAPPNATGLSVYLAGGQ  221

Query  833   gqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspga-----  997
             GQVVGGS  G LL AGPVV+MAASFSNAAYERLPLEED+   P   GGG           
Sbjct  222   GQVVGGSGGGPLLCAGPVVVMAASFSNAAYERLPLEEDEMQTPVHGGGGGGGSMEPPPMM  281

Query  998   --aggqllaeqgMFQGVPPNLINSI-----QLPNDAYWGGSRPPF  1111
                           QG+PPNL+        Q  N +YW   RPP+
Sbjct  282   GGPMPHQQQAMSAHQGLPPNLLGPTHQGLPQHDNQSYWSTGRPPY  326



>ref|XP_009379269.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=320

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 208/313 (66%), Gaps = 51/313 (16%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHP-----QQFH-----EQSGQKQRDPEEVNQQDDGNDGGESKNGLGG  466
             +PPPF  SRD + HP     Q  H      Q+ + +++   +N     N GG  +N  GG
Sbjct  11    IPPPF-LSRDLHLHPHHQFQQHLHPHHLNHQNSEDEQNSSGINSGIKRNRGGGDENSAGG  69

Query  467   --------------AGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGC  604
                           AGE EI+RRPRGRPAGSKNK KPPIIITRDSANALR+H+ME+A+GC
Sbjct  70    TTSLEGKDQLGSTSAGEAEITRRPRGRPAGSKNKAKPPIIITRDSANALRSHVMEVANGC  129

Query  605   DVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP  784
             D+M+SV+ FA+RRQRGVC+LSG+G VTNVTLRQPASPGAVVTLHGRFEILSL+GSFLPPP
Sbjct  130   DIMESVSTFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLSGSFLPPP  189

Query  785   APPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPP  964
             APP+A+ LTIYLAGGQGQ VGG VVG LLA+GPVVIMAASF NAAYERLPLEE++  A  
Sbjct  190   APPAASCLTIYLAGGQGQGVGGGVVGPLLASGPVVIMAASFGNAAYERLPLEEEEEPAVA  249

Query  965   FQgggmdspgaaggqllaeq------------------------gMFQGVPPNLINSIQL  1072
              Q  G      + G    E                          +F G+P +L+N  QL
Sbjct  250   VQVQGSGGSLGSPGIGGQEHQQQSLQQQQQQQQQQQLLQDPNAPSLFHGMPQSLLN--QL  307

Query  1073  PNDAYWGGSRPPF  1111
             P DAYWG +RPP+
Sbjct  308   PADAYWGTARPPY  320



>ref|XP_003573204.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=312

 Score =   231 bits (590),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 165/196 (84%), Gaps = 3/196 (2%)
 Frame = +2

Query  488   RRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLS  667
             RRPRGRPAGSKNKPKPPIIITRDSAN LRTH+ME+A GCD+ +S+ AFA+RRQRGVCVLS
Sbjct  97    RRPRGRPAGSKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITAFARRRQRGVCVLS  156

Query  668   GNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvg  847
             G G VTNVTLRQPAS GAVV LHGRFEILSL+GSFLPPPAPP ATGLT+YLAGGQGQVVG
Sbjct  157   GAGTVTNVTLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVG  216

Query  848   gsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeqg  1027
             GSVVGAL AAGPVVIMAASF+NA YERLPLE++D  A   QGG   +    G     +  
Sbjct  217   GSVVGALTAAGPVVIMAASFANAVYERLPLEDEDLLA---QGGDSGAGMLPGAGGQMDPN  273

Query  1028  MFQGVPPNLINSIQLP  1075
             +FQG+PPNL+ ++QLP
Sbjct  274   LFQGLPPNLLGNVQLP  289



>ref|NP_001146992.1| DNA binding protein [Zea mays]
 gb|ACG24948.1| DNA binding protein [Zea mays]
 gb|AFW65915.1| DNA binding protein [Zea mays]
Length=320

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 166/209 (79%), Gaps = 3/209 (1%)
 Frame = +2

Query  488   RRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLS  667
             RRPRGRPAGSKNKPKPPIIITRDSAN LRTH+ME+A GCD+ +SV AFA+RRQRGVCVLS
Sbjct  101   RRPRGRPAGSKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESVTAFARRRQRGVCVLS  160

Query  668   GNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvg  847
             G G VTNVTLRQPAS GAVV LHGRFEILSL+GSFLPPPAPP ATGLT+YLAGGQGQVVG
Sbjct  161   GAGTVTNVTLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVG  220

Query  848   gsvvgallaagpvvIMAASFSNAAYERLPLEEDD---GNAPPFQgggmdspgaaggqlla  1018
             GSVVGAL AAGPVV+MAASF+NA YERLPLE+DD    +  P          A       
Sbjct  221   GSVVGALTAAGPVVVMAASFANAVYERLPLEDDDLLAAHQAPQAQADGVLAAAQLAAGSV  280

Query  1019  eqgMFQGVPPNLINSIQLPNDAYWGGSRP  1105
             +  +FQG+PPNL+  +Q+P +  +G + P
Sbjct  281   DPTLFQGLPPNLLGDVQMPPEPAYGWNPP  309



>ref|XP_006402533.1| hypothetical protein EUTSA_v10006144mg [Eutrema salsugineum]
 gb|ESQ43986.1| hypothetical protein EUTSA_v10006144mg [Eutrema salsugineum]
Length=282

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 188/280 (67%), Gaps = 20/280 (7%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQFHEQSGQKQ-----RDPEEVNQQDDGNDGGESKNGL---GGAG  472
             L PP   S+D + H   FH QS   Q     RD ++    D  N  G+         G G
Sbjct  8     LSPPSFLSKDLHLH--NFHHQSSNHQILGLKRDRQDHIVNDHSNSSGKDHATTTTPSGEG  65

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +  I RRPRGRP+GSKNKPK PIIITRDSANA R H+MEIA+GCDVM+S+  FA+RR RG
Sbjct  66    DKIIKRRPRGRPSGSKNKPKAPIIITRDSANAFRCHVMEIANGCDVMESINVFARRRHRG  125

Query  653   VCVLSGNGIVTNVTLRQPASPG-----AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
             VCVL+GNG VT++T+R P   G     AVV L GRFEILSL+GSFLPPPAPP+A+GLT+Y
Sbjct  126   VCVLTGNGAVTDITVRHPVGGGGAGSNAVVKLLGRFEILSLSGSFLPPPAPPAASGLTVY  185

Query  818   laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPL--EEDDGNAPPFQgggmdsp  991
             LAGGQGQVVGG+VVG L+A+G VVIMAASF NAAYERLPL  EE+DGNA           
Sbjct  186   LAGGQGQVVGGNVVGPLMASGRVVIMAASFGNAAYERLPLEKEEEDGNAT---VADESQT  242

Query  992   gaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                   +       QG+P N++NS+ LP++AYWG  RP F
Sbjct  243   QTQKQLMQDATPFIQGLPSNIMNSVSLPSEAYWGTQRPSF  282



>ref|XP_002876587.1| hypothetical protein ARALYDRAFT_486561 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52846.1| hypothetical protein ARALYDRAFT_486561 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 158/271 (58%), Positives = 192/271 (71%), Gaps = 22/271 (8%)
 Frame = +2

Query  320   PPPFHTSRDFNFHPQQFHEQSGQKQ-RDPEEVNQQDDGNDGGESKNGLGGAGEGEISRRP  496
             PP F +S   ++H    H+ +G K+ R+ ++V   +DG D   + +  G   +    RRP
Sbjct  9     PPHFLSSDLHHYH----HQNAGLKRDREEDDVEPNNDGKDQDTTPSEGGNIKK----RRP  60

Query  497   RGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNG  676
             RGRPAGSKNKPK PII+TRDSANA R H+MEI +GCDVM+S+A FA+RRQRGVCVL+GNG
Sbjct  61    RGRPAGSKNKPKAPIIVTRDSANAFRCHVMEITNGCDVMESLAVFARRRQRGVCVLTGNG  120

Query  677   IVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsv  856
              VTNVT+RQP   G VV+LHGRFEILSL+GSFLPPPAPP+ATGLT+YLAGGQGQV+GGS+
Sbjct  121   AVTNVTVRQPG--GGVVSLHGRFEILSLSGSFLPPPAPPAATGLTVYLAGGQGQVIGGSL  178

Query  857   vgallaagpvvIMAASFSNAAYERLPLEED------DGNAPPFQgggmdspgaaggqlla  1018
             VG L+A+GPVVIMAASF NAAYERL LEE+      DGNA                 +  
Sbjct  179   VGPLMASGPVVIMAASFGNAAYERLQLEEEETDREIDGNA-----SMAVGTQTQKQLMHD  233

Query  1019  eqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                  QG P NLINS+ LP++AYWG  RP F
Sbjct  234   ATSFVQGSPSNLINSVSLPSEAYWGTQRPSF  264



>ref|XP_010676637.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=315

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 164/253 (65%), Positives = 184/253 (73%), Gaps = 29/253 (11%)
 Frame = +2

Query  425   DGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGC  604
             D  DGG   + +       I+RRPRGRPAGSKNKPKPPIIITRDSANALRTH+ME++DGC
Sbjct  68    DSKDGGADHHNMS-----MITRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEVSDGC  122

Query  605   DVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPAS-------PGAVVTLHGRFEILSLA  763
             D+MDSVA FA+ RQRGVC+LSG G V NVT+RQP S       P AVVTLHGRFEILSLA
Sbjct  123   DIMDSVATFARLRQRGVCILSGTGTVANVTIRQPGSTSTGNGGPPAVVTLHGRFEILSLA  182

Query  764   GSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEE  943
             GSFLPPPAPP+ATGL+IYLAGGQGQVVGGSVVG LLA+GPVVIMAASFSNAAYERLPLEE
Sbjct  183   GSFLPPPAPPAATGLSIYLAGGQGQVVGGSVVGQLLASGPVVIMAASFSNAAYERLPLEE  242

Query  944   DDGNAPPFQgggmdspgaaggqlla-----------------eqgMFQGVPPNLINSIQL  1072
             D        GGGM   G+  G                        MFQG+PPNL+NS+Q+
Sbjct  243   DQEGGGATMGGGMQGGGSLSGMEHQGMQQPPQQLLGNDPNGGGSAMFQGMPPNLLNSVQM  302

Query  1073  PNDAYWGGSRPPF  1111
             P++ YWG  RP F
Sbjct  303   PSEGYWGTGRPSF  315



>ref|XP_011090893.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=307

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 175/220 (80%), Gaps = 9/220 (4%)
 Frame = +2

Query  479   EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVC  658
             E++RRPRGRPAGSKNKPKPPIIITRDSANALR+H+ME+A+GCD+ +S++ FA RRQRGVC
Sbjct  88    EVTRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEVANGCDIQESISTFATRRQRGVC  147

Query  659   VLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgq  838
             +LSGNG VTNVTLRQPA+PGAVVTLHGRFEILSL+GSFLPPPAPP+A+ LTIYLAGGQGQ
Sbjct  148   ILSGNGTVTNVTLRQPAAPGAVVTLHGRFEILSLSGSFLPPPAPPAASALTIYLAGGQGQ  207

Query  839   vvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD------GNAPPFQgggmdspgaa  1000
             V+GG+VVG LLA+GPVVIMAASF NAAYERLPLEE++       +       GM      
Sbjct  208   VMGGTVVGPLLASGPVVIMAASFGNAAYERLPLEEEETAVGGVSSGGQMGSPGMVGQQGQ  267

Query  1001  ggqllaeqgMFQGV--PPNLINSI-QLPNDAYWGGSRPPF  1111
                      MFQG   P N++NS  QLP +AYWG  RPPF
Sbjct  268   QLMNDPNTNMFQGTMPPQNMLNSCGQLPAEAYWGTGRPPF  307



>ref|XP_010092850.1| hypothetical protein L484_022445 [Morus notabilis]
 gb|EXB52668.1| hypothetical protein L484_022445 [Morus notabilis]
Length=326

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 177/233 (76%), Gaps = 23/233 (10%)
 Frame = +2

Query  482   ISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCV  661
             I+RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA+ CDVMDS++AFA+RRQRG+CV
Sbjct  94    ITRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIANACDVMDSMSAFARRRQRGICV  153

Query  662   LSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqv  841
             LSG G VTNVTLRQPASPGAVV+LHGRFEILSL+GSFLPPPAPP+A+GLTIYLAGGQGQV
Sbjct  154   LSGTGTVTNVTLRQPASPGAVVSLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQV  213

Query  842   vggsvvgallaagpvvIMAASFSNAAYERLPLEEDD--GNAPPFQgg-------------  976
             VGGSVVG L+A+GPVVIMAASF NAAYERLPLEE+D   N    Q               
Sbjct  214   VGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEEDQANNQVSMQVSGGLGSPGSLNVGQ  273

Query  977   -----gmdspgaaggqllaeqgMFQGVPP--NLINSIQLPNDAYWG-GSRPPF  1111
                            Q      ++ GVP   NL+NS  LP+DAYWG  +RPP+
Sbjct  274   QQQQQQPPQQQEQMLQDPNTSTLYHGVPAAQNLLNSCNLPSDAYWGTAARPPY  326



>gb|EYU29016.1| hypothetical protein MIMGU_mgv1a023550mg [Erythranthe guttata]
Length=298

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 211/302 (70%), Gaps = 37/302 (12%)
 Frame = +2

Query  305   MDSQ-LPPPFHTSRDFNFHPQQFHEQSGQKQRDPEEVNQQDDGNDGGE--SKNGLGGAGE  475
             MD+  LPPPFHT RDFN   Q  H    Q   D +    +  G + G+   K   GG G+
Sbjct  1     MDNHSLPPPFHT-RDFNLQHQFHHHHQTQNSEDEQS---ETTGLNMGQHHQKRHRGGGGD  56

Query  476   GEISRRPRG-----------------RPAGSKNKPKPPIIITRDSANALRTHLMEIADGC  604
              + + +  G                 RP+GSKN+PKPPIII+RDSANALRTH+MEI+DGC
Sbjct  57    IDSAGKDGGADEGEMSGGGGSRRPRGRPSGSKNRPKPPIIISRDSANALRTHVMEISDGC  116

Query  605   DVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP  784
             DVMDSVA+FA+ RQRGVC++SG+G VTNVTLRQPASPGAVVTL GRFEILSL+GSFLPPP
Sbjct  117   DVMDSVASFARSRQRGVCIMSGSGNVTNVTLRQPASPGAVVTLQGRFEILSLSGSFLPPP  176

Query  785   APPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPP  964
             APP+ATGLTIYLAGGQGQVVGG VVG L+A+GPV++MAASFSNAAYERLPLEEDD N   
Sbjct  177   APPAATGLTIYLAGGQGQVVGGGVVGPLVASGPVIVMAASFSNAAYERLPLEEDDQNGVQ  236

Query  965   FQgggmds-------------pgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRP  1105
              QG  + S                   Q+LA+  +FQG+PPNL+NSIQ+PND +W   RP
Sbjct  237   GQGNSLGSPPQGGGGRAAPPPSLQQQQQILADPSLFQGMPPNLLNSIQMPNDEFWATGRP  296

Query  1106  PF  1111
             PF
Sbjct  297   PF  298



>ref|XP_011093194.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=297

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 170/293 (58%), Positives = 197/293 (67%), Gaps = 33/293 (11%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQF-------HEQSGQK-------QRDPEE-------VNQQDDGN  433
             LPPPFHT RD   H Q          EQSG         +RD EE              +
Sbjct  10    LPPPFHT-RDLQLHHQFQHHHQNPDDEQSGNSNSGGLSLKRDREENYGLPPTTATTTATS  68

Query  434   DGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVM  613
             DG E   G   +  GE++RRPRGRPAGSKNKPKPPIIITRDSANALR+H+ME+A+GCD+ 
Sbjct  69    DGKEL--GPQSSDHGEVTRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEVANGCDIQ  126

Query  614   DSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP  793
             +SV+ FA RRQRGVC+LSG+G VTNVTLRQPA+PGAV+TLHGRFEILSL+GSFLPPPAPP
Sbjct  127   ESVSNFATRRQRGVCILSGSGTVTNVTLRQPAAPGAVLTLHGRFEILSLSGSFLPPPAPP  186

Query  794   SATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEE-------DDG  952
             +A+ LTIYLAG QGQVVGG+VVG LLA+GPV+IMAASF NAAYERLPLE+          
Sbjct  187   AASSLTIYLAGAQGQVVGGTVVGPLLASGPVMIMAASFGNAAYERLPLEDEEQQQQQPPA  246

Query  953   NAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
               P                      MFQG+P N++NS  LP +AYWG  RPPF
Sbjct  247   AVPGSGQLESPGISGQQLMNDPNTNMFQGMPQNMLNS--LPAEAYWGTGRPPF  297



>ref|XP_010934543.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=319

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 177/314 (56%), Positives = 211/314 (67%), Gaps = 54/314 (17%)
 Frame = +2

Query  314   QLPPPFHTSRDFNFHP------------------QQFHEQSG---QKQRDPEEVNQQD--  424
              LPPPFHT RDF+                     +   E SG    K+R+ E+ +  +  
Sbjct  12    HLPPPFHT-RDFHHLHHQQHLPHLQPPSLQQQQQKAEEEHSGFNRGKKRELEDNSNDNIN  70

Query  425   --DGNDGGESKNGL-----GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHL  583
                G  GG+ K+ +     G +GEGEI+RRPRGRPAGSKNKPKPPIIITRDSANALR+H+
Sbjct  71    NNTGAKGGDVKDLVPAPQTGSSGEGEITRRPRGRPAGSKNKPKPPIIITRDSANALRSHV  130

Query  584   MEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLA  763
             MEIA GCD+ DSVA FA+ RQRGVC+L G+G VTNVTLRQPA+PG+VV LHGRFEILSL+
Sbjct  131   MEIASGCDIADSVATFARHRQRGVCILGGSGTVTNVTLRQPATPGSVVALHGRFEILSLS  190

Query  764   GSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEE  943
             GSFLPPPAPP+ATGLTIYLAGGQGQVVGGSVVGAL+A+GPVVIMAASF NA YERLPL+E
Sbjct  191   GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALIASGPVVIMAASFGNAVYERLPLDE  250

Query  944   DD--------------GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLI-NSIQLPN  1078
             ++              G +PP Q                   +F G+PPNL+ N++QLP 
Sbjct  251   EEPLPVPGPLGSPGLVGQSPPQQ-----QQQQQQLLPDPNAPLFHGLPPNLVLNNVQLPA  305

Query  1079  DAY-W--GGSRPPF  1111
             D Y W  GG RP +
Sbjct  306   DPYGWAAGGGRPLY  319



>ref|XP_010523691.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=297

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 176/219 (80%), Gaps = 9/219 (4%)
 Frame = +2

Query  479   EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVC  658
             +++RRPRGRPAGSKNKPKPPII+TRDSANALR+H+MEIA+GCDVM+SV  FA+RRQRGVC
Sbjct  80    QVTRRPRGRPAGSKNKPKPPIIVTRDSANALRSHVMEIANGCDVMESVTVFARRRQRGVC  139

Query  659   VLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgq  838
             VLSGNG VTNVT+RQP S GAVV LHGRFEILSL+GSFLPPPAPP+A+GLTIYLAGGQGQ
Sbjct  140   VLSGNGAVTNVTIRQP-SGGAVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQ  198

Query  839   vvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD--------GNAPPFQgggmdspg  994
             VVGGSVVG L+A+GPVVIMAASF NAAYERLPLEE+D                G      
Sbjct  199   VVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEEDEEHAAVVAAVDANANLGSAGGGT  258

Query  995   aaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                 QL+ E    QG+ P+LINS+QLP+++YWG  RP F
Sbjct  259   QTQQQLMQEPSFIQGLNPSLINSVQLPSESYWGTPRPSF  297



>ref|XP_008791267.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=322

 Score =   227 bits (579),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 183/236 (78%), Gaps = 19/236 (8%)
 Frame = +2

Query  461   GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQR  640
             G  GEGEI+RRPRGRPAGSKN+PKPPIIITRDSANALR+H+MEIA GCD+ +SV+ FA+R
Sbjct  87    GSGGEGEITRRPRGRPAGSKNRPKPPIIITRDSANALRSHVMEIAGGCDIAESVSTFARR  146

Query  641   RQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             RQRGVC+L G+G VTNVTLRQPASPG+VV LHGRFEILSL+GSFLPPPAPP+ATGLTIYL
Sbjct  147   RQRGVCILGGSGTVTNVTLRQPASPGSVVALHGRFEILSLSGSFLPPPAPPAATGLTIYL  206

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaa  1000
             AGGQGQVVGGSV+GAL+A+GPVVIMAASF NA YERLPL+E++    P   G     G +
Sbjct  207   AGGQGQVVGGSVLGALIASGPVVIMAASFGNAVYERLPLDEEEPLPVPGSLGSPGLVGQS  266

Query  1001  ggqllae----------------qgMFQGVPPNLINSIQLPNDAY-W--GGSRPPF  1111
               Q   +                  +F G+PPNL+N++QLP DAY W  GG RP +
Sbjct  267   PQQQQQQQQQQQPQQQQLLPDPNTHLFHGLPPNLLNNVQLPTDAYGWAAGGGRPLY  322



>ref|XP_008343156.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=317

 Score =   226 bits (577),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 210/310 (68%), Gaps = 48/310 (15%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHP-----QQFH-----EQSGQKQRDPEEVNQQDDGNDGGESKNGLGG  466
             +PPPF  SRD + HP     Q  H      Q+ + +++   +N+    + GG  +N  GG
Sbjct  11    IPPPF-LSRDLHLHPHHQFQQHLHPHHLNHQNSEDEQNGSGINRGIKRDRGGGDENSAGG  69

Query  467   --------------AGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGC  604
                           AGE EI+RRPRGRPAGSKNK KPPIIITRDSANALR+H+ME+A+GC
Sbjct  70    TTSLEGKDQLGSTSAGEAEITRRPRGRPAGSKNKAKPPIIITRDSANALRSHVMEVANGC  129

Query  605   DVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP  784
             D+M+SV+ FA+RRQRGVC+LSG+G VTNVTLRQPASPGAVVTLHGRFEILSL+GSFLPPP
Sbjct  130   DIMESVSTFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLSGSFLPPP  189

Query  785   APPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPP  964
             APP+A+ LTIYLAGGQGQVVGG VVG LLA+GPVVIMAASF NAAYERLPLEE++  A  
Sbjct  190   APPAASCLTIYLAGGQGQVVGGGVVGPLLASGPVVIMAASFGNAAYERLPLEEEEEPAVA  249

Query  965   FQgggmdspgaaggqllaeq---------------------gMFQGVPPNLINSIQLPND  1081
              Q  G      + G    E                       +F G+P +L+N  QLP D
Sbjct  250   GQVQGSGGSLGSPGIGGQEHQQQSLQQQQQQQQLLQDPNAPSLFHGMPQSLLN--QLPAD  307

Query  1082  AYWGGSRPPF  1111
             AYWG +RPP+
Sbjct  308   AYWGTARPPY  317



>ref|XP_009382863.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382873.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=309

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 179/235 (76%), Gaps = 29/235 (12%)
 Frame = +2

Query  464   GAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRR  643
             G G+GEI RRPRGRPAGSKNKPKPPIIITR+SAN LR+H+MEIA GCD+++S+A FA RR
Sbjct  85    GGGDGEIMRRPRGRPAGSKNKPKPPIIITRESANVLRSHVMEIAGGCDIVESIATFACRR  144

Query  644   QRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYla  823
              RGVC+LSG+G V NVTLRQPASP AVVTLHGRFEILSL+GSFLPPPAPP+ATGLTIYLA
Sbjct  145   HRGVCILSGSGTVVNVTLRQPASPSAVVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLA  204

Query  824   ggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD---------------GNA  958
             GGQGQ+VGGSVVGAL+A+ PV+IMAASF NAAYERLPL+E++               G +
Sbjct  205   GGQGQIVGGSVVGALIASSPVIIMAASFGNAAYERLPLDEEEPLQAQQGGLGSPGLVGQS  264

Query  959   PPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAY-W---GGSRPPF  1111
             PP Q             L     +  G+PPNL+N++QLP +AY W   GG R P+
Sbjct  265   PPPQ----------QQLLDPNNPLLHGLPPNLLNNVQLPAEAYGWATGGGGRTPY  309



>ref|XP_006296351.1| hypothetical protein CARUB_v10025523mg [Capsella rubella]
 gb|EOA29249.1| hypothetical protein CARUB_v10025523mg [Capsella rubella]
Length=316

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 182/237 (77%), Gaps = 24/237 (10%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +  I+RRPRGRPAGSKNKPKPPIIITRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  80    DNHITRRPRGRPAGSKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  139

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             +CVLSGNG VTNVT+RQPAS PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  140   ICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  199

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD--------------GNA  958
             AGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEEDD              GNA
Sbjct  200   AGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQTAGAVANNIDGNA  259

Query  959   PPFQgggmdspgaaggqllaeqgM------FQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                 G    +      Q   +Q M       QG+PPNL+NS+QLP +AYWG  RP F
Sbjct  260   AMGGGTPTQTQPQNQTQQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGTPRPSF  316



>ref|NP_182067.1| AT-hook motif nuclear-localized protein 22 [Arabidopsis thaliana]
 gb|AAB82621.1| putative AT-hook DNA-binding protein [Arabidopsis thaliana]
 gb|AAT70431.1| At2g45430 [Arabidopsis thaliana]
 gb|AAV74244.1| At2g45430 [Arabidopsis thaliana]
 tpd|FAA00293.1| TPA: AT-hook motif nuclear localized protein 22 [Arabidopsis 
thaliana]
 dbj|BAH30430.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10552.1| AT-hook motif nuclear-localized protein 22 [Arabidopsis thaliana]
Length=317

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 178/234 (76%), Gaps = 21/234 (9%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +  I+RRPRGRPAGSKNKPKPPIIITRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  84    DNHITRRPRGRPAGSKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  143

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             +CVLSGNG VTNVT+RQPAS PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  144   ICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  203

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD--------------GNA  958
             AGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEEDD              GNA
Sbjct  204   AGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQTAGAVANNIDGNA  263

Query  959   PP---FQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                   Q             +       QG+PPNL+NS+QLP +AYWG  RP F
Sbjct  264   TMGGGTQTQTQTQQQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGTPRPSF  317



>ref|XP_002880179.1| hypothetical protein ARALYDRAFT_903987 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56438.1| hypothetical protein ARALYDRAFT_903987 [Arabidopsis lyrata subsp. 
lyrata]
Length=318

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 176/236 (75%), Gaps = 23/236 (10%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +  I+RRPRGRPAGSKNKPKPPIIITRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  83    DNHITRRPRGRPAGSKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  142

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             +CVLSGNG VTNVT+RQPAS PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  143   ICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  202

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD-----------------  949
             AGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEEDD                 
Sbjct  203   AGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQTAGAVANNIDGNA  262

Query  950   --GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
               G     Q             +       QG+PPNL+NS+QLP +AYWG  RP F
Sbjct  263   TMGGGTQTQTQTQQQQQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGTPRPSF  318



>ref|XP_006397724.1| hypothetical protein EUTSA_v10001760mg [Eutrema salsugineum]
 gb|ESQ39177.1| hypothetical protein EUTSA_v10001760mg [Eutrema salsugineum]
Length=319

