BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22261_g1_i1 len=496 path=[1:0-495]

Length=496
                                                                      Score     E

ref|XP_011078979.1|  PREDICTED: WAT1-related protein At3g18200          179   3e-51   
ref|XP_006341703.1|  PREDICTED: WAT1-related protein At3g18200-like     166   2e-46   
ref|XP_004236428.1|  PREDICTED: WAT1-related protein At3g18200          162   4e-45   
gb|EYU44122.1|  hypothetical protein MIMGU_mgv1a018428mg                161   1e-44   
ref|XP_009797192.1|  PREDICTED: WAT1-related protein At3g18200          161   1e-44   
ref|XP_002321499.1|  hypothetical protein POPTR_0015s04130g             151   9e-41   Populus trichocarpa [western balsam poplar]
ref|XP_011000504.1|  PREDICTED: WAT1-related protein At3g18200          151   9e-41   
emb|CAN65389.1|  hypothetical protein VITISV_038362                     150   1e-40   Vitis vinifera
ref|XP_002277607.1|  PREDICTED: WAT1-related protein At3g18200          150   1e-40   Vitis vinifera
ref|XP_009587259.1|  PREDICTED: WAT1-related protein At3g18200 is...    149   3e-40   
ref|XP_009587258.1|  PREDICTED: WAT1-related protein At3g18200 is...    149   4e-40   
ref|XP_003620353.1|  Auxin-induced protein 5NG4                         145   1e-38   
gb|KHN23738.1|  Auxin-induced protein 5NG4                              144   4e-38   
ref|XP_003533350.1|  PREDICTED: WAT1-related protein At3g18200          144   5e-38   
ref|XP_004160446.1|  PREDICTED: auxin-induced protein 5NG4-like         144   6e-38   
ref|XP_010036916.1|  PREDICTED: WAT1-related protein At3g18200          143   8e-38   
gb|KHN44603.1|  Auxin-induced protein 5NG4                              143   8e-38   
ref|XP_004137548.1|  PREDICTED: auxin-induced protein 5NG4-like         142   3e-37   
ref|XP_003528964.2|  PREDICTED: WAT1-related protein At3g18200-like     143   6e-37   
ref|XP_004512876.1|  PREDICTED: WAT1-related protein At3g18200-like     141   7e-37   
ref|XP_008453450.1|  PREDICTED: WAT1-related protein At3g18200          139   2e-36   
ref|XP_010695638.1|  PREDICTED: WAT1-related protein At3g18200          139   4e-36   
ref|XP_010110114.1|  Auxin-induced protein 5NG4                         138   7e-36   
ref|XP_007152707.1|  hypothetical protein PHAVU_004G152600g             137   1e-35   
ref|XP_002520409.1|  conserved hypothetical protein                     134   3e-35   Ricinus communis
ref|XP_010926206.1|  PREDICTED: WAT1-related protein At3g18200-like     135   5e-35   
ref|XP_010549098.1|  PREDICTED: WAT1-related protein At3g18200          135   1e-34   
ref|XP_009403946.1|  PREDICTED: auxin-induced protein 5NG4-like         135   1e-34   
ref|NP_001030721.1|  nodulin MtN21-like transporter UMAMIT4             131   3e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39156.1|  hypothetical protein AALP_AA3G207600                    133   4e-34   
ref|XP_010250292.1|  PREDICTED: WAT1-related protein At3g18200-like     132   7e-34   
emb|CDY40602.1|  BnaC06g02180D                                          131   9e-34   
ref|XP_010249759.1|  PREDICTED: WAT1-related protein At3g18200-like     132   1e-33   
ref|NP_188448.1|  nodulin MtN21-like transporter UMAMIT4                132   1e-33   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LV20.1|WTR17_ARATH  RecName: Full=WAT1-related protein At3g1...    132   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406637.1|  hypothetical protein EUTSA_v10021001mg             131   3e-33   
emb|CDY51934.1|  BnaAnng11110D                                          130   3e-33   
ref|XP_010487731.1|  PREDICTED: WAT1-related protein At3g18200-like     131   3e-33   
ref|XP_010465903.1|  PREDICTED: WAT1-related protein At3g18200          131   3e-33   
ref|XP_009113449.1|  PREDICTED: WAT1-related protein At3g18200-like     130   4e-33   
ref|XP_002885242.1|  nodulin MtN21 family protein                       130   5e-33   
ref|XP_009147948.1|  PREDICTED: WAT1-related protein At3g18200-like     130   6e-33   
emb|CDX93689.1|  BnaA06g03590D                                          130   6e-33   
ref|XP_009589798.1|  PREDICTED: WAT1-related protein At3g18200-li...    130   6e-33   
emb|CDX95542.1|  BnaC01g34340D                                          129   7e-33   
ref|XP_010506531.1|  PREDICTED: WAT1-related protein At3g18200-like     130   9e-33   
ref|XP_009135570.1|  PREDICTED: WAT1-related protein At3g18200          129   1e-32   
emb|CDX75960.1|  BnaC03g40430D                                          127   2e-32   
ref|XP_009380328.1|  PREDICTED: auxin-induced protein 5NG4-like         127   7e-32   
emb|CDY18510.1|  BnaA01g26850D                                          127   7e-32   
ref|XP_006299289.1|  hypothetical protein CARUB_v10015443mg             127   1e-31   
ref|XP_009780288.1|  PREDICTED: WAT1-related protein At3g18200-like     126   1e-31   
gb|EEC73065.1|  hypothetical protein OsI_07025                          124   5e-31   Oryza sativa Indica Group [Indian rice]
dbj|BAD15605.1|  nodulin-like protein                                   124   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004954875.1|  PREDICTED: protein WALLS ARE THIN 1-like           124   1e-30   
ref|XP_006643724.1|  PREDICTED: WAT1-related protein At3g18200-like     124   1e-30   
ref|XP_010279405.1|  PREDICTED: WAT1-related protein At3g18200-li...    123   2e-30   
ref|NP_001041856.1|  Os01g0117900                                       123   2e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EAY72293.1|  hypothetical protein OsI_00148                          123   2e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_010279402.1|  PREDICTED: WAT1-related protein At3g18200-li...    123   3e-30   
ref|XP_003573156.2|  PREDICTED: protein WALLS ARE THIN 1                122   3e-30   
emb|CDM80504.1|  unnamed protein product                                123   3e-30   
gb|EEE56883.1|  hypothetical protein OsJ_06528                          120   9e-30   Oryza sativa Japonica Group [Japonica rice]
gb|ADE77565.1|  unknown                                                 119   1e-29   
dbj|BAJ86174.1|  predicted protein                                      120   3e-29   
tpg|DAA57086.1|  TPA: nodulin-like protein                              118   5e-29   
ref|XP_006844042.1|  hypothetical protein AMTR_s00006p00239950          119   8e-29   
ref|NP_001149629.1|  nodulin-like protein                               118   2e-28   Zea mays [maize]
ref|XP_006393371.1|  hypothetical protein EUTSA_v10012396mg             116   3e-28   
sp|Q6J163.1|5NG4_PINTA  RecName: Full=Auxin-induced protein 5NG4        116   1e-27   Pinus taeda
ref|XP_007017667.1|  Walls Are Thin 1                                   115   2e-27   
ref|XP_011074627.1|  PREDICTED: protein WALLS ARE THIN 1-like           115   2e-27   
ref|XP_008811716.1|  PREDICTED: probable fructose-bisphosphate al...    118   2e-27   
gb|KHG27290.1|  Auxin-induced 5NG4                                      115   2e-27   
ref|XP_006830632.1|  hypothetical protein AMTR_s00120p00105340          115   3e-27   
gb|EMT15640.1|  Auxin-induced protein 5NG4                              114   4e-27   
ref|XP_006646778.1|  PREDICTED: protein WALLS ARE THIN 1-like           114   6e-27   
ref|XP_002453161.1|  hypothetical protein SORBIDRAFT_04g001020          114   7e-27   Sorghum bicolor [broomcorn]
ref|XP_006647228.1|  PREDICTED: WAT1-related protein At3g18200-like     113   1e-26   
ref|NP_001172775.1|  Os02g0114050                                       113   1e-26   
ref|XP_004967997.1|  PREDICTED: protein WALLS ARE THIN 1-like           113   1e-26   
gb|KHG10968.1|  Auxin-induced 5NG4                                      113   2e-26   
ref|XP_010105267.1|  Auxin-induced protein 5NG4                         112   2e-26   
ref|XP_004147843.1|  PREDICTED: auxin-induced protein 5NG4-like         112   3e-26   
gb|EYU36746.1|  hypothetical protein MIMGU_mgv1a007773mg                112   4e-26   
ref|XP_008466514.1|  PREDICTED: protein WALLS ARE THIN 1-like           112   4e-26   
gb|EYU32879.1|  hypothetical protein MIMGU_mgv1a008013mg                111   4e-26   
ref|XP_011028934.1|  PREDICTED: protein WALLS ARE THIN 1-like           111   6e-26   
ref|XP_006665158.1|  PREDICTED: protein WALLS ARE THIN 1-like           107   6e-26   
ref|XP_009387815.1|  PREDICTED: protein WALLS ARE THIN 1-like           111   8e-26   
ref|NP_001132593.1|  uncharacterized protein LOC100194065               110   1e-25   Zea mays [maize]
ref|XP_009386212.1|  PREDICTED: protein WALLS ARE THIN 1-like           110   1e-25   
ref|XP_002307691.1|  nodulin MtN21 family protein                       110   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010061252.1|  PREDICTED: protein WALLS ARE THIN 1-like           110   1e-25   
ref|XP_007222733.1|  hypothetical protein PRUPE_ppa006496mg             110   2e-25   
gb|ABK93004.1|  unknown                                                 109   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_007222734.1|  hypothetical protein PRUPE_ppa006496mg             109   2e-25   
gb|AFW61678.1|  hypothetical protein ZEAMMB73_110601                    108   2e-25   
ref|XP_002510467.1|  Auxin-induced protein 5NG4, putative               109   2e-25   Ricinus communis
gb|KHN22214.1|  Auxin-induced protein 5NG4                              109   2e-25   
ref|XP_003577657.1|  PREDICTED: protein WALLS ARE THIN 1                109   3e-25   
ref|XP_003527860.1|  PREDICTED: protein WALLS ARE THIN 1                109   3e-25   
ref|XP_010536384.1|  PREDICTED: protein WALLS ARE THIN 1                109   3e-25   
dbj|BAJ53175.1|  JHL18I08.9                                             109   3e-25   
ref|NP_001150116.1|  nodulin-like protein 5NG4                          109   3e-25   Zea mays [maize]
ref|XP_006302285.1|  hypothetical protein CARUB_v10020328mg             109   3e-25   
ref|XP_008677722.1|  PREDICTED: nodulin-like protein 5NG4 isoform X1    109   3e-25   
gb|KHG23354.1|  Auxin-induced 5NG4                                      109   3e-25   
ref|XP_003523716.1|  PREDICTED: protein WALLS ARE THIN 1-like           109   3e-25   
gb|KHN45892.1|  Auxin-induced protein 5NG4                              109   4e-25   
ref|XP_009394641.1|  PREDICTED: protein WALLS ARE THIN 1-like           109   4e-25   
ref|XP_009104704.1|  PREDICTED: protein WALLS ARE THIN 1-like           109   4e-25   
ref|XP_010268621.1|  PREDICTED: protein WALLS ARE THIN 1-like           109   4e-25   
emb|CDX68127.1|  BnaA07g21670D                                          108   4e-25   
gb|EPS59354.1|  hypothetical protein M569_15453                         108   4e-25   
ref|XP_010935825.1|  PREDICTED: protein WALLS ARE THIN 1-like           108   4e-25   
emb|CDY39037.1|  BnaA02g17260D                                          108   4e-25   
ref|XP_002300735.1|  nodulin MtN21 family protein                       108   4e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010940523.1|  PREDICTED: protein WALLS ARE THIN 1-like           108   4e-25   
ref|NP_001145901.1|  hypothetical protein                               108   5e-25   Zea mays [maize]
ref|XP_011048851.1|  PREDICTED: protein WALLS ARE THIN 1-like           108   5e-25   
ref|XP_010533584.1|  PREDICTED: protein WALLS ARE THIN 1-like           108   6e-25   
ref|XP_003565262.1|  PREDICTED: WAT1-related protein At3g18200-like     108   6e-25   
ref|XP_009128107.1|  PREDICTED: protein WALLS ARE THIN 1                108   7e-25   
ref|XP_010030394.1|  PREDICTED: protein WALLS ARE THIN 1-like           108   7e-25   
emb|CDY20378.1|  BnaC02g24380D                                          108   7e-25   
dbj|BAJ91525.1|  predicted protein                                      108   7e-25   
ref|XP_010271523.1|  PREDICTED: protein WALLS ARE THIN 1-like           108   8e-25   
ref|XP_008779069.1|  PREDICTED: protein WALLS ARE THIN 1-like           108   8e-25   
ref|XP_002457483.1|  hypothetical protein SORBIDRAFT_03g008060          108   8e-25   Sorghum bicolor [broomcorn]
ref|XP_004500966.1|  PREDICTED: protein WALLS ARE THIN 1-like           107   1e-24   
ref|XP_006660389.1|  PREDICTED: protein WALLS ARE THIN 1-like           107   1e-24   
emb|CDX85897.1|  BnaC06g22370D                                          107   2e-24   
emb|CDP07454.1|  unnamed protein product                                107   2e-24   
gb|KEH36221.1|  auxin-induced 5NG4-like protein                         105   2e-24   
gb|EMT17329.1|  Auxin-induced protein 5NG4                              107   2e-24   
emb|CDM80143.1|  unnamed protein product                                107   2e-24   
gb|KEH36220.1|  auxin-induced 5NG4-like protein                         106   2e-24   
gb|KHN39450.1|  Auxin-induced protein 5NG4                              106   3e-24   
gb|AAF87121.1|AC006434_17  F10A5.28                                     106   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KEH36219.1|  auxin-induced 5NG4-like protein                         106   3e-24   
ref|XP_003545052.1|  PREDICTED: protein WALLS ARE THIN 1-like           106   3e-24   
emb|CDY64209.1|  BnaC06g43970D                                          106   3e-24   
ref|XP_009106202.1|  PREDICTED: protein WALLS ARE THIN 1-like           106   3e-24   
emb|CDY47518.1|  BnaAnng09160D                                          106   3e-24   
gb|EAZ08018.1|  hypothetical protein OsI_30283                          106   3e-24   Oryza sativa Indica Group [Indian rice]
dbj|BAD13218.1|  putative MtN21                                         106   3e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_565111.1|  protein walls are thin 1                              106   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428578.1|  PREDICTED: protein WALLS ARE THIN 1-like           106   3e-24   
gb|EAZ13316.1|  hypothetical protein OsJ_03238                          106   3e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011083629.1|  PREDICTED: protein WALLS ARE THIN 1-like           106   3e-24   
ref|XP_006390298.1|  hypothetical protein EUTSA_v10018690mg             106   4e-24   
ref|XP_006435087.1|  hypothetical protein CICLE_v10001438mg             106   4e-24   
ref|XP_002445672.1|  hypothetical protein SORBIDRAFT_07g023970          106   4e-24   Sorghum bicolor [broomcorn]
gb|KDO84715.1|  hypothetical protein CISIN_1g016399mg                   106   4e-24   
ref|XP_006473582.1|  PREDICTED: protein WALLS ARE THIN 1-like           106   4e-24   
ref|XP_004974226.1|  PREDICTED: protein WALLS ARE THIN 1-like           106   4e-24   
ref|XP_010416441.1|  PREDICTED: protein WALLS ARE THIN 1-like           106   5e-24   
ref|XP_010061007.1|  PREDICTED: protein WALLS ARE THIN 1-like iso...    105   5e-24   
gb|KHN12669.1|  Auxin-induced protein 5NG4                              105   7e-24   
ref|XP_004499208.1|  PREDICTED: protein WALLS ARE THIN 1-like iso...    105   7e-24   
ref|XP_008377184.1|  PREDICTED: protein WALLS ARE THIN 1-like           105   8e-24   
ref|XP_007136044.1|  hypothetical protein PHAVU_009G013400g             105   9e-24   
emb|CBI19781.3|  unnamed protein product                                105   1e-23   
ref|XP_007160706.1|  hypothetical protein PHAVU_001G010100g             105   1e-23   
ref|XP_003550406.1|  PREDICTED: protein WALLS ARE THIN 1-like           105   1e-23   
ref|XP_002280062.1|  PREDICTED: protein WALLS ARE THIN 1                105   1e-23   Vitis vinifera
ref|XP_009612893.1|  PREDICTED: protein WALLS ARE THIN 1-like           104   2e-23   
ref|XP_002889028.1|  nodulin MtN21 family protein                       104   2e-23   
ref|XP_010471663.1|  PREDICTED: protein WALLS ARE THIN 1                104   2e-23   
ref|XP_009787760.1|  PREDICTED: protein WALLS ARE THIN 1-like           104   2e-23   
ref|XP_009611297.1|  PREDICTED: protein WALLS ARE THIN 1-like           104   2e-23   
ref|XP_008221332.1|  PREDICTED: protein WALLS ARE THIN 1                104   2e-23   
gb|KFK41985.1|  hypothetical protein AALP_AA2G197400                    104   2e-23   
ref|XP_004952146.1|  PREDICTED: protein WALLS ARE THIN 1-like           103   2e-23   
ref|XP_009335645.1|  PREDICTED: protein WALLS ARE THIN 1                103   2e-23   
ref|XP_008387993.1|  PREDICTED: protein WALLS ARE THIN 1                103   2e-23   
ref|XP_008787458.1|  PREDICTED: protein WALLS ARE THIN 1-like           103   3e-23   
ref|XP_010672402.1|  PREDICTED: protein WALLS ARE THIN 1                103   4e-23   
ref|XP_004238311.1|  PREDICTED: protein WALLS ARE THIN 1                103   4e-23   
ref|XP_009777724.1|  PREDICTED: protein WALLS ARE THIN 1-like           102   7e-23   
ref|XP_004291402.1|  PREDICTED: auxin-induced protein 5NG4-like         102   7e-23   
ref|XP_006341994.1|  PREDICTED: protein WALLS ARE THIN 1-like           102   8e-23   
ref|XP_006393368.1|  hypothetical protein EUTSA_v10011671mg             102   9e-23   
ref|XP_004289105.1|  PREDICTED: auxin-induced protein 5NG4-like         101   2e-22   
gb|ACN31266.1|  unknown                                                 101   2e-22   Zea mays [maize]
ref|XP_004152669.1|  PREDICTED: auxin-induced protein 5NG4-like         101   2e-22   
ref|XP_008444764.1|  PREDICTED: protein WALLS ARE THIN 1                101   2e-22   
ref|XP_003589345.1|  Auxin-induced protein 5NG4                         101   2e-22   
ref|XP_003589346.1|  Auxin-induced protein 5NG4                         100   3e-22   
gb|AFK36474.1|  unknown                                                 100   3e-22   
ref|NP_001140284.1|  nodulin-like protein                             99.8    6e-22   Zea mays [maize]
ref|XP_008240210.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...  96.3    4e-21   
ref|XP_002534136.1|  Auxin-induced protein 5NG4, putative             96.7    9e-21   Ricinus communis
ref|XP_007046789.1|  Nodulin MtN21 /EamA-like transporter family ...  96.3    1e-20   
gb|AFK44308.1|  unknown                                               94.4    2e-20   
gb|KDP32670.1|  hypothetical protein JCGZ_13668                       95.5    3e-20   
gb|EMT27043.1|  Auxin-induced protein 5NG4                            95.9    6e-20   
ref|XP_006827501.1|  hypothetical protein AMTR_s00009p00175310        93.6    1e-19   
gb|KCW78781.1|  hypothetical protein EUGRSUZ_C00215                   93.6    1e-19   
ref|XP_010047033.1|  PREDICTED: WAT1-related protein At4g30420 is...  93.6    1e-19   
ref|XP_010047034.1|  PREDICTED: WAT1-related protein At4g30420 is...  93.2    1e-19   
ref|XP_002528209.1|  conserved hypothetical protein                   91.7    3e-19   Ricinus communis
dbj|BAF01728.1|  nodulin-like protein                                 88.6    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006425588.1|  hypothetical protein CICLE_v10025927mg           91.3    6e-19   
gb|KDO71057.1|  hypothetical protein CISIN_1g018069mg                 91.3    7e-19   
ref|XP_010918790.1|  PREDICTED: WAT1-related protein At5g07050-like   91.3    8e-19   
ref|XP_011025888.1|  PREDICTED: protein WALLS ARE THIN 1-like iso...  90.5    1e-18   
ref|XP_009369498.1|  PREDICTED: WAT1-related protein At4g08300-like   90.9    1e-18   
tpg|DAA45833.1|  TPA: hypothetical protein ZEAMMB73_166425            90.1    1e-18   
ref|XP_008382878.1|  PREDICTED: WAT1-related protein At4g08300-like   90.5    1e-18   
ref|NP_001159175.1|  hypothetical protein                             90.5    1e-18   Zea mays [maize]
ref|XP_007201258.1|  hypothetical protein PRUPE_ppa008369mg           90.1    2e-18   
gb|KHG11330.1|  Auxin-induced 5NG4                                    90.5    2e-18   
ref|XP_009413154.1|  PREDICTED: WAT1-related protein At2g39510-like   90.1    2e-18   
ref|XP_007035083.1|  Nodulin MtN21 /EamA-like transporter family ...  89.7    2e-18   
ref|XP_010262297.1|  PREDICTED: WAT1-related protein At1g44800-li...  89.7    2e-18   
ref|XP_011025887.1|  PREDICTED: WAT1-related protein At3g53210-li...  90.5    2e-18   
ref|XP_006379888.1|  hypothetical protein POPTR_0008s16550g           90.1    2e-18   
ref|XP_007224058.1|  hypothetical protein PRUPE_ppa015276mg           90.1    2e-18   
ref|XP_002280977.1|  PREDICTED: WAT1-related protein At5g07050        90.1    2e-18   Vitis vinifera
ref|XP_008224471.1|  PREDICTED: WAT1-related protein At4g08300-like   90.1    2e-18   
ref|XP_010262296.1|  PREDICTED: WAT1-related protein At1g44800-li...  89.7    2e-18   
ref|XP_010262295.1|  PREDICTED: WAT1-related protein At1g44800-li...  89.7    2e-18   
ref|XP_008235790.1|  PREDICTED: WAT1-related protein At1g44800-like   90.1    3e-18   
ref|XP_007035082.1|  Nodulin MtN21 /EamA-like transporter family ...  89.7    3e-18   
ref|XP_006651043.1|  PREDICTED: WAT1-related protein At2g39510-like   90.1    4e-18   
ref|XP_010671057.1|  PREDICTED: WAT1-related protein At5g07050-like   89.4    4e-18   
ref|XP_007035084.1|  Nodulin MtN21 /EamA-like transporter family ...  89.4    4e-18   
gb|ACF87060.1|  unknown                                               88.2    4e-18   Zea mays [maize]
ref|XP_011029842.1|  PREDICTED: WAT1-related protein At5g07050-like   89.4    4e-18   
ref|NP_001142624.1|  uncharacterized protein LOC100274895             88.2    4e-18   Zea mays [maize]
emb|CBI17428.3|  unnamed protein product                              89.0    5e-18   
ref|XP_002267729.1|  PREDICTED: protein WALLS ARE THIN 1              89.0    5e-18   Vitis vinifera
ref|XP_006355962.1|  PREDICTED: WAT1-related protein At3g28050-like   88.6    6e-18   
ref|XP_010268395.1|  PREDICTED: WAT1-related protein At4g30420-li...  88.2    6e-18   
ref|XP_010432988.1|  PREDICTED: WAT1-related protein At4g30420-like   89.0    6e-18   
ref|XP_010268394.1|  PREDICTED: WAT1-related protein At4g30420-li...  88.2    6e-18   
ref|XP_002310832.2|  hypothetical protein POPTR_0007s13580g           88.6    7e-18   Populus trichocarpa [western balsam poplar]
ref|XP_007158608.1|  hypothetical protein PHAVU_002G166900g           88.6    7e-18   
dbj|BAK07585.1|  predicted protein                                    88.6    7e-18   
ref|XP_007144098.1|  hypothetical protein PHAVU_007G128600g           87.8    1e-17   
ref|XP_004512084.1|  PREDICTED: protein WALLS ARE THIN 1-like         87.8    1e-17   
gb|EMT27247.1|  Auxin-induced protein 5NG4                            88.2    1e-17   
ref|XP_007144918.1|  hypothetical protein PHAVU_007G194500g           88.2    1e-17   
gb|KDP38760.1|  hypothetical protein JCGZ_04113                       85.5    1e-17   
gb|ABF93996.1|  Integral membrane protein DUF6 containing protein...  87.8    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010268393.1|  PREDICTED: WAT1-related protein At4g30420-li...  87.8    1e-17   
ref|NP_001142002.1|  hypothetical protein                             87.8    1e-17   Zea mays [maize]
gb|EEC74527.1|  hypothetical protein OsI_10035                        87.8    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_004237143.1|  PREDICTED: WAT1-related protein At2g39510-like   87.4    1e-17   
ref|XP_010103143.1|  Auxin-induced protein 5NG4                       87.0    2e-17   
ref|XP_008668286.1|  PREDICTED: hypothetical protein isoform X2       88.2    2e-17   
gb|AAN87740.1|  Unknown protein                                       87.8    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008362204.1|  PREDICTED: WAT1-related protein At4g30420-like   84.7    2e-17   
ref|XP_008391190.1|  PREDICTED: WAT1-related protein At5g07050-like   87.4    2e-17   
ref|XP_002467683.1|  hypothetical protein SORBIDRAFT_01g032270        87.4    2e-17   Sorghum bicolor [broomcorn]
ref|XP_010274797.1|  PREDICTED: WAT1-related protein At4g08300-like   87.0    3e-17   
ref|XP_010436326.1|  PREDICTED: WAT1-related protein At4g30420-like   87.0    3e-17   
gb|KHG27655.1|  Auxin-induced 5NG4                                    86.7    3e-17   
emb|CAB64224.1|  putative protein                                     86.7    3e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KEH42562.1|  auxin-induced 5NG4-like protein                       86.7    3e-17   
ref|XP_007050328.1|  Nodulin MtN21 /EamA-like transporter family ...  87.0    3e-17   
ref|XP_008218973.1|  PREDICTED: WAT1-related protein At1g25270-like   86.3    3e-17   
ref|XP_009382149.1|  PREDICTED: WAT1-related protein At5g07050-like   86.7    3e-17   
ref|XP_009629024.1|  PREDICTED: WAT1-related protein At3g28050-like   86.7    3e-17   
gb|KDO84716.1|  hypothetical protein CISIN_1g016399mg                 86.7    4e-17   
ref|XP_010451104.1|  PREDICTED: WAT1-related protein At4g30420-like   86.7    4e-17   
ref|XP_004292204.1|  PREDICTED: auxin-induced protein 5NG4-like       86.7    4e-17   
gb|AAM65079.1|  nodulin-like protein                                  86.3    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006453494.1|  hypothetical protein CICLE_v10008665mg           86.7    4e-17   
gb|KEH27571.1|  nodulin MtN21/EamA-like transporter family protein    85.9    4e-17   
ref|XP_002969284.1|  hypothetical protein SELMODRAFT_91939            86.7    4e-17   
ref|XP_006453495.1|  hypothetical protein CICLE_v10008665mg           86.7    4e-17   
ref|XP_008452363.1|  PREDICTED: WAT1-related protein At4g30420        86.3    5e-17   
gb|KGN61082.1|  hypothetical protein Csa_2G042770                     85.5    5e-17   
ref|XP_010527398.1|  PREDICTED: WAT1-related protein At5g07050-like   85.9    5e-17   
ref|NP_566981.1|  nodulin MtN21 /EamA-like transporter family pro...  86.3    5e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39204.1|  BnaA03g50160D                                        85.9    5e-17   
ref|XP_004162696.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...  86.3    5e-17   
ref|XP_004144705.1|  PREDICTED: auxin-induced protein 5NG4-like       86.3    5e-17   
ref|XP_006474092.1|  PREDICTED: WAT1-related protein At4g30420-like   86.7    5e-17   
ref|XP_004247715.1|  PREDICTED: WAT1-related protein At4g08300-like   86.3    5e-17   
ref|XP_009790539.1|  PREDICTED: WAT1-related protein At3g28050-like   85.9    6e-17   
ref|XP_009137918.1|  PREDICTED: WAT1-related protein At4g30420-like   85.9    6e-17   
emb|CDX72241.1|  BnaC07g42630D                                        85.5    7e-17   
ref|XP_010447720.1|  PREDICTED: WAT1-related protein At4g30420-like   85.9    7e-17   
ref|XP_003612089.1|  Auxin-induced protein 5NG4                       85.5    8e-17   
ref|XP_004983989.1|  PREDICTED: WAT1-related protein At4g08290-li...  85.5    8e-17   
ref|XP_011028786.1|  PREDICTED: WAT1-related protein At4g08300-li...  85.1    1e-16   
ref|XP_011028783.1|  PREDICTED: WAT1-related protein At4g08300-li...  85.1    1e-16   
ref|XP_007148456.1|  hypothetical protein PHAVU_006G210300g           85.9    1e-16   
ref|XP_004297816.1|  PREDICTED: auxin-induced protein 5NG4-like       85.1    1e-16   
ref|XP_011091208.1|  PREDICTED: WAT1-related protein At4g08300-like   84.7    1e-16   
ref|XP_009589800.1|  PREDICTED: WAT1-related protein At3g18200-like   81.3    2e-16   
ref|XP_002962703.1|  hypothetical protein SELMODRAFT_165705           84.7    2e-16   
ref|XP_002529296.1|  Auxin-induced protein 5NG4, putative             84.7    2e-16   
ref|XP_002980389.1|  hypothetical protein SELMODRAFT_153780           84.7    2e-16   
ref|XP_010023974.1|  PREDICTED: WAT1-related protein At5g07050-like   84.3    2e-16   
ref|XP_008813248.1|  PREDICTED: WAT1-related protein At4g08300-like   84.3    3e-16   
gb|KFK29616.1|  hypothetical protein AALP_AA7G157200                  84.3    3e-16   
ref|XP_003558804.2|  PREDICTED: WAT1-related protein At1g43650-like   85.1    3e-16   
ref|XP_002324505.1|  hypothetical protein POPTR_0018s10840g           84.0    3e-16   
ref|XP_009380771.1|  PREDICTED: WAT1-related protein At4g30420-like   84.0    3e-16   
ref|XP_008781052.1|  PREDICTED: WAT1-related protein At1g09380        84.0    3e-16   
ref|XP_009379003.1|  PREDICTED: WAT1-related protein At5g07050-like   84.0    3e-16   
ref|XP_010103139.1|  Auxin-induced protein 5NG4                       82.8    4e-16   
ref|XP_007226248.1|  hypothetical protein PRUPE_ppa017897mg           85.5    4e-16   
ref|XP_003626700.1|  Auxin-induced protein 5NG4                       82.0    4e-16   
ref|XP_003537616.1|  PREDICTED: protein WALLS ARE THIN 1-like         83.6    4e-16   
ref|XP_004309502.1|  PREDICTED: auxin-induced protein 5NG4-like       83.2    5e-16   
ref|XP_011071065.1|  PREDICTED: WAT1-related protein At3g28050-li...  83.2    5e-16   
ref|XP_003541345.1|  PREDICTED: WAT1-related protein At3g18200-like   83.6    5e-16   
ref|XP_006386233.1|  hypothetical protein POPTR_0002s04130g           83.2    5e-16   
ref|XP_006589293.1|  PREDICTED: WAT1-related protein At5g07050 is...  82.4    5e-16   
ref|XP_008781415.1|  PREDICTED: WAT1-related protein At1g68170-like   84.0    6e-16   
ref|XP_006387336.1|  hypothetical protein POPTR_1228s00010g           82.0    6e-16   
ref|XP_006585458.1|  PREDICTED: WAT1-related protein At1g68170-li...  83.2    6e-16   
ref|XP_003536248.1|  PREDICTED: WAT1-related protein At5g07050 is...  83.2    6e-16   
ref|XP_002271279.2|  PREDICTED: WAT1-related protein At4g30420        84.3    7e-16   
ref|XP_003596047.1|  hypothetical protein MTR_2g065550                83.2    7e-16   
gb|EYU22475.1|  hypothetical protein MIMGU_mgv1a009299mg              82.8    7e-16   
ref|XP_003547068.1|  PREDICTED: WAT1-related protein At1g68170-like   83.6    8e-16   
emb|CDY28186.1|  BnaA01g06630D                                        83.2    8e-16   
ref|NP_194771.1|  nodulin MtN21-like transporter family protein       82.8    9e-16   
ref|XP_004297653.1|  PREDICTED: auxin-induced protein 5NG4-like       82.4    9e-16   
ref|XP_008392675.1|  PREDICTED: WAT1-related protein At1g43650-li...  82.8    9e-16   