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 154/237 (65%), Positives = 176/237 (74%), Gaps = 24/237 (10%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +  I+RRPRGRPAGSKNKPKPPIIITRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  83    DNHITRRPRGRPAGSKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  142

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             +CVLSGNG VTNVT+RQPAS PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  143   ICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  202

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD-----------------  949
             AGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEEDD                 
Sbjct  203   AGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQQTAGAVANNIDGN  262

Query  950   ---GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                G     Q             +       QG+PPNL+NS+QLP +AYWG  RP F
Sbjct  263   ASMGGGTQTQTQSQTQTQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGTPRPSF  319



>ref|XP_010469137.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=267

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 156/268 (58%), Positives = 187/268 (70%), Gaps = 17/268 (6%)
 Frame = +2

Query  323   PPFHTSRDFNFHPQQFHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGA----GEGEIS-  487
             PP   SRD     Q +H Q+   +R+ EE NQ  D N+   + +G   A    GE     
Sbjct  9     PPHLLSRDL----QLYHHQNAGLKRNREE-NQVVDPNNNHSNSSGRDQATTPSGEDNTKK  63

Query  488   RRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLS  667
             RRPRGRPAGSKNKPK PII+TRD+AN+LR H+MEI +GCDVM+S+A FA+RRQRGVCVL+
Sbjct  64    RRPRGRPAGSKNKPKAPIIVTRDAANSLRCHVMEITNGCDVMESLAVFARRRQRGVCVLT  123

Query  668   GNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvg  847
             GNG VTNV +RQP   G VV+LHGR +ILSL+GSFLPPPAPP+A+GLT+YLAGGQGQVVG
Sbjct  124   GNGAVTNVNVRQPG--GGVVSLHGRLDILSLSGSFLPPPAPPAASGLTVYLAGGQGQVVG  181

Query  848   gsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeqg  1027
             G+VVG L+ +GPVVIMAASF N AYERLPLEED+      +        A        Q 
Sbjct  182   GNVVGPLMTSGPVVIMAASFGNTAYERLPLEEDE-----VEPQREIDANADRAVGTQTQK  236

Query  1028  MFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                G P NLINS+ LP++AYWG  RP F
Sbjct  237   QLMGSPSNLINSVSLPDEAYWGTQRPCF  264



>ref|XP_010538771.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=307

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 194/255 (76%), Gaps = 9/255 (4%)
 Frame = +2

Query  371   HEQSGQKQRDPEEVNQQDDGNDG-GESKNGLGGAGEG--EISRRPRGRPAGSKNKPKPPI  541
             HE+ G K  D EE +   D N G G   N  G +G G  +++RRPRGRP+GSKNKPKPPI
Sbjct  54    HERGGIKL-DREETSDDMDNNSGEGIDVNLHGNSGGGGQQLTRRPRGRPSGSKNKPKPPI  112

Query  542   IITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPAS-PG  718
             IITRDSANALRTH+ME+ADGCD+++S++ FA+RRQRGVCV+SG G VTNVT+RQP S PG
Sbjct  113   IITRDSANALRTHVMEVADGCDIVESMSVFARRRQRGVCVMSGTGNVTNVTIRQPGSPPG  172

Query  719   AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMA  898
             +VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YL+GGQGQVVGGSVVG L+ AGPVV+MA
Sbjct  173   SVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLSGGQGQVVGGSVVGPLVCAGPVVVMA  232

Query  899   ASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeqgM-FQGVPPNLINSIQLP  1075
             ASFSNAAYERLP+EE++   P   GG     G+   Q      M   G+PPNL+ S QLP
Sbjct  233   ASFSNAAYERLPMEEEEMQTPVHGGGAGGPMGSPPHQQQGLAAMAASGLPPNLLGSGQLP  292

Query  1076  ---NDAYWGGSRPPF  1111
                +  YW   RPPF
Sbjct  293   PPHDPPYWATGRPPF  307



>ref|XP_010518160.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=321

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 179/238 (75%), Gaps = 25/238 (11%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +  I+RRPRGRPAGSKNKPKPPIIITRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  84    DNHITRRPRGRPAGSKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  143

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             +CVLSGNG VTNVT+RQPAS PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  144   ICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  203

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEED--------------DGNA  958
             AGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEED              DGNA
Sbjct  204   AGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQTAGAVANNIDGNA  263

Query  959   P-------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                     P Q             +       QG+PPNL+NS+QLP +AYWG  RP F
Sbjct  264   AMGGGTQTPTQTQNQMQQQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGTPRPSF  321



>ref|XP_010508171.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=322

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 155/239 (65%), Positives = 177/239 (74%), Gaps = 26/239 (11%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +  I+RRPRGRPAGSKNKPKPPIIITRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  84    DNHITRRPRGRPAGSKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  143

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             +CVLSGNG VTNVT+RQPAS PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  144   ICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  203

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD--------------GNA  958
             AGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEEDD              GNA
Sbjct  204   AGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQTAGAVANNIDGNA  263

Query  959   P--------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                                      +       QG+PPNL+NS+QLP +AYWG  RP F
Sbjct  264   AMGGGTQTPTQTQNQTQQQQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGTPRPSF  322



>ref|XP_010506485.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=322

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 155/239 (65%), Positives = 177/239 (74%), Gaps = 26/239 (11%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +  I+RRPRGRPAGSKNKPKPPIIITRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  84    DNHITRRPRGRPAGSKNKPKPPIIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  143

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             +CVLSGNG VTNVT+RQPAS PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  144   ICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  203

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD--------------GNA  958
             AGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEEDD              GNA
Sbjct  204   AGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQTAGAVANNIDGNA  263

Query  959   P--------PFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                                      +       QG+PPNL+NS+QLP +AYWG  RP F
Sbjct  264   AMGGGTQTPTQTQNQTQQQQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGTPRPSF  322



>ref|XP_009393002.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=307

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 197/303 (65%), Gaps = 44/303 (15%)
 Frame = +2

Query  314   QLPPPFHTSRDFNFHPQQF------------HEQSGQK---QRD----PEEVNQQDDGND  436
              LPPPFH      FHP  F             E SG +   +RD      + N    G D
Sbjct  12    HLPPPFHGQE---FHPLHFQHLQQQQQLKVEEEHSGLRRGTKRDHDDSNNDENNNSSGGD  68

Query  437   GGE-SKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVM  613
             G E +       GEGEI RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA GCD++
Sbjct  69    GKELAPATFSAGGEGEIMRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIASGCDIV  128

Query  614   DSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP  793
             +SVA+FA RRQRGVC+LSGNG VTNV LRQPAS  AVV L GRFEILSL+GSFLPPPAPP
Sbjct  129   ESVASFACRRQRGVCILSGNGTVTNVNLRQPASSSAVVNLRGRFEILSLSGSFLPPPAPP  188

Query  794   SATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQg  973
             +A+GLTIYLAGGQGQ+VGGSVVGAL+A+GPV+IMAASF NAAYERLPL+E++    P Q 
Sbjct  189   AASGLTIYLAGGQGQIVGGSVVGALIASGPVIIMAASFGNAAYERLPLDEEE----PLQA  244

Query  974   ggmdspgaaggqllaeqg-------------MFQGVPPNLINSIQLPNDAY-W---GGSR  1102
                                            +  G+PPNL+N++QLP +AY W    G R
Sbjct  245   QQGALGSPGLVGQSTPPQQPQQQQLLDPNNPLLHGIPPNLLNNLQLPAEAYSWATGAGGR  304

Query  1103  PPF  1111
               F
Sbjct  305   ASF  307



>ref|XP_010917984.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=291

 Score =   223 bits (568),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 161/269 (60%), Positives = 200/269 (74%), Gaps = 14/269 (5%)
 Frame = +2

Query  314   QLPPPFHTSRDFN-FH----PQQFHEQSGQ---KQRDPEEVNQQDDGNDGGESKNG----  457
              LPPPFHT RDF+ FH    P+   +Q+G    ++RD E+++  ++        +G    
Sbjct  13    HLPPPFHT-RDFHHFHQLQQPKSEDDQTGLNRGQKRDREDISNTNNNGSNSSCGDGKELV  71

Query  458   -LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFA  634
              +    +GE +RRPRGRPAGSKNKPKPPIII RDSANA RTH+MEIA GCD+++S+A FA
Sbjct  72    PVPFGADGEAARRPRGRPAGSKNKPKPPIIINRDSANAFRTHVMEIAGGCDIVESMATFA  131

Query  635   QRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTI  814
              RRQRG+C+LSG G VTNVTLRQPAS GAVVTLHGRFEILSL+GSFLPPPAPP+ATGLT+
Sbjct  132   CRRQRGLCILSGTGSVTNVTLRQPASQGAVVTLHGRFEILSLSGSFLPPPAPPAATGLTV  191

Query  815   YlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspg  994
             YLAGGQGQVVGGSVVG L+A+GPVVIMAASF+NAAY+RLPLEE++              G
Sbjct  192   YLAGGQGQVVGGSVVGPLMASGPVVIMAASFANAAYDRLPLEEEESLPAQGPLESHGLVG  251

Query  995   aaggqllaeqgMFQGVPPNLINSIQLPND  1081
                 Q L +  +F G+ PNL+ ++QLP++
Sbjct  252   QQQQQFLQDPSLFHGLAPNLLGNVQLPSE  280



>gb|KDO85858.1| hypothetical protein CISIN_1g047830mg [Citrus sinensis]
Length=313

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 197/307 (64%), Gaps = 46/307 (15%)
 Frame = +2

Query  317   LPPPFHTSRDF------------------------NFHPQQFHEQSGQKQRDPEEVNQQD  424
             LPPPFHT RD                         N          GQK RD  E N  +
Sbjct  11    LPPPFHT-RDIHLQPHHHQFQQQQQHHHHHQQQQQNSEEDNSSLNRGQK-RDRNENNIAN  68

Query  425   DGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGC  604
                +G E     G  GE  I+RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA+GC
Sbjct  69    AMEEGEELAVATGEGGE--ITRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIANGC  126

Query  605   DVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP  784
             D+MDSV+ FA+RRQRG+C+LSG G VTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP
Sbjct  127   DIMDSVSNFARRRQRGICILSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP  186

Query  785   APPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERL-----------  931
             APP+A+GLTIYLAGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERL           
Sbjct  187   APPAASGLTIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEEEETPEAS  246

Query  932   -----PLEEDDGNAPPFQgggmdspgaaggqllaeqgMF-QGVPPNLINSIQLPNDAYWG  1093
                  PL   + N    Q     S       L      F  G+PPNL++S+QLP + YW 
Sbjct  247   IPGSRPLGSPEVNVGQPQQQQQQSQSHQQQLLQDPNASFIHGLPPNLLSSVQLPAEPYWA  306

Query  1094  GSRP-PF  1111
               RP PF
Sbjct  307   TGRPAPF  313



>ref|XP_008811429.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=294

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 162/279 (58%), Positives = 199/279 (71%), Gaps = 24/279 (9%)
 Frame = +2

Query  314   QLPPPFHTSRDF--NFHPQQFHEQSGQKQ---RDPEEVNQQDDGN---DGGESKNGLG--  463
              LPPPFHT RDF  NFH Q    +S   Q      ++ N+ D G+   +G  S  G G  
Sbjct  13    HLPPPFHT-RDFHHNFHQQLQQPKSEDDQGGLNRSQKRNRDDSGHTNTNGSSSSCGDGKE  71

Query  464   -------GAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSV  622
                    G  +GE +RRPRGRPAGS+NKPKPPIII RDSANA RTH+ME+A GCD+++ +
Sbjct  72    LVPVTSYGEADGEAARRPRGRPAGSRNKPKPPIIINRDSANAFRTHVMEVAGGCDIVEGM  131

Query  623   AAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSAT  802
             AAFA RRQRG+C+LSG G VTNV LRQPAS GAVVTLHG FEILSL+GSFLPPPAPP+AT
Sbjct  132   AAFACRRQRGMCILSGTGTVTNVRLRQPASQGAVVTLHGYFEILSLSGSFLPPPAPPAAT  191

Query  803   GLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP--PFQgg  976
             GLT+YLAGGQGQVVGGSVVG L+A+GPVVIMAASF+NAAY+RLPLEE++      P +  
Sbjct  192   GLTVYLAGGQGQVVGGSVVGPLMASGPVVIMAASFANAAYDRLPLEEEESLQAQGPLE--  249

Query  977   gmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAY-W  1090
                       Q   +  +F G+ PNL++++QLP++ + W
Sbjct  250   -SHGLLGQQQQFPQDPNLFHGLAPNLLSNVQLPSEPHSW  287



>ref|XP_004305833.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=266

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 162/216 (75%), Gaps = 6/216 (3%)
 Frame = +2

Query  458   LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
             +  A EGE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+  FA+
Sbjct  51    VSSASEGETIRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLTNFAR  110

Query  638   RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
             R+QRG+C+LSG+G VTNVTLRQPAS GA+VTLHGRFEILSL GS LPPPAPP  TGLTIY
Sbjct  111   RKQRGICILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIY  170

Query  818   laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspga  997
             LAG QGQVVGG VVGAL+A+GPVVIMAASF NA ++RLPL+ED+  A        +    
Sbjct  171   LAGAQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDEDEVAA-----ALQNQQYQ  225

Query  998   aggqllaeqgMFQGVPPNLINSIQLPNDAY-WGGSR  1102
              G     +   F G+PPNL+ +  +P + Y W   R
Sbjct  226   NGRHHHLDMSDFYGLPPNLLTNGNVPPEVYSWASGR  261



>ref|XP_007220373.1| hypothetical protein PRUPE_ppa018314mg [Prunus persica]
 gb|EMJ21572.1| hypothetical protein PRUPE_ppa018314mg [Prunus persica]
Length=312

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 175/232 (75%), Gaps = 17/232 (7%)
 Frame = +2

Query  467   AGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQ  646
             AGEGEI+RRPRGRPAGSKNK KPPIIITRDSANALR+H+ME+A+GCD+MDSV+ FA+RRQ
Sbjct  81    AGEGEITRRPRGRPAGSKNKAKPPIIITRDSANALRSHVMEVANGCDIMDSVSTFARRRQ  140

Query  647   RGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlag  826
             RGVC+LSG+G VTNVT+RQPASPG+VVTLHGRFEILSL+GSFLPPPAPP+A+GLTIYLAG
Sbjct  141   RGVCILSGSGTVTNVTIRQPASPGSVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAG  200

Query  827   gqgqvvggsvvgallaagpvvIMAASFSNAAYERL-----------------PLEEDDGN  955
              QGQVVGG VVG LLA+GPVVIMAASF NAAYERL                 PL      
Sbjct  201   VQGQVVGGGVVGPLLASGPVVIMAASFGNAAYERLPLEEEEPAAAGQVQGSGPLGSPGVG  260

Query  956   APPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                 Q   +        Q      +F G+P +L+NS QLP + YWG +RPP+
Sbjct  261   GQEHQQQSIQQQQQQLLQDPNAPSLFHGMPQSLLNSCQLPAEGYWGTARPPY  312



>ref|XP_002874744.1| hypothetical protein ARALYDRAFT_490024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51003.1| hypothetical protein ARALYDRAFT_490024 [Arabidopsis lyrata subsp. 
lyrata]
Length=331

 Score =   222 bits (566),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 172/281 (61%), Positives = 200/281 (71%), Gaps = 30/281 (11%)
 Frame = +2

Query  356   HPQQFHEQSGQK------QRDPEEVNQQDDG----NDGGESKN-----GLGGAGEGEISR  490
             +P Q HEQ G        + D EE +   D     N G E K      G GG+GE +++R
Sbjct  52    NPDQDHEQQGGSIMNRSIKMDREETSDNMDNIANNNSGSEGKEMSLHGGEGGSGE-QMTR  110

Query  491   RPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSG  670
             RPRGRPAGSKNKPK PIIITRDSANALRTH+MEI DGCD++D +A FA+RRQRGVCV+SG
Sbjct  111   RPRGRPAGSKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSG  170

Query  671   NGIVTNVTLRQPAS-PGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvg  847
              G VTNVT+RQP S PG+VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVG
Sbjct  171   TGNVTNVTIRQPGSPPGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVG  230

Query  848   gsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggq------  1009
             GSVVG LL +GPVV+MAASFSNAAYERLPLEED+   P   GGG    G   G       
Sbjct  231   GSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVHGGGGGGGEGGGMGSPPMMGQ  290

Query  1010  --llaeqgMFQGVPPNLINSIQLP----ND-AYWGGSRPPF  1111
                +A     QG+PPNL+ S+QLP    ND  YW   RPP+
Sbjct  291   QQAMAAMAAAQGLPPNLLGSVQLPPPQQNDQQYWSTGRPPY  331



>ref|XP_006292551.1| hypothetical protein CARUB_v10018786mg [Capsella rubella]
 gb|EOA25449.1| hypothetical protein CARUB_v10018786mg [Capsella rubella]
Length=268

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 147/273 (54%), Positives = 177/273 (65%), Gaps = 24/273 (9%)
 Frame = +2

Query  323   PPFHTSRDFNFHPQQFHEQSGQKQRDPEEVN---QQDDGNDGGESKNGLGGAGEGEISRR  493
             PP   SRD       +H Q+   +RD EE       D  N  G+ +       E    RR
Sbjct  9     PPHLLSRDL----HHYHHQNAVLKRDREEDQFEPNNDHSNSSGKDQTTTPSGQENTKKRR  64

Query  494   PRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGN  673
             PRGRPAGSKNKPK PI++TRDSAN+LR H+MEI + CDVM+S+A FA+RRQRGVCV +GN
Sbjct  65    PRGRPAGSKNKPKAPIVVTRDSANSLRCHVMEITNACDVMESLAVFARRRQRGVCVFTGN  124

Query  674   GIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggs  853
             G VTNV +RQP   G VV+LHGR EILSL+GSFLPPPAP +A+GLT+YLAGGQGQVVGGS
Sbjct  125   GAVTNVNVRQPG--GGVVSLHGRLEILSLSGSFLPPPAPSAASGLTVYLAGGQGQVVGGS  182

Query  854   vvgallaagpvvIMAASFSNAAYERLPLEED-------DGNAPPFQgggmdspgaaggql  1012
             VVG L+A+GP+VIMAASF NAAYERLPLE++       DGNA                Q 
Sbjct  183   VVGPLVASGPIVIMAASFGNAAYERLPLEDEEETEREIDGNA--------ARAVGTQTQK  234

Query  1013  laeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                         +++NS+ LP +AYWG  R  F
Sbjct  235   ELMHDAASFTHSDVVNSVSLPGEAYWGPQRSCF  267



>ref|XP_010540129.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
 ref|XP_010540136.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=333

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 173/226 (77%), Gaps = 15/226 (7%)
 Frame = +2

Query  479   EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVC  658
              I+RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEI DGCD++DS+A FA+RRQRGVC
Sbjct  108   HITRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIGDGCDIVDSMATFARRRQRGVC  167

Query  659   VLSGNGIVTNVTLRQPAS-PGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqg  835
             V+SG G VTNVT+RQP S PG+VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQG
Sbjct  168   VMSGTGNVTNVTIRQPGSPPGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQG  227

Query  836   qvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP-----------PFQgggm  982
             QVVGGSVVG L+ AGPVV+MAASFSNAAYERLPLEE++   P              G   
Sbjct  228   QVVGGSVVGPLVCAGPVVVMAASFSNAAYERLPLEEEEMQTPVHGGGGGGSGGGVMGSPP  287

Query  983   dspgaaggqllaeqgMFQGVPPNLINSIQLP---NDAYWGGSRPPF  1111
                  +  Q      M  G+PPNL+ S+QLP   +  YW   RPPF
Sbjct  288   MMGQQSSNQQAGLAAMAGGLPPNLLGSVQLPPPHDQPYWATGRPPF  333



>ref|XP_006647239.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Oryza 
brachyantha]
Length=323

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 161/209 (77%), Gaps = 6/209 (3%)
 Frame = +2

Query  485   SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVL  664
             +RRPRGRPAGSKNKPKPPIIITRDSAN LRTH+ME+A G  +  S+  FA+RRQRGVCVL
Sbjct  102   TRRPRGRPAGSKNKPKPPIIITRDSANTLRTHVMEVAGGGGISASIQTFARRRQRGVCVL  161

Query  665   SGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvv  844
             SG G VTNVTLRQPAS GAVV LHGRFEILSL+GSFLPPPAPP ATGLT+YLAGGQGQVV
Sbjct  162   SGAGTVTNVTLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVV  221

Query  845   ggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeq  1024
             GGSVVGAL AAGPVVIMAA F+NA YERLPLE+D+  A   Q        A         
Sbjct  222   GGSVVGALTAAGPVVIMAAPFANAVYERLPLEDDELLAAQGQADSAGLLAAGQQAAQLAG  281

Query  1025  ------gMFQGVPPNLINSIQLPNDAYWG  1093
                    +FQG+PPNL+ ++QLP +A +G
Sbjct  282   AGAVDPSLFQGLPPNLLGNVQLPPEAAYG  310



>ref|XP_002279677.2| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=268

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 157/213 (74%), Gaps = 6/213 (3%)
 Frame = +2

Query  467   AGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQ  646
             A EGE +RRPRGRPAGSKNKPKPPIIITRDSANALR H ME++ GCDV +S+A FA+R+Q
Sbjct  56    ASEGEATRRPRGRPAGSKNKPKPPIIITRDSANALRAHAMEVSSGCDVSESLANFARRKQ  115

Query  647   RGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlag  826
             RG+C+LSG+G VTNVTLRQPAS GA+VTLHGRFEILSL GS LPPPAPP  TGLTIYLAG
Sbjct  116   RGICILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAG  175

Query  827   gqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaagg  1006
              QGQVVGG VVGAL+A+GPV +MAASF NA ++RLPL++D+                 G 
Sbjct  176   AQGQVVGGGVVGALIASGPVFVMAASFMNATFDRLPLDDDE-----VTTAVQSQHYQNGR  230

Query  1007  qllaeqgMFQGVPPNLI-NSIQLPNDAYWGGSR  1102
                 +     G+PPNL+ N   LP    W   R
Sbjct  231   HHHIDMSDLYGIPPNLLTNGTMLPEIYSWAPGR  263



>ref|XP_004229823.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=302

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 173/293 (59%), Positives = 204/293 (70%), Gaps = 29/293 (10%)
 Frame = +2

Query  317   LPPPFHTSRDF-------NFHPQQFHEQSGQKQRDPEEV---NQQDDGNDG-------GE  445
             LPPPFHT RD        + H Q  H Q  QK  D ++    NQ+ D +D          
Sbjct  11    LPPPFHT-RDVQLQNNNPHLHAQFHHIQQQQKSEDEQQSGHRNQKRDRDDNFSLNPDPSG  69

Query  446   SKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVA  625
             S +  G    G+  RRPRGRPAGSKNKPKPPIIITRDSANALR+H+MEIA GCD+ +S++
Sbjct  70    SMDSKGNNTIGDGGRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEIATGCDIQESIS  129

Query  626   AFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATG  805
              FA RRQRGVC+LS +G VTNVT+RQPASPGAVVTLHGRFEILSL+GS+LPPPAPP+A+G
Sbjct  130   NFATRRQRGVCILSASGTVTNVTIRQPASPGAVVTLHGRFEILSLSGSYLPPPAPPAASG  189

Query  806   LTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD---------GNA  958
             LTIYLAGGQGQVVGGSVVG L A+GPVVIMAASF NAAYERLPLE+++         GN 
Sbjct  190   LTIYLAGGQGQVVGGSVVGPLNASGPVVIMAASFGNAAYERLPLEDEESPVGQQGSGGNL  249

Query  959   PPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQL-PNDAYWG-GSRPPF  1111
                   G  +     G       + QG+P NL+NS QL P +AYWG G+RPP+
Sbjct  250   GTSTNQGAAAAQQIMGTDPNANNLLQGLPQNLLNSCQLPPAEAYWGPGARPPY  302



>emb|CDY27387.1| BnaC04g50180D [Brassica napus]
Length=312

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 178/232 (77%), Gaps = 24/232 (10%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +  I+RRPRGRPAGSKNKPKPP+IITRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  86    DNHITRRPRGRPAGSKNKPKPPVIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  145

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             +CVLSGNG VTNVT+RQPAS PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  146   ICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  205

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD---------------GN  955
             AGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEEDD               GN
Sbjct  206   AGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQDEQQTAGAVANNMDGN  265

Query  956   APPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
             A      G  +       +       QG+PP+L+NS QLP +AYWG  RP F
Sbjct  266   A----TMGGGTQTQPQQLMQDPTSFIQGLPPSLMNS-QLPAEAYWGTPRPSF  312



>ref|XP_009142337.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=308

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 178/232 (77%), Gaps = 24/232 (10%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +  I+RRPRGRPAGSKNKPKPP+IITRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  82    DNHITRRPRGRPAGSKNKPKPPVIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  141

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             +CVLSGNG VTNVT+RQPAS PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  142   ICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  201

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD---------------GN  955
             AGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEEDD               GN
Sbjct  202   AGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQDEQQTAGAVANNIDGN  261

Query  956   APPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
             A      G  +       +       QG+PP+L+NS QLP +AYWG  RP F
Sbjct  262   A----TMGGGTQTQPQQLMQDPTSFIQGLPPSLMNS-QLPAEAYWGTPRPSF  308



>ref|XP_008229461.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=266

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 162/216 (75%), Gaps = 6/216 (3%)
 Frame = +2

Query  458   LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
             +  A EGE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+  FA+
Sbjct  51    ISAAAEGESIRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLTNFAR  110

Query  638   RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
             R+QRG+C+LSG+G VTNVTLRQPAS GA+VTLHGRFEILSL GS LPPPAPP  TGLTIY
Sbjct  111   RKQRGICILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIY  170

Query  818   laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspga  997
             LAG QGQVVGGSVVGAL+A+GPVVIMAASF NA ++RLPL+ED+  A        +    
Sbjct  171   LAGAQGQVVGGSVVGALIASGPVVIMAASFMNATFDRLPLDEDEVAA-----ALQNQQYQ  225

Query  998   aggqllaeqgMFQGVPPNLINSIQLPNDAY-WGGSR  1102
              G     +     G+PPNL+ +  +P + Y W   R
Sbjct  226   NGRHHHLDISDLYGLPPNLLTNGNVPPEVYSWASGR  261



>emb|CDY37040.1| BnaA04g26180D [Brassica napus]
Length=308

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 178/232 (77%), Gaps = 24/232 (10%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             +  I+RRPRGRPAGSKNKPKPP+IITRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  82    DNHITRRPRGRPAGSKNKPKPPVIITRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  141

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             +CVLSGNG VTNVT+RQPAS PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  142   ICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  201

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD---------------GN  955
             AGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEEDD               GN
Sbjct  202   AGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQDEQQTAGAVANNIDGN  261

Query  956   APPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
             A      G  +       +       QG+PP+L+NS QLP +AYWG  RP F
Sbjct  262   A----TMGGGTQTRPQQLMQDPTSFIQGLPPSLMNS-QLPAEAYWGTPRPSF  308