ref|XP_002465849.1|  hypothetical protein SORBIDRAFT_01g046960        82.8    1e-15   
ref|XP_004985690.1|  PREDICTED: WAT1-related protein At2g39510-li...  82.8    1e-15   
ref|XP_004985689.1|  PREDICTED: WAT1-related protein At2g39510-li...  82.8    1e-15   
emb|CDX72237.1|  BnaC07g42590D                                        82.4    1e-15   
ref|XP_003532973.1|  PREDICTED: WAT1-related protein At1g68170-li...  83.2    1e-15   
ref|XP_003602166.1|  Auxin-induced protein 5NG4                       82.0    1e-15   
ref|XP_007046790.1|  Nodulin MtN21 /EamA-like transporter family ...  82.0    1e-15   
gb|EPS58157.1|  hypothetical protein M569_16659                       79.0    1e-15   
gb|AET01174.2|  nodulin MtN21/EamA-like transporter family protein    82.4    1e-15   
ref|XP_003524084.1|  PREDICTED: WAT1-related protein At1g68170-like   82.4    1e-15   
ref|XP_010921389.1|  PREDICTED: WAT1-related protein At1g09380        82.8    1e-15   
ref|XP_007148453.1|  hypothetical protein PHAVU_006G2101000g          80.9    1e-15   
ref|XP_010278027.1|  PREDICTED: WAT1-related protein At4g30420-like   82.4    1e-15   
gb|KHN22918.1|  Auxin-induced protein 5NG4                            82.0    2e-15   
ref|XP_007211007.1|  hypothetical protein PRUPE_ppa020611mg           81.3    2e-15   
ref|XP_003626706.1|  Auxin-induced protein 5NG4                       81.6    2e-15   
ref|XP_007044593.1|  Nodulin MtN21 /EamA-like transporter family ...  81.3    2e-15   
ref|XP_010682604.1|  PREDICTED: WAT1-related protein At3g28050-li...  81.6    2e-15   
dbj|BAG94378.1|  unnamed protein product                              80.5    2e-15   
ref|XP_007044597.1|  Nodulin MtN21 /EamA-like transporter family ...  80.9    2e-15   
gb|AET01182.2|  nodulin MtN21/EamA-like transporter family protein    82.0    2e-15   
ref|XP_006845483.1|  hypothetical protein AMTR_s00019p00140850        81.6    2e-15   
ref|XP_011018102.1|  PREDICTED: WAT1-related protein At4g30420-li...  81.6    2e-15   
ref|XP_006291322.1|  hypothetical protein CARUB_v10017455mg           82.0    2e-15   
ref|XP_003547067.2|  PREDICTED: WAT1-related protein At1g68170-like   82.4    2e-15   
ref|XP_007159054.1|  hypothetical protein PHAVU_002G204500g           81.6    2e-15   
ref|XP_007013959.1|  Nodulin MtN21 /EamA-like transporter family ...  82.0    2e-15   
emb|CDY39203.1|  BnaA03g50150D                                        81.6    2e-15   
emb|CDX72240.1|  BnaC07g42620D                                        81.6    2e-15   
ref|XP_003531568.1|  PREDICTED: WAT1-related protein At1g68170-like   82.0    2e-15   
ref|XP_002986830.1|  hypothetical protein SELMODRAFT_45419            80.9    2e-15   
ref|NP_001052791.1|  Os04g0422600                                     80.5    2e-15   
gb|KHN41935.1|  Auxin-induced protein 5NG4                            83.2    2e-15   
gb|KHG05804.1|  Auxin-induced 5NG4                                    81.3    2e-15   
ref|XP_007044594.1|  Nodulin MtN21 /EamA-like transporter family ...  81.3    3e-15   
ref|XP_009137919.1|  PREDICTED: WAT1-related protein At4g30420-like   81.3    3e-15   
ref|XP_006285169.1|  hypothetical protein CARUB_v10006514mg           81.6    3e-15   
ref|XP_009624060.1|  PREDICTED: WAT1-related protein At1g25270-like   80.1    3e-15   
ref|XP_004510125.1|  PREDICTED: WAT1-related protein At4g30420-like   81.3    3e-15   
ref|XP_003581230.2|  PREDICTED: WAT1-related protein At1g68170        81.6    3e-15   
ref|XP_004161682.1|  PREDICTED: auxin-induced protein 5NG4-like       81.3    3e-15   
emb|CDX68657.1|  BnaC01g07960D                                        81.3    3e-15   
ref|XP_003561231.2|  PREDICTED: WAT1-related protein At4g01440-like   81.3    3e-15   
ref|XP_003590293.1|  Auxin-induced protein 5NG4                       80.9    3e-15   
ref|XP_009373689.1|  PREDICTED: WAT1-related protein At1g43650-like   81.3    3e-15   
ref|XP_004142085.1|  PREDICTED: auxin-induced protein 5NG4-like       81.3    4e-15   
ref|XP_002869378.1|  predicted protein                                81.3    4e-15   
ref|NP_001172290.1|  Os01g0296900                                     80.9    4e-15   
ref|XP_010914061.1|  PREDICTED: WAT1-related protein At4g30420        81.3    4e-15   
ref|XP_006412708.1|  hypothetical protein EUTSA_v10025504mg           81.3    4e-15   
ref|XP_010515811.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...  80.9    4e-15   
ref|XP_009103541.1|  PREDICTED: WAT1-related protein At3g53210        80.9    4e-15   
ref|XP_006354548.1|  PREDICTED: WAT1-related protein At1g21890-like   80.1    4e-15   
emb|CDY45218.1|  BnaA07g12720D                                        80.9    4e-15   
ref|XP_010426957.1|  PREDICTED: WAT1-related protein At3g53210        80.9    4e-15   
emb|CDY39201.1|  BnaA03g50130D                                        80.9    5e-15   
ref|XP_009137916.1|  PREDICTED: WAT1-related protein At4g30420-like   80.9    5e-15   
ref|XP_002976850.1|  hypothetical protein SELMODRAFT_106053           80.5    5e-15   
gb|EMT15803.1|  Auxin-induced protein 5NG4                            78.2    5e-15   
ref|XP_002455503.1|  hypothetical protein SORBIDRAFT_03g012300        81.3    5e-15   
gb|AES60544.2|  auxin-induced 5NG4-like protein                       80.5    5e-15   
ref|XP_010233653.1|  PREDICTED: WAT1-related protein At3g30340-like   82.0    5e-15   
emb|CDY65383.1|  BnaCnng46840D                                        79.7    5e-15   
emb|CAE05944.3|  OSJNBb0088C09.3                                      80.5    5e-15   
ref|XP_006441413.1|  hypothetical protein CICLE_v10023533mg           80.5    5e-15   
ref|XP_006483798.1|  PREDICTED: WAT1-related protein At3g28050-li...  80.5    6e-15   
gb|EEC77269.1|  hypothetical protein OsI_15893                        80.1    6e-15   
ref|XP_009587592.1|  PREDICTED: WAT1-related protein At4g30420        80.9    6e-15   
gb|EEE60997.1|  hypothetical protein OsJ_14806                        80.1    6e-15   
gb|KDO68469.1|  hypothetical protein CISIN_1g019289mg                 79.3    6e-15   
ref|XP_002512549.1|  Auxin-induced protein 5NG4, putative             80.5    6e-15   
ref|XP_004309501.1|  PREDICTED: auxin-induced protein 5NG4-like       80.5    6e-15   
ref|XP_008654546.1|  PREDICTED: hypothetical protein isoform X8       79.7    6e-15   
ref|XP_010652361.1|  PREDICTED: WAT1-related protein At2g39510-like   80.5    6e-15   
ref|XP_003626705.1|  Auxin-induced protein 5NG4                       81.6    6e-15   
ref|XP_004242999.1|  PREDICTED: WAT1-related protein At4g30420 is...  80.5    7e-15   
ref|XP_010323229.1|  PREDICTED: WAT1-related protein At4g30420 is...  80.5    8e-15   
gb|EMS50456.1|  Auxin-induced protein 5NG4                            79.0    8e-15   
ref|XP_002309381.2|  hypothetical protein POPTR_0006s19150g           78.6    8e-15   
emb|CDP02894.1|  unnamed protein product                              80.1    8e-15   
ref|XP_009781457.1|  PREDICTED: WAT1-related protein At5g07050-like   80.1    9e-15   
ref|XP_010270886.1|  PREDICTED: WAT1-related protein At1g09380 is...  79.7    9e-15   
gb|AFK39686.1|  unknown                                               77.8    1e-14   
gb|KEH42713.1|  auxin-induced 5NG4-like protein                       79.7    1e-14   
ref|XP_008221761.1|  PREDICTED: WAT1-related protein At3g28050-li...  79.7    1e-14   
gb|EMS60466.1|  Auxin-induced protein 5NG4                            79.0    1e-14   
ref|XP_006856802.1|  hypothetical protein AMTR_s00055p00136850        79.0    1e-14   
ref|XP_006356109.1|  PREDICTED: WAT1-related protein At4g08300-like   79.7    1e-14   
ref|XP_006586353.1|  PREDICTED: WAT1-related protein At1g25270        79.7    1e-14   
ref|XP_002876193.1|  nodulin MtN21 family protein                     79.7    1e-14   
gb|KDO68468.1|  hypothetical protein CISIN_1g019289mg                 79.3    1e-14   
ref|XP_006343720.1|  PREDICTED: WAT1-related protein At4g30420-like   79.7    1e-14   
ref|XP_010274799.1|  PREDICTED: WAT1-related protein At1g44800-like   79.7    1e-14   
gb|KDO48741.1|  hypothetical protein CISIN_1g018219mg                 79.3    1e-14   
ref|XP_002980579.1|  hypothetical protein SELMODRAFT_112931           79.0    1e-14   
gb|KHG16428.1|  Auxin-induced 5NG4                                    79.7    1e-14   
ref|XP_006443864.1|  hypothetical protein CICLE_v10020769mg           79.3    1e-14   
ref|XP_006441412.1|  hypothetical protein CICLE_v10020812mg           79.3    1e-14   
ref|XP_004498117.1|  PREDICTED: WAT1-related protein At3g30340-li...  79.3    1e-14   
ref|XP_009622130.1|  PREDICTED: WAT1-related protein At5g07050-like   79.3    1e-14   
gb|KDP21318.1|  hypothetical protein JCGZ_21789                       79.0    1e-14   
ref|XP_002272440.2|  PREDICTED: WAT1-related protein At3g30340-like   79.3    2e-14   
gb|KEH42716.1|  auxin-induced 5NG4-like protein                       79.3    2e-14   
ref|XP_008654544.1|  PREDICTED: hypothetical protein isoform X6       79.7    2e-14   
ref|XP_006479558.1|  PREDICTED: WAT1-related protein At4g08300-like   79.3    2e-14   
ref|XP_003593114.1|  Auxin-induced protein 5NG4                       79.7    2e-14   
gb|AFK38302.1|  unknown                                               79.3    2e-14   
ref|XP_008654543.1|  PREDICTED: hypothetical protein isoform X5       79.7    2e-14   
gb|KHG29659.1|  Auxin-induced 5NG4                                    79.3    2e-14   
ref|XP_007036653.1|  Nodulin MtN21 /EamA-like transporter family ...  79.3    2e-14   
ref|XP_009108984.1|  PREDICTED: WAT1-related protein At4g30420-like   79.3    2e-14   
ref|XP_011098512.1|  PREDICTED: WAT1-related protein At5g40240-like   79.3    2e-14   
gb|KEH17794.1|  nodulin MtN21/EamA-like transporter family protein    78.2    2e-14   
ref|XP_010687695.1|  PREDICTED: WAT1-related protein At4g30420-like   79.3    2e-14   
ref|XP_010260724.1|  PREDICTED: WAT1-related protein At4g15540-like   79.0    2e-14   
ref|XP_011045738.1|  PREDICTED: WAT1-related protein At1g25270-like   79.0    2e-14   
ref|XP_002271326.3|  PREDICTED: WAT1-related protein At1g43650-like   79.0    2e-14   
ref|XP_003551846.1|  PREDICTED: WAT1-related protein At1g25270-like   79.3    2e-14   
ref|XP_006483800.1|  PREDICTED: WAT1-related protein At3g28050-li...  78.6    2e-14   
ref|XP_010911986.1|  PREDICTED: WAT1-related protein At1g25270-like   79.0    2e-14   
ref|XP_003557257.1|  PREDICTED: WAT1-related protein At3g30340-like   78.6    2e-14   
gb|AFK45047.1|  unknown                                               77.8    2e-14   
emb|CBI27642.3|  unnamed protein product                              78.2    2e-14   
ref|XP_008460633.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...  79.3    2e-14   
ref|XP_010312462.1|  PREDICTED: WAT1-related protein At1g68170        79.0    2e-14   
ref|XP_007222235.1|  hypothetical protein PRUPE_ppa007913mg           78.6    2e-14   
ref|XP_010438180.1|  PREDICTED: WAT1-related protein At4g30420        79.0    2e-14   
gb|KEH36637.1|  auxin-induced 5NG4-like protein                       78.6    3e-14   
gb|ACU21327.1|  unknown                                               77.0    3e-14   
gb|KDP38761.1|  hypothetical protein JCGZ_04114                       77.4    3e-14   
gb|KCW57045.1|  hypothetical protein EUGRSUZ_I02705                   77.4    3e-14   
ref|XP_008447554.1|  PREDICTED: WAT1-related protein At2g37460-like   78.6    3e-14   
ref|XP_006356485.1|  PREDICTED: WAT1-related protein At4g08300-like   78.6    3e-14   
ref|XP_009387482.1|  PREDICTED: WAT1-related protein At1g09380-like   78.6    3e-14   
gb|EMS47107.1|  Auxin-induced protein 5NG4                            77.4    3e-14   
ref|XP_006489750.1|  PREDICTED: WAT1-related protein At5g07050-like   78.2    3e-14   
ref|XP_008339318.1|  PREDICTED: WAT1-related protein At1g68170-like   77.4    3e-14   
ref|XP_003626704.1|  Auxin-induced protein 5NG4                       78.2    4e-14   
ref|XP_006493416.1|  PREDICTED: WAT1-related protein At5g64700-like   78.2    4e-14   
ref|XP_002528211.1|  Auxin-induced protein 5NG4, putative             78.6    4e-14   
ref|XP_006301709.1|  hypothetical protein CARUB_v10022166mg           78.2    4e-14   
gb|AET01178.2|  nodulin MtN21/EamA-like transporter family protein    78.2    4e-14   
emb|CDY03534.1|  BnaC03g67930D                                        78.2    4e-14   
gb|AET01180.2|  nodulin MtN21/EamA-like transporter family protein    78.2    4e-14   
ref|XP_004964298.1|  PREDICTED: WAT1-related protein At3g30340-like   78.2    4e-14   
ref|XP_002272105.2|  PREDICTED: WAT1-related protein At3g30340-like   78.2    4e-14   
ref|XP_010111532.1|  Auxin-induced protein 5NG4                       78.2    4e-14   
ref|XP_002298718.1|  hypothetical protein POPTR_0001s31530g           78.2    5e-14   
gb|KDP45025.1|  hypothetical protein JCGZ_01525                       76.3    5e-14   
ref|XP_010687694.1|  PREDICTED: WAT1-related protein At4g30420        78.2    5e-14   
ref|XP_002309379.2|  hypothetical protein POPTR_0006s19170g           78.2    5e-14   
ref|XP_010910686.1|  PREDICTED: WAT1-related protein At5g64700-like   76.6    5e-14   
gb|AFK33485.1|  unknown                                               77.8    5e-14   
ref|XP_006356107.1|  PREDICTED: WAT1-related protein At2g39510-like   77.8    5e-14   
ref|XP_008342773.1|  PREDICTED: WAT1-related protein At1g25270-like   78.2    5e-14   
gb|EEC70465.1|  hypothetical protein OsI_01511                        77.4    5e-14   
gb|KDO57625.1|  hypothetical protein CISIN_1g018804mg                 77.8    5e-14   
emb|CDO99217.1|  unnamed protein product                              77.8    5e-14   
ref|XP_010525756.1|  PREDICTED: WAT1-related protein At4g30420        78.2    6e-14   
ref|XP_007039289.1|  Nodulin MtN21 /EamA-like transporter family ...  77.8    6e-14   
ref|XP_007163305.1|  hypothetical protein PHAVU_001G223600g           77.8    6e-14   
gb|AFK41401.1|  unknown                                               78.2    6e-14   
gb|KDP45392.1|  hypothetical protein JCGZ_09641                       77.0    6e-14   
ref|XP_006851387.1|  hypothetical protein AMTR_s00040p00029850        78.2    6e-14   
ref|XP_006653393.1|  PREDICTED: WAT1-related protein At1g68170-like   77.8    6e-14   
gb|EYU25979.1|  hypothetical protein MIMGU_mgv1a009103mg              77.4    6e-14   
emb|CBI27639.3|  unnamed protein product                              79.0    6e-14   
ref|XP_002517371.1|  conserved hypothetical protein                   77.4    6e-14   
ref|XP_010261295.1|  PREDICTED: WAT1-related protein At1g68170        78.2    7e-14   
gb|ABN08304.1|  Integral membrane protein DUF6 containing protein     76.6    7e-14   
ref|XP_010550438.1|  PREDICTED: WAT1-related protein At3g53210        77.4    7e-14   
ref|XP_006444681.1|  hypothetical protein CICLE_v10020746mg           77.4    7e-14   
ref|XP_003589726.1|  Auxin-induced protein 5NG4                       77.0    7e-14   