>ref|NP_194012.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
 emb|CAA16566.1| putative DNA binding protein [Arabidopsis thaliana]
 emb|CAB79236.1| putative DNA binding protein [Arabidopsis thaliana]
 dbj|BAF01184.1| putative DNA binding protein [Arabidopsis thaliana]
 tpd|FAA00295.1| TPA: AT-hook motif nuclear localized protein 24 [Arabidopsis 
thaliana]
 dbj|BAH30531.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84660.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
Length=324

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 177/315 (56%), Positives = 208/315 (66%), Gaps = 49/315 (16%)
 Frame = +2

Query  311   SQLPPPFHTSRDFNF------------HPQQFHEQSG-----------QKQRDPEEVNQQ  421
             S LPPPFH +RDF              H QQ   Q+            Q + D EE +  
Sbjct  11    SSLPPPFH-ARDFQLHLQQQQQEFFLHHHQQQRNQTDGDQQGGSGGNRQIKMDREETSDN  69

Query  422   DDG---NDGGESKN----------GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSA  562
              D    N G E K+          G G  G+ +++RRPRGRPAGSKNKPKPPIIITRDSA
Sbjct  70    IDNIANNSGSEGKDIDIHGGSGEGGGGSGGDHQMTRRPRGRPAGSKNKPKPPIIITRDSA  129

Query  563   NALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPA---SPGAVVTL  733
             NALRTH+MEI DGCD+++SVA FA+RRQRGVCV+SG G VTNVT+RQP    SPG+VV+L
Sbjct  130   NALRTHVMEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSHPSPGSVVSL  189

Query  734   HGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSN  913
             HGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL AGPVV+MAASFSN
Sbjct  190   HGRFEILSLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSN  249

Query  914   AAYERLPLEEDDGNAPPFQgggmdspga------aggqllaeqgMFQGVPPNLINSIQLP  1075
             AAYERLPLEED+   P   GGG  S  +                  QG+PPNL+ S+QL 
Sbjct  250   AAYERLPLEEDEMQTPVHGGGGGGSLESPPMMGQQLQHQQQAMSGHQGLPPNLLGSVQLQ  309

Query  1076  ---NDAYWGGSRPPF  1111
                + +YW   RPP+
Sbjct  310   QQHDQSYWSTGRPPY  324



>gb|KCW77938.1| hypothetical protein EUGRSUZ_D02188, partial [Eucalyptus grandis]
Length=277

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 167/222 (75%), Gaps = 17/222 (8%)
 Frame = +2

Query  335  TSRDFNFHPQQ---FHEQSGQKQRDPEEV-----NQQDDGND----GGESKNGLG----G  466
            T+  FN H  Q    H  S Q + D  E      N Q  G+D    G      LG    G
Sbjct  8    TASRFNIHQLQRPDLHLHSQQSESDDHEAISNNHNHQFSGSDHHDEGAHQTLELGAVNTG  67

Query  467  AGEGEI-SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRR  643
             G G+I +RRPRGRP GSKNKPKPP+IITR+SAN+LR H++E+ +GCDV D +A +A+RR
Sbjct  68   HGTGDIVARRPRGRPPGSKNKPKPPVIITRESANSLRAHILEVGNGCDVFDCIATYARRR  127

Query  644  QRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYla  823
            QRG+CVLSG G VTNV+LRQPA+ G+VVTLHGRFEILSL+GSFLPPPAPP AT LTI+LA
Sbjct  128  QRGICVLSGTGTVTNVSLRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLA  187

Query  824  ggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            GGQGQVVGGSVVG L+A+GPV+++AASF+N AYERLPLEE++
Sbjct  188  GGQGQVVGGSVVGELIASGPVIVIAASFTNVAYERLPLEEEE  229



>ref|XP_004145056.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004153892.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004172845.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN46234.1| hypothetical protein Csa_6G076820 [Cucumis sativus]
Length=282

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 194/273 (71%), Gaps = 9/273 (3%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQFHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEISRRP  496
             LPPPF  S+D + H   FH        D     ++D  +D   + +          SRRP
Sbjct  11    LPPPF-LSKDLHLHHGLFHAHHQNSDDDHTPGPKRDRDSDDNPTMDDDTKELSNSSSRRP  69

Query  497   RGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNG  676
             RGRPAGSKNKPKPPIIITRDSANALR+HL+EI+   D++DS+A FA+RRQRGVC+LS  G
Sbjct  70    RGRPAGSKNKPKPPIIITRDSANALRSHLIEISTASDIVDSLATFARRRQRGVCILSATG  129

Query  677   IVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsv  856
              V NVTLRQP+SPGAV+TL GRFEILSL+GSFLPPPAPP+A+GLT+YLAGGQGQVVGG+V
Sbjct  130   TVANVTLRQPSSPGAVITLPGRFEILSLSGSFLPPPAPPAASGLTVYLAGGQGQVVGGNV  189

Query  857   vgallaagpvvIMAASFSNAAYERLPLEEDDGNAP-PFQgggmdspgaaggqlla---eq  1024
             +G L A+GPV+IMAASF NAAYERLP++++D  +P P Q  G  +  A     L      
Sbjct  190   IGPLSASGPVIIMAASFGNAAYERLPIDDEDETSPAPDQMAGQQAAAAPPPPQLLGDPNG  249

Query  1025  gMFQGVPPNLIN-SIQLPND---AYWGGSRPPF  1111
             G+F G+  N++N S QLP +   A+WGG RPP+
Sbjct  250   GLFHGMAQNVVNSSCQLPGEAAAAFWGGGRPPY  282



>ref|XP_008467078.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
 ref|XP_008467079.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=282

 Score =   218 bits (555),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 153/273 (56%), Positives = 188/273 (69%), Gaps = 9/273 (3%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHPQQFHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEISRRP  496
             LPPPF  S+D + H   FH        D     ++D  +D   + +          SRRP
Sbjct  11    LPPPF-LSKDLHLHHGLFHAHHQNSDDDHTPGPKRDRDSDDNPTMDDDTKELSNSSSRRP  69

Query  497   RGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNG  676
             RGRPAGSKNKPKPPIIITRDSANALR+HL+EI+   D++DS+A FA+RRQRGVC+LS  G
Sbjct  70    RGRPAGSKNKPKPPIIITRDSANALRSHLIEISTASDIVDSLATFARRRQRGVCILSATG  129

Query  677   IVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsv  856
              V NVTLRQPASPGAV+TL GRFEILSL+GSFLPPPAPP+A+GLT+YLAGGQGQVVGG+V
Sbjct  130   TVANVTLRQPASPGAVITLPGRFEILSLSGSFLPPPAPPAASGLTVYLAGGQGQVVGGNV  189

Query  857   vgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeqg---  1027
             +G L A+GPV+IMAASF NAAYERLP++++D  +P           AA            
Sbjct  190   IGPLSASGPVIIMAASFGNAAYERLPIDDEDETSPAADQMAGQQAAAAAPPPQLLGDPNG  249

Query  1028  -MFQGVPPNLIN-SIQLPND---AYWGGSRPPF  1111
              +F G+  N +N S QLP +   A+WGG RPP+
Sbjct  250   GLFHGMAQNAVNSSCQLPGEAAAAFWGGGRPPY  282



>ref|XP_002869805.1| hypothetical protein ARALYDRAFT_492588 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46064.1| hypothetical protein ARALYDRAFT_492588 [Arabidopsis lyrata subsp. 
lyrata]
Length=319

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 160/266 (60%), Positives = 189/266 (71%), Gaps = 24/266 (9%)
 Frame = +2

Query  386   QKQRDPEEVNQQDDGNDGGESKN----------GLGGAGEGEISRRPRGRPAGSKNKPKP  535
             Q + D EE +     N G E K+          G G  G+ +++RRPRGRPAGSKNKPKP
Sbjct  54    QIKMDREETSDNIANNSGSEGKDIDLHGGSGEGGGGSGGDHQMTRRPRGRPAGSKNKPKP  113

Query  536   PIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPA--  709
             PII+TRDSANALRTH+MEI DGCD+++SVA FA+RRQRGVCV+SG G VTNVT+RQP   
Sbjct  114   PIIVTRDSANALRTHVMEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSH  173

Query  710   -SPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpv  886
              SPG+VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL AGPV
Sbjct  174   PSPGSVVSLHGRFEILSLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPV  233

Query  887   vIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaag--------gqllaeqgMFQGV  1042
             V+MAASFSNAAYERLPLEED+   P   GGG                          QG+
Sbjct  234   VVMAASFSNAAYERLPLEEDEMQTPVHGGGGGGGGSMESPPMMGQQLQHQQQAMSGHQGL  293

Query  1043  PPNLINSIQLP---NDAYWGGSRPPF  1111
             PPNL+ S+QL    + +YW   RPP+
Sbjct  294   PPNLLGSVQLQQQHDQSYWSTGRPPY  319



>ref|XP_009420779.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=305

 Score =   218 bits (555),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 163/299 (55%), Positives = 199/299 (67%), Gaps = 38/299 (13%)
 Frame = +2

Query  314   QLPPPFHTSRDFN--FHPQQFHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGG-------  466
              LPPPFH +RDF+   HP Q  +Q  Q     EE +    G   G  ++  G        
Sbjct  12    HLPPPFH-NRDFHHPLHPFQHLQQQQQPPPAVEEEHSGTSGLHRGMKRDYDGDNNDGNDG  70

Query  467   ----------AGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMD  616
                       +GEG++ R+PRGRPAGS+NKPKPPIII +DSANAL +H+MEIA GCD++D
Sbjct  71    GDGKELVSALSGEGDMVRKPRGRPAGSRNKPKPPIIINQDSANALSSHVMEIAGGCDIVD  130

Query  617   SVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPS  796
              VA FA+RRQRGVCVLSG+G V NVTLRQPASPGAVV LHGRFEILSL+GSFLPPPAPP+
Sbjct  131   GVATFARRRQRGVCVLSGSGTVANVTLRQPASPGAVVNLHGRFEILSLSGSFLPPPAPPA  190

Query  797   ATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgg  976
             ATGLTIYLAGGQGQ+VGGSVVG L+A+GPV+IMAASF NAAYERLPL++++    P Q  
Sbjct  191   ATGLTIYLAGGQGQIVGGSVVGPLIASGPVIIMAASFGNAAYERLPLDDEE----PLQAQ  246

Query  977   gmdspgaaggqllaeqg----------MFQGVPPNLINSIQLPNDAY-W---GGSRPPF  1111
                                        +  G+PPNL+N++QLP + + W   GG R P+
Sbjct  247   QGGLGSPGLVGQSPPLQQQQLHDPSNPLLHGLPPNLLNNVQLPGEPHGWATGGGGRTPY  305



>ref|XP_002527105.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF35268.1| DNA binding protein, putative [Ricinus communis]
Length=279

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  458  LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
            +  A EGE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+A FA+
Sbjct  50   VSSAVEGETIRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLANFAR  109

Query  638  RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
            RRQRG+CVLSG+G VTNVTLRQPAS GA+VTLHGRFEILSL GS LPPPAPP  TGLTIY
Sbjct  110  RRQRGICVLSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIY  169

Query  818  laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            LAG QGQVVGG VVGAL+A+GPVVIMAASF NA ++RLPL+ED+
Sbjct  170  LAGAQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDEDE  213



>ref|XP_010439279.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=328

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 174/319 (55%), Positives = 210/319 (66%), Gaps = 53/319 (17%)
 Frame = +2

Query  311   SQLPPPFHTSRDFNFHPQQFHEQSG----QKQRDPEEVNQQDDGNDGGESK---------  451
             S LPPPFH +RDF  H QQ  ++      Q+QR+  E +QQ  G+ GG ++         
Sbjct  11    SSLPPPFH-ARDFQLHLQQQQQEFFLHHHQQQRNQTEDDQQGAGSGGGLNRQIKMDREET  69

Query  452   --------NGLGGAG------------------EGEISRRPRGRPAGSKNKPKPPIIITR  553
                     N  G  G                  + +++RRPRGRPAGSKNKPKPPIIITR
Sbjct  70    SDNIDNIANNSGSEGKDIDLHGGSGEGGGGSGGDHQMTRRPRGRPAGSKNKPKPPIIITR  129

Query  554   DSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPA---SPGAV  724
             DSANALRTH+MEI DGCD+++SVA FA+RRQRGVCV+SG G VTNVT+RQP    SPG+V
Sbjct  130   DSANALRTHVMEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSHPSPGSV  189

Query  725   VTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAAS  904
             V+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL AGPVV+MAAS
Sbjct  190   VSLHGRFEILSLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAAS  249

Query  905   FSNAAYERLPLEEDDGNAPPFQgggmdspgaa-------ggqllaeqgMFQGVPPNLINS  1063
             FSNAAYERLPLE+D+   P   GGG      +                  QG+PPNL+ S
Sbjct  250   FSNAAYERLPLEDDEMQTPVHGGGGGGGSMESPPMMGQQLQHQQQAMSGHQGLPPNLLGS  309

Query  1064  IQLP---NDAYWGGSRPPF  1111
             +QL    + +YW   RPP+
Sbjct  310   VQLQQQHDQSYWSTGRPPY  328



>ref|XP_010053603.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=289

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 152/283 (54%), Positives = 187/283 (66%), Gaps = 25/283 (9%)
 Frame = +2

Query  335   TSRDFNFHPQQ---FHEQSGQKQRDPEEV-----NQQDDGND----GGESKNGLG----G  466
             T+  FN H  Q    H  S Q + D  E      N Q  G+D    G      LG    G
Sbjct  8     TASRFNIHQLQRPDLHLHSQQSESDDHEAISNNHNHQFSGSDHHDEGAHQTLELGAVNTG  67

Query  467   AGEGEI-SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRR  643
              G G+I +RRPRGRP GSKNKPKPP+IITR+SAN+LR H++E+ +GCDV D +A +A+RR
Sbjct  68    HGTGDIVARRPRGRPPGSKNKPKPPVIITRESANSLRAHILEVGNGCDVFDCIATYARRR  127

Query  644   QRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYla  823
             QRG+CVLSG G VTNV+LRQPA+ G+VVTLHGRFEILSL+GSFLPPPAPP AT LTI+LA
Sbjct  128   QRGICVLSGTGTVTNVSLRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLA  187

Query  824   ggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaag  1003
             GGQGQVVGGSVVG L+A+GPV+++AASF+N AYERLPLEE++               +  
Sbjct  188   GGQGQVVGGSVVGELIASGPVIVIAASFTNVAYERLPLEEEEQIQMQAAAAAASGGHSPF  247

Query  1004  gqllaeqgMFQ----GVPPNLINSIQLPNDAYWGGS---RPPF  1111
                 +    F      +  N  N++QLP D  WGG+   RPPF
Sbjct  248   PDPSSGLPFFNLPLGNMTNNNSNAVQLPVDG-WGGNSGPRPPF  289



>gb|EYU40290.1| hypothetical protein MIMGU_mgv1a019526mg [Erythranthe guttata]
Length=292

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 164/208 (79%), Gaps = 3/208 (1%)
 Frame = +2

Query  335  TSRDFNFHPQQFHEQSGQKQRDPEEVNQ--QDDGNDGGESKNGLGGAGEGEISRRPRGRP  508
            +S D + H +Q  E   Q  R          DD +DG      L  +G+  ++RRPRGRP
Sbjct  19   SSADHHHHQRQQSEDDHQPNRHQFSAGNPAADDDDDGSHPGLDLSNSGD-MVARRPRGRP  77

Query  509  AGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTN  688
            AGSKNKPKPP+IITR+SAN LR H++E+  GCDV ++VA +A++RQRG+C+LSG G VTN
Sbjct  78   AGSKNKPKPPVIITRESANTLRAHILEVGSGCDVFEAVATYARKRQRGICILSGTGTVTN  137

Query  689  VTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgal  868
            V+LRQPA+ G+VVTLHGRFEILSL+GSFLPPPAPP AT LTIYLAGGQGQVVGG+VVGAL
Sbjct  138  VSLRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSLTIYLAGGQGQVVGGNVVGAL  197

Query  869  laagpvvIMAASFSNAAYERLPLEEDDG  952
            +AAGPV+I+AASF+N AYERLPL+E++G
Sbjct  198  IAAGPVIIIAASFTNVAYERLPLDEEEG  225



>ref|XP_010102152.1| hypothetical protein L484_021386 [Morus notabilis]
 gb|EXB92402.1| hypothetical protein L484_021386 [Morus notabilis]
Length=267

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 160/217 (74%), Gaps = 6/217 (3%)
 Frame = +2

Query  458   LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
             +  A +GE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+A FA+
Sbjct  51    VSSAPDGESIRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLANFAR  110

Query  638   RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
             R+QRG+C+LSG+G VTNVTLRQP S GA+VTLHGRFEILSL GS LPPPAPP  TGLTIY
Sbjct  111   RKQRGICILSGSGCVTNVTLRQPTSSGAIVTLHGRFEILSLLGSVLPPPAPPGITGLTIY  170

Query  818   laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspga  997
             LAG QGQVVGGSVVG L+A+GPVVIMAASF NA ++RLPL+ED+  A        +    
Sbjct  171   LAGAQGQVVGGSVVGTLVASGPVVIMAASFMNATFDRLPLDEDEVTA-----ALQNQHYQ  225

Query  998   aggqllaeqgMFQGVPPNLINSIQLPNDAY-WGGSRP  1105
                    +     G+P NL+ +  +P + Y W   RP
Sbjct  226   NARHHPLDVSDLYGMPHNLLTNGNMPPEMYSWASCRP  262



>gb|KDP46909.1| hypothetical protein JCGZ_10400 [Jatropha curcas]
Length=254

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 160/216 (74%), Gaps = 2/216 (1%)
 Frame = +2

Query  458   LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
             +  A EGE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+  FA+
Sbjct  35    VSSAPEGETIRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLLNFAR  94

Query  638   RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
             R+QRG+CVLSG+G VTNVTLRQPAS GA+VTLHGRFEILSL GS LPPPAPP  TGLTIY
Sbjct  95    RKQRGICVLSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIY  154

Query  818   laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspga  997
             LAG QGQVVGG VVGAL+A+GPVVIMAASF NA ++RLPL+ED+  A   Q     +   
Sbjct  155   LAGAQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDEDEIAA-AVQNQHYQNGRH  213

Query  998   aggqllaeqgMFQGVPPNLINSIQLPNDAY-WGGSR  1102
                    +     GVP NL+ +  +P + Y W   R
Sbjct  214   NHHHHHLDISDLYGVPQNLLTNGSVPPEIYSWAPGR  249



>ref|XP_009373365.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=235

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 145/293 (49%), Positives = 173/293 (59%), Gaps = 82/293 (28%)
 Frame = +2

Query  305   MDSQ-LPPPFHTSRDFNFHPQQF------------HEQSG-----QKQRDPEEVNQQDDG  430
             MD+  LPPPFHT RDF+ H QQ              EQ+G     + Q+   +++  D G
Sbjct  1     MDTHSLPPPFHT-RDFHLHHQQQHPQFHHQQQNSEDEQTGSSGLNKGQKRERDIDNNDSG  59

Query  431   NDGGESKNGL-----GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIA  595
              +GGE    L     GG G  E++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEIA
Sbjct  60    GNGGELGKELNVTMSGGDGS-EMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIA  118

Query  596   DGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFL  775
             DGCD+++SVA FA+RRQRGVC++SG G VTNVTLRQPASPG++VTLHGRFEILSLAGSFL
Sbjct  119   DGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGSIVTLHGRFEILSLAGSFL  178

Query  776   PPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGN  955
             PPPAPP+ATGL                                      ++L  E  + N
Sbjct  179   PPPAPPAATGL----------------------------------KQQQQQLMAEAANSN  204

Query  956   APPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPND-AYWGGSRPPF  1111
              P F                       G+PPNL+NS+QLP + AYW   RPPF
Sbjct  205   PPLF----------------------HGLPPNLLNSMQLPAEAAYWATGRPPF  235



>ref|XP_009377422.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=245

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 153/192 (80%), Gaps = 5/192 (3%)
 Frame = +2

Query  389  KQRDPEEVNQQDD-GNDGGESKNGLGGA----GEGEISRRPRGRPAGSKNKPKPPIIITR  553
            + +D ++ N     GND   +   L  A     EGE  RRPRGRPAGSKNKPKPPII+TR
Sbjct  20   RSQDADKSNSHHKPGNDAMLTAPKLPKAVTPVSEGETLRRPRGRPAGSKNKPKPPIIVTR  79

Query  554  DSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTL  733
            DSANALR H ME++ GCDV +S+  FA+R+QRG+C+LSG+G VTNVTLRQPAS GA+VTL
Sbjct  80   DSANALRAHAMEVSSGCDVSESLTHFARRKQRGICILSGSGCVTNVTLRQPASSGAIVTL  139

Query  734  HGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSN  913
            HGRFEILSL GS LPPPAPP  TGLTIYLAG QGQVVGG VVGAL+A+GPVVIMAASF N
Sbjct  140  HGRFEILSLLGSILPPPAPPGITGLTIYLAGAQGQVVGGGVVGALIASGPVVIMAASFMN  199

Query  914  AAYERLPLEEDD  949
            A ++RLPL+ED+
Sbjct  200  ATFDRLPLDEDE  211



>ref|XP_010448831.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=328

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 174/319 (55%), Positives = 206/319 (65%), Gaps = 53/319 (17%)
 Frame = +2

Query  311   SQLPPPFHTSRDFNF-------------------HPQQFHEQSG--------QKQRDPEE  409
             S LPPPFH +RDF                      P+  H+Q G        Q + D EE
Sbjct  11    SSLPPPFH-ARDFQLHLQQQQQEFFLHHHQQQRNQPEDDHQQGGGSGGGINRQIKMDREE  69

Query  410   VNQQDDG---NDGGESKN--------GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRD  556
              +   D    N G E K+          G  G+ +++RRPRGRPAGSKNKPKPPIIITRD
Sbjct  70    TSDNIDNIANNSGSEGKDIDLHGGSGEGGSGGDHQMTRRPRGRPAGSKNKPKPPIIITRD  129

Query  557   SANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPA---SPGAVV  727
             SANALRTH+MEI DGCD+++SVA FA+RRQRGVCV+SG G VTNVT+RQP    SPG+VV
Sbjct  130   SANALRTHVMEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSHPSPGSVV  189

Query  728   TLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASF  907
             +LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL AGPVV+MAASF
Sbjct  190   SLHGRFEILSLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASF  249

Query  908   SNAAYERLPLEEDDGNAPPFQgggmdspgaag--------gqllaeqgMFQGVPPNLINS  1063
             SNAAYERLPLE+D+   P   GGG                          QG+PPNL+ S
Sbjct  250   SNAAYERLPLEDDEMQTPVHGGGGGGGGSMESPPMMGQQLQHQQQAMSGHQGLPPNLLGS  309

Query  1064  IQLP---NDAYWGGSRPPF  1111
             +QL    + +YW   RPP+
Sbjct  310   VQLQQQHDQSYWSTGRPPY  328



>ref|XP_003539199.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=250

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 154/185 (83%), Gaps = 2/185 (1%)
 Frame = +2

Query  386  QKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEI-SRRPRGRPAGSKNKPKPPIIITRDSA  562
            Q    P+   Q D G D  +S    G   +G++  RRPRGRPAGSKNKPKPP+IITR+SA
Sbjct  14   QSLHRPDFNQQHDSGEDAKQSAED-GPHHQGDVVGRRPRGRPAGSKNKPKPPVIITRESA  72

Query  563  NALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGR  742
            N LR H++E+A+GCDV +SVA++A+RRQRG+C+LSG+G VTNV+LRQPAS GAVVTLHGR
Sbjct  73   NTLRAHILEVANGCDVFESVASYARRRQRGICILSGSGTVTNVSLRQPASAGAVVTLHGR  132

Query  743  FEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAY  922
            FEILSL GSFLPPPAPP AT L+IYLAGGQGQVVGGSVVG L+AAGPV++MAASF+N AY
Sbjct  133  FEILSLTGSFLPPPAPPGATSLSIYLAGGQGQVVGGSVVGELIAAGPVIVMAASFTNVAY  192

Query  923  ERLPL  937
            ERLPL
Sbjct  193  ERLPL  197



>ref|XP_007039519.1| AT-hook DNA-binding family protein [Theobroma cacao]
 gb|EOY24020.1| AT-hook DNA-binding family protein [Theobroma cacao]
Length=292

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 181/240 (75%), Gaps = 7/240 (3%)
 Frame = +2

Query  413   NQQDDGNDGGESKNGLGGAGEGE-ISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLME  589
             +QQDDG+         G +G G+ ++RRPRGRP GSKNKPKPP+IITR+SAN LR H++E
Sbjct  53    HQQDDGSHHALDLVNAGNSGPGDLVARRPRGRPPGSKNKPKPPVIITRESANTLRAHILE  112

Query  590   IADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGS  769
             + +GCDV D VA +A+RRQRG+C+LSG+G VTNV++RQPA+ GA+VTLHGRFEILSL+GS
Sbjct  113   VGNGCDVFDCVANYARRRQRGICILSGSGTVTNVSIRQPAAAGAIVTLHGRFEILSLSGS  172

Query  770   FLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
             FLPPPAPP AT LTI+LAGGQGQVVGGSVVG L+AAGPV+++AASF+N AYERLPL+ED+
Sbjct  173   FLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELMAAGPVIVIAASFTNVAYERLPLDEDE  232

Query  950   ----GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWG--GSRPPF  1111
                  +     GGG  +   A G   A    F  +P N+  ++QLP + + G  G RPPF
Sbjct  233   QLQMQSGGGGSGGGGGNNMFADGGAGAGGLPFFNLPLNMPPNVQLPVEGWPGNSGGRPPF  292



>ref|XP_006366237.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=265

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 157/198 (79%), Gaps = 1/198 (1%)
 Frame = +2

Query  362  QQFHEQSGQKQRDP-EEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPP  538
            Q  H      QR P +E N     +D     NG    G   + RRPRGRPAGSKNKPKPP
Sbjct  15   QLHHPADFNLQRQPGDEDNNNQFSDDHHHEDNGHQNQGGDIVGRRPRGRPAGSKNKPKPP  74

Query  539  IIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPG  718
            +IITR+SAN LR H++EI +GCDV + V+ +A+RRQRG+C+LSG+G VTNV++RQPA+ G
Sbjct  75   VIITRESANTLRAHILEIGNGCDVFECVSTYARRRQRGICILSGSGTVTNVSIRQPAAAG  134

Query  719  AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMA  898
            +VVTLHGRFEILSL+GSFLPPPAPP AT LTI++AGGQGQVVGGSVVG L+A+GPV+++A
Sbjct  135  SVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFVAGGQGQVVGGSVVGELIASGPVIVIA  194

Query  899  ASFSNAAYERLPLEEDDG  952
            +SF+N AYERLPLEED+G
Sbjct  195  SSFTNVAYERLPLEEDEG  212



>dbj|BAF02122.1| putative DNA binding protein [Arabidopsis thaliana]
Length=324

 Score =   216 bits (551),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 206/315 (65%), Gaps = 49/315 (16%)
 Frame = +2

Query  311   SQLPPPFHTSRDFNF------------HPQQFHEQSG-----------QKQRDPEEVNQQ  421
             S LPPPFH +RDF              H QQ   Q+            Q + D EE +  
Sbjct  11    SSLPPPFH-ARDFQLHLQQQQQEFFLHHHQQQRNQTDGDQQGGSGGNRQIKMDREETSDN  69