>ref|XP_011078979.1| PREDICTED: WAT1-related protein At3g18200 [Sesamum indicum]
Length=367

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFVE+D K WQIQSGEEI  ILYAGI+SSG+VISLQTWCIQKGGPVFVASFQPVQTVLVA
Sbjct  239  AFVEKDPKRWQIQSGEEIFTILYAGIISSGLVISLQTWCIQKGGPVFVASFQPVQTVLVA  298

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
             MAF+I+GD+LY GG+IG V IV GLYLVLWGKT + +  SQ+ EETL K LL G+  D+
Sbjct  299  GMAFIILGDQLYFGGVIGAVLIVIGLYLVLWGKTTETRYQSQDTEETLTKHLLQGDNNDQ  358

Query  134  ECPVGADIP  108
            +CP G DIP
Sbjct  359  DCPDGVDIP  367



>ref|XP_006341703.1| PREDICTED: WAT1-related protein At3g18200-like [Solanum tuberosum]
Length=359

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 2/127 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD  HW+IQSGEEI LILYAGI+SSGIVISLQTWCIQKGGPV+VASFQPVQTVLVA
Sbjct  233  AFTERDPAHWKIQSGEEIYLILYAGIISSGIVISLQTWCIQKGGPVYVASFQPVQTVLVA  292

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            VMAF+I+GDRLY+GGI+GG+ I+ GLYLVLWGKT+++++ + E E TL K LL  N K E
Sbjct  293  VMAFLILGDRLYSGGILGGLLIMFGLYLVLWGKTEEKRVANTE-ETTLTKHLLAPNNK-E  350

Query  134  ECPVGAD  114
            E   GAD
Sbjct  351  EASTGAD  357



>ref|XP_004236428.1| PREDICTED: WAT1-related protein At3g18200 [Solanum lycopersicum]
Length=359

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 107/127 (84%), Gaps = 2/127 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD  HW+IQSGEEI LILYAGI+SSGIVISLQTWCIQKGGPV+VASFQPVQTVLVA
Sbjct  233  AFTERDPTHWKIQSGEEIYLILYAGIISSGIVISLQTWCIQKGGPVYVASFQPVQTVLVA  292

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            VMAF+I+GD+LY+GGI+GG+ I+ GLYLVLWGKT++++I + E E TL K LL    K E
Sbjct  293  VMAFLILGDQLYSGGILGGLLIMFGLYLVLWGKTEEKRIANTE-ETTLTKHLLPPTNK-E  350

Query  134  ECPVGAD  114
            E   GAD
Sbjct  351  EASTGAD  357



>gb|EYU44122.1| hypothetical protein MIMGU_mgv1a018428mg [Erythranthe guttata]
Length=354

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFVERD KHWQIQSGEEI  ILYAGI+SSG+VISLQTWCIQKGGPVFVASFQPVQTVLV 
Sbjct  232  AFVERDPKHWQIQSGEEIFTILYAGIISSGLVISLQTWCIQKGGPVFVASFQPVQTVLVT  291

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI--NSQENEETLKKPLLDGNKK  141
             MAFVI+GD++Y+GG+IG V I+ GLYLVLWGKT + +    SQ+ EE+L K LL G+K 
Sbjct  292  GMAFVILGDQIYSGGVIGAVLIIIGLYLVLWGKTAETRYQSQSQDTEESLTKHLLQGDKT  351

Query  140  D  138
            +
Sbjct  352  E  352



>ref|XP_009797192.1| PREDICTED: WAT1-related protein At3g18200 [Nicotiana sylvestris]
Length=361

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 109/129 (84%), Gaps = 2/129 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD   W+I SGEE+ LILYAGIVSSGIV+SLQTWCIQKGGPV+VA+FQPVQTVLVA
Sbjct  233  AFTERDPTRWKIHSGEEVYLILYAGIVSSGIVLSLQTWCIQKGGPVYVATFQPVQTVLVA  292

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEE-TLKKPLLDGNKKD  138
            VMAFV++GD+LY+GGI+GG+ IV GLYLVLWGK ++++I SQ+ EE TL K LL  + K 
Sbjct  293  VMAFVVLGDQLYSGGILGGLLIVVGLYLVLWGKNEEKRIVSQQTEEATLTKHLLASSSK-  351

Query  137  EECPVGADI  111
            EE  VGAD+
Sbjct  352  EESSVGADV  360



>ref|XP_002321499.1| hypothetical protein POPTR_0015s04130g [Populus trichocarpa]
 gb|EEF05626.1| hypothetical protein POPTR_0015s04130g [Populus trichocarpa]
Length=363

 Score =   151 bits (381),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFVE D+ HW+IQSGEE+  ILYAGIVSS IVISLQTWCI KGGPVFVA FQP+QT+LVA
Sbjct  237  AFVETDVNHWKIQSGEELFTILYAGIVSSAIVISLQTWCIHKGGPVFVAVFQPMQTILVA  296

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLL-DGNKKD  138
            +MA +I+GD+LY+GGIIG + I+ GLY VLWGK +++++  Q  EETL + LL D NK  
Sbjct  297  IMASLILGDQLYSGGIIGAILIMLGLYSVLWGKIEEKRVEIQNREETLTRNLLEDKNKDK  356

Query  137  EECP  126
            EE P
Sbjct  357  EEGP  360



>ref|XP_011000504.1| PREDICTED: WAT1-related protein At3g18200 [Populus euphratica]
Length=363

 Score =   151 bits (381),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFVE D  HW+IQSGEE+  ILYAGIVSS IVISLQTWCI KGGPVFVA FQP+QT+LVA
Sbjct  237  AFVETDFNHWKIQSGEELFTILYAGIVSSAIVISLQTWCIHKGGPVFVAVFQPMQTILVA  296

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLL-DGNKKD  138
            VMA +I+GD+LY+GGIIG + I+ GLY VLWGK +++++  Q  EETL + LL D NK  
Sbjct  297  VMASLILGDQLYSGGIIGAILIMLGLYSVLWGKIEEKRVEIQNREETLTRNLLEDKNKDK  356

Query  137  EECP  126
            EE P
Sbjct  357  EERP  360



>emb|CAN65389.1| hypothetical protein VITISV_038362 [Vitis vinifera]
Length=347

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFVE + + W+IQSGEE+  ILYAG+V++GIV SLQTWCIQKGGPVFVA FQP+QT+LVA
Sbjct  219  AFVETNPELWKIQSGEELFTILYAGVVAAGIVFSLQTWCIQKGGPVFVAVFQPMQTLLVA  278

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            VMA +I+GD+LY GGIIG   I+ GLY VLWGKT+++++ SQ+ E TL K LLD   +D+
Sbjct  279  VMASLILGDQLYLGGIIGAALIMIGLYSVLWGKTEEKRVGSQDQERTLTKHLLDTENRDK  338

Query  134  ECPVGADIP  108
            +    +DIP
Sbjct  339  DDAPASDIP  347



>ref|XP_002277607.1| PREDICTED: WAT1-related protein At3g18200 [Vitis vinifera]
 emb|CBI15513.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFVE + + W+IQSGEE+  ILYAG+V++GIV SLQTWCIQKGGPVFVA FQP+QT+LVA
Sbjct  236  AFVETNPELWKIQSGEELFTILYAGVVAAGIVFSLQTWCIQKGGPVFVAVFQPMQTLLVA  295

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            VMA +I+GD+LY GGIIG   I+ GLY VLWGKT+++++ SQ+ E TL K LLD   +D+
Sbjct  296  VMASLILGDQLYLGGIIGAALIMIGLYSVLWGKTEEKRVGSQDQERTLTKHLLDTENRDK  355

Query  134  ECPVGADIP  108
            +    +DIP
Sbjct  356  DDAPASDIP  364



>ref|XP_009587259.1| PREDICTED: WAT1-related protein At3g18200 isoform X2 [Nicotiana 
tomentosiformis]
Length=354

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 105/129 (81%), Gaps = 3/129 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD   W+I SGEE+ LILYAGIVSSGIV+SLQTWCIQKGGPV+VA+FQPVQTVLVA
Sbjct  227  AFTERDPTRWKIHSGEEVYLILYAGIVSSGIVLSLQTWCIQKGGPVYVATFQPVQTVLVA  286

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI-NSQENEETLKKPLLDGNKKD  138
            VMAFV++GD+LY+GGI+GG+ IV GLYLVLWGK ++++I N    E TL K LL  + ++
Sbjct  287  VMAFVVLGDQLYSGGILGGLLIVVGLYLVLWGKNEEKRIVNKHTEEATLTKHLLASSSEE  346

Query  137  EECPVGADI  111
                VGAD+
Sbjct  347  SS--VGADV  353



>ref|XP_009587258.1| PREDICTED: WAT1-related protein At3g18200 isoform X1 [Nicotiana 
tomentosiformis]
Length=363

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 105/129 (81%), Gaps = 3/129 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD   W+I SGEE+ LILYAGIVSSGIV+SLQTWCIQKGGPV+VA+FQPVQTVLVA
Sbjct  236  AFTERDPTRWKIHSGEEVYLILYAGIVSSGIVLSLQTWCIQKGGPVYVATFQPVQTVLVA  295

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI-NSQENEETLKKPLLDGNKKD  138
            VMAFV++GD+LY+GGI+GG+ IV GLYLVLWGK ++++I N    E TL K LL  + ++
Sbjct  296  VMAFVVLGDQLYSGGILGGLLIVVGLYLVLWGKNEEKRIVNKHTEEATLTKHLLASSSEE  355

Query  137  EECPVGADI  111
                VGAD+
Sbjct  356  SS--VGADV  362



>ref|XP_003620353.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES76571.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=362

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 100/130 (77%), Gaps = 5/130 (4%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E D + W+IQS EE+  ILYAGIV+SGIVISLQTWCIQKGGPVFVA FQP+QT LVA
Sbjct  237  AFTENDFEKWKIQSSEELFTILYAGIVASGIVISLQTWCIQKGGPVFVAVFQPIQTFLVA  296

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            VMA +I+GD+LY+GGIIG + IV GLYLVLWGKT ++K     NE  L KPLLD  ++++
Sbjct  297  VMAALILGDQLYSGGIIGAILIVLGLYLVLWGKTNEKK----ANESALTKPLLDSKEENK  352

Query  134  ECPVGA-DIP  108
                 + DIP
Sbjct  353  VIDAASKDIP  362



>gb|KHN23738.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=359

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 103/130 (79%), Gaps = 5/130 (4%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL++W+IQS EE+ +ILYAGI++SG+VISLQTWCIQKGGPVFVA FQPVQT+LVA
Sbjct  234  AFAENDLENWKIQSLEELFIILYAGIIASGVVISLQTWCIQKGGPVFVAVFQPVQTILVA  293

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            VMA +I+GD+LY GG+IG V IV GLYLVLWGKT ++K+     E +L  PLL   ++++
Sbjct  294  VMAALILGDQLYPGGLIGAVLIVLGLYLVLWGKTNEKKV----TEPSLTNPLLKAEEENK  349

Query  134  EC-PVGADIP  108
            E   V  DIP
Sbjct  350  ETVAVPKDIP  359



>ref|XP_003533350.1| PREDICTED: WAT1-related protein At3g18200 [Glycine max]
Length=359

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 103/130 (79%), Gaps = 5/130 (4%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL++W+IQS EE+ +ILYAGI++SG+VISLQTWCIQKGGPVFVA FQPVQT+LVA
Sbjct  234  AFAENDLENWKIQSLEELFIILYAGIIASGVVISLQTWCIQKGGPVFVAVFQPVQTILVA  293

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            VMA +I+GD+LY GG+IG V IV GLYLVLWGKT ++K+     E +L  PLL   ++++
Sbjct  294  VMAALILGDQLYPGGLIGAVLIVLGLYLVLWGKTNEKKV----TEPSLTNPLLKAEEENK  349

Query  134  EC-PVGADIP  108
            E   V  DIP
Sbjct  350  ETVAVPKDIP  359



>ref|XP_004160446.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=362

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
             FVE D ++W+IQS EE+  ILYAGIV+SGIV SLQTWCI K  PVFVA FQP+QTVLVA
Sbjct  237  GFVETDYQYWKIQSVEELFTILYAGIVASGIVFSLQTWCIHKSDPVFVAVFQPLQTVLVA  296

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MAF+I+GDRL++GG+IG V I  GLYLVLWGK+K++ +  +E ++ LK PLLD  K+D+
Sbjct  297  IMAFLILGDRLFSGGVIGAVLITLGLYLVLWGKSKEKAL--EEEDKCLKHPLLDDQKEDQ  354

Query  134  E  132
            E
Sbjct  355  E  355



>ref|XP_010036916.1| PREDICTED: WAT1-related protein At3g18200 [Eucalyptus grandis]
 gb|KCW48574.1| hypothetical protein EUGRSUZ_K02243 [Eucalyptus grandis]
Length=364

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F+E D + W+IQSGEE+  ILYAGIV+S +V+SLQTWCI KGGPVFVA FQPVQT+LVAV
Sbjct  236  FMETDTERWKIQSGEELFTILYAGIVASAVVLSLQTWCIHKGGPVFVAVFQPVQTLLVAV  295

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNK-KDE  135
            MA    GD+LY+G ++G V I  GLY VLWGKT++RK+  Q  E TL K LL+    +D 
Sbjct  296  MAIFTFGDQLYSGRLLGAVLITLGLYSVLWGKTEERKMEVQHKEGTLTKHLLEAAATEDG  355

Query  134  ECPVGADIP  108
               V +DIP
Sbjct  356  RSQVASDIP  364



>gb|KHN44603.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=359

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 103/130 (79%), Gaps = 5/130 (4%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL++W+IQS EE+ +ILYAGI++SG+VISLQTWCIQKGGPVFVA FQPVQT+LVA
Sbjct  234  AFAENDLENWKIQSLEELFIILYAGIIASGVVISLQTWCIQKGGPVFVAVFQPVQTILVA  293

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            VMA +I+GD+LY+GG+IG + IV GLYLVLWGK  ++K+     E +L  PLL   ++++
Sbjct  294  VMAALILGDQLYSGGLIGAILIVLGLYLVLWGKNNEKKV----TEPSLTNPLLKAEEENK  349

Query  134  EC-PVGADIP  108
            E   V  DIP
Sbjct  350  ETVSVPKDIP  359



>ref|XP_004137548.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN63848.1| hypothetical protein Csa_1G024800 [Cucumis sativus]
Length=362

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
             FVE D ++W+IQS EE+  ILYAGIV+SGIV SLQTWCI K  PVFVA FQP+QTVLVA
Sbjct  237  GFVETDYQYWKIQSVEELFTILYAGIVASGIVFSLQTWCIHKSDPVFVAVFQPLQTVLVA  296

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MAF+I+GDRL++GG+IG V I  GLYLVLWGK+K++ +  +E ++ LK PLLD  K+++
Sbjct  297  IMAFLILGDRLFSGGVIGAVLITLGLYLVLWGKSKEKAL--EEEDKCLKHPLLDDQKEEQ  354

Query  134  E  132
            E
Sbjct  355  E  355



>ref|XP_003528964.2| PREDICTED: WAT1-related protein At3g18200-like [Glycine max]
Length=528

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 103/130 (79%), Gaps = 5/130 (4%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL++W+IQS EE+ +ILYAGI++SG+VISLQTWCIQKGGPVFVA FQPVQT+LVA
Sbjct  403  AFAENDLENWKIQSLEELFIILYAGIIASGVVISLQTWCIQKGGPVFVAVFQPVQTILVA  462

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            VMA +I+GD+LY+GG+IG + IV GLYLVLWGK  ++K+     E +L  PLL   ++++
Sbjct  463  VMAALILGDQLYSGGLIGAILIVLGLYLVLWGKNNEKKV----TEPSLTNPLLKAEEENK  518

Query  134  EC-PVGADIP  108
            E   V  DIP
Sbjct  519  ETVSVPKDIP  528



>ref|XP_004512876.1| PREDICTED: WAT1-related protein At3g18200-like [Cicer arietinum]
Length=362

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 99/131 (76%), Gaps = 7/131 (5%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL+ W+IQS EE+  ILYAGIV+SGIVISLQTWCIQKGGPVFVA FQP+QT LVA
Sbjct  237  AFTENDLEKWKIQSAEELFTILYAGIVASGIVISLQTWCIQKGGPVFVAVFQPIQTFLVA  296

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
             MA  I+GD+LY+GG+IG +FI+ GLYLVLWGKT ++K      E +L KPLLD  K+D 
Sbjct  297  FMAAFILGDQLYSGGVIGAIFIMFGLYLVLWGKTNEQK----AIEPSLTKPLLD-TKEDN  351

Query  134  EC--PVGADIP  108
            E       DIP
Sbjct  352  EVIDKASKDIP  362



>ref|XP_008453450.1| PREDICTED: WAT1-related protein At3g18200 [Cucumis melo]
Length=360

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 95/120 (79%), Gaps = 2/120 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
             FVE D ++W+IQS EE+  ILYAGIV+SGIV SLQTWCI K  PVFVA FQP+QT LVA
Sbjct  237  GFVETDYQYWKIQSAEELFTILYAGIVASGIVFSLQTWCIHKSDPVFVAVFQPLQTFLVA  296

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MAF+I+GDRL++GG+IG V I  GLYLVLWGK+K++ +  +E ++ LK PLLD  K++ 
Sbjct  297  IMAFLILGDRLFSGGVIGAVLITLGLYLVLWGKSKEKAL--EEEDKCLKHPLLDDQKEEN  354



>ref|XP_010695638.1| PREDICTED: WAT1-related protein At3g18200 [Beta vulgaris subsp. 
vulgaris]
Length=371

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E D +HW+I S EE+  ILYAGIV+SG+VISLQTWCI KGGPV VA FQPVQT+LVA
Sbjct  243  AFTETDYEHWKIASLEEVYTILYAGIVASGLVISLQTWCIAKGGPVCVAVFQPVQTILVA  302

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA + +GD+LY+GGI+G + I  GLYLVLWGK+K+  + +Q++E+ L K L++   + +
Sbjct  303  IMAAMFLGDQLYSGGILGSIIITLGLYLVLWGKSKEYIMVNQDSEDQLTKHLIENGDEAQ  362

Query  134  ECPVGADIP  108
            E  + +DIP
Sbjct  363  EDFITSDIP  371



>ref|XP_010110114.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXC25201.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=362

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 101/132 (77%), Gaps = 7/132 (5%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFVE D + W+I SGEE+  ILYAGI+SSG+VI+LQTWCI KGGPVFVA FQP+QT LVA
Sbjct  235  AFVETDFERWKIVSGEEVFTILYAGIISSGVVIALQTWCIHKGGPVFVAVFQPLQTFLVA  294

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDG---NK  144
            +MA +I+ D+LY+GGI+G V I+ GLYLVLWGK ++R++ +Q   E  K PLLD     K
Sbjct  295  IMATLILHDQLYSGGIVGAVLIMLGLYLVLWGKNRERRMENQ--REPFKVPLLDEESIEK  352

Query  143  KDEECPVGADIP  108
            +D E  V +DIP
Sbjct  353  QDGE--VESDIP  362



>ref|XP_007152707.1| hypothetical protein PHAVU_004G152600g [Phaseolus vulgaris]
 gb|ESW24701.1| hypothetical protein PHAVU_004G152600g [Phaseolus vulgaris]
Length=360

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E D ++W+IQS EE+ +ILYAGI++SG+VISLQTWCIQKGGPVFVA FQPVQT+LVA
Sbjct  234  AFAEDDFENWKIQSLEELSIILYAGIIASGVVISLQTWCIQKGGPVFVAVFQPVQTILVA  293

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
             MA +I+GD+LY+GG+IG +FIV GLYLVLWGK  ++K+       +L  PLL   ++++
Sbjct  294  FMAVLILGDQLYSGGLIGAIFIVLGLYLVLWGKNNEKKVT---KSSSLTNPLLKAEEENK  350

Query  134  ECPVGA-DIP  108
            E      DIP
Sbjct  351  EIDAAPKDIP  360



>ref|XP_002520409.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41964.1| conserved hypothetical protein [Ricinus communis]
Length=266

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFVE DL +W+IQSGEE+  ILYAGIV+S I+ SLQTWCI KGGPVFVA FQP+QT+LVA
Sbjct  155  AFVETDLTNWKIQSGEELFTILYAGIVASSIIFSLQTWCIDKGGPVFVAIFQPMQTLLVA  214

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKK  165
            +MA +I+GD+LY G IIG + I+ GLY VLWGK++++++ + E  ETL +
Sbjct  215  IMASLILGDQLYFGRIIGAILIMLGLYSVLWGKSEEKRVETDEKPETLTR  264



>ref|XP_010926206.1| PREDICTED: WAT1-related protein At3g18200-like [Elaeis guineensis]
Length=359

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E D++ W++ SGEE++ ILYAG+V+SG+  SLQ WCI +GGP+F A FQPVQTV+VA
Sbjct  231  AFTENDMERWKVHSGEELLTILYAGLVASGVAFSLQIWCIDRGGPLFAAVFQPVQTVVVA  290

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA ++ GD+LY+GGIIG + I+ GLY VLWGK++++K  +QE E+ L + LL+     +
Sbjct  291  IMAAIMFGDQLYSGGIIGSILIMVGLYFVLWGKSQEKKAGNQEKEKDLTRHLLEEENSHK  350

Query  134  ECPVGADIP  108
                 ADIP
Sbjct  351  YVAPAADIP  359



>ref|XP_010549098.1| PREDICTED: WAT1-related protein At3g18200 [Tarenaya hassleriana]
Length=361

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE D+ +W I S EE++ ILYAGIV+SGIV+ LQTWCI KGGPVFVA FQP+QT+LVA 
Sbjct  234  FVETDINNWVIVSWEELLTILYAGIVASGIVVYLQTWCIHKGGPVFVAVFQPLQTLLVAA  293

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            MAF+++GD+LY+G I+G VFI+ GLYLVLWGKT++R+    + +E+L K LL      E
Sbjct  294  MAFLLLGDQLYSGRIVGAVFIMLGLYLVLWGKTEERRTMRNQEDESLTKHLLGDETTGE  352



>ref|XP_009403946.1| PREDICTED: auxin-induced protein 5NG4-like [Musa acuminata subsp. 
malaccensis]
Length=361

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD++ W++ SG E+  ILYAG+V+SGI  SLQ WCI +GGP+FVA FQPVQTV+VA
Sbjct  233  AFSERDIERWKVHSGVELFTILYAGLVASGISFSLQIWCIDRGGPLFVAVFQPVQTVVVA  292

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA VI+GD+ Y+GGIIG + IV GLY VLWGK++++K   Q  EE ++  LLD  K  +
Sbjct  293  IMAAVILGDQFYSGGIIGSILIVFGLYFVLWGKSEEKKATEQVMEEDVRGHLLDQEKSHK  352

Query  134  ECPVGADIP  108
            +    +DIP
Sbjct  353  QNAAVSDIP  361



>ref|NP_001030721.1| nodulin MtN21-like transporter UMAMIT4 [Arabidopsis thaliana]
 gb|AEE76063.1| nodulin MtN21-like transporter UMAMIT4 [Arabidopsis thaliana]
Length=253

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 95/120 (79%), Gaps = 3/120 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI K GPVFVA FQP+QT+LVA 
Sbjct  126  FVETDLNNWIIVSWEELFTILYAGIIASGLVVYLQTWCIYKSGPVFVAVFQPLQTLLVAA  185

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI---NSQENEETLKKPLLDGNKK  141
            MAF+I+GD+LY+GGI+G VFI+ GLYLVLWGK ++RK+    SQ++ E+L K LL+   K
Sbjct  186  MAFLILGDQLYSGGIVGAVFIMLGLYLVLWGKNEERKLALEESQQDPESLTKHLLEAQHK  245



>gb|KFK39156.1| hypothetical protein AALP_AA3G207600 [Arabis alpina]
Length=362

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI KGGPVFVA FQP+QT+LVA 
Sbjct  233  FVETDLNNWIIVSWEELFTILYAGIIASGLVVYLQTWCIYKGGPVFVAVFQPLQTLLVAA  292