Query  422   DD--GNDGGESKNGL-----------GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSA  562
              D   N+ G    G+           G  G+ +++RRPRGRPAGSKNKPKPPIIITRDSA
Sbjct  70    IDNIANNSGSEGKGIDIHGGSGEGGGGSGGDHQMTRRPRGRPAGSKNKPKPPIIITRDSA  129

Query  563   NALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPA---SPGAVVTL  733
             NALRTH+MEI DGCD+++SVA FA+RRQRGVCV+SG G VTNVT+RQP    SPG+VV+L
Sbjct  130   NALRTHVMEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSHPSPGSVVSL  189

Query  734   HGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSN  913
             HGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL AGPVV+MAASFSN
Sbjct  190   HGRFEILSLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSN  249

Query  914   AAYERLPLEEDDGNAPPFQgggmdspga------aggqllaeqgMFQGVPPNLINSIQLP  1075
             AAYERLPLEE +   P   GGG  S  +                  QG+PPNL+ S+QL 
Sbjct  250   AAYERLPLEEGEMQTPVHGGGGGGSLESPPMMGQQLQHQQQAMSGHQGLPPNLLGSVQLQ  309

Query  1076  ---NDAYWGGSRPPF  1111
                + +YW   RPP+
Sbjct  310   QQHDQSYWSTGRPPY  324



>ref|XP_008668970.1| PREDICTED: putative DNA-binding protein ESCAROLA [Zea mays]
Length=309

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = +2

Query  440  GESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDS  619
            G++  G GG GE  + RRPRGRP GSKNKPKPP+IITR+SAN LR H++E+A GCDV +S
Sbjct  69   GDAPGGSGGNGE-MVVRRPRGRPPGSKNKPKPPVIITRESANTLRAHILEVASGCDVFES  127

Query  620  VAAFAQRRQRGVCVLSGNGIVTNVTLRQPASP-GAVVTLHGRFEILSLAGSFLPPPAPPS  796
            V+ +A+RRQRGVCVLSG+G+VTNVTLRQP++P GAVVTLHGRFEILSL+GSFLPPPAPP 
Sbjct  128  VSTYARRRQRGVCVLSGSGVVTNVTLRQPSAPAGAVVTLHGRFEILSLSGSFLPPPAPPG  187

Query  797  ATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPP  964
            AT LTI+LAGGQGQVVGG+VVGAL AAGPV+++AASF+N AYERLPLEE++  A P
Sbjct  188  ATSLTIFLAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLEEEEAQAAP  243



>tpg|DAA36260.1| TPA: hypothetical protein ZEAMMB73_652841 [Zea mays]
Length=347

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = +2

Query  440  GESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDS  619
            G++  G GG GE  + RRPRGRP GSKNKPKPP+IITR+SAN LR H++E+A GCDV +S
Sbjct  69   GDAPGGSGGNGE-MVVRRPRGRPPGSKNKPKPPVIITRESANTLRAHILEVASGCDVFES  127

Query  620  VAAFAQRRQRGVCVLSGNGIVTNVTLRQPASP-GAVVTLHGRFEILSLAGSFLPPPAPPS  796
            V+ +A+RRQRGVCVLSG+G+VTNVTLRQP++P GAVVTLHGRFEILSL+GSFLPPPAPP 
Sbjct  128  VSTYARRRQRGVCVLSGSGVVTNVTLRQPSAPAGAVVTLHGRFEILSLSGSFLPPPAPPG  187

Query  797  ATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPP  964
            AT LTI+LAGGQGQVVGG+VVGAL AAGPV+++AASF+N AYERLPLEE++  A P
Sbjct  188  ATSLTIFLAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLEEEEAQAAP  243



>ref|XP_008353637.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=245

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 153/192 (80%), Gaps = 5/192 (3%)
 Frame = +2

Query  389  KQRDPEEVNQQDD-GNDGGESKNGLGGA----GEGEISRRPRGRPAGSKNKPKPPIIITR  553
            + +D ++ N     GND   +   L  A     EGE  RRPRGRPAGSKNKPKPPII+TR
Sbjct  20   RSQDADKSNSHHKPGNDAMLTAPKLPKAVTLVSEGETLRRPRGRPAGSKNKPKPPIIVTR  79

Query  554  DSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTL  733
            DSANALR H ME++ GCDV +++  FA+R+QRG+C+LSG+G VTNVTLRQPAS GA+VTL
Sbjct  80   DSANALRAHAMEVSSGCDVSETLTHFARRKQRGICILSGSGCVTNVTLRQPASSGAIVTL  139

Query  734  HGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSN  913
            HGRFEILSL GS LPPPAPP  TGLTIYLAG QGQVVGG VVGAL+A+GPVVIMAASF N
Sbjct  140  HGRFEILSLLGSILPPPAPPGITGLTIYLAGPQGQVVGGGVVGALIASGPVVIMAASFMN  199

Query  914  AAYERLPLEEDD  949
            A ++RLPL+ED+
Sbjct  200  ATFDRLPLDEDE  211



>ref|XP_010433987.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=324

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 174/224 (78%), Gaps = 13/224 (6%)
 Frame = +2

Query  479   EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVC  658
             +++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEI DGCD+++SVA FA+RRQRGVC
Sbjct  101   QMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIGDGCDLVESVATFARRRQRGVC  160

Query  659   VLSGNGIVTNVTLRQPAS---PGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlagg  829
             V+SG G VTNVT+RQP S   PG+VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGG
Sbjct  161   VMSGTGNVTNVTIRQPGSHPSPGSVVSLHGRFEILSLSGSFLPPPAPPTATGLSVYLAGG  220

Query  830   qgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaa---  1000
             QGQVVGGSVVG LL AGPVV+MAASFSNAAYERLPLEED+   P   GGG      +   
Sbjct  221   QGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEDEMQTPVHGGGGGGGSMESPPM  280

Query  1001  ----ggqllaeqgMFQGVPPNLINSIQLP---NDAYWGGSRPPF  1111
                             G+PPNL+ S+QL    + +YW   RPP+
Sbjct  281   MGQQLQHQQQAMSGHHGLPPNLLGSVQLQQQHDQSYWSTGRPPY  324



>gb|KCW71795.1| hypothetical protein EUGRSUZ_E00284 [Eucalyptus grandis]
Length=281

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 150/274 (55%), Positives = 185/274 (68%), Gaps = 15/274 (5%)
 Frame = +2

Query  335   TSRDFNFHPQ-QFHEQSGQKQRDPEEVNQQDDGNDGGESKNGL-----GGAGEGE-ISRR  493
             T+R    H Q Q H  SG    +P       +  D G   +GL     G  G G+ ++RR
Sbjct  8     TARFLPHHLQLQRHGDSGDDASNPNHNQYSGEPQDDGSHHHGLDLGPAGNHGPGDLVARR  67

Query  494   PRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGN  673
             PRGRP GSKNKPKPP+IITR+SAN LR H++E+  GCDV + VA +A+RRQRGVC+LSG+
Sbjct  68    PRGRPPGSKNKPKPPVIITRESANTLRAHILEVGSGCDVFECVAMYARRRQRGVCILSGS  127

Query  674   GIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggs  853
             G VTNV+LRQPA+ GAVVTLHGRFEILSL+GSFLPPPAPP AT LT++LAGGQGQVVGGS
Sbjct  128   GTVTNVSLRQPAAAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTVFLAGGQGQVVGGS  187

Query  854   vvgallaagpvvIMAASFSNAAYERLPLEEDDGNA----PPFQgggmdspgaaggqllae  1021
             VVG L AAGPV+++AASF+N AYERLPL+E+D       P  Q        A        
Sbjct  188   VVGELTAAGPVIVIAASFTNVAYERLPLDEEDQQLHMQPPASQPPSGPGAAAGNSYPDPS  247

Query  1022  qgM-FQGVPPNLINSIQLPNDAYWGGS---RPPF  1111
              G+ F  +P N + S+QLP + + G +   RPPF
Sbjct  248   SGLPFFNLPLNNMGSVQLPVENWPGNNSAPRPPF  281



>ref|XP_008356452.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=290

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = +2

Query  422  DDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADG  601
            DD + GG    G+ G     ++RRPRGRP GSKNKPKPP+IITR+SAN LR H++E+ +G
Sbjct  49   DDHHQGGLDLGGINGGSGDIVARRPRGRPPGSKNKPKPPVIITRESANTLRAHILEVGNG  108

Query  602  CDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPP  781
            CDV D VA +A+RRQRG+C+LSG+G VTNVTLRQPA+ GAVVTLHGRFEILSL+GSFLPP
Sbjct  109  CDVFDCVATYARRRQRGICILSGSGTVTNVTLRQPAAAGAVVTLHGRFEILSLSGSFLPP  168

Query  782  PAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            PAPP AT LTI+LAGGQGQVVGGSVVG L AAGPV+++A+SF+N AYERLPL+E++
Sbjct  169  PAPPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLDEEE  224



>ref|XP_010055327.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=282

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 150/274 (55%), Positives = 185/274 (68%), Gaps = 15/274 (5%)
 Frame = +2

Query  335   TSRDFNFHPQ-QFHEQSGQKQRDPEEVNQQDDGNDGGESKNGL-----GGAGEGE-ISRR  493
             T+R    H Q Q H  SG    +P       +  D G   +GL     G  G G+ ++RR
Sbjct  9     TARFLPHHLQLQRHGDSGDDASNPNHNQYSGEPQDDGSHHHGLDLGPAGNHGPGDLVARR  68

Query  494   PRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGN  673
             PRGRP GSKNKPKPP+IITR+SAN LR H++E+  GCDV + VA +A+RRQRGVC+LSG+
Sbjct  69    PRGRPPGSKNKPKPPVIITRESANTLRAHILEVGSGCDVFECVAMYARRRQRGVCILSGS  128

Query  674   GIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggs  853
             G VTNV+LRQPA+ GAVVTLHGRFEILSL+GSFLPPPAPP AT LT++LAGGQGQVVGGS
Sbjct  129   GTVTNVSLRQPAAAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTVFLAGGQGQVVGGS  188

Query  854   vvgallaagpvvIMAASFSNAAYERLPLEEDDGNA----PPFQgggmdspgaaggqllae  1021
             VVG L AAGPV+++AASF+N AYERLPL+E+D       P  Q        A        
Sbjct  189   VVGELTAAGPVIVIAASFTNVAYERLPLDEEDQQLHMQPPASQPPSGPGAAAGNSYPDPS  248

Query  1022  qgM-FQGVPPNLINSIQLPNDAYWGGS---RPPF  1111
              G+ F  +P N + S+QLP + + G +   RPPF
Sbjct  249   SGLPFFNLPLNNMGSVQLPVENWPGNNSAPRPPF  282



>ref|XP_007048865.1| AT-hook DNA-binding family protein [Theobroma cacao]
 gb|EOX93022.1| AT-hook DNA-binding family protein [Theobroma cacao]
Length=257

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 159/214 (74%), Gaps = 8/214 (4%)
 Frame = +2

Query  467   AGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQ  646
             A EGE  RRPRGRPAGSKNKPKPPIIITRDSANALR H +E++ GCDV +S+A FA+R+Q
Sbjct  45    AAEGENIRRPRGRPAGSKNKPKPPIIITRDSANALRAHALEVSSGCDVNESLANFARRKQ  104

Query  647   RGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlag  826
             RG+CVLSG+G VTNVTLRQPAS GA+VTLHGR+EILSL GS LPPPAPP  TGLTIYLAG
Sbjct  105   RGICVLSGSGCVTNVTLRQPASSGAIVTLHGRYEILSLLGSILPPPAPPGITGLTIYLAG  164

Query  827   gqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD-GNAPPFQgggmdspgaag  1003
              QGQVVGG VVGAL+A+GPV++MAASF NA ++RLPL++D+   A P Q           
Sbjct  165   AQGQVVGGGVVGALIASGPVLVMAASFMNATFDRLPLDDDEVAAAMPNQYHQNARHHHLD  224

Query  1004  gqllaeqgMFQGVPPNLINSIQLPNDAY-WGGSR  1102
                        G+P NLI +  +P + Y W   R
Sbjct  225   ISD------LYGMPQNLITNGTMPPEIYSWAPGR  252



>gb|KFK28863.1| hypothetical protein AALP_AA7G058200 [Arabis alpina]
Length=324

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 204/315 (65%), Gaps = 49/315 (16%)
 Frame = +2

Query  311   SQLPPPFHTSRDFNF-------------HPQQFHEQSGQKQR-----------DPEEVNQ  418
             S LPPPFH +RDF               H QQ   Q+ Q  +           D EE + 
Sbjct  11    SSLPPPFH-ARDFQLHLQQQQQQEFFLHHHQQQRNQTDQDDQQGGGLNRQIKMDREETSD  69

Query  419   QDD--GNDGGESKNGL--------GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANA  568
               D  GN+ G     L        GG+G  +++RRPRGRPAGSKNKPKPPIIITRDSANA
Sbjct  70    NIDNIGNNSGSEGKELHGGSGEGGGGSGGDQMTRRPRGRPAGSKNKPKPPIIITRDSANA  129

Query  569   LRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPA---SPGAVVTLHG  739
             LRTH+MEI DGCD+++SVA FA+RRQRGVCV+SG G V NVT+RQP    SPG+VV+LHG
Sbjct  130   LRTHVMEIGDGCDLVESVATFARRRQRGVCVMSGTGNVINVTIRQPGSAPSPGSVVSLHG  189

Query  740   RFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAA  919
             RFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL AGPVV+MAASFSNAA
Sbjct  190   RFEILSLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAA  249

Query  920   YERLPLEEDDGNAPPFQgggmdspg------aaggqllaeqgMFQGVPPNLINSIQL---  1072
             YERLPLEED+   P   GGG                        QG+PPNL+ S+QL   
Sbjct  250   YERLPLEEDEMQTPVHGGGGGSMESPPMMGQQQLQHQQQAMSGHQGLPPNLLGSVQLQQP  309

Query  1073  --PNDAYWGGSRPPF  1111
                N +YW   RP +
Sbjct  310   QHDNQSYWSTGRPTY  324



>gb|KDO60958.1| hypothetical protein CISIN_1g040216mg [Citrus sinensis]
Length=265

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 160/215 (74%), Gaps = 7/215 (3%)
 Frame = +2

Query  467   AGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQ  646
             A +GE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+A FA+R+Q
Sbjct  52    AADGETLRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLANFARRKQ  111

Query  647   RGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlag  826
             RG+C+LSG+G VTNVTLRQPA+ G++VTLHGRFEILSL GS LPPPAPP  TGLTIYLAG
Sbjct  112   RGICILSGSGCVTNVTLRQPATSGSIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAG  171

Query  827   gqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaagg  1006
              QGQVVGG VVGAL+A+GPVVIMAASF NA ++RLPL++D+           +       
Sbjct  172   AQGQVVGGVVVGALIASGPVVIMAASFMNATFDRLPLDDDE-----LAAAMQNQHYQNSR  226

Query  1007  qllaeqgMFQGVPP-NLINSIQLPNDAY-WGGSRP  1105
                 +     G+PP NL+ +  +P + Y W   +P
Sbjct  227   HHHLDISDLHGLPPQNLLTNGTMPPEIYAWAPGKP  261



>ref|NP_001056730.1| Os06g0136900 [Oryza sativa Japonica Group]
 dbj|BAD68464.1| putative AT-hook protein 2 [Oryza sativa Japonica Group]
 dbj|BAF18644.1| Os06g0136900 [Oryza sativa Japonica Group]
 gb|EAY99567.1| hypothetical protein OsI_21541 [Oryza sativa Indica Group]
 dbj|BAG98046.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 170/241 (71%), Gaps = 22/241 (9%)
 Frame = +2

Query  386   QKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSAN  565
             Q+Q+  EE +QQ              GA    + RRPRGRPAGSKNKPKPP+IITRDSA+
Sbjct  91    QRQQSGEEQHQQ--------------GAAAPVVIRRPRGRPAGSKNKPKPPVIITRDSAS  136

Query  566   ALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQP-ASPGAVVTLHGR  742
             ALR H++E+A GCD++DSVA FA+RRQ GVCVLS  G VTNV++RQP A PGAVV L GR
Sbjct  137   ALRAHVLEVASGCDLVDSVATFARRRQVGVCVLSATGAVTNVSVRQPGAGPGAVVNLTGR  196

Query  743   FEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAY  922
             F+ILSL+GSFLPPPAPPSATGLT+Y++GGQGQVVGG+V G L+A GPVVIMAASF NAAY
Sbjct  197   FDILSLSGSFLPPPAPPSATGLTVYVSGGQGQVVGGTVAGPLIAVGPVVIMAASFGNAAY  256

Query  923   ERLPLEEDDGNAPPFQgg----gmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYW  1090
             ERLPLE+D+   PP            P         +  +   +P NL+N I LP DA +
Sbjct  257   ERLPLEDDE---PPQHMAGGGQSSPPPPPLPLPPHQQPILQDHLPHNLMNGIHLPGDAAY  313

Query  1091  G  1093
             G
Sbjct  314   G  314



>ref|XP_010422173.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=337

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 178/328 (54%), Positives = 207/328 (63%), Gaps = 62/328 (19%)
 Frame = +2

Query  311   SQLPPPFHTSRDF----------------------NFH------PQQFHEQSG------Q  388
             S LPPPFH +RDF                      N H      P Q HEQ G       
Sbjct  11    SSLPPPFH-ARDFQLHLQQQQQQHHHQQQQQQFFLNHHQQPQRNPDQDHEQQGGSILNRS  69

Query  389   KQRDPEEV--NQQDDGNDGGESKNGLG----------GAGEGEISRRPRGRPAGSKNKPK  532
              + D EE   N  + GN+ G     +           G    +++RRPRGRPAGSKNKPK
Sbjct  70    MKMDREETSDNMDNMGNNSGSEGKEMSLHGGEGGSGGGGSGEQMTRRPRGRPAGSKNKPK  129

Query  533   PPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPAS  712
              PIIITRDSANALRTH+MEI DGCD++D +A FA+RRQRGVCV+SG G VTNVT+RQP S
Sbjct  130   APIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVTIRQPGS  189

Query  713   P-GAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvv  889
             P G+VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL +GPVV
Sbjct  190   PAGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVV  249

Query  890   IMAASFSNAAYERLPLEEDDGNAP---------PFQgggmdspgaaggqllaeqgMFQGV  1042
             +MAASFSNAAYERLPLEED+   P            GG    P     Q +A     QG+
Sbjct  250   VMAASFSNAAYERLPLEEDEMQTPVQGGGGGGGGGGGGMGSPPMMGQQQAMAAMAAAQGL  309

Query  1043  PPNLINSIQLP----ND-AYWGGSRPPF  1111
             PPNL+ S+QLP    ND  YW   RPP+
Sbjct  310   PPNLLGSVQLPLPQQNDQQYWSTGRPPY  337



>ref|XP_009356620.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=263

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 157/211 (74%), Gaps = 6/211 (3%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             EGE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+  FA+R+QRG
Sbjct  53    EGETLRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLTNFARRKQRG  112

Query  653   VCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggq  832
             +C+LSG+G VTNVTLRQPAS GA+VTLHGRFEILSL GS LPPPAPP  TGLTIYLAG Q
Sbjct  113   ICILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAGAQ  172

Query  833   gqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggql  1012
             GQV+GG VVGAL+A+GPVVIMAASF N  ++RLPL+E++  A        +     G   
Sbjct  173   GQVMGGGVVGALIASGPVVIMAASFMNVTFDRLPLDEEEVAA-----ALQNQQHQNGRHH  227

Query  1013  laeqgMFQGVPPNLINSIQLPNDAY-WGGSR  1102
               +     G+P NLI +  +P + Y W   R
Sbjct  228   HLDISDLYGLPQNLITNGNVPPEVYSWASGR  258



>ref|XP_010908279.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=296

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 165/300 (55%), Positives = 199/300 (66%), Gaps = 50/300 (17%)
 Frame = +2

Query  314   QLPPPFHTSRDF--NFHPQQFHEQS---------GQKQ--------------------RD  400
              LP PFHT RDF  NFH +    +S         GQK+                    +D
Sbjct  13    HLPSPFHT-RDFHHNFHHRLQQPKSEDDHGGLNRGQKRDYDDNSNINNNGSSSSNGDGKD  71

Query  401   PEEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTH  580
               EVN              L G  +G+ +RRPRGRPAGSKNK K PIII ++SAN LRTH
Sbjct  72    SLEVN--------------LAGT-DGDAARRPRGRPAGSKNKAKLPIIINQESANVLRTH  116

Query  581   LMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSL  760
             +M++A GCD+++SVA FA+RRQ+GVC+LSG G VTNVTL+QPAS G +VTLHGRFEILSL
Sbjct  117   VMDVAGGCDIVESVANFARRRQQGVCILSGTGTVTNVTLQQPASLGGIVTLHGRFEILSL  176

Query  761   AGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLE  940
             +GSFLPPPAPP+ATGLT+YLAGGQGQVVGGSVVG L A+G VVIMAASFSNAAYE+LPLE
Sbjct  177   SGSFLPPPAPPAATGLTVYLAGGQGQVVGGSVVGPLTASGHVVIMAASFSNAAYEKLPLE  236

Query  941   EDDGNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAY-W--GGSRPPF  1111
             E++   P          G    QLL E  +F G+ PNL+NS+ LP++ Y W  G  RPP+
Sbjct  237   EEESLPPQGPVQTHGLVGQEQQQLLQEPNLFHGLAPNLLNSVHLPSEPYSWTMGAGRPPY  296



>ref|XP_010433825.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=336

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 177/327 (54%), Positives = 207/327 (63%), Gaps = 61/327 (19%)
 Frame = +2

Query  311   SQLPPPFHTSRDF--------------------NFH------PQQFHEQSG------QKQ  394
             S LPPPFH +RDF                    N H      P Q HEQ G        +
Sbjct  11    SSLPPPFH-ARDFQLHLQQQQQQHHQQQQQFFLNHHQQPQRNPDQDHEQQGGSILNRSMK  69

Query  395   RDPEEV--NQQDDGNDGGESKNGLG----------GAGEGEISRRPRGRPAGSKNKPKPP  538
              D EE   N  + GN+ G     +           G    +++RRPRGRPAGSKNKPK P
Sbjct  70    MDREETSDNMDNMGNNSGSEGKEMSLHGGEGGSGGGGSGEQMTRRPRGRPAGSKNKPKAP  129

Query  539   IIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASP-  715
             IIITRDSANALRTH+MEI DGCD++D +A FA+RRQRGVCV+SG G VTNVT+RQP SP 
Sbjct  130   IIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVTIRQPGSPA  189

Query  716   GAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIM  895
             G+VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL +GPVV+M
Sbjct  190   GSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVM  249

Query  896   AASFSNAAYERLPLEEDDGNAP----------PFQgggmdspgaaggqllaeqgMFQGVP  1045
             AASFSNAAYERLPLEED+   P             GG   SP     Q +A     QG+P
Sbjct  250   AASFSNAAYERLPLEEDEMQTPVQGGNGGGGGGGGGGMGSSPMMGQQQAMAAMAAAQGLP  309

Query  1046  PNLINSIQLP-----NDAYWGGSRPPF  1111
             PNL+ S+QLP     +  YW   RPP+
Sbjct  310   PNLLGSVQLPPPQQNDQQYWSTGRPPY  336



>ref|XP_006437176.1| hypothetical protein CICLE_v10032444mg [Citrus clementina]
 ref|XP_006484853.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR50416.1| hypothetical protein CICLE_v10032444mg [Citrus clementina]
Length=265

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 160/215 (74%), Gaps = 7/215 (3%)
 Frame = +2

Query  467   AGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQ  646
             A +GE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+A FA+R+Q
Sbjct  52    AADGETLRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLANFARRKQ  111

Query  647   RGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlag  826
             RG+C+LSG+G VTNVTLRQPA+ G++VTLHGRFEILSL GS LPPPAPP  TGLTIYLAG
Sbjct  112   RGMCILSGSGCVTNVTLRQPATSGSIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAG  171

Query  827   gqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaagg  1006
              QGQVVGG VVGAL+A+GPVVIMAASF NA ++RLPL++D+           +       
Sbjct  172   AQGQVVGGVVVGALIASGPVVIMAASFMNATFDRLPLDDDE-----LAAAMQNQHYQNSR  226

Query  1007  qllaeqgMFQGVPP-NLINSIQLPNDAY-WGGSRP  1105
                 +     G+PP NL+ +  +P + Y W   +P
Sbjct  227   HHHLDISDLHGLPPQNLLTNGTMPPEIYAWAPGKP  261



>ref|XP_010275243.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=285

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 163/205 (80%), Gaps = 9/205 (4%)
 Frame = +2

Query  362  QQFHEQSGQKQRDPEEVNQQDDGNDGGE----SKNGL----GGAGEGEI-SRRPRGRPAG  514
             + H+     QR PE  +  + G   GE    +  GL      AG G+I +RRPRGRP G
Sbjct  14   HRLHQPELHLQRQPESEDDNNRGQFSGERDDSNHQGLELVAANAGPGDIVARRPRGRPPG  73

Query  515  SKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVT  694
            SKN+PKPP+IITR+SAN LR H++E+ +GCDV D VA +A+RRQRG+C+LSG+G VTNV+
Sbjct  74   SKNRPKPPVIITRESANTLRAHILEVGNGCDVFDCVATYARRRQRGICILSGSGTVTNVS  133

Query  695  LRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgalla  874
            LRQPA+ GA+VTLHGRFEILSL+GSFLPPPAPP AT LTI+LAGGQGQVVGGSVVGAL+A
Sbjct  134  LRQPAAAGAIVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGALIA  193

Query  875  agpvvIMAASFSNAAYERLPLEEDD  949
            AGPV+++AASF+N AYERLPL+E++
Sbjct  194  AGPVIVIAASFTNVAYERLPLDEEE  218



>emb|CAN83987.1| hypothetical protein VITISV_032602 [Vitis vinifera]
Length=282

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 146/275 (53%), Positives = 185/275 (67%), Gaps = 31/275 (11%)
 Frame = +2

Query  362   QQFHEQSGQKQRDPEEVNQQDDGNDGGESKNG--------------LGGAGEGE-ISRRP  496
              Q H      QR P++ ++ ++ N GG   +G                 AG G+ ++RRP
Sbjct  14    HQLHRSDLHLQR-PQDSDEDNNTNRGGAQYSGDHQDDVAHHGLELVSANAGPGDLVARRP  72

Query  497   RGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNG  676
             RGRP GSKNKPKPP+IITR+SAN LR H++E+ +GCDV D VA +A+RRQRG+CVLSG+G
Sbjct  73    RGRPPGSKNKPKPPVIITRESANTLRAHILEVGNGCDVFDCVATYARRRQRGICVLSGSG  132

Query  677   IVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsv  856
              VTNV++RQPA+ GA++TLHGRFEILSL+GSFLPPPAPP AT LTI+LAGGQGQVVGGSV
Sbjct  133   TVTNVSIRQPAAAGAILTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSV  192

Query  857   vgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeqgM--  1030
             VG L AAGPV+++AASF+N AYERLPL+E++    P Q        + GG          
Sbjct  193   VGELTAAGPVIVIAASFTNVAYERLPLDEEE----PLQMQQQVPQSSGGGGGGINNPFPD  248