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI----NSQENEETLKKPLLDGNK  144
            MAF+I+GD+LY+G I+G V I+ GLYLVLWGK ++RK      SQ++ E+L K LL+   
Sbjct  293  MAFLILGDQLYSGSIVGAVLIMLGLYLVLWGKNEERKQVLEETSQQDPESLTKHLLEAQH  352

Query  143  KDE  135
            K +
Sbjct  353  KKD  355



>ref|XP_010250292.1| PREDICTED: WAT1-related protein At3g18200-like [Nelumbo nucifera]
Length=356

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E D +HW+I  GEE++ +LYAG+V++ +V +LQ WCI KGGP+FVA FQPV TVLVA
Sbjct  228  AFAETDGEHWKIHFGEELLTVLYAGVVATAVVYALQMWCIDKGGPIFVAVFQPVSTVLVA  287

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA +I+GD+LYTGGIIG + I+ GLY VLWG+ +++K   Q NEE L + L++     +
Sbjct  288  IMACLILGDQLYTGGIIGVILIIIGLYSVLWGRNEEKKFKDQGNEEILTRHLMNEKNARK  347

Query  134  ECPVGADIP  108
            E  V ++IP
Sbjct  348  ESEVVSNIP  356



>emb|CDY40602.1| BnaC06g02180D [Brassica napus]
Length=299

 Score =   131 bits (330),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 98/131 (75%), Gaps = 8/131 (6%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE D  +W I S EE+  ILYAGIV+SG+V+ LQTWCI KGGPVFVA FQP+QT+LVA 
Sbjct  169  FVETDPNNWIIGSWEELFTILYAGIVASGLVVYLQTWCIYKGGPVFVAVFQPLQTLLVAA  228

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKD-RKINS----QENEETLKKPLLDGN  147
            MAFV++GD+LY+G I+G VFI+ GLYLVLWGKT++ R++N     +E+ E+L K LL   
Sbjct  229  MAFVVLGDQLYSGSIVGSVFIMLGLYLVLWGKTEEKRQLNEASSQEEDHESLTKNLLGDE  288

Query  146  KK---DEECPV  123
             K   D E PV
Sbjct  289  TKEAQDSESPV  299



>ref|XP_010249759.1| PREDICTED: WAT1-related protein At3g18200-like [Nelumbo nucifera]
Length=368

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            + VE D   W I S EE++ ILYAG+VSSGIVI+LQTWCI KGGPVFVA FQPVQTVLVA
Sbjct  238  SLVETDTDRWIIHSKEELLTILYAGVVSSGIVIALQTWCIHKGGPVFVAVFQPVQTVLVA  297

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLD  153
            +MA +I+ D+LY+GGIIG + I+ GLY VLWGK +++K+ +QE EE+L K LL 
Sbjct  298  IMASLILRDQLYSGGIIGAILIMIGLYSVLWGKNEEKKVIAQEKEESLTKHLLH  351



>ref|NP_188448.1| nodulin MtN21-like transporter UMAMIT4 [Arabidopsis thaliana]
 gb|AEE76062.1| nodulin MtN21-like transporter UMAMIT4 [Arabidopsis thaliana]
Length=360

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 95/123 (77%), Gaps = 3/123 (2%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI K GPVFVA FQP+QT+LVA 
Sbjct  233  FVETDLNNWIIVSWEELFTILYAGIIASGLVVYLQTWCIYKSGPVFVAVFQPLQTLLVAA  292

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI---NSQENEETLKKPLLDGNKK  141
            MAF+I+GD+LY+GGI+G VFI+ GLYLVLWGK ++RK+    SQ++ E+L K LL+   K
Sbjct  293  MAFLILGDQLYSGGIVGAVFIMLGLYLVLWGKNEERKLALEESQQDPESLTKHLLEAQHK  352

Query  140  DEE  132
               
Sbjct  353  KSN  355



>sp|Q9LV20.1|WTR17_ARATH RecName: Full=WAT1-related protein At3g18200 [Arabidopsis thaliana]
 dbj|BAB02033.1| nodulin-like protein [Arabidopsis thaliana]
Length=383

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 95/123 (77%), Gaps = 3/123 (2%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI K GPVFVA FQP+QT+LVA 
Sbjct  256  FVETDLNNWIIVSWEELFTILYAGIIASGLVVYLQTWCIYKSGPVFVAVFQPLQTLLVAA  315

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI---NSQENEETLKKPLLDGNKK  141
            MAF+I+GD+LY+GGI+G VFI+ GLYLVLWGK ++RK+    SQ++ E+L K LL+   K
Sbjct  316  MAFLILGDQLYSGGIVGAVFIMLGLYLVLWGKNEERKLALEESQQDPESLTKHLLEAQHK  375

Query  140  DEE  132
               
Sbjct  376  KSN  378



>ref|XP_006406637.1| hypothetical protein EUTSA_v10021001mg [Eutrema salsugineum]
 gb|ESQ48090.1| hypothetical protein EUTSA_v10021001mg [Eutrema salsugineum]
Length=361

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 94/122 (77%), Gaps = 4/122 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI KGGPVFVA FQP+QT+LVA 
Sbjct  233  FVETDLNNWIIVSWEELFTILYAGIIASGLVVYLQTWCIYKGGPVFVAVFQPLQTLLVAA  292

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI----NSQENEETLKKPLLDGNK  144
            MAF+++GD+LY+G I+G VFI+ GLYLVLWGK ++RK      SQ++ E+L K LL+   
Sbjct  293  MAFLVLGDQLYSGRIVGAVFIMLGLYLVLWGKNEERKQVLEETSQQDPESLTKHLLEAQH  352

Query  143  KD  138
            + 
Sbjct  353  RK  354



>emb|CDY51934.1| BnaAnng11110D [Brassica napus]
Length=295

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 93/117 (79%), Gaps = 4/117 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI KGGPVFVA FQP+QT+LVA 
Sbjct  177  FVETDLNNWIIVSWEELFTILYAGIIASGLVVYLQTWCIYKGGPVFVAVFQPLQTLLVAA  236

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI----NSQENEETLKKPLLD  153
            MAF+++GD+LY+G ++G VFI+ GLYLVLWGK ++R+      SQ++ E+L K LL+
Sbjct  237  MAFLVLGDQLYSGSVLGAVFIMLGLYLVLWGKNQERRQMVEETSQQDPESLTKHLLE  293



>ref|XP_010487731.1| PREDICTED: WAT1-related protein At3g18200-like [Camelina sativa]
Length=358

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 94/120 (78%), Gaps = 3/120 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI K GPVFVA FQP+QT+LVA 
Sbjct  231  FVETDLNNWIIASWEELFTILYAGIIASGLVVYLQTWCIYKSGPVFVAVFQPLQTLLVAA  290

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI---NSQENEETLKKPLLDGNKK  141
            MAF+I+GD+LY+G I+G VFI++GLYLVLWGK ++RK     SQ++ E+L K LL+   K
Sbjct  291  MAFLILGDQLYSGRIVGAVFIMSGLYLVLWGKNEERKQVLEESQQDPESLTKHLLEAQHK  350



>ref|XP_010465903.1| PREDICTED: WAT1-related protein At3g18200 [Camelina sativa]
Length=358

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 93/120 (78%), Gaps = 3/120 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI K GPVFVA FQP+QT+LVA 
Sbjct  231  FVETDLNNWIIASWEELFTILYAGIIASGLVVYLQTWCIYKSGPVFVAVFQPLQTLLVAA  290

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI---NSQENEETLKKPLLDGNKK  141
            MAF+I+GD+LY+G I+G VFI+ GLYLVLWGK ++RK     SQ++ E+L K LL+   K
Sbjct  291  MAFLILGDQLYSGRIVGAVFIMLGLYLVLWGKNEERKQVLEESQQDPESLTKHLLEAQHK  350



>ref|XP_009113449.1| PREDICTED: WAT1-related protein At3g18200-like [Brassica rapa]
Length=360

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 94/121 (78%), Gaps = 4/121 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI KGGP FVA FQP+QT+LVA 
Sbjct  232  FVETDLNNWIIVSWEELFTILYAGIIASGLVVYLQTWCIYKGGPAFVAVFQPLQTLLVAA  291

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI----NSQENEETLKKPLLDGNK  144
            MAF+++GD+LY+G I+G VFI+ GLYLVLWGK ++R+      SQ++ E+L K LL+ + 
Sbjct  292  MAFIVLGDQLYSGRIVGAVFIMLGLYLVLWGKNEERRQVLEETSQQDPESLTKHLLEAHD  351

Query  143  K  141
            K
Sbjct  352  K  352



>ref|XP_002885242.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61501.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 94/122 (77%), Gaps = 3/122 (2%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI K GPVFVA FQP+QT+LVA 
Sbjct  234  FVETDLNNWIIVSWEELFTILYAGIIASGLVVYLQTWCIYKSGPVFVAVFQPLQTLLVAA  293

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI---NSQENEETLKKPLLDGNKK  141
            MAF+I+GD+LY+G I+G VFI+ GLYLVLWGK ++RK+    SQ++ E+L K LL+   +
Sbjct  294  MAFLILGDQLYSGRIVGAVFIMLGLYLVLWGKNEERKLVLEESQQDPESLTKNLLEAQHQ  353

Query  140  DE  135
              
Sbjct  354  KS  355



>ref|XP_009147948.1| PREDICTED: WAT1-related protein At3g18200-like [Brassica rapa]
Length=360

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 99/132 (75%), Gaps = 9/132 (7%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE D  +W I S EE+  ILYAGIV+SG+V+ LQTWCI KGGPVFVA FQP+QT+LVA 
Sbjct  229  FVETDPNNWIIGSWEELFTILYAGIVASGLVVYLQTWCIYKGGPVFVAVFQPLQTLLVAA  288

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKD-RKIN---SQE--NEETLKKPLLDG  150
            MAFV++GD+LY+G I+G VFI+ GLYLVLWGKT++ R++N   SQE  +E +L K LL  
Sbjct  289  MAFVVLGDQLYSGSIVGSVFIMLGLYLVLWGKTEEKRQVNEASSQEEDHESSLTKNLLGD  348

Query  149  NKK---DEECPV  123
              K   D E PV
Sbjct  349  ETKEAHDSESPV  360



>emb|CDX93689.1| BnaA06g03590D [Brassica napus]
Length=360

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 99/132 (75%), Gaps = 9/132 (7%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE D  +W I S EE+  ILYAGIV+SG+V+ LQTWCI KGGPVFVA FQP+QT+LVA 
Sbjct  229  FVETDPNNWIIGSWEELFTILYAGIVASGLVVYLQTWCIYKGGPVFVAVFQPLQTLLVAA  288

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKD-RKIN---SQE--NEETLKKPLLDG  150
            MAFV++GD+LY+G I+G VFI+ GLYLVLWGKT++ R++N   SQE  +E +L K LL  
Sbjct  289  MAFVVLGDQLYSGSIVGSVFIMLGLYLVLWGKTEEKRQVNEASSQEEDHESSLTKNLLGD  348

Query  149  NKK---DEECPV  123
              K   D E PV
Sbjct  349  ETKEAQDSESPV  360



>ref|XP_009589798.1| PREDICTED: WAT1-related protein At3g18200-like isoform X1 [Nicotiana 
tomentosiformis]
Length=357

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD ++W+IQSGEE++ ILY GI++SG+V SL TWCIQKGGPV  A+FQP+QTV+VA
Sbjct  230  AFTERDPRNWRIQSGEEVLTILYVGIINSGVVYSLVTWCIQKGGPVLTATFQPLQTVVVA  289

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENE-ETLKKPLLDGNKKD  138
            VMAFV +GD+LY+GG+ GG+ + AGLYLVLWGKT++ KI +Q+ E  TL+K L+D  +  
Sbjct  290  VMAFVFLGDQLYSGGLFGGILVAAGLYLVLWGKTEEEKIVNQDKEGATLRKHLVD-QENT  348

Query  137  EECPVGADI  111
            EECP+   +
Sbjct  349  EECPITVQV  357



>emb|CDX95542.1| BnaC01g34340D [Brassica napus]
Length=305

 Score =   129 bits (324),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 94/121 (78%), Gaps = 4/121 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAG+++SG+V+ LQTWCI KGGPVFVA FQP+QT+LVA 
Sbjct  177  FVETDLNNWIIVSWEELFTILYAGLIASGLVVYLQTWCIYKGGPVFVAVFQPLQTLLVAA  236

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK----INSQENEETLKKPLLDGNK  144
            MAF+++GD+LY+G I+G VFI+ GLYLVLWGK ++R+      +Q++ E+L K LL+   
Sbjct  237  MAFLVLGDQLYSGRIVGAVFIMLGLYLVLWGKNEERRQVLEQTTQQDPESLTKHLLEAQD  296

Query  143  K  141
            K
Sbjct  297  K  297



>ref|XP_010506531.1| PREDICTED: WAT1-related protein At3g18200-like [Camelina sativa]
Length=358

 Score =   130 bits (326),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 93/120 (78%), Gaps = 3/120 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI K GPVFVA FQP+QT++VA 
Sbjct  231  FVETDLNNWIIASWEELFTILYAGIIASGLVVYLQTWCIYKSGPVFVAVFQPLQTLIVAA  290

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI---NSQENEETLKKPLLDGNKK  141
            MAF+I+GD+LY+G I+G VFI+ GLYLVLWGK ++RK     SQ++ E+L K LL+   K
Sbjct  291  MAFLILGDQLYSGRIVGAVFIMLGLYLVLWGKNEERKQVLGESQQDPESLTKHLLEAQHK  350



>ref|XP_009135570.1| PREDICTED: WAT1-related protein At3g18200 [Brassica rapa]
Length=351

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 93/117 (79%), Gaps = 4/117 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI KGGPVFVA FQP+QT+LVA 
Sbjct  233  FVETDLNNWIIVSWEELFTILYAGIIASGLVVYLQTWCIYKGGPVFVAVFQPLQTLLVAA  292

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI----NSQENEETLKKPLLD  153
            MAF+++GD+LY+G ++G VFI+ GLYLVLWGK ++R+      SQ++ E+L K LL+
Sbjct  293  MAFLVLGDQLYSGSVLGAVFIMLGLYLVLWGKNQERRQMVEETSQQDPESLTKHLLE  349



>emb|CDX75960.1| BnaC03g40430D [Brassica napus]
Length=295

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 92/117 (79%), Gaps = 4/117 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI KGGPVFVA FQP+QT+LVA 
Sbjct  177  FVETDLNNWIIVSWEELFTILYAGIIASGLVVYLQTWCIYKGGPVFVAVFQPLQTLLVAA  236

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI----NSQENEETLKKPLLD  153
            MAF+++GD+LY+G ++G VFI+ GLYLVLWGK ++R+      S ++ E+L K LL+
Sbjct  237  MAFLVLGDQLYSGSVLGAVFIMLGLYLVLWGKNQERRQMVEETSPQDPESLNKHLLE  293



>ref|XP_009380328.1| PREDICTED: auxin-induced protein 5NG4-like [Musa acuminata subsp. 
malaccensis]
Length=362

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E+D++ W++ SG E+  ILYAG+V+SG+  SLQ WCI +GGP+FVA FQPVQTV+VA
Sbjct  233  AFAEKDIERWKVHSGGELFTILYAGLVASGVSFSLQIWCIDRGGPLFVAVFQPVQTVVVA  292

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEET-LKKPLLDGNKKD  138
            +MA VI+GD+LY+GGIIG + IV GLY VLWGK++++K   +  E   L++ LLD     
Sbjct  293  IMAAVILGDQLYSGGIIGSILIVLGLYFVLWGKSEEKKPTKEALENNDLRRLLLDQENLH  352

Query  137  EECPVGADIP  108
            +E     DIP
Sbjct  353  KENAAVTDIP  362



>emb|CDY18510.1| BnaA01g26850D [Brassica napus]
Length=360

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 93/121 (77%), Gaps = 4/121 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE DL +W I S EE+  ILYAGI++SG+V+ LQTWCI KGGPVFVA FQP+QT+LVA 
Sbjct  232  FVETDLNNWIIVSWEELFTILYAGIIASGLVVYLQTWCIYKGGPVFVAVFQPLQTLLVAA  291

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI----NSQENEETLKKPLLDGNK  144
            MAF+++GD+LY+G I+G VFI+ GLYLVLWGK ++R+      + ++ E+L K LL+   
Sbjct  292  MAFLVLGDQLYSGRIVGAVFIMLGLYLVLWGKNEERRQVLEETTPQDPESLTKHLLEAQD  351

Query  143  K  141
            K
Sbjct  352  K  352



>ref|XP_006299289.1| hypothetical protein CARUB_v10015443mg [Capsella rubella]
 gb|EOA32187.1| hypothetical protein CARUB_v10015443mg [Capsella rubella]
Length=359

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 92/120 (77%), Gaps = 3/120 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE D+ +W I S EE+  ILYAGI++SG+V+ LQTWCI K GPVFVA FQP+QT+LVA 
Sbjct  232  FVETDVNNWIIASWEELFTILYAGIIASGLVVYLQTWCIYKSGPVFVAVFQPLQTLLVAA  291

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI---NSQENEETLKKPLLDGNKK  141
            MA +I+GD+LY+G I+G VFI+ GLYLVLWGK ++RK     SQ++ E+L K LL+   K
Sbjct  292  MALLILGDQLYSGRIVGAVFIMLGLYLVLWGKNEERKQVLEESQQDPESLTKHLLEAQHK  351



>ref|XP_009780288.1| PREDICTED: WAT1-related protein At3g18200-like [Nicotiana sylvestris]
Length=356

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD ++W+IQSG+E++ ILY GI+ SG+V SL TWCIQKGGPV  A+FQP+QTV+VA
Sbjct  229  AFTERDPRNWRIQSGKEVLTILYVGIIFSGVVYSLVTWCIQKGGPVLTATFQPLQTVVVA  288

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENE-ETLKKPLLDGNKKD  138
            V+AFV +G+RLY+GG+ GG+ I AG+YLVLWGK ++ KI +Q+ E  TL+K LLD  +  
Sbjct  289  VLAFVFLGNRLYSGGVFGGILIAAGVYLVLWGKNEEEKIANQDKEGATLRKHLLD-QENT  347

Query  137  EECPVGADI  111
            EECPV   +
Sbjct  348  EECPVTVQV  356



>gb|EEC73065.1| hypothetical protein OsI_07025 [Oryza sativa Indica Group]
Length=298

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 93/129 (72%), Gaps = 3/129 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E D+  W++ SGEE+  ILYAG+V+SG+ +SLQ WCI +GG +F A FQPVQTV+VA
Sbjct  173  AFWENDIGKWRLHSGEELFTILYAGLVASGVALSLQIWCIDRGGALFTAIFQPVQTVMVA  232

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA VI+GD LYTGGIIG V IV GLYLVLWGK +++K NS  N+  L + LL   +   
Sbjct  233  IMAAVILGDLLYTGGIIGAVLIVIGLYLVLWGKNEEKKSNS--NQPDLSRHLLS-EESSR  289

Query  134  ECPVGADIP  108
               V +D+P
Sbjct  290  PTTVTSDVP  298



>dbj|BAD15605.1| nodulin-like protein [Oryza sativa Japonica Group]
 dbj|BAD16512.1| nodulin-like protein [Oryza sativa Japonica Group]
Length=356

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 93/129 (72%), Gaps = 3/129 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E D+  W++ SGEE+  ILYAG+V+SG+ +SLQ WCI +GG +F A FQPVQTV+VA
Sbjct  231  AFWENDIGKWRLHSGEELFTILYAGLVASGVALSLQIWCIDRGGALFTAIFQPVQTVMVA  290

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA VI+GD LYTGGIIG V IV GLYLVLWGK +++K NS  N+  L + LL   +   
Sbjct  291  IMAAVILGDLLYTGGIIGAVLIVIGLYLVLWGKNEEKKSNS--NQPDLSRHLLS-EESSR  347

Query  134  ECPVGADIP  108
               V +D+P
Sbjct  348  PTTVTSDVP  356



>ref|XP_004954875.1| PREDICTED: protein WALLS ARE THIN 1-like [Setaria italica]
Length=361

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E D   W++ SG E+  +LYAG+V+SG+ +SLQ WCI +GG +F A FQPVQTV+VA
Sbjct  233  AFCENDSDKWKLHSGGELFTVLYAGLVASGVALSLQIWCIDRGGALFTAIFQPVQTVMVA  292

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA V++GD LYTGG+IG V IV GLY VLWGK ++++ ++Q NE  L + LL      E
Sbjct  293  IMAAVMLGDELYTGGVIGAVLIVIGLYFVLWGKNEEKRSSNQGNEPELSRHLLREESSPE  352

Query  134  ECPVGADIP  108
               +  DIP
Sbjct  353  PKSMTNDIP  361



>ref|XP_006643724.1| PREDICTED: WAT1-related protein At3g18200-like [Oryza brachyantha]
Length=377

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 93/133 (70%), Gaps = 9/133 (7%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL  W++ SG E+  ILYAG+V+SG+  +LQ WCI +GGP+F A FQPVQTV VA
Sbjct  240  AFTEEDLSRWKVNSGGELFTILYAGLVASGVAFALQIWCIDRGGPLFTAVFQPVQTVAVA  299

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINS------QENEETLKKPLL-  156
            VMA +I+GD+LYTGGIIG V IV GLY VLWGK++++K  +      Q   + + + LL 
Sbjct  300  VMAAIILGDQLYTGGIIGAVLIVIGLYFVLWGKSEEKKSKNTQGHSVQAGGDDITRRLLG  359

Query  155  --DGNKKDEECPV  123
              D ++KDEE  V
Sbjct  360  QEDASRKDEEAAV  372



>ref|XP_010279405.1| PREDICTED: WAT1-related protein At3g18200-like isoform X2 [Nelumbo 
nucifera]
Length=335

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F E D +HW+I S +E+++ILYAG+V++GIV +LQ WCI KG PVFVA FQPV TV+VAV
Sbjct  208  FAETDSEHWKIHSVQELLIILYAGVVATGIVYALQMWCIDKGRPVFVAVFQPVSTVIVAV  267

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            +A +I+ D+LYTGGIIG + I+ GLY VLWG+ ++RK   ++ E   +  L + N   +E
Sbjct  268  LACLILSDQLYTGGIIGVILIIIGLYSVLWGRNEERKFRERKEEALTRHLLCEKNTVCQE  327

Query  131  CPVGADIP  108
              V +DIP
Sbjct  328  SAVVSDIP  335



>ref|NP_001041856.1| Os01g0117900 [Oryza sativa Japonica Group]
 dbj|BAB17350.1| putative nodulin-like protein 5NG4 [Oryza sativa Japonica Group]
 dbj|BAB55472.1| putative nodulin-like protein 5NG4 [Oryza sativa Japonica Group]
 dbj|BAF03770.1| Os01g0117900 [Oryza sativa Japonica Group]
 gb|EAZ10323.1| hypothetical protein OsJ_00158 [Oryza sativa Japonica Group]
 dbj|BAG87905.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96818.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96831.1| unnamed protein product [Oryza sativa Japonica Group]
Length=374

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 94/135 (70%), Gaps = 11/135 (8%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL  W++ SG E+  ILYAG+V+SG+  +LQ WCI +GGP+F A FQPVQTV VA
Sbjct  235  AFTEEDLSRWKVNSGSELFTILYAGLVASGVAFALQIWCIDRGGPLFTAVFQPVQTVAVA  294

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINS--------QENEETLKKPL  159
            VMA +I+GD+LY+GGIIG V IV GLY VLWGK++++K  +        Q   + +++ L
Sbjct  295  VMAAIILGDQLYSGGIIGAVLIVIGLYFVLWGKSEEKKSKNNNLQDQPVQGGGDDIRRHL  354

Query  158  L---DGNKKDEECPV  123
            L   D ++KDEE  V
Sbjct  355  LGQEDASRKDEEAAV  369



>gb|EAY72293.1| hypothetical protein OsI_00148 [Oryza sativa Indica Group]
Length=375

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 95/136 (70%), Gaps = 12/136 (9%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL  W++ SG E+  ILYAG+V+SG+  +LQ WCI +GGP+F A FQPVQTV VA
Sbjct  235  AFTEEDLSRWKVNSGSELFTILYAGLVASGVAFALQIWCIDRGGPLFTAVFQPVQTVAVA  294

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEET---------LKKP  162
            VMA +I+GD+LY+GGIIG V IV GLY VLWGK++++K  +   +++         +++ 
Sbjct  295  VMAAIILGDQLYSGGIIGAVLIVIGLYFVLWGKSEEKKSKNNLQDQSSVQGGGGDDIRRH  354

Query  161  LL---DGNKKDEECPV  123
            LL   D ++KDEE  V
Sbjct  355  LLGQEDASRKDEEAAV  370



>ref|XP_010279402.1| PREDICTED: WAT1-related protein At3g18200-like isoform X1 [Nelumbo 
nucifera]
Length=356

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F E D +HW+I S +E+++ILYAG+V++GIV +LQ WCI KG PVFVA FQPV TV+VAV
Sbjct  229  FAETDSEHWKIHSVQELLIILYAGVVATGIVYALQMWCIDKGRPVFVAVFQPVSTVIVAV  288

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            +A +I+ D+LYTGGIIG + I+ GLY VLWG+ ++RK   ++ E   +  L + N   +E
Sbjct  289  LACLILSDQLYTGGIIGVILIIIGLYSVLWGRNEERKFRERKEEALTRHLLCEKNTVCQE  348

Query  131  CPVGADIP  108
              V +DIP
Sbjct  349  SAVVSDIP  356



>ref|XP_003573156.2| PREDICTED: protein WALLS ARE THIN 1 [Brachypodium distachyon]
Length=351

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E+D ++W++ SG E+  ILYAG+V+SGI +SLQ WCI KGG +F A FQPVQTV+VA
Sbjct  221  AFSEKDPENWKLHSGGELFTILYAGLVASGIALSLQIWCIHKGGALFTAIFQPVQTVMVA  280

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR-KINS-QENEETLKKPLLDGNKK  141
            ++A  ++GD LYTGG+IG V IV GLY VLWGK ++R K +S Q +EE L + LL+    
Sbjct  281  ILAAAVLGDELYTGGVIGAVLIVIGLYFVLWGKNEERSKTDSDQSSEEDLSRHLLNEEPS  340

Query  140  DEECPVGADIP  108
             E   V  D+P
Sbjct  341  REAKCVTNDVP  351



>emb|CDM80504.1| unnamed protein product [Triticum aestivum]
Length=369

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E D+  W++QS  E+  ILYAG+V+SG+  +LQ WCI +GGP+F A FQPVQTV VA
Sbjct  240  AFTEEDMSRWKVQSVGELFTILYAGLVASGVAFALQIWCIDRGGPLFTAVFQPVQTVAVA  299

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLL--DGNKK  141
            VMA +I+GD+LYTGGIIG V IV GLY VLWGK++++K  SQ+ E  + + LL  DG + 
Sbjct  300  VMAAIILGDQLYTGGIIGAVLIVIGLYFVLWGKSEEKKTRSQDPE--MARHLLGEDGGEA  357

Query  140  DEE  132
            D++
Sbjct  358  DKD  360



>gb|EEE56883.1| hypothetical protein OsJ_06528 [Oryza sativa Japonica Group]
Length=298

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 92/129 (71%), Gaps = 3/129 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E D+  W++ SGEE+  ILYAG+V+SG+ +SLQ WCI +GG +F A FQPVQTV+VA
Sbjct  173  AFWENDIGKWRLHSGEELFTILYAGLVASGVALSLQIWCIDRGGALFTAIFQPVQTVMVA  232

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA VI+G  LYTGGIIG V IV GLYLVLWGK +++K NS  N+  L + LL   +   
Sbjct  233  IMAAVILGYLLYTGGIIGAVLIVIGLYLVLWGKNEEKKSNS--NQPDLSRHLLS-EESSR  289

Query  134  ECPVGADIP  108
               V +D+P
Sbjct  290  PTTVTSDVP  298



>gb|ADE77565.1| unknown [Picea sitchensis]
Length=220

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD  HW+++SG E+  +LYAGIV+SGI  S+Q WCI +GGPVFVA +QPVQT+ VA
Sbjct  57   AFFERDPSHWKMRSGGEVFTVLYAGIVASGIAFSVQIWCIDRGGPVFVAVYQPVQTIAVA  116

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKIN  195
            +MA +I+G++ Y GGIIG + I+AGLYLVLWGK++++++N
Sbjct  117  IMASIILGEQFYLGGIIGAILIIAGLYLVLWGKSEEKRLN  156



>dbj|BAJ86174.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92575.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97482.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL  W+++SG E+  ILYAG+V+SG+  +LQ WCI +GGP+F A FQPVQTV VA
Sbjct  245  AFTEVDLSRWKVRSGGELFTILYAGLVASGVAFALQIWCIDRGGPLFTAVFQPVQTVAVA  304

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            VMA VI+GD+LYTGGIIG V IV GLY VLWGK++++K  SQ++ E + + LLDG   D+
Sbjct  305  VMAAVILGDQLYTGGIIGAVLIVIGLYFVLWGKSEEKKTRSQQDPE-MARHLLDGGAADK  363

Query  134  ECPVGADI  111
            +  V A +
Sbjct  364  DQRVSATV  371



>tpg|DAA57086.1| TPA: nodulin-like protein [Zea mays]
Length=254

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 89/129 (69%), Gaps = 8/129 (6%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL  W+++SG E+  ILYAG+V+SG+  +LQ WCI +GGP+F A FQPVQTV VA
Sbjct  119  AFTEEDLSRWKVRSGGELFTILYAGLVASGVAFALQIWCIDRGGPLFTAVFQPVQTVAVA  178

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLK------KPLLD  153
            VMA  I+GD+LYTGGIIG V IV GLY VLWGK+ ++K      ++ L       + LL 
Sbjct  179  VMASAILGDQLYTGGIIGAVLIVIGLYFVLWGKSAEKKGARNLLQDQLAQGADVTRHLLG  238