Query  1031  ------FQGVPPNLINSIQLPNDAYWG--GSRPPF  1111
                   F  +P N+ N  QLP D + G  G+RPPF
Sbjct  249   PSAGLPFFNLPLNMPNC-QLPVDGWAGNSGARPPF  282



>ref|XP_008342359.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=245

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  476  GEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGV  655
            GE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +++  FA+R+QRG+
Sbjct  54   GETLRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSETLTHFARRKQRGI  113

Query  656  CVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqg  835
            C+LSG+G VTNVTLRQPAS GA+VTLHGRFEILSL GS LPPPAPP  TGLTIYLAG QG
Sbjct  114  CILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAGPQG  173

Query  836  qvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            QVVGG VVGAL+A+GPVVIMAASF NA ++RLPL+ED+
Sbjct  174  QVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDEDE  211



>ref|XP_010544659.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=281

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 156/279 (56%), Positives = 192/279 (69%), Gaps = 19/279 (7%)
 Frame = +2

Query  317   LPPPFHTSRDFNFHP--QQFHEQSGQKQRDPEEVNQQDDGND-------GGESKNGLGGA  469
             LPPPF +      HP  Q  H  S  +  D      + D +D       G  +   + G 
Sbjct  8     LPPPFMSPDLHLHHPHHQSRHTLSNHRDDDQHLRRVKPDHDDPIISAEKGQAASVSVAGG  67

Query  470   GEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQR  649
             GE ++++RPRGRP+GSKNKPKPP+IITRDSANAL++H+MEIA+GCDVM+S+  FA+RRQ 
Sbjct  68    GE-QVTKRPRGRPSGSKNKPKPPVIITRDSANALKSHVMEIANGCDVMESITVFARRRQL  126

Query  650   GVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlagg  829
             GVCVLSGNG VTNVT+ QP S G+VV LHGRF+I+SL+GSFLPPPAPP+A+GLTIYLAGG
Sbjct  127   GVCVLSGNGAVTNVTIDQP-SGGSVVNLHGRFDIVSLSGSFLPPPAPPAASGLTIYLAGG  185

Query  830   qgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEED-----DGNAPPFQgggmdspg  994
             QGQV+GG   G L A+GPVVIMAASF NA+YERLP+EE      DGN P  +        
Sbjct  186   QGQVIGGGGGGPLTASGPVVIMAASFGNASYERLPVEEQSEAAVDGN-PTLR--SGADGT  242

Query  995   aaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                 QL+ +    QG+ P+L NS QLP +AYW   RPPF
Sbjct  243   QTQQQLMQDPLFIQGLNPSLTNSAQLPAEAYWVTPRPPF  281



>ref|XP_011093448.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=281

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 159/206 (77%), Gaps = 10/206 (5%)
 Frame = +2

Query  365  QFHEQSGQKQRDPEEVNQQDDGNDGGE----SKNGL------GGAGEGEISRRPRGRPAG  514
            Q H      QR PE  ++ +     GE    S  GL        +G   ++RRPRGRP G
Sbjct  15   QLHRPDLHLQRPPESEDESNRNRFSGENADNSHQGLDLVASNTSSGGDVVARRPRGRPPG  74

Query  515  SKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVT  694
            SKNKPKPP+IITR+SAN LR H++E+  GCDV ++VA +A++RQRG+CVLSG G V NV+
Sbjct  75   SKNKPKPPVIITRESANPLRAHILEVGSGCDVFEAVATYARKRQRGICVLSGTGTVNNVS  134

Query  695  LRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgalla  874
            LRQPA+ G+VVTLHGRFEILSL+GSFLPPPAPP AT LTIYLAGGQGQVVGG+V+GAL+A
Sbjct  135  LRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSLTIYLAGGQGQVVGGNVMGALIA  194

Query  875  agpvvIMAASFSNAAYERLPLEEDDG  952
            +GPV+I+AASF+N AYERLPL+E+DG
Sbjct  195  SGPVIIIAASFTNVAYERLPLDEEDG  220



>ref|XP_008362336.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=245

 Score =   211 bits (537),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  476  GEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGV  655
            GE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +++  FA+R+QRG+
Sbjct  54   GETLRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSETLTHFARRKQRGI  113

Query  656  CVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqg  835
            C+LSG+G VTNVTLRQPAS GA+VTLHGRFEILSL GS LPPPAPP  TGLTIYLAG QG
Sbjct  114  CILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAGPQG  173

Query  836  qvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            QVVGG VVGAL+A+GPVVIMAASF NA ++RLPL+ED+
Sbjct  174  QVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDEDE  211



>ref|XP_010692273.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=334

 Score =   214 bits (544),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 178/233 (76%), Gaps = 24/233 (10%)
 Frame = +2

Query  479   EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVC  658
             EI RRPRGRPAGSKNKPKPPIIITRDSANALR+H+ME+A+GCD+M+S+  FA+RRQRGVC
Sbjct  104   EIQRRPRGRPAGSKNKPKPPIIITRDSANALRSHVMEVANGCDIMESITNFARRRQRGVC  163

Query  659   VLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgq  838
             +L+G G V NVTLRQP +PGAVVTLHGRFEILSL+GSFLPPPAPP+A+GLTIYLAGGQGQ
Sbjct  164   ILNGTGTVANVTLRQPGAPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQ  223

Query  839   vvggsvvgallaagpvvIMAASFSNAAYERLPLEED-DGNAPPF----------------  967
             VVGG VVG LLA+GPVV+MAASF NAAYERLPL+ED +G   P                 
Sbjct  224   VVGGGVVGPLLASGPVVVMAASFGNAAYERLPLDEDQEGPGAPMPGVTSGGGALGSPPPG  283

Query  968   ----QgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGG-SRPPF  1111
                 Q     + G+ GG      G+ QG+PPNL+NS  LP +A+WG  +R P+
Sbjct  284   GVPGQVIDPGTNGSGGGSGSGSGGLLQGLPPNLLNS--LPPEAFWGTPNRTPY  334



>ref|XP_003524711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=276

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 160/213 (75%), Gaps = 18/213 (8%)
 Frame = +2

Query  350  NFHPQQFHEQSGQKQRDPEE-------------VNQQDDGNDGGESKNGLGGAGEGEISR  490
            + H QQ ++Q   K RD EE              +  DD + G E  +G G      + R
Sbjct  20   DLHLQQNYQQPRHK-RDSEEQETPPNPGTALAPFDNDDDKSQGLELASGPGDI----VGR  74

Query  491  RPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSG  670
            RPRGRP+GSKNKPKPP+IITR+SAN LR H++E+  G DV D V A+A+RRQRG+CVLSG
Sbjct  75   RPRGRPSGSKNKPKPPVIITRESANTLRAHILEVGSGSDVFDCVTAYARRRQRGICVLSG  134

Query  671  NGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvgg  850
            +G VTNV+LRQPA+ GAVV LHGRFEILSL+GSFLPPPAPP AT LTIYLAGGQGQVVGG
Sbjct  135  SGTVTNVSLRQPAAAGAVVRLHGRFEILSLSGSFLPPPAPPGATSLTIYLAGGQGQVVGG  194

Query  851  svvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            +VVG L AAGPV+++AASF+N AYERLPLEED+
Sbjct  195  NVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  227



>ref|XP_003516633.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=250

 Score =   211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 152/192 (79%), Gaps = 11/192 (6%)
 Frame = +2

Query  362  QQFHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPI  541
            Q  H     +Q++ EE  +  DG   G+            + RRPRGRPAGSKNKPKPP+
Sbjct  14   QSLHRPDFNQQQESEEDAKPQDGPQQGDV-----------VGRRPRGRPAGSKNKPKPPV  62

Query  542  IITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGA  721
            IITR+SANALR H++E+A GCDV +SVA++A+RRQRG+C+LSG+G VTNV+LRQPAS GA
Sbjct  63   IITRESANALRAHILEVASGCDVFESVASYARRRQRGICILSGSGTVTNVSLRQPASAGA  122

Query  722  VVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAA  901
            V TLHGRFEILSL GSFLPPPAPP AT L+IYLAGGQGQVVGGSVVG L AAGPV+++AA
Sbjct  123  VATLHGRFEILSLTGSFLPPPAPPGATSLSIYLAGGQGQVVGGSVVGELTAAGPVIVIAA  182

Query  902  SFSNAAYERLPL  937
            SF+N AYERLPL
Sbjct  183  SFTNVAYERLPL  194



>ref|XP_002281411.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=282

 Score =   212 bits (540),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 146/275 (53%), Positives = 185/275 (67%), Gaps = 31/275 (11%)
 Frame = +2

Query  362   QQFHEQSGQKQRDPEEVNQQDDGNDGGESKNG--------------LGGAGEGEI-SRRP  496
              Q H      QR P++ ++ ++ N GG   +G                 AG G+I +RRP
Sbjct  14    HQLHRSDLHLQR-PQDSDEDNNTNRGGAQYSGDHQDDVAHHGLELVSANAGPGDIVARRP  72

Query  497   RGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNG  676
             RGRP GSKN+PKPP+IITR+SAN LR H++E+ +GCDV D VA +A+RRQRG+CVLSG+G
Sbjct  73    RGRPPGSKNRPKPPVIITRESANTLRAHILEVGNGCDVFDCVATYARRRQRGICVLSGSG  132

Query  677   IVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsv  856
              VTNV++RQPA+ GA++TLHGRFEILSL+GSFLPPPAPP AT LTI+LAGGQGQVVGGSV
Sbjct  133   TVTNVSIRQPAAAGAILTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSV  192

Query  857   vgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeqgM--  1030
             VG L AAGPV+++AASF+N AYERLPL+E++    P Q        + GG          
Sbjct  193   VGELTAAGPVIVIAASFTNVAYERLPLDEEE----PLQMQQQVPQSSGGGGGGINNPFPD  248

Query  1031  ------FQGVPPNLINSIQLPNDAYWG--GSRPPF  1111
                   F  +P N+ N  QLP D + G  G+RPPF
Sbjct  249   PSAGLPFFNLPLNMPNC-QLPVDGWAGNSGARPPF  282



>ref|XP_010035901.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW47415.1| hypothetical protein EUGRSUZ_K01211 [Eucalyptus grandis]
Length=249

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 159/220 (72%), Gaps = 7/220 (3%)
 Frame = +2

Query  449   KNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAA  628
             KN +  A EG   RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+ +
Sbjct  30    KNLVSSAAEGATIRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVTESLTS  89

Query  629   FAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGL  808
             FA+R+QRG+C+LSG G VTNVT+RQ AS GA+VTLHGRFEILSL GS LPPPAPP   GL
Sbjct  90    FARRKQRGLCILSGTGCVTNVTIRQSASSGAIVTLHGRFEILSLLGSILPPPAPPGIMGL  149

Query  809   TIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmds  988
             TIYLAG QGQVVGG VVG L+A+GPV+IMAASF N  ++RLPL++D+           + 
Sbjct  150   TIYLAGAQGQVVGGGVVGGLIASGPVMIMAASFMNVTFDRLPLDDDE-----VSVAIQNQ  204

Query  989   pgaaggqllaeqgMFQGVPPNLINSI-QLPNDAY-WGGSR  1102
                 G    A+     G+P NL+N+   L  + Y WG +R
Sbjct  205   HYQNGRHQHADISDLYGMPQNLLNNAGSLHTEMYAWGSAR  244



>ref|XP_002448423.1| hypothetical protein SORBIDRAFT_06g026940 [Sorghum bicolor]
 gb|EES12751.1| hypothetical protein SORBIDRAFT_06g026940 [Sorghum bicolor]
Length=312

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +2

Query  461  GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQR  640
            GG GE  ++RRPRGRP GSKNKPKPP+IITR+SAN LR H++E+  GCDV +SV+ +A+R
Sbjct  79   GGNGE-MVARRPRGRPPGSKNKPKPPVIITRESANTLRAHILEVGSGCDVFESVSTYARR  137

Query  641  RQRGVCVLSGNGIVTNVTLRQPASP-GAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
            RQRGVCVLSG+G+VTNVTLRQP++P GAVVTLHGRFEILSL+GSFLPPPAPP AT LTI+
Sbjct  138  RQRGVCVLSGSGVVTNVTLRQPSAPTGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIF  197

Query  818  laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPP  964
            LAGGQGQVVGG+VVGAL AAGPV+++AASF+N AYERLPLEE++  A P
Sbjct  198  LAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLEEEEAQAAP  246



>ref|XP_006413619.1| hypothetical protein EUTSA_v10025672mg [Eutrema salsugineum]
 gb|ESQ55072.1| hypothetical protein EUTSA_v10025672mg [Eutrema salsugineum]
Length=333

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 203/324 (63%), Gaps = 58/324 (18%)
 Frame = +2

Query  311   SQLPPPFHTSRDFNFHPQQ------------FHEQSGQKQRDPEE----------VNQQD  424
             S LPPPFH +RDF  H QQ             H Q  + Q D ++          +N+++
Sbjct  11    SSLPPPFH-ARDFQLHLQQQQQQQQQQEFFLHHHQQQRNQTDQDDQQGGLNRQIKINREE  69

Query  425   DGNDGGESKNGLGGAGEG---------------------EISRRPRGRPAGSKNKPKPPI  541
               ++     N  G  G+                      +++RRPRGRPAGSKNKPKPPI
Sbjct  70    TSDNIDNIANNSGSEGKDISLHGGSGEGGGGGGGGSGGDQMTRRPRGRPAGSKNKPKPPI  129

Query  542   IITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPA--SP  715
             IITRDSANALRTH+MEI DGCD+++SVA FA+RRQRGVCV+SG G VTNVT+RQP   SP
Sbjct  130   IITRDSANALRTHVMEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSPSP  189

Query  716   GAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIM  895
             G+VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL AGPVV+M
Sbjct  190   GSVVSLHGRFEILSLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVM  249

Query  896   AASFSNAAYERLPLEEDDGNAPPFQgggmdspgaa-------ggqllaeqgMFQGVPPNL  1054
             AASFSNAAYERLPLE+D+   P   GGG      +                  QG+PPNL
Sbjct  250   AASFSNAAYERLPLEDDEMQTPVHGGGGGGGSMESPPMMGGQLPHQQQAMSGHQGLPPNL  309

Query  1055  INSI-----QLPNDAYWGGSRPPF  1111
             +        Q  N +YW   RP +
Sbjct  310   LGPAHQGLPQHDNQSYWSTGRPSY  333



>emb|CDP09327.1| unnamed protein product [Coffea canephora]
Length=292

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 159/206 (77%), Gaps = 11/206 (5%)
 Frame = +2

Query  365  QFHEQSGQKQR------DPEEVNQQDDGNDGGESKNGL----GGAGEGEI-SRRPRGRPA  511
            Q H    Q QR      D    NQ    ND    + GL         G++ +RRPRGRP 
Sbjct  15   QLHRPDLQLQRPVANSEDDSNRNQFSGENDDESHQAGLELVTSNTSSGDVVARRPRGRPP  74

Query  512  GSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNV  691
            GSKNKPKPP+IITR+SAN LR H++E++ GCDV +SVA +A++RQRG+C+LSG+G V NV
Sbjct  75   GSKNKPKPPVIITRESANTLRAHILEVSSGCDVFESVATYARKRQRGICILSGSGTVNNV  134

Query  692  TLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgall  871
            +LRQPA+ G+VVTLHGRFEILSL+GSFLPPPAPP AT LTIYLAGGQGQVVGG+VVGAL+
Sbjct  135  SLRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSLTIYLAGGQGQVVGGNVVGALI  194

Query  872  aagpvvIMAASFSNAAYERLPLEEDD  949
            A+GPV+++AASF+N AYERLPL+EDD
Sbjct  195  ASGPVIVIAASFTNVAYERLPLDEDD  220



>ref|XP_008805810.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=297

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 199/287 (69%), Gaps = 23/287 (8%)
 Frame = +2

Query  314   QLPPPFHTSRDF--NFHP--QQFHEQSGQ------KQRDPEEVNQQDDGNDGGESKN---  454
              LPPPFHT RDF  NFH   QQ   +  Q      ++RD ++ +  ++      + +   
Sbjct  13    HLPPPFHT-RDFHRNFHQRLQQLKSEEDQGGLNRGQKRDYDDNSNINNNGSSSSNGDGKE  71

Query  455   ----GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSV  622
                  L GA +G+ +RR RGRP+GSKNK KPPIII ++S NALRTH+ME+ADG D+++SV
Sbjct  72    SLPVNLAGA-DGDAARRLRGRPSGSKNKAKPPIIINQESTNALRTHVMEVADGGDIVESV  130

Query  623   AAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSAT  802
             A FA+ RQRGVC+LSG G VTNVTL+QP S GA++TLHGRFEILSL+GSF+PPPAPP+AT
Sbjct  131   ANFARLRQRGVCILSGTGTVTNVTLQQPGSQGAILTLHGRFEILSLSGSFVPPPAPPAAT  190

Query  803   GLTIYlaggqgqvvggsvvga-llaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQggg  979
             GLTIYLAGGQGQVV G  V   L A+G VVIMAASFSNAAYERLPLEE++   P      
Sbjct  191   GLTIYLAGGQGQVVVGGSVVGPLTASGHVVIMAASFSNAAYERLPLEEEESAPPQRLVES  250

Query  980   mdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAY-W--GGSRPPF  1111
                 G    QLL E  +F  + PNL+N++QLP++ Y W  G  RPP+
Sbjct  251   HGLVGQEQQQLLQEPNLFHALAPNLLNNVQLPSEPYSWTAGAGRPPY  297



>ref|XP_008380207.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=263

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 157/210 (75%), Gaps = 6/210 (3%)
 Frame = +2

Query  476   GEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGV  655
             GE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+  FA+R+QRG+
Sbjct  54    GETLRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLTNFARRKQRGI  113

Query  656   CVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqg  835
             C+LSG+G VTNVTLRQPAS GA+VTLHGRFEILSL GS LPPPAPP  TGLTIYLAG QG
Sbjct  114   CILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAGAQG  173

Query  836   qvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqll  1015
             QV+GG VVGAL+A+GPVVIMAASF NA ++RLP +E++  A        +     G    
Sbjct  174   QVMGGGVVGALIASGPVVIMAASFMNATFDRLPQDEEEVAA-----ALQNQHHQNGRHHH  228

Query  1016  aeqgMFQGVPPNLINSIQLPNDAY-WGGSR  1102
              +     G+P NLI +  +P + Y WG  R
Sbjct  229   VDISDLYGLPQNLITNGNVPPEVYSWGSGR  258



>ref|XP_003617443.1| hypothetical protein MTR_5g091630 [Medicago truncatula]
 gb|AET00402.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=254

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 154/199 (77%), Gaps = 17/199 (9%)
 Frame = +2

Query  404  EEVNQQDDGN-DGGESKNGL----------------GGAGEGEISRRPRGRPAGSKNKPK  532
            E   +QD+GN +   S NG+                  A EGE  +RPRGRPAGSKNKPK
Sbjct  2    EHKQEQDNGNQNNNMSGNGIDVTLMSPKIPKSVSPVSSAAEGETLKRPRGRPAGSKNKPK  61

Query  533  PPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPAS  712
            PPII+TRDSANAL+ H ME++ GCDV +S+  FA+R+QRG+C+L+G G VTNVTLRQPAS
Sbjct  62   PPIIVTRDSANALKAHAMEVSSGCDVNESLLNFARRKQRGLCILNGTGCVTNVTLRQPAS  121

Query  713  PGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvI  892
             GA+VTLHGRFEILSL GS LPPPAPP  TGLTIYLAG QGQVVGG+VVGAL+A+GPVVI
Sbjct  122  SGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAGAQGQVVGGAVVGALIASGPVVI  181

Query  893  MAASFSNAAYERLPLEEDD  949
            MAASF +A ++RLPLE+D+
Sbjct  182  MAASFMHATFDRLPLEDDE  200



>ref|XP_010455638.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=337

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 206/328 (63%), Gaps = 62/328 (19%)
 Frame = +2

Query  311   SQLPPPFHTSRDF---------------------NFH------PQQFHEQSG------QK  391
             S LPPPFH +RDF                     N H      P Q HEQ G        
Sbjct  11    SSLPPPFH-ARDFQLHLQQQQQQHHQQQQQQFFLNHHQQPQRNPDQDHEQQGGSILNRSM  69

Query  392   QRDPEEV--NQQDDGNDGGESKNGLG----------GAGEGEISRRPRGRPAGSKNKPKP  535
             + D EE   N  + GN+ G     +           G    +++RRPRGRPAGSKNKPK 
Sbjct  70    KMDREETSDNMDNMGNNSGSEGKEMSLHGGEGGSGGGGSGEQMTRRPRGRPAGSKNKPKA  129

Query  536   PIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASP  715
             PIIITRDSANALRTH+MEI DGCD++D +A FA+RRQRGVCV+SG G VTNVT+RQP SP
Sbjct  130   PIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVTIRQPGSP  189

Query  716   -GAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvI  892
              G+VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL +GPVV+
Sbjct  190   AGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVV  249

Query  893   MAASFSNAAYERLPLEEDDGNAP----------PFQgggmdspgaaggqllaeqgMFQGV  1042
             MAASFSNAAYERLPLEED+   P             GG    P     Q +A     QG+
Sbjct  250   MAASFSNAAYERLPLEEDEMQTPVQGGGGGGGGGGGGGMGSPPMMGQQQAMAAMAAAQGL  309

Query  1043  PPNLINSIQLP-----NDAYWGGSRPPF  1111
             PPNL+ S+QLP     +  YW   RPP+
Sbjct  310   PPNLLGSVQLPPPQQNDQQYWSTGRPPY  337



>ref|NP_192942.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
 emb|CAB40946.1| putative DNA-binding protein [Arabidopsis thaliana]
 emb|CAB78248.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAP88365.1| At4g12050 [Arabidopsis thaliana]
 dbj|BAF00128.1| putative DNA-binding protein [Arabidopsis thaliana]
 tpd|FAA00297.1| TPA: AT-hook motif nuclear localized protein 26 [Arabidopsis 
thaliana]
 dbj|BAH30517.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83091.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
Length=339

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 176/225 (78%), Gaps = 14/225 (6%)
 Frame = +2

Query  479   EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVC  658
             +++RRPRGRPAGSKNKPK PIIITRDSANALRTH+MEI DGCD++D +A FA+RRQRGVC
Sbjct  115   QMTRRPRGRPAGSKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVC  174

Query  659   VLSGNGIVTNVTLRQPAS-PGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqg  835
             V+SG G VTNVT+RQP S PG+VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQG
Sbjct  175   VMSGTGSVTNVTIRQPGSPPGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQG  234

Query  836   qvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP--------PFQgggmdsp  991
             QVVGGSVVG LL +GPVV+MAASFSNAAYERLPLEED+   P           GG    P
Sbjct  235   QVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVQGGGGGGGGGGGMGSPP  294

Query  992   gaaggqllaeqgMFQGVPPNLINSIQLP----ND-AYWGGSRPPF  1111
                  Q +A     QG+PPNL+ S+QLP    ND  YW   RPP+
Sbjct  295   MMGQQQAMAAMAAAQGLPPNLLGSVQLPPPQQNDQQYWSTGRPPY  339



>ref|XP_010257112.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=395

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 179/243 (74%), Gaps = 9/243 (4%)
 Frame = +2

Query  404   EEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHL  583
             +E + +D+  D  E +N      E    RRPRGRPAGSKNKPKPPIIITR+S NALR+H+
Sbjct  152   DEDDSKDNDRDA-EDQNVGHEVIEAGTGRRPRGRPAGSKNKPKPPIIITRESPNALRSHV  210

Query  584   MEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLA  763
             +EI+ G DV +S+A FA+RRQRGVCVLSG+GIVTNVTLRQPA+PGAVV+LHGRFEILSL+
Sbjct  211   LEISSGSDVAESIATFARRRQRGVCVLSGSGIVTNVTLRQPAAPGAVVSLHGRFEILSLS  270

Query  764   GSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEE  943
             G+FLP P+PP ATGLT+YL+GGQGQVVGGSVVGAL+A+GPV+++AA+F+NA YERLP+E+
Sbjct  271   GAFLPAPSPPGATGLTVYLSGGQGQVVGGSVVGALVASGPVMVIAATFTNATYERLPIED  330

Query  944   D-DGNAPPFQgggmdspgaaggqllaeqgM-------FQGVPPNLINSIQLPNDAYWGGS  1099
             +  G     Q     + G+ G        +          +PPNL+ + Q+P+D +W   
Sbjct  331   EPAGEGIQLQQSSGVNSGSTGISASQPHTLPDSSSMPIYNLPPNLLPNGQMPHDVFWAPR  390

Query  1100  RPP  1108
              PP
Sbjct  391   PPP  393



>ref|XP_008377132.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=293

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +2

Query  425  DGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGC  604
            D + G  +  G+ G     ++RRPRGRP GSKNKPKPP+IITR+SAN LR H++E+ +GC
Sbjct  50   DDHQGSLNLGGINGGSXEIVARRPRGRPPGSKNKPKPPVIITRESANTLRAHILEVGNGC  109

Query  605  DVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP  784
            DV D VA +A+RRQRG+C+LSG+G VTNVTLRQPA+ GAVVTLHGRFEILSL+GSFLPPP
Sbjct  110  DVFDCVATYARRRQRGICILSGSGTVTNVTLRQPAAVGAVVTLHGRFEILSLSGSFLPPP  169

Query  785  APPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            APP AT LTI+LAGGQGQVVGGSVVG L  AGPV+++A+SF+N AYERLPL+E++
Sbjct  170  APPGATSLTIFLAGGQGQVVGGSVVGELTTAGPVIVIASSFTNVAYERLPLDEEE  224



>ref|XP_006368407.1| DNA-binding family protein [Populus trichocarpa]
 gb|ERP64976.1| DNA-binding family protein [Populus trichocarpa]
Length=298

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 153/181 (85%), Gaps = 2/181 (1%)
 Frame = +2

Query  413  NQQDDGNDGG-ESKNGLGGAGEGE-ISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLM  586
            +  DDG+  G +       +G+G+ + RRPRGRPAGSKNKPKPP+IITR+SAN LR H++
Sbjct  54   HHHDDGSHQGLDLVAAAANSGQGDLVGRRPRGRPAGSKNKPKPPVIITRESANTLRAHIL  113

Query  587  EIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAG  766
            E+ +GCDV + VA +A+RRQRG+C+LSG G VTNV++RQPA+ GA+VTLHGRFEILSL+G
Sbjct  114  EVGNGCDVFECVANYARRRQRGICILSGAGTVTNVSIRQPAAAGAIVTLHGRFEILSLSG  173

Query  767  SFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEED  946
            SFLPPPAPP AT LTI+LAGGQGQVVGGSVVG L AAGPV+++AASF+N AYERLPL+ED
Sbjct  174  SFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDED  233

Query  947  D  949
            D
Sbjct  234  D  234



>ref|XP_003611214.1| AT-hook DNA-binding protein [Medicago truncatula]
 gb|AES94172.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=325

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 176/228 (77%), Gaps = 18/228 (8%)
 Frame = +2

Query  482   ISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCV  661
             ++RRPRGRPAGSKNKPKPPIIITRDSANAL+TH+ME+ADGCDV++SV  FA+RRQRGVC+
Sbjct  98    MTRRPRGRPAGSKNKPKPPIIITRDSANALKTHVMEVADGCDVVESVNNFARRRQRGVCI  157

Query  662   LSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqv  841
             +SG G VTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP+A+GLTIYLAGGQGQV
Sbjct  158   MSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQV  217

Query  842   vggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNA-----------PPFQgggmds  988
             VGGSVVGAL+A+GPVVIM+ASFSNAAYERLPLE+DDG++            P  GGG   
Sbjct  218   VGGSVVGALIASGPVVIMSASFSNAAYERLPLEDDDGSSIQQLQGGGGGGSPSGGGGGVQ  277

Query  989   pgaaggqllaeqgMFQGVPPNLINSI-------QLPNDAYWGGSRPPF  1111
                      +   +FQ + P   N         Q+P+D +W   R P+
Sbjct  278   QQQQQLLGDSTAPLFQAMHPPNSNPNLNPNLLGQMPSDNFWPTGRSPY  325



>emb|CDY18931.1| BnaC04g04190D [Brassica napus]
Length=309

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 178/235 (76%), Gaps = 23/235 (10%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             + +I+RRPRGRPAGSKNKPKPPII+TRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  76    DNQITRRPRGRPAGSKNKPKPPIIVTRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  135

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             VCVLSGNG VTNVT+RQPAS PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  136   VCVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  195

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEED-----------------D  949
             AGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEE+                 D
Sbjct  196   AGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEEDQEEQQTSGAVVNNNNID  255

Query  950   GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLI-NSIQLPNDAYWGGSRPPF  1111
             GN     GG           +       QG+ PNL+ +S+QLP +AYWG  RP F
Sbjct  256   GNG-TMGGGTQTQQPQQQQLMQDPTSFIQGLQPNLMSSSVQLPGEAYWGTPRPSF  309



>ref|XP_004491337.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=253

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  443  ESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSV  622
            +S + +  A EGE  +RPRGRPAGSKNKPKPPII+TRDSANAL+ H ME++ GCDV +S+
Sbjct  33   KSVSPVSSAAEGETLKRPRGRPAGSKNKPKPPIIVTRDSANALKAHAMEVSSGCDVNESL  92

Query  623  AAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSAT  802
              FA+R+QRG+C+L+G G VTNVTLRQPAS GA+VTLHGRFEILSL GS LPPPAPP  T
Sbjct  93   LNFARRKQRGLCILNGTGCVTNVTLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGIT  152

Query  803  GLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            GLTIYLAG QGQVVGG+VVGAL+A+GPVVIMAASF +A ++RLPLE+D+
Sbjct  153  GLTIYLAGAQGQVVGGAVVGALIASGPVVIMAASFMHATFDRLPLEDDE  201



>ref|XP_010262258.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=255

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 165/223 (74%), Gaps = 14/223 (6%)
 Frame = +2

Query  485   SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVL  664
             +RRPRGRP GSKNKPKPPI +TRDS NALR+H+ME+A G DV +SVA FA+RRQRGVCVL
Sbjct  33    TRRPRGRPPGSKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESVAQFARRRQRGVCVL  92

Query  665   SGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvv  844
             SG+G V NVTLRQPA+PGAVV LHGRFEILSL G+FLP PAPP +TGLT+YLAGGQGQVV
Sbjct  93    SGSGAVANVTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVV  152

Query  845   ggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeq  1024
             GGSVVG L+AAGPV+++AA+F+NA YERLPLEE++  A     G +     +    +   
Sbjct  153   GGSVVGTLVAAGPVMVIAATFANATYERLPLEEEEDEAGSGGQGQLAGGAGSSPPAIGSS  212

Query  1025  gMFQG------------VPPNLI-NSIQLPNDAY-WGGSRPPF  1111
                Q             +PPNLI N  QL +DA+ W  +RPPF
Sbjct  213   AQQQSGLPDPSSLPIYNLPPNLIPNGGQLNHDAFAWAHARPPF  255



>ref|XP_009411479.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=307

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 173/226 (77%), Gaps = 11/226 (5%)
 Frame = +2

Query  455   GLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFA  634
             G GGA   EI R+PRGRP GSKNKPKPPIIITR+SANAL +H+MEIADG D+ +SVA FA
Sbjct  82    GNGGAEGREIIRKPRGRPPGSKNKPKPPIIITRESANALLSHVMEIADGYDICESVATFA  141

Query  635   QRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTI  814
              RRQRGVCVLSG+G VTNVTL QPASPGAVVTLHGRFEILSL+GSFLPPPAPP+ATGL I
Sbjct  142   CRRQRGVCVLSGSGTVTNVTLHQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAATGLAI  201

Query  815   YlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDG-------NAPPFQg  973
             YLAGGQGQVVGGSVVG L+A+GPV+I+AASF  AAYERLPL  ++G        +P    
Sbjct  202   YLAGGQGQVVGGSVVGPLIASGPVIIIAASFGTAAYERLPLAAEEGLQMQGTLGSPDL--  259

Query  974   ggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAY-WGGSRPP  1108
                 SP            +F  +PPNL+N++Q+P DA+ W GSR P
Sbjct  260   -IGQSPPPQLLPPDPNNLLFHSLPPNLLNNVQVPADAHGWDGSRDP  304



>ref|XP_010053890.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW78264.1| hypothetical protein EUGRSUZ_D02447 [Eucalyptus grandis]
Length=304

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 175/234 (75%), Gaps = 13/234 (6%)
 Frame = +2

Query  434   DGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVM  613
             DG ES    GG G  E++RRPRGRPAGSKNKPKPPIIITRDS NALR+H++E+A G D++
Sbjct  73    DGKES----GGRGGKEVTRRPRGRPAGSKNKPKPPIIITRDSPNALRSHVVEVASGADIV  128

Query  614   DSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPP  793
             +S++ FA+RRQRGVC+LSG+G VTNV LRQPASPGAVVTLHGRFEILSL+GS LPPPAPP
Sbjct  129   ESMSTFARRRQRGVCILSGSGTVTNVALRQPASPGAVVTLHGRFEILSLSGSILPPPAPP  188

Query  794   SATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEED---------  946
             + +GLT+YLAGGQGQVVGG+V G L+A+GPVVIMAASF NAAYERLPLEE+         
Sbjct  189   ALSGLTVYLAGGQGQVVGGNVAGPLMASGPVVIMAASFGNAAYERLPLEEEEAGAAAPVP  248

Query  947   DGNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLINSIQLPNDAYWGGSRPP  1108
              G      G G          + A   +  G  PNL+NS  LP + YWG +RPP
Sbjct  249   SGGQLGSPGMGQQQQQQQIMPVDANGALLHGFAPNLLNSCNLPGETYWGAARPP  302



>gb|EPS64135.1| hypothetical protein M569_10646 [Genlisea aurea]
Length=318

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 168/219 (77%), Gaps = 8/219 (4%)
 Frame = +2

Query  461   GGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQR  640
             G A + E +RRPRGRPAGSKNKPKPPIIITRDSANALR+H++E+A GCD+ +SV+ FA R
Sbjct  86    GAADQTEFTRRPRGRPAGSKNKPKPPIIITRDSANALRSHVIEVATGCDIQESVSTFATR  145

Query  641   RQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             RQRGVC+LSG G VTNVT+RQP SPGAV+TL GRFEILSL GSFLPPPAPP+A+ LTIYL
Sbjct  146   RQRGVCILSGTGTVTNVTIRQPTSPGAVLTLQGRFEILSLTGSFLPPPAPPAASSLTIYL  205

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaa  1000
             AG QGQV+GG++VG L+A+GPVVIMAASF NAAYERLPLEE++G +    G G       
Sbjct  206   AGSQGQVMGGTIVGPLIASGPVVIMAASFGNAAYERLPLEEEEGQSTAVHGRGQMGSPVM  265

Query  1001  ggqllaeqgM------FQGVPPNLIN--SIQLPNDAYWG  1093
               Q L    +      FQG+P  ++N  S Q+  + YWG
Sbjct  266   MSQQLMNDPIHPNVNYFQGLPHGIMNSSSYQISGEGYWG  304



>ref|XP_007139682.1| hypothetical protein PHAVU_008G050100g [Phaseolus vulgaris]
 gb|ESW11676.1| hypothetical protein PHAVU_008G050100g [Phaseolus vulgaris]
Length=271

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +2

Query  470  GEGEI-SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQ  646
            G G+I +RRPRGRP GSKNKPKPP+IITR+SAN LR H++E++ GCDV DSVA +A++RQ
Sbjct  49   GPGDIVARRPRGRPPGSKNKPKPPVIITRESANTLRAHILEVSSGCDVFDSVATYARKRQ  108

Query  647  RGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlag  826
            RG+CVLSG+G VTNVTLRQPA+ GAVVTLHGRFEILSL+GSFLPPPAPP AT LT++L G
Sbjct  109  RGICVLSGSGTVTNVTLRQPAAAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTVFLGG  168

Query  827  gqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            GQGQVVGG+VVG L+A+GPV+++A+SF+N AYERLPL+E+D
Sbjct  169  GQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDEED  209



>ref|XP_006284928.1| hypothetical protein CARUB_v10006227mg [Capsella rubella]
 gb|EOA17826.1| hypothetical protein CARUB_v10006227mg [Capsella rubella]
Length=330

 Score =   211 bits (537),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 173/226 (77%), Gaps = 15/226 (7%)
 Frame = +2

Query  479   EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVC  658
             +++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+MEI DGCD+++SVA FA+RRQRGVC
Sbjct  105   QMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEIGDGCDLVESVATFARRRQRGVC  164

Query  659   VLSGNGIVTNVTLRQPA---SPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlagg  829
             V+SG G VTNVT+RQP    SPG+VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGG
Sbjct  165   VMSGTGNVTNVTIRQPGSHPSPGSVVSLHGRFEILSLSGSFLPPPAPPTATGLSVYLAGG  224

Query  830   qgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaag--  1003
             QGQVVGGSVVG LL AGPVV+MAASFSNAAYERLPLEED+   P   GGG          
Sbjct  225   QGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEDEMQTPVHGGGGGGGGSMESPP  284

Query  1004  ------gqllaeqgMFQGVPPNLINSI----QLPNDAYWGGSRPPF  1111
                             QG+PPNL+ S+    Q  + +YW   RPP+
Sbjct  285   MMGQQLQHQQQAMSGHQGLPPNLLGSVQLQQQQHDQSYWSTGRPPY  330



>gb|KCW61537.1| hypothetical protein EUGRSUZ_H04257, partial [Eucalyptus grandis]
Length=272

 Score =   209 bits (532),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVL  664
            SRRPRGRP GSKNKPKPPI +TRDS NALR+H+MEIA+G D+ +SVA FA+RRQRGVCVL
Sbjct  63   SRRPRGRPPGSKNKPKPPIFVTRDSPNALRSHVMEIANGADIAESVAQFARRRQRGVCVL  122

Query  665  SGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvv  844
            SG+G VTNVTLRQP +PGAV+ LHGRFEILSL G+FLP PAPP +TGLTIYLAGGQGQVV
Sbjct  123  SGSGTVTNVTLRQPTAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVV  182

Query  845  ggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            GGSVVG+L+A+GPV+++AA+FSNA YERLPLEED+
Sbjct  183  GGSVVGSLVASGPVMVIAATFSNATYERLPLEEDE  217



>ref|XP_008786310.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=295

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 150/170 (88%), Gaps = 4/170 (2%)
 Frame = +2

Query  464  GAGEGEI-SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQR  640
            GAG G++ +RRPRGRP GSKNKPKPP+IITR+SANALR H++E+  G DV D VA +A+R
Sbjct  69   GAGAGDVVARRPRGRPPGSKNKPKPPVIITRESANALRAHILEVGGGYDVFDCVATYARR  128

Query  641  RQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
            RQRG+CVLSG+G VTNV+LRQP++ GAVVTLHGRFEILSL+GSFLPPPAPP AT LTI+L
Sbjct  129  RQRGICVLSGSGTVTNVSLRQPSAAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFL  188

Query  821  aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQ  970
            AGGQGQVVGG+VVGAL AAGPV+++AASF+N AYERLPLEE+D   PP Q
Sbjct  189  AGGQGQVVGGNVVGALFAAGPVIVIAASFTNVAYERLPLEEED---PPLQ  235



>ref|XP_004976643.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=310

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +2

Query  482  ISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCV  661
            ++RRPRGRP GSKNKPKPP+IITR+SAN LR H++E+  GCDV +SV+ +A+RRQRGVCV
Sbjct  84   VARRPRGRPPGSKNKPKPPVIITRESANTLRAHILEVGSGCDVFESVSTYARRRQRGVCV  143

Query  662  LSGNGIVTNVTLRQPASP-GAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgq  838
            LSG+G+VTNVTLRQP++P GAVVTLHGRFEILSL+GSFLPPPAPP AT LTI+LAGGQGQ
Sbjct  144  LSGSGVVTNVTLRQPSAPTGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQ  203

Query  839  vvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPP  964
            VVGG+VVGAL AAGPV+++AASF+N AYERLPLEE++  A P
Sbjct  204  VVGGNVVGALYAAGPVIVIAASFANVAYERLPLEEEEAQAAP  245



>emb|CDO99189.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 147/247 (60%), Positives = 176/247 (71%), Gaps = 11/247 (4%)
 Frame = +2

Query  368   FHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIII  547
              +E SG K  + EE +     N  GE + G    G    +RRPRGRP GSKNKPKPPI +
Sbjct  48    LNENSGSKGSEDEERD-----NTSGEPREGAVEVG----NRRPRGRPPGSKNKPKPPIFV  98

Query  548   TRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVV  727
             TRDS NALR+H+ME+A G DV +S+A FA++RQRGVCVLSG+G V NVTLRQPA+PGAVV
Sbjct  99    TRDSPNALRSHVMEVAGGSDVAESIAQFARKRQRGVCVLSGSGSVANVTLRQPAAPGAVV  158

Query  728   TLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASF  907
              LHGRFEILSL G+FLP PAPP ATGLT+YLAGGQGQVVGGSVVG+L+AAGPV+++AA+F
Sbjct  159   ALHGRFEILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGSLVAAGPVLVIAATF  218

Query  908   SNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLI-NSIQLPNDA  1084
             +NA YERLPLE+D+   P   GGG   P                + PNL+ N  QL +DA
Sbjct  219   ANATYERLPLEDDEDTTPACGGGGGGQPHLGHAMPDPPSLPSYNLTPNLLPNGGQLNHDA  278

Query  1085  Y-WGGSR  1102
             Y W  SR
Sbjct  279   YGWAQSR  285



>ref|XP_007211085.1| hypothetical protein PRUPE_ppa016700mg, partial [Prunus persica]
 gb|EMJ12284.1| hypothetical protein PRUPE_ppa016700mg, partial [Prunus persica]
Length=204

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 142/191 (74%), Gaps = 21/191 (11%)
 Frame = +2

Query  305  MDSQ-LPPPFHTSRDF--------------NFHPQQ-----FHEQSGQKQRDPEEVNQQD  424
            MD+  LPPPFHT RDF              N   +Q      + +  +++RD +  +  +
Sbjct  1    MDTHSLPPPFHT-RDFHLQHHPQFHHQQQQNSEDEQTGSSGLNNKGQKRERDIDNDSGGN  59

Query  425  DGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGC  604
             G+ G E    + G    E++RRPRGRPAGSKNKPKPPIIITRDSANALRTH+ME+ADGC
Sbjct  60   GGDLGKELNVTISGGDGSEMTRRPRGRPAGSKNKPKPPIIITRDSANALRTHVMEVADGC  119

Query  605  DVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPP  784
            D+++SVA FA+RRQRGVC++SG G VTNVT+RQPASPG++VTLHGRFEILSLAGSFLPPP
Sbjct  120  DIVESVATFARRRQRGVCIMSGTGTVTNVTIRQPASPGSIVTLHGRFEILSLAGSFLPPP  179

Query  785  APPSATGLTIY  817
            APP+ATGLTIY
Sbjct  180  APPAATGLTIY  190



>ref|XP_010262897.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=360

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 169/216 (78%), Gaps = 8/216 (4%)
 Frame = +2

Query  485   SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVL  664
             +RRPRGRP GSKNKPKPPIIITR+S NALR+H++EI+ G DV++S+A FA+RRQRGVCVL
Sbjct  142   ARRPRGRPPGSKNKPKPPIIITRESPNALRSHVLEISSGSDVVESIATFARRRQRGVCVL  201

Query  665   SGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvv  844
             SG+G+VTNVTLRQPA+ GAV+TLHGRFEILSL+G+FLP P+PP A+GLT+YLAGGQGQVV
Sbjct  202   SGSGVVTNVTLRQPAASGAVITLHGRFEILSLSGAFLPAPSPPGASGLTVYLAGGQGQVV  261

Query  845   ggsvvgallaagpvvIMAASFSNAAYERLPLEED-DGNAPPFQgggmdspgaaggqllae  1021
             GGSVVGAL+A+GPV+++AA+F+NA YERLP++++  G     Q     + G +G      
Sbjct  262   GGSVVGALMASGPVMVIAATFANATYERLPIKDEPAGEGMQLQQTSGVNSGTSGISASQS  321

Query  1022  qgM-------FQGVPPNLINSIQLPNDAYWGGSRPP  1108
               +          +PPNL+ + Q+P+D +W   RPP
Sbjct  322   HVLPDPSSLPIYNLPPNLLTNGQMPHDVFWAPPRPP  357



>emb|CDP17786.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 163/212 (77%), Gaps = 13/212 (6%)
 Frame = +2

Query  515   SKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVT  694
             SKNKPKPPIIITRDSANALR+H+MEIA GCD+ +SV+ FA RRQRGVC+LSGNG V NVT
Sbjct  99    SKNKPKPPIIITRDSANALRSHVMEIASGCDIQESVSNFATRRQRGVCILSGNGTVNNVT  158

Query  695   LRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgalla  874
             LRQPA+PGAVVTLHGRFEILSL+GSFLPPPAP +A+GLTIYLAGGQGQVVGGSVVG LLA
Sbjct  159   LRQPAAPGAVVTLHGRFEILSLSGSFLPPPAPAAASGLTIYLAGGQGQVVGGSVVGPLLA  218

Query  875   agpvvIMAASFSNAAYERLPLEEDDGNAPP------------FQgggmdspgaaggqlla  1018
             AGPVVIMAASF NAAYERLPLE+D+  A P               G      +       
Sbjct  219   AGPVVIMAASFGNAAYERLPLEDDETAAVPPPGSGPLGSPGAGIVGQQQPQQSQQLLPDP  278

Query  1019  eqgMFQGVPPNLINSIQLPND-AYWGGSRPPF  1111
                +F G+PPNL+NS QLP + AYWG  RPPF
Sbjct  279   SSSLFHGMPPNLLNSCQLPAEAAYWGTGRPPF  310



>ref|XP_010097716.1| hypothetical protein L484_023857 [Morus notabilis]
 gb|EXB70671.1| hypothetical protein L484_023857 [Morus notabilis]
Length=308

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 166/216 (77%), Gaps = 18/216 (8%)
 Frame = +2

Query  368  FHEQSGQKQRDPEEVNQQD--------DGNDGGESKNGLG------GAGEGEIS-RRPRG  502
             H Q      D  +VN+ +        D N G +  N  G        G G+++ RRPRG
Sbjct  21   LHLQIPPDSDDHHDVNRNNGHFSGAGADHNHGEDDNNTAGLDLVTPNHGMGDVAARRPRG  80

Query  503  RPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIV  682
            RPAGSKNK KPP+IITR+SAN LR H++E++ GCDV DSVAA+A++RQRG+CVLSG+G V
Sbjct  81   RPAGSKNKAKPPVIITRESANTLRAHILEVSGGCDVFDSVAAYARKRQRGICVLSGSGTV  140

Query  683  TNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvg  862
            TNVTLRQPA+ GAVVTLHGRFEILSL+GSFLPPPAPP AT LT++LAGGQGQVVGG+VVG
Sbjct  141  TNVTLRQPAAAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTVFLAGGQGQVVGGNVVG  200

Query  863  allaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQ  970
            AL+A+GPV+++A+SF+N AYERLPL+E++   PP Q
Sbjct  201  ALIASGPVIVIASSFTNVAYERLPLDEEE---PPLQ  233



>ref|XP_006436718.1| hypothetical protein CICLE_v10032253mg [Citrus clementina]
 ref|XP_006485575.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR49958.1| hypothetical protein CICLE_v10032253mg [Citrus clementina]
 gb|KDO40054.1| hypothetical protein CISIN_1g022380mg [Citrus sinensis]
Length=298

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 155/183 (85%), Gaps = 5/183 (3%)
 Frame = +2

Query  416  QQDDGND---GGESKNGLGGAG-EGEI-SRRPRGRPAGSKNKPKPPIIITRDSANALRTH  580
            Q  DG+D   G +  N  G +G  G+I +RRPRGRP GSKNKPKPP+IITR+SAN LR H
Sbjct  52   QFSDGSDHHQGLDLVNAAGNSGGHGDIVARRPRGRPPGSKNKPKPPVIITRESANTLRAH  111

Query  581  LMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSL  760
            ++E+ +GCDV D VA +A+RRQRG+C+LSG+G VTNV++RQPA+ GA+VTLHGRFEILSL
Sbjct  112  ILEVGNGCDVFDCVANYARRRQRGICILSGSGTVTNVSIRQPAAAGAIVTLHGRFEILSL  171

Query  761  AGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLE  940
            +GSFLPPPAPP AT LTI+LAGGQGQVVGGSVVG L AAGPV+++AASF+N AYERLPL+
Sbjct  172  SGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLD  231

Query  941  EDD  949
            ED+
Sbjct  232  EDE  234



>ref|XP_002312579.2| hypothetical protein POPTR_0008s16440g, partial [Populus trichocarpa]
 gb|EEE89946.2| hypothetical protein POPTR_0008s16440g, partial [Populus trichocarpa]
Length=291

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 168/226 (74%), Gaps = 21/226 (9%)
 Frame = +2

Query  485   SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVL  664
             +RRPRGRP GSKNKPKPPI +TRDS NALR+H+MEIA G DV +SVA FA+RRQRGVCVL
Sbjct  70    NRRPRGRPPGSKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVL  129

Query  665   SGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvv  844
             SG+G V NVTLRQPA+PGAVV LHGRFEILSL G+FLP PAPP +TGLT+YLAGGQGQVV
Sbjct  130   SGSGSVANVTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVV  189

Query  845   ggsvvgallaagpvvIMAASFSNAAYERLPLEEDD--------------GNAPPFQgggm  982
             GGSVVG+L+AAGPV+++AA+F+NA YERLPLE+DD               N+PP     +
Sbjct  190   GGSVVGSLVAAGPVMVIAATFANATYERLPLEDDDEAGSGGQGQIQSGANNSPP----AI  245

Query  983   dspgaaggqllaeqgMFQGVPPNLI--NSIQLPNDAY-WGGSRPPF  1111
              S G   G           +PPNLI   + QL +DAY W  +RPP+
Sbjct  246   GSSGQQAGLPDPSAMPIYNLPPNLIPNGAHQLGHDAYAWAHARPPY  291



>ref|XP_006420137.1| hypothetical protein CICLE_v10005603mg [Citrus clementina]
 gb|ESR33377.1| hypothetical protein CICLE_v10005603mg [Citrus clementina]
Length=276

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 178/271 (66%), Gaps = 32/271 (12%)
 Frame = +2

Query  356   HPQQFHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKP  535
             H    HE S        + N+++D +   E + G    G    +RRPRGRP GSKNKPKP
Sbjct  18    HQHHHHELSIN------DTNEEEDRDTADEPREGAVEVG----TRRPRGRPPGSKNKPKP  67

Query  536   PIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASP  715
             PI +TRDS N+LR+H+ME+A G DV +SVA FA+RRQRGVCVLSG+G V NVTLRQPA+P
Sbjct  68    PIFVTRDSPNSLRSHVMEVAGGADVAESVALFARRRQRGVCVLSGSGSVANVTLRQPAAP  127

Query  716   GAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIM  895
             GAVV LHGRFEILSL G+FLP P+PP +TGLT+YLAGGQGQVVGGSVVG L+AAGPV+++
Sbjct  128   GAVVALHGRFEILSLTGAFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGQLVAAGPVMVI  187

Query  896   AASFSNAAYERLPLEEDD------------------GNAPPFQgggmdspgaaggqllae  1021
             AA+F+NA YERLPLE+D+                   N+PP       S   +   L   
Sbjct  188   AATFANATYERLPLEDDEEVTGTQGQIQSTGAAANNNNSPP---QIGSSGQPSSAGLPDP  244

Query  1022  qgMFQGVPPNLI-NSIQLPNDAYWGGSRPPF  1111
               +   +PPNLI N  QL     W  +RPP+
Sbjct  245   SSLTYNLPPNLIPNGGQLHEAYAWAHARPPY  275



>emb|CDX74739.1| BnaA05g04850D [Brassica napus]
Length=310

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 178/235 (76%), Gaps = 25/235 (11%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             + +I+RRPRGRPAGSKNKPKPPII+TRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  79    DNQITRRPRGRPAGSKNKPKPPIIVTRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  138

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             VCVLSGNG VTNVT+RQPA+ PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  139   VCVLSGNGAVTNVTIRQPATVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  198

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEED-----------------D  949
             AGGQGQVVGGSVVG L+A+GPVVIMAASF NAAYERLPLEE+                 D
Sbjct  199   AGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEEDQEEQQTSGAVVNNNNID  258

Query  950   GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLI-NSIQLPNDAYWGGSRPPF  1111
             GN      GG          +       QG+ PNL+ +S+QLP +AYWG  RP F
Sbjct  259   GNG---TMGGGTQTQQQQQLMQDPTSFIQGLQPNLMSSSVQLPGEAYWGTPRPSF  310



>gb|KDP22981.1| hypothetical protein JCGZ_01738 [Jatropha curcas]
Length=301

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 152/185 (82%), Gaps = 3/185 (2%)
 Frame = +2

Query  404  EEVNQQDDGNDGGESKNGLGG--AGEGEI-SRRPRGRPAGSKNKPKPPIIITRDSANALR  574
            ++  Q +DG   G    G+     G G+I +RRPRGRP GSKNKPKPP+IITR+SAN LR
Sbjct  52   DQHQQHEDGTHQGLDLVGIAANSGGPGDIVARRPRGRPPGSKNKPKPPVIITRESANTLR  111

Query  575  THLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEIL  754
             H++E+  GCDV + VA +A+RRQRG+C+LSG G VTNV++RQPA+ GA+VTLHGRFEIL
Sbjct  112  AHILEVGSGCDVFECVANYARRRQRGICILSGAGTVTNVSIRQPAAAGAIVTLHGRFEIL  171

Query  755  SLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLP  934
            SL+GSFLPPPAPP AT LTI+LAGGQGQVVGGSVVG L AAGPV+++AASF+N AYERLP
Sbjct  172  SLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLP  231

Query  935  LEEDD  949
            LEED+
Sbjct  232  LEEDE  236



>ref|XP_006601994.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=302

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 174/246 (71%), Gaps = 11/246 (4%)
 Frame = +2

Query  404   EEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHL  583
             EE   +D+G D  ++     G+  G   RRPRGRPAGSKNKPKPPI+IT++S NALR+H+
Sbjct  54    EEEVSRDNGEDQNQNLGSHEGSEPGSSGRRPRGRPAGSKNKPKPPIVITKESPNALRSHV  113

Query  584   MEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLA  763
             +EIA G DV +S+AAFA RR RGV VLSG+GIV NVTLRQPA+P  V+TLHGRFEILSL+
Sbjct  114   LEIASGSDVAESIAAFANRRHRGVSVLSGSGIVANVTLRQPAAPAGVITLHGRFEILSLS  173

Query  764   GSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEE  943
             G+FLP P+P  ATGLT+YLAGGQGQVVGG+V G+L+A+GPV+++AA+F+NA YERLPLE+
Sbjct  174   GAFLPSPSPSGATGLTVYLAGGQGQVVGGNVAGSLVASGPVMVIAATFANATYERLPLED  233

Query  944   DDGNAPPFQgggmdspgaaggqllaeqgMFQG---------VPPNLINSIQ-LPNDAYWG  1093
             D G                  Q   +Q    G         +PPNL+++ Q +P+D +WG
Sbjct  234   DQGEEEMQVQQQQQQQQQQQQQQQQQQSQGLGEQVSMPMYNLPPNLLHNGQNMPHDVFWG  293

Query  1094  G-SRPP  1108
                RPP
Sbjct  294   APPRPP  299



>ref|XP_010024974.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=282

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVL  664
            SRRPRGRP GSKNKPKPPI +TRDS NALR+H+MEIA+G D+ +SVA FA+RRQRGVCVL
Sbjct  63   SRRPRGRPPGSKNKPKPPIFVTRDSPNALRSHVMEIANGADIAESVAQFARRRQRGVCVL  122

Query  665  SGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvv  844
            SG+G VTNVTLRQP +PGAV+ LHGRFEILSL G+FLP PAPP +TGLTIYLAGGQGQVV
Sbjct  123  SGSGTVTNVTLRQPTAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVV  182

Query  845  ggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            GGSVVG+L+A+GPV+++AA+FSNA YERLPLEED+
Sbjct  183  GGSVVGSLVASGPVMVIAATFSNATYERLPLEEDE  217



>ref|XP_009143141.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=308

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 178/236 (75%), Gaps = 26/236 (11%)
 Frame = +2

Query  473   EGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRG  652
             + +I+RRPRGRPAGSKNKPKPPII+TRDSANAL++H+ME+A+GCDVM+SV  FA+RRQRG
Sbjct  76    DNQITRRPRGRPAGSKNKPKPPIIVTRDSANALKSHVMEVANGCDVMESVTVFARRRQRG  135

Query  653   VCVLSGNGIVTNVTLRQPAS-PG---AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYl  820
             VCVLSGNG VTNVT+RQPA+ PG   +VV LHGRFEILSL+GSFLPPPAPP+A+GLTIYL
Sbjct  136   VCVLSGNGAVTNVTIRQPATVPGGGSSVVNLHGRFEILSLSGSFLPPPAPPAASGLTIYL  195

Query  821   aggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEED------------------  946
             AGGQGQVVGGSVVG L+A+GPV+IMAASF NAAYERLPLEE+                  
Sbjct  196   AGGQGQVVGGSVVGPLMASGPVMIMAASFGNAAYERLPLEEEDQEEQQTSGAVVNNNNNI  255

Query  947   DGNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLI-NSIQLPNDAYWGGSRPPF  1111
             DGN      GG          +       QG+ PNL+ +S+QLP +AYWG  RP F
Sbjct  256   DGNG---TMGGGTQTQQQQQLMQDPTSFIQGLQPNLMSSSVQLPGEAYWGTPRPSF  308



>gb|EYU41285.1| hypothetical protein MIMGU_mgv1a025243mg [Erythranthe guttata]
Length=293

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 157/213 (74%), Gaps = 7/213 (3%)
 Frame = +2

Query  332  HTSRDFNFHPQ-------QFHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEISR  490
            H  R  + H Q       Q H          E+ +Q  +      +    GG G+    R
Sbjct  18   HHHRPSDLHLQIPRDSDDQSHRHHFSGDNADEDSHQALESLQVNSTNTSSGGTGDLAGGR  77

Query  491  RPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSG  670
            RPRGRPAGSKNKPKPP+IITR+SAN LR H++E+  GCDV ++VA +A+RRQRGVC+LSG
Sbjct  78   RPRGRPAGSKNKPKPPVIITRESANTLRAHILEVGSGCDVFEAVATYARRRQRGVCILSG  137

Query  671  NGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvgg  850
             G V NV+LRQPA+ G+V TLHGRFEILSL+GSFLPPPAPP AT LTIYLAGGQGQVVGG
Sbjct  138  TGTVNNVSLRQPAAAGSVATLHGRFEILSLSGSFLPPPAPPGATSLTIYLAGGQGQVVGG  197

Query  851  svvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            +VVGAL+A+GPV+I+AASF+N AYERLPL+E++
Sbjct  198  NVVGALIASGPVIIVAASFTNVAYERLPLDEEE  230



>ref|XP_011029905.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Populus 
euphratica]
Length=292

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 168/226 (74%), Gaps = 21/226 (9%)
 Frame = +2

Query  485   SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVL  664
             +RRPRGRP GSKNKPKPPI +TRDS NALR+H+MEIA G DV +SVA FA+RRQRGVCVL
Sbjct  71    NRRPRGRPPGSKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVL  130

Query  665   SGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvv  844
             SG+G V NVTLRQPA+PGAVV LHGRFEILSL G+FLP PAPP +TGLT+YLAGGQGQVV
Sbjct  131   SGSGSVANVTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVV  190

Query  845   ggsvvgallaagpvvIMAASFSNAAYERLPLEEDD--------------GNAPPFQgggm  982
             GGSVVG+L+AAGPV+++AA+F+NA YERLPLE+D+               N+PP     +
Sbjct  191   GGSVVGSLVAAGPVMVIAATFANATYERLPLEDDEEAGSGGQGQIQSGANNSPP----AI  246

Query  983   dspgaaggqllaeqgMFQGVPPNLI--NSIQLPNDAY-WGGSRPPF  1111
              S G   G           +PPNLI   + QL +DAY W  +RPP+
Sbjct  247   GSSGQQAGLPDPSAMPIYNLPPNLIPNGAHQLGHDAYAWAHARPPY  292



>ref|XP_009794976.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=267

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 149/197 (76%), Gaps = 15/197 (8%)
 Frame = +2

Query  404  EEVNQQDDGNDGGESKNGLGGAG---------------EGEISRRPRGRPAGSKNKPKPP  538
            E +NQ  + +  G  K G+ G G               E +  RRPRGRPAGSKNKPKPP
Sbjct  16   ETINQNQEVDKIGTHKPGIDGNGLMVTANLPKVTVPVRERDSIRRPRGRPAGSKNKPKPP  75

Query  539  IIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPG  718
            IIITRDSANALR H ME+  GCDV +S+  FA+R+QRG+CVLS  G VTNVTLRQPA+ G
Sbjct  76   IIITRDSANALRAHAMEVNSGCDVNESLVNFARRKQRGICVLSATGCVTNVTLRQPATSG  135

Query  719  AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMA  898
            ++VTLHGRFEILS+ GS LPPPAPP  TGLTIYLAG QGQV+GG VVGAL+A+GPVVIMA
Sbjct  136  SIVTLHGRFEILSMLGSVLPPPAPPGVTGLTIYLAGAQGQVIGGGVVGALVASGPVVIMA  195

Query  899  ASFSNAAYERLPLEEDD  949
            A+F NA ++RLPL++D+
Sbjct  196  ATFMNATFDRLPLDDDE  212



>ref|XP_002307550.2| hypothetical protein POPTR_0005s22440g [Populus trichocarpa]
 gb|EEE94546.2| hypothetical protein POPTR_0005s22440g [Populus trichocarpa]
Length=256

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  458  LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
            +  A  GE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+A FA+
Sbjct  41   ISSARGGETLRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVCESLANFAR  100

Query  638  RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
            R+QRG+ VLSG+G VTNVTLRQPAS GA+VTLHGRFEILSL GS LPPPAP   TGLTIY
Sbjct  101  RKQRGISVLSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLLGSVLPPPAPQGITGLTIY  160

Query  818  laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEED  946
            LAG QGQVVGG VVGAL+A+GPVVIMAASF NA+++RLPL+ED
Sbjct  161  LAGAQGQVVGGVVVGALIASGPVVIMAASFMNASFDRLPLDED  203



>ref|XP_007035040.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
 gb|EOY05966.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
Length=273

 Score =   207 bits (526),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 144/250 (58%), Positives = 178/250 (71%), Gaps = 25/250 (10%)
 Frame = +2

Query  413   NQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEI  592
             ++ +D + G E K G    G    +RRPRGRP GSKNKPKPPI +TRDS NALR+H+ME+
Sbjct  32    DEDEDRDTGDEPKEGAVEVG----TRRPRGRPPGSKNKPKPPIFVTRDSPNALRSHVMEV  87

Query  593   ADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSF  772
             A G DV +S+A FA+RRQRGVCVLSG+G V NVTLRQPA+PGAVV LHGRFEILSL G+F
Sbjct  88    ASGTDVAESIAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLTGAF  147

Query  773   LPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD-  949
             LP PAPP +TGLT+YLAGGQGQVVGGSVVG+L+AAGPV+++AA+F+NA YERLP+E+D+ 
Sbjct  148   LPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPIEDDEE  207

Query  950   --------------GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLI-NSIQLPNDA  1084
                           GN+PP     + S G   G           +PPNL+ N  QL ++A
Sbjct  208   AGSGGHGGQIQGGAGNSPP----AIGSSGPQTGLPDPSSLPIYNLPPNLLANGGQLGHEA  263

Query  1085  Y-WGGSRPPF  1111
             Y W   RPP+
Sbjct  264   YAWAHGRPPY  273



>ref|XP_011044786.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
 ref|XP_011044787.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
 ref|XP_011044788.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
 ref|XP_011044789.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=254

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  458  LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
            +  A  GE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+A FA+
Sbjct  39   ISSARGGETIRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVCESLANFAR  98

Query  638  RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
            R+QRG+ VLSG+G VTNVTLRQPAS GA+VTLHGRFEILSL GS LPPPAP   TGLTIY
Sbjct  99   RKQRGISVLSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLLGSVLPPPAPQGITGLTIY  158

Query  818  laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEED  946
            LAG QGQVVGG VVGAL+A+GPVVIMAASF NA+++RLPL+ED
Sbjct  159  LAGAQGQVVGGGVVGALIASGPVVIMAASFMNASFDRLPLDED  201



>ref|XP_006289235.1| hypothetical protein CARUB_v10002691mg [Capsella rubella]
 gb|EOA22133.1| hypothetical protein CARUB_v10002691mg [Capsella rubella]
Length=340

 Score =   209 bits (531),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 151/230 (66%), Positives = 175/230 (76%), Gaps = 19/230 (8%)
 Frame = +2

Query  479   EISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVC  658
             +++RRPRGRPAGSKNKPK PIIITRDSANALRTH+MEI DGCD++D +A FA+RRQRGVC
Sbjct  111   QMTRRPRGRPAGSKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVC  170

Query  659   VLSGNGIVTNVTLRQPASP-GAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqg  835
             V+SG G V NVT+RQP SP G+VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQG
Sbjct  171   VMSGTGNVNNVTIRQPGSPAGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQG  230

Query  836   qvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAP-------------PFQgg  976
             QVVGGSVVG LL +GPVV+MAASFSNAAYERLPLEED+   P                GG
Sbjct  231   QVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVQGGGGGGGGGGGGGSGG  290

Query  977   gmdspgaaggqllaeqgMFQGVPPNLINSIQLP----ND-AYWGGSRPPF  1111
                 P     Q +A     QG+PPNL+ S+QLP    ND  YW   RPP+
Sbjct  291   MGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQLPPQQQNDQQYWSTGRPPY  340



>ref|XP_006396802.1| hypothetical protein EUTSA_v10029174mg [Eutrema salsugineum]
 gb|ESQ38255.1| hypothetical protein EUTSA_v10029174mg [Eutrema salsugineum]
Length=342

 Score =   209 bits (531),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 173/333 (52%), Positives = 205/333 (62%), Gaps = 67/333 (20%)
 Frame = +2

Query  311   SQLPPPFHTSRDFNF------------------------HPQQFHEQSG--------QKQ  394
             S LPPPFH +RDF                          +P Q HEQ G        +  
Sbjct  11    SALPPPFH-ARDFQLHLQQQQQQQQQQQQFFLHHHQQQRNPDQDHEQQGGGSMNRSIKMD  69

Query  395   RDPEEVNQQDDGNDGGESKNGLG-----------GAGEGEISRRPRGRPAGSKNKPKPPI  541
             R+    N ++  N+ G     +            G    +++RRPRGRPAGSKNKPK PI
Sbjct  70    REETSDNMENIANNSGSEGKEMSLHGGGGGGSGGGGSGEQMTRRPRGRPAGSKNKPKAPI  129

Query  542   IITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPAS-PG  718
             IITRDSANALRTH+MEI DGCD++D +A FA+RRQRGVCV+SG G VTNVT+RQP S PG
Sbjct  130   IITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVTIRQPGSPPG  189

Query  719   AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMA  898
             +VV+LHGRFEILSL+GSFLPPPAPP+ATGL++YLAGGQGQVVGGSVVG LL +GPVV+MA
Sbjct  190   SVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMA  249

Query  899   ASFSNAAYERLPLEEDDGNAPPF-----------------Qgggmdspgaaggqllaeqg  1027
             ASFSNAAYERLPLEED+   P                    GG    P     Q +A   
Sbjct  250   ASFSNAAYERLPLEEDEMQTPVHGGGGGGGGGSGGGGGGGGGGMGSPPMMGQQQAMAAMA  309

Query  1028  MFQGVPPNLINSIQLP----NDA-YWGGSRPPF  1111
               QG+PPNL+ S+QLP    ND  YW   RPP+
Sbjct  310   AAQGLPPNLLGSVQLPPQQQNDQPYWSTGRPPY  342



>ref|XP_002314642.2| hypothetical protein POPTR_0010s08500g [Populus trichocarpa]
 gb|EEF00813.2| hypothetical protein POPTR_0010s08500g [Populus trichocarpa]
Length=289

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 167/222 (75%), Gaps = 12/222 (5%)
 Frame = +2

Query  467   AGEGEI---SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
             A EG +   +RRPRGRP GSKNKPKPPI +TRDS NALR+H+MEIA G DV +SVA FA+
Sbjct  73    AKEGAVEVGNRRPRGRPPGSKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFAR  132

Query  638   RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
             RRQRGVCVLSG+G V NVTLRQPA+PGAVV LHGRFEILSL G+FLP PAPP +TGLT+Y
Sbjct  133   RRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVY  192

Query  818   laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspga  997
             LAGGQGQVVGGSVVG+L+AAGPV+++AA+F+NA YERLPLE+D+         G      
Sbjct  193   LAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPLEDDEEAG-----SGAIGSSG  247

Query  998   aggqllaeqgMFQGVPPNLINS--IQLPNDAY-WG-GSRPPF  1111
                 L     M   +PPNL+ S   QL +DAY W   +RPP+
Sbjct  248   QQAGLPDPSSMPVYLPPNLMQSGAQQLGHDAYAWAHAARPPY  289



>ref|XP_007218339.1| hypothetical protein PRUPE_ppa008610mg [Prunus persica]
 gb|EMJ19538.1| hypothetical protein PRUPE_ppa008610mg [Prunus persica]
Length=325

 Score =   208 bits (529),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 174/256 (68%), Gaps = 20/256 (8%)
 Frame = +2

Query  371   HEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIIT  550
             H + G+   D E  NQ  D N G  S + L     G  +RRPRGRP GSKNKPKPPIIIT
Sbjct  64    HHEDGRDNNDLEADNQ--DPNTGSGSHDSLE---PGSSNRRPRGRPPGSKNKPKPPIIIT  118

Query  551   RDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVT  730
             ++S NALR+H++EI+ G D++DS+A FAQRR RGV VLSG+GIV NVTLR PA+P  V+T
Sbjct  119   KESPNALRSHVLEISSGSDIVDSIATFAQRRHRGVSVLSGSGIVANVTLRHPAAPSGVIT  178

Query  731   LHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFS  910
             LHGRFEILSL+G+FLP P+PP ATGLT+YLAGGQGQVVGG+V+GAL+A+GPV+++AA+F+
Sbjct  179   LHGRFEILSLSGAFLPSPSPPGATGLTVYLAGGQGQVVGGTVMGALVASGPVMVVAATFT  238

Query  911   NAAYERLPLEED---DGNAPPFQgggmdspgaaggqllaeqgMFQG------------VP  1045
             NA YERLPLE++   +G     Q                     QG            +P
Sbjct  239   NATYERLPLEDEQAGEGGMQVQQQQQQQQQSGVNSAGTGGNSGSQGLVEHTSSMAIYNLP  298

Query  1046  PNLINSIQLPNDAYWG  1093
             PNL+ + Q+P D +WG
Sbjct  299   PNLLPNGQMPPDVFWG  314



>ref|XP_007156666.1| hypothetical protein PHAVU_002G006900g [Phaseolus vulgaris]
 gb|ESW28660.1| hypothetical protein PHAVU_002G006900g [Phaseolus vulgaris]
Length=272

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 154/199 (77%), Gaps = 12/199 (6%)
 Frame = +2

Query  344  DFNFHPQQFHE-QSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSK  520
            DFN H     E +   KQ DP      +DG   G S   +GG       RRPRGRP GSK
Sbjct  22   DFNHHHHHQQESEEDAKQSDPFST---EDGAQQG-SPGDVGG-------RRPRGRPQGSK  70

Query  521  NKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLR  700
            NKPKPP+IITR+SAN LR H++E+  GCDV DSVA++A+RRQRG+C+LSG+G VTNV+LR
Sbjct  71   NKPKPPVIITRESANTLRAHILEVGSGCDVFDSVASYARRRQRGICILSGSGTVTNVSLR  130

Query  701  QPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaag  880
            QPA+ GAVVTLHGRFEILSL GSFLPPPAPP AT L++YLAGGQGQVVGGSVVG L AAG
Sbjct  131  QPAASGAVVTLHGRFEILSLTGSFLPPPAPPGATSLSVYLAGGQGQVVGGSVVGELTAAG  190

Query  881  pvvIMAASFSNAAYERLPL  937
            PV++MAASF+N AYERLPL
Sbjct  191  PVIVMAASFTNVAYERLPL  209



>ref|XP_009377073.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=293

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  482  ISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCV  661
            + RRPRGRP GSKNKPKPP+IITR+SAN LR H++E+ +GCDV D VA +A+RRQRG+C+
Sbjct  69   VVRRPRGRPPGSKNKPKPPVIITRESANTLRAHILEVGNGCDVFDCVATYARRRQRGICI  128

Query  662  LSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqv  841
            LSG+G VTNVTLRQPA+ GAVVTLHGRFEILSL+GSFLPPPAPP AT LTI+LAGGQGQV
Sbjct  129  LSGSGTVTNVTLRQPAAVGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQV  188

Query  842  vggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            VGGSVVG L A GPV+++A+SF+N AYERLPL+E++
Sbjct  189  VGGSVVGELTAVGPVIVIASSFTNVAYERLPLDEEE  224



>ref|XP_009347388.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=293

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  482  ISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCV  661
            + RRPRGRP GSKNKPKPP+IITR+SAN LR H++E+ +GCDV D VA +A+RRQRG+C+
Sbjct  69   VVRRPRGRPPGSKNKPKPPVIITRESANTLRAHILEVGNGCDVFDCVATYARRRQRGICI  128

Query  662  LSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqv  841
            LSG+G VTNVTLRQPA+ GAVVTLHGRFEILSL+GSFLPPPAPP AT LTI+LAGGQGQV
Sbjct  129  LSGSGTVTNVTLRQPAAVGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQV  188

Query  842  vggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            VGGSVVG L AAGPV+++A+SF+N AYERLPL+E++
Sbjct  189  VGGSVVGELTAAGPVIVIASSFTNVAYERLPLDEEE  224



>ref|XP_004296621.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=277

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 165/227 (73%), Gaps = 18/227 (8%)
 Frame = +2

Query  485   SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVL  664
             SRRPRGRP GSKNKPKPPI +TRDS N+LR+H+ME+A G DV +SVA FA+RRQRGVCVL
Sbjct  51    SRRPRGRPPGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVL  110

Query  665   SGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvv  844
             SG+G V NVTLRQPA+PGAVV LHGRFEILSL+G+FLP PAPP +TGLT+YLAGGQGQVV
Sbjct  111   SGSGSVANVTLRQPAAPGAVVALHGRFEILSLSGAFLPGPAPPGSTGLTVYLAGGQGQVV  170

Query  845   ggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeq  1024
             GGSVVG+L+AAGPV+++AA+F+NA YERLPLEEDD  A    G G       G       
Sbjct  171   GGSVVGSLVAAGPVMVVAATFANATYERLPLEEDDEAASVGGGHGASGSSPTGVGSSGGP  230

Query  1025  gM----------------FQGVPPNLI-NSIQLPNDAY-WGGSRPPF  1111
              +                  G+PPNLI N   L +DAY W  SR P+
Sbjct  231   QVLPPGHGGQLPDPSSLPLYGLPPNLIPNGGPLGHDAYPWPHSRAPY  277



>ref|XP_006477506.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 ref|XP_006489611.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
Length=350

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 177/271 (65%), Gaps = 32/271 (12%)
 Frame = +2

Query  356   HPQQFHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKP  535
             H    HE S        + N+++D +   E + G    G    +RRPRGRP GSKNKPKP
Sbjct  92    HQHHHHELS------INDTNEEEDRDTADEPREGAVEVG----TRRPRGRPPGSKNKPKP  141

Query  536   PIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASP  715
             PI +TRDS N+LR+H+ME+A G DV +SVA FA+RRQRGVCVLSG+G V NVTLRQPA+P
Sbjct  142   PIFVTRDSPNSLRSHVMEVAGGADVAESVALFARRRQRGVCVLSGSGSVANVTLRQPAAP  201

Query  716   GAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIM  895
             GAVV LHGRFEILSL G+FLP P+PP +TGLT+YLAGGQGQVVGGSVVG L+AAGPV+++
Sbjct  202   GAVVALHGRFEILSLTGAFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGQLVAAGPVMVI  261

Query  896   AASFSNAAYERLPLEEDD------------------GNAPPFQgggmdspgaaggqllae  1021
             AA+F+NA YERLPLE+D+                   N+PP       S       L   
Sbjct  262   AATFANATYERLPLEDDEEVTGTQGQIQSTGAATNNNNSPP---QIGSSGQPPSAGLPDP  318

Query  1022  qgMFQGVPPNLI-NSIQLPNDAYWGGSRPPF  1111
               +   +PPNLI N  QL     W  +RPP+
Sbjct  319   SSLTYNLPPNLIPNGGQLHEAYAWAHARPPY  349



>ref|XP_008238264.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=283

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  458  LGGAGEGE---ISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAA  628
            LGG   G    ++RRPRGRP GSKNKPKPP+IITR+SAN LR H++E+ +GCDV D VA 
Sbjct  55   LGGINPGSGDIVARRPRGRPPGSKNKPKPPVIITRESANTLRAHILEVGNGCDVFDCVAT  114

Query  629  FAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGL  808
            +A+RRQRG+C+LSG+G VTNV+LRQPA+ G+VVTLHGRFEILSL+GSFLPPPAPP AT L
Sbjct  115  YARRRQRGICILSGSGTVTNVSLRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSL  174

Query  809  TIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            TI+LAG QGQVVGGSVVG L AAGPV+++A+SF+N AYERLPL+E++
Sbjct  175  TIFLAGVQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLDEEE  221



>ref|XP_007210169.1| hypothetical protein PRUPE_ppa019786mg [Prunus persica]
 gb|EMJ11368.1| hypothetical protein PRUPE_ppa019786mg [Prunus persica]
Length=283

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  458  LGGAGEGE---ISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAA  628
            LGG   G    ++RRPRGRP GSKNKPKPP+IITR+SAN LR H++E+ +GCDV D VA 
Sbjct  55   LGGINPGSGDIVARRPRGRPPGSKNKPKPPVIITRESANTLRAHILEVGNGCDVFDCVAT  114

Query  629  FAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGL  808
            +A+RRQRG+C+LSG+G VTNV+LRQPA+ G+VVTLHGRFEILSL+GSFLPPPAPP AT L
Sbjct  115  YARRRQRGICILSGSGTVTNVSLRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSL  174

Query  809  TIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            TI+LAG QGQVVGGSVVG L AAGPV+++A+SF+N AYERLPL+E++
Sbjct  175  TIFLAGVQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLDEEE  221



>ref|XP_008799381.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=296

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 161/217 (74%), Gaps = 3/217 (1%)
 Frame = +2

Query  323  PPFHTSRDFNFHPQQFHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEI-SRRPR  499
            P  H   D +       + +G              G +  +   G   AG G++ +RRPR
Sbjct  15   PLLHRRPDLHLQRSDADDSAGVGDESSAAAAAASAGLELMDPPGGSSAAGPGDVVARRPR  74

Query  500  GRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGI  679
            GRP GSKNKPKPP+IITR+SAN L+ H++E+  GCDV D VA +A+RRQRGVC+LSG+G 
Sbjct  75   GRPPGSKNKPKPPVIITRESANTLQAHILEVGSGCDVFDCVATYARRRQRGVCILSGSGS  134

Query  680  VTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvv  859
            VTNV+LRQPAS G+VVTLHGRFEILSL+GSFLPPPAPP AT LTI+LAGGQGQVVGGSVV
Sbjct  135  VTNVSLRQPASAGSVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVV  194

Query  860  gallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQ  970
            GAL+AAGPV+++AASF+N AYERLPLE+++   PP Q
Sbjct  195  GALIAAGPVIVIAASFTNVAYERLPLEDEE--PPPLQ  229



>ref|XP_007226723.1| hypothetical protein PRUPE_ppa019745mg [Prunus persica]
 gb|EMJ27922.1| hypothetical protein PRUPE_ppa019745mg [Prunus persica]
Length=285

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 156/192 (81%), Gaps = 5/192 (3%)
 Frame = +2

Query  389  KQRDPE-EVNQQDDG-NDGGESKNGLGGAGEGEI---SRRPRGRPAGSKNKPKPPIIITR  553
            KQR+ E  +N+ + G + GG+         EG +   SRRPRGRP GSKNKPKPPI +TR
Sbjct  13   KQRELEISINENNSGRSSGGDEDRDQDEPKEGAVEIGSRRPRGRPPGSKNKPKPPIFVTR  72

Query  554  DSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTL  733
            DS N+LR+H+ME+A G DV +SVA FA+RRQRGVCVLSG+G V NVTLRQPA+PGAVV L
Sbjct  73   DSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVAL  132

Query  734  HGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSN  913
             GRFEILSL+G+FLP PAPP +TGLT+YLA G GQVVGGSVVG+L+AAGPV+++AA+F+N
Sbjct  133  QGRFEILSLSGAFLPGPAPPGSTGLTVYLAAGNGQVVGGSVVGSLVAAGPVMVVAATFAN  192

Query  914  AAYERLPLEEDD  949
            A YERLPLEED+
Sbjct  193  ATYERLPLEEDE  204



>ref|XP_007144108.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
 gb|ESW16102.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
Length=310

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 150/183 (82%), Gaps = 3/183 (2%)
 Frame = +2

Query  410  VNQQDDGNDGGESKNGLGGAGEGEI---SRRPRGRPAGSKNKPKPPIIITRDSANALRTH  580
            +N+   G+D  E ++      EG +   +RRPRGRP GSKNKPKPPI +TRDS NALR+H
Sbjct  62   INESSGGHDIEEDEDNRDEPKEGAVEVGTRRPRGRPPGSKNKPKPPIFVTRDSPNALRSH  121

Query  581  LMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSL  760
            +MEI  G DV +SVA FA+RRQRGVCVLSG+G V NVTLRQPA+PGAVV LHGRFEILSL
Sbjct  122  VMEITGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSL  181

Query  761  AGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLE  940
             G+FLP PAPP +TGLT+YLAGGQGQV+GGSVVG L+A GPV+++AA+F+NA YERLPL+
Sbjct  182  TGTFLPGPAPPGSTGLTVYLAGGQGQVLGGSVVGPLVATGPVMVIAATFANATYERLPLD  241

Query  941  EDD  949
            EDD
Sbjct  242  EDD  244



>ref|XP_008224392.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=285

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 156/192 (81%), Gaps = 5/192 (3%)
 Frame = +2

Query  389  KQRDPE-EVNQQDDG-NDGGESKNGLGGAGEGEI---SRRPRGRPAGSKNKPKPPIIITR  553
            KQR+ E  +N+ + G + GG+         EG +   SRRPRGRP GSKNKPKPPI +TR
Sbjct  13   KQRELEISINENNSGRSSGGDEDRDQDEPKEGAVEIGSRRPRGRPPGSKNKPKPPIFVTR  72

Query  554  DSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTL  733
            DS N+LR+H+ME+A G DV +SVA FA+RRQRGVCVLSG+G V NVTLRQPA+PGAVV L
Sbjct  73   DSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVAL  132

Query  734  HGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSN  913
             GRFEILSL+G+FLP PAPP +TGLT+YLA G GQVVGGSVVG+L+AAGPV+++AA+F+N
Sbjct  133  QGRFEILSLSGAFLPGPAPPGSTGLTVYLAAGNGQVVGGSVVGSLVAAGPVMVVAATFAN  192

Query  914  AAYERLPLEEDD  949
            A YERLPLEED+
Sbjct  193  ATYERLPLEEDE  204



>ref|XP_004974243.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Setaria italica]
 ref|XP_004974244.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Setaria italica]
 ref|XP_004974245.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X3 [Setaria italica]
 ref|XP_004974246.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X4 [Setaria italica]
Length=260

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 175/255 (69%), Gaps = 20/255 (8%)
 Frame = +2

Query  395   RDPEEVNQQDDGNDGGESKNGLGGAGEGEI---SRRPRGRPAGSKNKPKPPIIITRDSAN  565
             +D +   Q   G+D    +NG G   EG +   +RRPRGRP GSKNKPKPPI +TRDS N
Sbjct  7     KDGDATEQPTSGDD---RENGTGEPKEGAVVTGNRRPRGRPPGSKNKPKPPIFVTRDSPN  63

Query  566   ALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRF  745
             ALR+H+ME+A G DV +S+A FA+RRQRGVCVLSG G VT+V LRQPA+PGAVV L GRF
Sbjct  64    ALRSHVMEVAGGADVAESIAHFARRRQRGVCVLSGAGTVTDVALRQPAAPGAVVALRGRF  123

Query  746   EILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYE  925
             EILSL G+FLP PAPP +TGLT+YLAGGQGQVVGGSVVG L AAGPV+++A++F+NA YE
Sbjct  124   EILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLTAAGPVMVIASTFANATYE  183

Query  926   RLPLEEDDGN-----APPFQgggmdspgaaggqllaeqgMFQGVPPNLI--------NSI  1066
             RLPL+E +       A    G G   P   G    +   MF GVPPNL+          +
Sbjct  184   RLPLDEAEEESAGQAAQLPPGPGGGPPLMGGMADPSAMPMFGGVPPNLMPGGGGASGAGL  243

Query  1067  QLPNDAY-WGGSRPP  1108
             QL +D   W  +RPP
Sbjct  244   QLGHDGLAWAHARPP  258



>ref|XP_011026257.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=265

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  458  LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
            +  A EGE  RRPRGRPAGSKNKPKPPII+TRDSANALR H ME++ GCDV +S+A FA+
Sbjct  50   VSSAPEGETIRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVCESLANFAR  109

Query  638  RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
            R+QRG+ VLSG+G VTNVTLRQP S GA+VTLHGRFEILSL GS LPPPAP   TGLTIY
Sbjct  110  RKQRGISVLSGSGCVTNVTLRQPTSSGAIVTLHGRFEILSLLGSVLPPPAPQGITGLTIY  169

Query  818  laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNA  958
            LAG QGQVVGG VVGAL+A+GPVVIMAASF  A ++RLPL++D+  A
Sbjct  170  LAGAQGQVVGGGVVGALIASGPVVIMAASFMKATFDRLPLDDDEITA  216



>ref|XP_011030530.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Populus 
euphratica]
Length=289

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 170/236 (72%), Gaps = 26/236 (11%)
 Frame = +2

Query  467   AGEGEI---SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
             A EG +   +RRPRGRP GSKNKPKPPI +TRDS NALR+H+MEIA G DV +SVA FA+
Sbjct  59    AKEGAVEIGNRRPRGRPPGSKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFAR  118

Query  638   RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
             RRQRGVCVLSG+G V NVTLRQPA+PGAVV LHGRFEILSL G+FLP PAPP +TGLT+Y
Sbjct  119   RRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVY  178

Query  818   laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD--------------GN  955
             LAGGQGQVVGGSVVG+L+AAGPV+++AA+F+NA YERLPLE+D+               N
Sbjct  179   LAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPLEDDEEAGSGGQGHLQSGANN  238

Query  956   APPFQgggmdspgaaggqllaeqgMFQGVPPNLINS--IQLPNDAY-WG-GSRPPF  1111
             +PP               L     M   +PPNL+ S   QL ++AY W   +RPP+
Sbjct  239   SPP-----AIGSSGQQSGLPDPSSMPVYLPPNLMQSGAQQLGHEAYAWAHAARPPY  289



>gb|ABL63119.1| AT-hook DNA-binding protein, partial [Catharanthus roseus]
Length=256

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 153/182 (84%), Gaps = 4/182 (2%)
 Frame = +2

Query  404  EEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHL  583
            E+ ++  +   GGE K G    G    +RRPRGRP GSKNKPKPPI +TRDS NALR+H+
Sbjct  1    EDEDEDRENGSGGEPKEGAVEIG----TRRPRGRPPGSKNKPKPPIFVTRDSPNALRSHV  56

Query  584  MEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLA  763
            +E++ G DV +S+A FA++RQRGVCVLSG+G V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  57   LEVSGGSDVAESIAVFARKRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLS  116

Query  764  GSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEE  943
            G+FLP PAPP +TGLT+YLAGGQGQVVGGSVVG+L+AAGPV+I+AA+F+NA YERLPLE+
Sbjct  117  GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVAAGPVLIIAATFANATYERLPLED  176

Query  944  DD  949
            D+
Sbjct  177  DE  178



>ref|XP_009351431.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=310

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 135/248 (54%), Positives = 181/248 (73%), Gaps = 7/248 (3%)
 Frame = +2

Query  371   HEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGE-GEISRRPRGRPAGSKNKPKPPIII  547
             H+Q+ +   D  + N  +  + G  + +G   + E G  +RRPRGRP GSKNKPKPP++I
Sbjct  54    HKQNNKHHEDGRDNNDLEGDDQGPNTGSGSQDSLEPGSSNRRPRGRPPGSKNKPKPPVVI  113

Query  548   TRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVV  727
             T++S NALR+H++EI+ G D++DS+A F+QRR RGV VLSG+GIV NVTLRQPA+P  V+
Sbjct  114   TKESPNALRSHVLEISSGSDIVDSIATFSQRRHRGVSVLSGSGIVANVTLRQPAAPTGVI  173

Query  728   TLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASF  907
             TLHGRFEILSL+G+FLP P+PP ATGLT+YLAGGQGQVVGG+V+GAL+A+GPV+++AA+F
Sbjct  174   TLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGTVMGALVASGPVIVIAATF  233

Query  908   SNAAYERLPLEEDDGNA-----PPFQgggmdspgaaggqllaeqgMFQGVPPNLI-NSIQ  1069
             +NA YERLPLEE+ G       P  Q     + G+ G    A       +PPNL+ N  Q
Sbjct  234   TNATYERLPLEEEQGGEGGMQIPQEQQQSGVNSGSRGVGENASAMAVYNLPPNLLANGGQ  293

Query  1070  LPNDAYWG  1093
             +P+D +WG
Sbjct  294   IPHDVFWG  301



>ref|XP_009589802.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=284

 Score =   204 bits (519),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 148/197 (75%), Gaps = 15/197 (8%)
 Frame = +2

Query  404  EEVNQQDDGNDGGESKNGLGGAG---------------EGEISRRPRGRPAGSKNKPKPP  538
            E +NQ  + +  G  K  + G G               E +  RRPRGRPAGSKNKPKPP
Sbjct  33   ETINQNQELDKIGNHKPDIDGNGLMVTANLPKVTVPVRERDSIRRPRGRPAGSKNKPKPP  92

Query  539  IIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPG  718
            IIITRDSANALR H ME+  GCDV +S+  FA+R+QRG+CVLS  G VTNVTLRQPA+ G
Sbjct  93   IIITRDSANALRAHAMEVNSGCDVNESLVNFARRKQRGICVLSATGCVTNVTLRQPATSG  152

Query  719  AVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMA  898
            ++VTLHGRFEILS+ GS LPPPAPP  TGLTIYLAG QGQV+GG VVGAL+A+GPVVIMA
Sbjct  153  SIVTLHGRFEILSMLGSVLPPPAPPGVTGLTIYLAGAQGQVIGGGVVGALIASGPVVIMA  212

Query  899  ASFSNAAYERLPLEEDD  949
            A+F NA ++RLPL++D+
Sbjct  213  ATFMNATFDRLPLDDDE  229



>ref|XP_008788674.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=303

 Score =   205 bits (521),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 147/168 (88%), Gaps = 3/168 (2%)
 Frame = +2

Query  470  GEGEI-SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQ  646
            G G++ +RRPRGRP GSKNKPKPP+IITR+SAN LR H++E+  GCDV D +A +A+RRQ
Sbjct  68   GPGDVGARRPRGRPPGSKNKPKPPVIITRESANTLRAHILEVGSGCDVFDCLATYARRRQ  127

Query  647  RGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlag  826
            RGVC+LSG+G V NV+LRQPAS GAV+TLHGRFEILSL+GSFLPPPAPP AT LTI+LAG
Sbjct  128  RGVCILSGSGTVANVSLRQPASAGAVITLHGRFEILSLSGSFLPPPAPPGATSLTIFLAG  187

Query  827  gqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQ  970
            GQGQVVGG+VVGAL+A GPV+++AASF+N AYERLPLE+++   PP Q
Sbjct  188  GQGQVVGGNVVGALIATGPVIVIAASFTNVAYERLPLEDEE--PPPLQ  233



>ref|XP_007220428.1| hypothetical protein PRUPE_ppa009347mg [Prunus persica]
 gb|EMJ21627.1| hypothetical protein PRUPE_ppa009347mg [Prunus persica]
Length=296

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 152/190 (80%), Gaps = 4/190 (2%)
 Frame = +2

Query  380  SGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDS  559
            S   Q D ++ N    G D      G G +G     RR RGRP GS+NKPKPP+IITR+S
Sbjct  45   SDHHQNDVDDDNPHHQGLDLVTPNPGSGDSG----GRRSRGRPPGSRNKPKPPVIITRES  100

Query  560  ANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHG  739
            AN LR H++E++ GCDV DSV  +A++RQRG+CVLSG+G+VTNV+LRQPA+ GAVVTLHG
Sbjct  101  ANTLRAHILEVSSGCDVFDSVGTYARKRQRGICVLSGSGMVTNVSLRQPAAAGAVVTLHG  160

Query  740  RFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAA  919
            RFEILSL GSFLPPPAPP AT LTI+LAGG GQV+GG+VVGAL+A+GPV+++A+SF+N A
Sbjct  161  RFEILSLTGSFLPPPAPPGATSLTIFLAGGSGQVMGGNVVGALIASGPVIVIASSFTNVA  220

Query  920  YERLPLEEDD  949
            YERLPLEE+D
Sbjct  221  YERLPLEEED  230



>gb|ADY38789.1| DNA-binding protein [Coffea arabica]
Length=289

 Score =   204 bits (519),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 175/244 (72%), Gaps = 20/244 (8%)
 Frame = +2

Query  431   NDGGESKNGLGGAGEGEI---SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADG  601
             +D  E +N      EG +   +RRPRGRP GSKNKPKPPI +TRDS NALR+H+ME+A+G
Sbjct  49    DDEDERENSTDEPKEGAVEVATRRPRGRPPGSKNKPKPPIFVTRDSPNALRSHVMEVANG  108

Query  602   CDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPP  781
              D+ +S+A FA+RRQRGVCVLS +G VTNVTLRQP++PGAV+ LHGRFEILSL G+FLP 
Sbjct  109   SDIAESIAQFARRRQRGVCVLSASGTVTNVTLRQPSAPGAVMALHGRFEILSLTGAFLPG  168

Query  782   PAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD----  949
             PAPP ATGLTIYLAGGQGQVVGGSVVG+L+A+GPV+++A++FSNA YERLP+EED+    
Sbjct  169   PAPPGATGLTIYLAGGQGQVVGGSVVGSLVASGPVMVIASTFSNATYERLPIEEDEEGGG  228

Query  950   --------GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLI-NSIQLPNDAY-WGGS  1099
                       +PP   GG    G  G            +PPNL+ N  QL ++A+ W   
Sbjct  229   AAQGQLGGNGSPPLGSGGAPQQGGLGDPSSMP---VYSLPPNLMPNGGQLNHEAFAWAHG  285

Query  1100  RPPF  1111
             RPP+
Sbjct  286   RPPY  289



>ref|XP_009379018.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=288

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVL  664
            SRRPRGRP GSKNKPKPPI +TRDS N+LR+H+ME+A G DV +SVA FA+RRQRGVCVL
Sbjct  52   SRRPRGRPPGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVL  111

Query  665  SGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvv  844
            SG+G V NVTLRQPA+PGAVV LHGRFEILSL+G+FLP PAPP +TGLT+YLAGGQGQVV
Sbjct  112  SGSGSVANVTLRQPAAPGAVVALHGRFEILSLSGAFLPGPAPPGSTGLTVYLAGGQGQVV  171

Query  845  ggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            GGSVVG+L+AAGPV+++AA+F+NA YERLPLEED+
Sbjct  172  GGSVVGSLVAAGPVMVVAATFANATYERLPLEEDE  206



>ref|XP_007144002.1| hypothetical protein PHAVU_007G120900g [Phaseolus vulgaris]
 gb|ESW15996.1| hypothetical protein PHAVU_007G120900g [Phaseolus vulgaris]
Length=278

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 173/266 (65%), Gaps = 20/266 (8%)
 Frame = +2

Query  374   EQSGQKQRDPEEVNQQDD----GNDGG--------ESKNGLGGAGEGEISRRPRGRPAGS  517
             E SG   R P+     +D    GN  G         S     GA +   +RRPRGRP GS
Sbjct  13    ENSGDSMRKPDLGFSMNDSAVTGNHAGEEEEEEKENSDEPKEGAIDVANTRRPRGRPPGS  72

Query  518   KNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTL  697
             KNKPKPPI +TRDS NALR+H+MEIA G D+ D V  FA+RRQRGV +LSG+G V NVTL
Sbjct  73    KNKPKPPIFVTRDSPNALRSHVMEIASGADITDCVLQFARRRQRGVSILSGSGAVVNVTL  132

Query  698   RQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvgallaa  877
             RQP +PGAV+ LHGRF+ILSL GSFLP P+PP ATGLTIYLAGGQGQ+VGG VVG L+AA
Sbjct  133   RQPTAPGAVMALHGRFDILSLTGSFLPGPSPPGATGLTIYLAGGQGQIVGGGVVGPLVAA  192

Query  878   gpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspgaaggqllaeqgMFQGVPPNL-  1054
             GPV+IMAA+FSNA YERLPLEEDD       G      G  G    +       VPP+L 
Sbjct  193   GPVLIMAATFSNATYERLPLEEDDQEQGGGGGSPPGMGGGPGEASSSISVYNNNVPPSLG  252

Query  1055  -INSIQLPNDAY---WG---GSRPPF  1111
               N  Q+ ++AY   WG    SRPP+
Sbjct  253   GPNGQQVNHEAYSSAWGHAPHSRPPY  278



>ref|XP_009391843.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=313

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 171/226 (76%), Gaps = 12/226 (5%)
 Frame = +2

Query  464   GAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRR  643
             G  EGEI+R+PRGRP GSKNKPKPPIIITR+SANAL +H+MEIA GCD+ +SVA FA+RR
Sbjct  90    GGAEGEINRKPRGRPPGSKNKPKPPIIITRNSANALLSHVMEIAGGCDICESVATFARRR  149

Query  644   QRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYla  823
             QRGVC+L G G V NVTLRQ ASPGAVVTL GRFEILS++GSFLPPPAPP+ATG+TIYL+
Sbjct  150   QRGVCILGGTGTVINVTLRQSASPGAVVTLRGRFEILSISGSFLPPPAPPAATGMTIYLS  209

Query  824   ggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDG-------NAPPFQgggm  982
             GGQGQVVGGSVVG L+A GP++IMAASF +AAYERLPL E++G        +P F   G 
Sbjct  210   GGQGQVVGGSVVGPLIALGPIIIMAASFGSAAYERLPLPEEEGLQAQGPLGSPDF--VGQ  267

Query  983   dspgaaggqllaeqgMFQGVPPNLINSIQLPNDAY-W--GGSRPPF  1111
                            +F  + P+L+N++Q P DAY W  GG RP +
Sbjct  268   SPQAQQQLLPDPNNPLFHNLSPSLLNNMQSPADAYGWGAGGVRPAY  313



>ref|XP_002312113.2| hypothetical protein POPTR_0008s05890g [Populus trichocarpa]
 gb|EEE89480.2| hypothetical protein POPTR_0008s05890g [Populus trichocarpa]
Length=336

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 164/224 (73%), Gaps = 16/224 (7%)
 Frame = +2

Query  470   GEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQR  649
             G G  SRRPRGRPAGSKNKPKPP++IT++S N+LR+H++EI+ G D++DS+A F+ RR  
Sbjct  104   GSGSTSRRPRGRPAGSKNKPKPPVVITKESPNSLRSHVLEISSGSDIVDSIANFSHRRHH  163

Query  650   GVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlagg  829
             GV +LSG+GIV NVTLRQPA+PG V+TLHGRFEILSL+GSFLP P+PP AT LT+YLAG 
Sbjct  164   GVSILSGSGIVDNVTLRQPAAPGGVITLHGRFEILSLSGSFLPAPSPPGATRLTVYLAGA  223

Query  830   qgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmds-----pg  994
             QGQVVGG+V+G L+AAGPV+++AA+FSNA YERLPLEE +      Q     S       
Sbjct  224   QGQVVGGTVMGELVAAGPVMVIAATFSNATYERLPLEEQEQEGMQLQQQVDSSGTNNGNA  283

Query  995   aaggqllaeqgMFQG-----------VPPNLINSIQLPNDAYWG  1093
             AAGG   +     QG           +PPNL+ + Q+P+D +WG
Sbjct  284   AAGGGNNSGTQSSQGLGEHGSIPVFNLPPNLLPNGQMPHDVFWG  327



>ref|XP_007141856.1| hypothetical protein PHAVU_008G231500g [Phaseolus vulgaris]
 gb|ESW13850.1| hypothetical protein PHAVU_008G231500g [Phaseolus vulgaris]
Length=248

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  458  LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
            +  A EG+  RRPRGRPAGSKNKPKPPII+TRDSANAL+ H ME++ GCDV +S+  FA+
Sbjct  33   VSSAAEGDTLRRPRGRPAGSKNKPKPPIIVTRDSANALKAHAMEVSSGCDVNESLLNFAR  92

Query  638  RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
            R+QRG+ +L+G G VTNVTLRQP S GA+VTLHGRFEILSL GS LPPPAPP  TGLTIY
Sbjct  93   RKQRGLYILNGTGCVTNVTLRQPGSSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIY  152

Query  818  laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD  949
            LAG QGQVVGG+VVGAL+A+GP+VIMAASF +A ++RLPLE+D+
Sbjct  153  LAGAQGQVVGGAVVGALIASGPLVIMAASFMHATFDRLPLEDDE  196



>ref|XP_006588553.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=230

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +2

Query  485  SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVL  664
            +RRPRGRP GSKNKPKPPI +TRDS N+LR+H+ME+A G DV +SVA FA+RRQRGVCVL
Sbjct  40   TRRPRGRPPGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVL  99

Query  665  SGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvv  844
            SG+G V NVTLRQP++PGAVV LHGRFEILSL G+FLP PAPP ATGLT+YLAGGQGQVV
Sbjct  100  SGSGSVANVTLRQPSAPGAVVALHGRFEILSLTGAFLPGPAPPGATGLTVYLAGGQGQVV  159

Query  845  ggsvvgallaagpvvIMAASFSNAAYERLPL--EEDDG  952
            GGSVVG+L+AAGPV+++AA+F+NA YERLPL  EEDDG
Sbjct  160  GGSVVGSLVAAGPVMVIAATFANATYERLPLEEEEDDG  197



>gb|ABZ89182.1| putative protein [Coffea canephora]
 gb|ADZ55300.1| DNA-binding protein [Coffea arabica]
 emb|CDO99972.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 175/244 (72%), Gaps = 20/244 (8%)
 Frame = +2

Query  431   NDGGESKNGLGGAGEGEI---SRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADG  601
             +D  E +N      EG +   +RRPRGRP GSKNKPKPPI +TRDS NALR+H+ME+A+G
Sbjct  49    DDEDERENSTDEPKEGAVEVATRRPRGRPPGSKNKPKPPIFVTRDSPNALRSHVMEVANG  108

Query  602   CDVMDSVAAFAQRRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPP  781
              D+ +S+A FA+RRQRGVCVLS +G VTNVTLRQP++PGAV+ LHGRFEILSL G+FLP 
Sbjct  109   SDIAESIAQFARRRQRGVCVLSASGTVTNVTLRQPSAPGAVMALHGRFEILSLTGAFLPG  168

Query  782   PAPPSATGLTIYlaggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDD----  949
             PAPP ATGLTIYLAGGQGQVVGGSVVG+L+A+GPV+++A++FSNA YERLP+EED+    
Sbjct  169   PAPPGATGLTIYLAGGQGQVVGGSVVGSLVASGPVMVIASTFSNATYERLPIEEDEEGGG  228

Query  950   --------GNAPPFQgggmdspgaaggqllaeqgMFQGVPPNLI-NSIQLPNDAY-WGGS  1099
                       +PP   GG    G  G            +PPNL+ N  QL ++A+ W   
Sbjct  229   AAQGQLGGNGSPPLGSGGAPQQGGLGDPSSMP---VYNLPPNLMPNGGQLNHEAFAWAHG  285

Query  1100  RPPF  1111
             RPP+
Sbjct  286   RPPY  289



>ref|NP_191646.1| AT-hook motif nuclear-localized protein 18 [Arabidopsis thaliana]
 emb|CAB82691.1| putative protein [Arabidopsis thaliana]
 tpd|FAA00289.1| TPA: AT-hook motif nuclear localized protein 18 [Arabidopsis 
thaliana]
 gb|AEE80119.1| AT-hook motif nuclear-localized protein 18 [Arabidopsis thaliana]
Length=265

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 155/270 (57%), Positives = 188/270 (70%), Gaps = 21/270 (8%)
 Frame = +2

Query  323   PPFHTSRDFNFHPQQFHEQSGQKQRDPEEVNQQDDGNDGGESKNGLGGAGEGEISRRPRG  502
             P F +S   ++H    H+ +G+++R  EE  +  + N+ GE         E    RRPRG
Sbjct  10    PQFLSSDHQHYH----HQNAGRQKRGREE--EGVEPNNIGEDLATFPSGEENIKKRRPRG  63

Query  503   RPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQRRQRGVCVLSGNGIV  682
             RPAGSKNKPK PII+TRDSANA R H+MEI + CDVM+S+A FA+RRQRGVCVL+GNG V
Sbjct  64    RPAGSKNKPKAPIIVTRDSANAFRCHVMEITNACDVMESLAVFARRRQRGVCVLTGNGAV  123

Query  683   TNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIYlaggqgqvvggsvvg  862
             TNVT+RQP   G VV+LHGRFEILSL+GSFLPPPAPP+A+GL +YLAGGQGQV+GGSVVG
Sbjct  124   TNVTVRQPG--GGVVSLHGRFEILSLSGSFLPPPAPPAASGLKVYLAGGQGQVIGGSVVG  181

Query  863   allaagpvvIMAASFSNAAYERLPLEED-------DGNAPPFQgggmdspgaaggqllae  1021
              L A+ PVV+MAASF NA+YERLPLEE+       DGNA                QL+ +
Sbjct  182   PLTASSPVVVMAASFGNASYERLPLEEEEETEREIDGNA------ARAIGTQTQKQLMQD  235

Query  1022  qgMFQGVPPNLINSIQLPNDAYWGGSRPPF  1111
                F G P NLINS+ LP +AYWG  RP F
Sbjct  236   ATSFIGSPSNLINSVSLPGEAYWGTQRPSF  265



>emb|CDP06170.1| unnamed protein product [Coffea canephora]
Length=270

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 155/216 (72%), Gaps = 3/216 (1%)
 Frame = +2

Query  458   LGGAGEGEISRRPRGRPAGSKNKPKPPIIITRDSANALRTHLMEIADGCDVMDSVAAFAQ  637
             L   G+GE +RRPRGRPAGSKNKPKPPIIITRDSANALR H ME+  GCDV +S+ +FA+
Sbjct  52    LSSTGDGEANRRPRGRPAGSKNKPKPPIIITRDSANALRAHAMEVNSGCDVSESLLSFAR  111

Query  638   RRQRGVCVLSGNGIVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPSATGLTIY  817
             R+QRG+ VL+  G VTNVTLRQP S GA+VTLHGRFEILSL GS LPPPAP    GLTIY
Sbjct  112   RKQRGISVLNATGCVTNVTLRQPTSSGAIVTLHGRFEILSLLGSVLPPPAPQGVAGLTIY  171

Query  818   laggqgqvvggsvvgallaagpvvIMAASFSNAAYERLPLEEDDGNAPPFQgggmdspga  997
             LAG QGQVVGG VVGAL+A+GPVVIMAASF NA ++RLPL++D+    P           
Sbjct  172   LAGPQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDDDE--VVPAAAVQSQQYHN  229

Query  998   aggqllaeqgMFQGVPPNLINSIQLPNDAY-WGGSR  1102
             +  +   +     G+P NL+ +  LP + Y W   R
Sbjct  230   SRQRHHVDCSDIYGLPQNLLTNGTLPTEFYSWAPGR  265



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4054079720394