Query  152  G--NKKDEE  132
            G  + KDEE
Sbjct  239  GEASAKDEE  247



>ref|XP_006844042.1| hypothetical protein AMTR_s00006p00239950 [Amborella trichopoda]
 gb|ERN05717.1| hypothetical protein AMTR_s00006p00239950 [Amborella trichopoda]
Length=322

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFVE D +HW IQS EE+  ILYAG V+SGI  S+Q WCI +GGP+FVA +QPVQT+ VA
Sbjct  191  AFVEADAQHWIIQSKEELFTILYAGFVASGIAFSVQIWCIDRGGPMFVAVYQPVQTIAVA  250

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA + +GD+LYTGGI+G + IV GLY VL GK+K+  +  +   + L++ L+  +K   
Sbjct  251  IMASMSLGDQLYTGGIVGAILIVVGLYSVLRGKSKENNLKGEGKGDKLRQRLVSNDKSQA  310

Query  134  E---CPVGADIP  108
            E     V +D+P
Sbjct  311  EGAVIAVSSDMP  322



>ref|NP_001149629.1| nodulin-like protein [Zea mays]
 gb|ACF82498.1| unknown [Zea mays]
 gb|ACG36160.1| nodulin-like protein [Zea mays]
Length=368

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 89/130 (68%), Gaps = 8/130 (6%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL  W+++SG E+  ILYAG+V+SG+  +LQ WCI +GGP+F A FQPVQTV VA
Sbjct  233  AFTEEDLSRWKVRSGGELFTILYAGLVASGVAFALQIWCIDRGGPLFTAVFQPVQTVAVA  292

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLK------KPLLD  153
            VMA  I+GD+LYTGGIIG V IV GLY VLWGK+ ++K      ++ L       + LL 
Sbjct  293  VMASAILGDQLYTGGIIGAVLIVIGLYFVLWGKSAEKKGARNLLQDQLAQGADVTRHLLG  352

Query  152  G--NKKDEEC  129
            G  + KDEE 
Sbjct  353  GEASAKDEEA  362



>ref|XP_006393371.1| hypothetical protein EUTSA_v10012396mg [Eutrema salsugineum]
 gb|ESQ30657.1| hypothetical protein EUTSA_v10012396mg [Eutrema salsugineum]
Length=279

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 93/121 (77%), Gaps = 7/121 (6%)
 Frame = -3

Query  473  KHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMAFVII  294
            ++W I S EE+  ILYAGIV+SG+V+ LQTWC+ KGGPVFVA+F P+QT+LVA M FV++
Sbjct  151  RNWIIVSWEELFTILYAGIVASGLVVYLQTWCMYKGGPVFVAAFLPLQTLLVAGMTFVLL  210

Query  293  GDRLYTggiiggvfivaGLYLVLWGKTKDRK-INSQENE-----ETLKKPLL-DGNKKDE  135
            GD+LY+G I+  +FI+ GLYLVLW KT++R+ +N + N+     E+L + LL D NK+ +
Sbjct  211  GDQLYSGSIVAAMFIMLGLYLVLWSKTEERRQVNEESNQEEEDHESLTRHLLGDVNKEAQ  270

Query  134  E  132
            +
Sbjct  271  Q  271



>sp|Q6J163.1|5NG4_PINTA RecName: Full=Auxin-induced protein 5NG4 [Pinus taeda]
 gb|AAT37621.1| nodulin-like protein 5NG4 [Pinus taeda]
Length=410

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL+HW+I SG E+  ILYAG V+SGI  S+Q WCI +GGPVFVA +QPVQT+ VA
Sbjct  248  AFFETDLEHWKIHSGGELFTILYAGFVASGIAFSVQIWCIDRGGPVFVAVYQPVQTIAVA  307

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETL  171
            +MA +I+G++ Y GGI G + I+ GLYLVLWGK++++++   + + ++
Sbjct  308  IMASIILGEQFYLGGIFGAILIIIGLYLVLWGKSEEKRLGLLQAKSSM  355



>ref|XP_007017667.1| Walls Are Thin 1 [Theobroma cacao]
 gb|EOY14892.1| Walls Are Thin 1 [Theobroma cacao]
Length=383

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   SG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  246  AFLERDPQAWMFHSGGELFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  305

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA + +G+  Y GGIIG V I+AGLYLVL+GK+++RK  +QE       P    N+   
Sbjct  306  IMASIALGEEFYLGGIIGAVLIIAGLYLVLYGKSEERKFAAQEKAAIQSTPEHSNNRTPS  365

Query  134  E  132
             
Sbjct  366  H  366



>ref|XP_011074627.1| PREDICTED: protein WALLS ARE THIN 1-like [Sesamum indicum]
Length=392

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 89/128 (70%), Gaps = 2/128 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERDL+ W + SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  255  AFMERDLQAWLVHSGAELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  314

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA  ++G++ Y GG++G V I+ GLYLVLWGK ++RK  +Q  +  ++ P    N +  
Sbjct  315  IMASFLLGEQFYLGGMMGAVLIITGLYLVLWGKNEERKFATQ--KRMIQSPTDHSNNRTS  372

Query  134  ECPVGADI  111
               + + I
Sbjct  373  TPHIKSSI  380



>ref|XP_008811716.1| PREDICTED: probable fructose-bisphosphate aldolase 3, chloroplastic 
[Phoenix dactylifera]
Length=710

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E D++ W++ SGEE+  ILYAG+V+SG   SLQTWCI  GGP+F A FQPVQTV+VA
Sbjct  223  AFTENDIERWKVHSGEELFTILYAGLVASGAAFSLQTWCIDTGGPLFAAVFQPVQTVMVA  282

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINS  192
            +++  I GD+LY+GGIIG + I+ GLY VLWGK++++K+ S
Sbjct  283  ILSATIFGDQLYSGGIIGSILIMVGLYFVLWGKSQEKKMAS  323



>gb|KHG27290.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=384

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD   W   SG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  247  AFAERDPPAWMFHSGGELFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  306

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKP  162
            +MA + +G+  Y GGIIG V I+ GLYLVLWGK+++RK  +QE       P
Sbjct  307  IMASIALGEEFYLGGIIGAVLIIVGLYLVLWGKSQERKFAAQEKGAIQSTP  357



>ref|XP_006830632.1| hypothetical protein AMTR_s00120p00105340 [Amborella trichopoda]
 gb|ERM98048.1| hypothetical protein AMTR_s00120p00105340 [Amborella trichopoda]
Length=383

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 90/134 (67%), Gaps = 14/134 (10%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W I SG E+  ILYAG V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  248  AFMERDFDAWTIHSGGELFTILYAGFVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  307

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQ--------------ENEE  177
            ++A + +G++ Y GGIIG V IV GLYLVLWGK++++K+N +               + +
Sbjct  308  IVASIALGEQFYLGGIIGAVLIVGGLYLVLWGKSEEKKLNKEAITSNTSSHEISHAHSTK  367

Query  176  TLKKPLLDGNKKDE  135
            TL +PLL  +   E
Sbjct  368  TLTQPLLTSSTVAE  381



>gb|EMT15640.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=373

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%), Gaps = 4/130 (3%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL  W++QSG E+  ILYAG+V+SG+  +LQ WCI +GGP+F A FQPVQTV VA
Sbjct  244  AFTEEDLSRWKVQSGGELFTILYAGLVASGVAFALQIWCIDRGGPLFTAVFQPVQTVAVA  303

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLL--DGNKK  141
            VMA VI+GD+LYTGGIIG V IV GLY VLWGK++++K  SQ+ E  + + LL  DG   
Sbjct  304  VMAAVILGDQLYTGGIIGAVLIVIGLYFVLWGKSEEKKTRSQDPE--MARHLLGEDGGAA  361

Query  140  DEECPVGADI  111
            D++  V   +
Sbjct  362  DKDQQVNTTV  371



>ref|XP_006646778.1| PREDICTED: protein WALLS ARE THIN 1-like [Oryza brachyantha]
Length=381

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W ++SG E++ ILYAG V+SG+  ++QTWCI +GGPVFVA +QPVQT+LVA
Sbjct  243  AFLERDAAAWVVRSGPELLTILYAGFVASGVAFAVQTWCIHRGGPVFVAVYQPVQTLLVA  302

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            VMA +++G+  Y GGIIG V IVAGLYLVLWGK ++R 
Sbjct  303  VMASLLLGEHFYLGGIIGAVLIVAGLYLVLWGKNQERA  340



>ref|XP_002453161.1| hypothetical protein SORBIDRAFT_04g001020 [Sorghum bicolor]
 gb|EES06137.1| hypothetical protein SORBIDRAFT_04g001020 [Sorghum bicolor]
Length=386

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 90/134 (67%), Gaps = 13/134 (10%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A VERD   W + SG E++ ILYAG+V+SG+  ++QTWCI +GGPVFVA +QPVQT+LVA
Sbjct  251  AVVERDAAAWTLTSGSELLTILYAGLVASGVAFAVQTWCIDRGGPVFVAVYQPVQTLLVA  310

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK---------INSQENE----ET  174
            VMA +++G++ Y GG++G V I+AGLYLVLWGK+++R          +   E +      
Sbjct  311  VMASLLLGEQFYLGGVMGAVLIIAGLYLVLWGKSEERALAAKLAAAGVGDDEPDAAAASC  370

Query  173  LKKPLLDGNKKDEE  132
            LK+PLL      E 
Sbjct  371  LKQPLLPSPATLES  384



>ref|XP_006647228.1| PREDICTED: WAT1-related protein At3g18200-like [Oryza brachyantha]
Length=358

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 91/131 (69%), Gaps = 3/131 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E D+  W++ SGEE+  ILYAG+V+SG+ +SLQ WCI +GG +F A FQPVQTV+VA
Sbjct  229  AFWENDIGKWRLHSGEELFTILYAGMVASGVALSLQIWCIDRGGALFTAIFQPVQTVMVA  288

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEET--LKKPLLDGNKK  141
            +MA VI+GD+LYTGGIIG   IV GLY VLWGK +++K +S        L + LL   + 
Sbjct  289  IMAAVILGDQLYTGGIIGAALIVIGLYFVLWGKNEEKKSSSSNRSNEPDLSRHLLS-EES  347

Query  140  DEECPVGADIP  108
                PV +D+P
Sbjct  348  SRPTPVISDVP  358



>ref|NP_001172775.1| Os02g0114050 [Oryza sativa Japonica Group]
 dbj|BAD07925.1| putative nodulin MtN21 [Oryza sativa Japonica Group]
 dbj|BAD07647.1| putative nodulin MtN21 [Oryza sativa Japonica Group]
 gb|EAZ21482.1| hypothetical protein OsJ_05091 [Oryza sativa Japonica Group]
 gb|EEC72342.1| hypothetical protein OsI_05563 [Oryza sativa Indica Group]
 dbj|BAH91504.1| Os02g0114050 [Oryza sativa Japonica Group]
Length=386

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W ++SG E+  ILYAG V+SG+  ++QTWCI +GGPVFVA +QPVQT+LVA
Sbjct  244  AFLERDAAAWAVRSGSELFTILYAGFVASGVAFAVQTWCIHRGGPVFVAVYQPVQTLLVA  303

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR  204
            VMA +++G++ + GGIIG V IVAGLYLVLWGK+++R
Sbjct  304  VMASLLLGEQFHLGGIIGAVLIVAGLYLVLWGKSQER  340



>ref|XP_004967997.1| PREDICTED: protein WALLS ARE THIN 1-like [Setaria italica]
Length=379

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 94/135 (70%), Gaps = 12/135 (9%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL  W+++SG E+  ILYAG+V+SG+  +LQ WCI +GGP+F A FQPVQTV VA
Sbjct  239  AFTEEDLSRWKVRSGGELFTILYAGLVASGVAFALQIWCIDRGGPLFTAVFQPVQTVAVA  298

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK---INSQENEET-----LKKPL  159
            VMA  I+GD+LYTGGIIG V IV GLY VLWGK+ ++K   +N Q+ E+      + + L
Sbjct  299  VMAAAILGDQLYTGGIIGAVLIVIGLYFVLWGKSAEKKKAAMNHQDQEQGGGGGDMTRHL  358

Query  158  L----DGNKKDEECP  126
            L    D + K+EE P
Sbjct  359  LGGDGDASAKEEEAP  373



>gb|KHG10968.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=386

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ERD + W   SG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  248  AVFERDAQAWVFHSGGELFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  307

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +M+ V +G+  Y GGIIG V I+ GLYLVLWGK+++RK  +QE           GN +  
Sbjct  308  IMSSVALGEEFYLGGIIGAVLIITGLYLVLWGKSEERKFAAQEKAAIQSSTAEHGNSRAS  367

Query  134  E  132
             
Sbjct  368  S  368



>ref|XP_010105267.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXC04202.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=382

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A VER+ K W   +G E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  248  AIVEREAKAWIFTTGGEVFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  307

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKK  141
            +MA V +G+  Y GGIIG V I+ GLYLVLWGK++++K  +QE       P    N +
Sbjct  308  IMASVALGEEFYLGGIIGAVLIIVGLYLVLWGKSEEKKFMAQEKAAIQPAPEHSNNSR  365



>ref|XP_004147843.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN60004.1| Auxin-induced protein 5NG4 [Cucumis sativus]
Length=394

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (69%), Gaps = 1/121 (1%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ERD + W   SG EI  +LYAG+V+SGI  ++Q WCIQ+GGPVFVA +QPVQT++VA
Sbjct  253  AIAERDAQAWLFHSGGEIFSVLYAGVVASGIAFAVQIWCIQRGGPVFVAVYQPVQTLVVA  312

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            VMA   +G++ + GGIIG V I+AGLY VLWGK+++RK  + E    L  P   GN +  
Sbjct  313  VMASFALGEQFFLGGIIGAVLIIAGLYFVLWGKSEERKF-ALEKAAILSAPDHSGNNRTP  371

Query  134  E  132
             
Sbjct  372  P  372



>gb|EYU36746.1| hypothetical protein MIMGU_mgv1a007773mg [Erythranthe guttata]
Length=395

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFVERD + W + SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  258  AFVERDPQAWLVHSGAELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  317

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +M   ++G+  Y GGIIG V I+ GLY VLWGK ++RK    +  E +  P   GN  + 
Sbjct  318  IMTSALLGEEFYLGGIIGAVLIITGLYFVLWGKNEERKFGLAQKAE-IHSPAEHGNNSEP  376

Query  134  E  132
             
Sbjct  377  S  377



>ref|XP_008466514.1| PREDICTED: protein WALLS ARE THIN 1-like [Cucumis melo]
Length=393

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (69%), Gaps = 1/121 (1%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ERD + W   SG EI  +LYAG+V+SGI  ++Q WCIQ+GGPVFVA +QPVQT++VA
Sbjct  253  AIAERDAQAWLFHSGGEIFSVLYAGVVASGIAFAVQIWCIQRGGPVFVAVYQPVQTLVVA  312

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            VMA   +G++ + GGIIG V I+AGLY VLWGK+++RK  + E    L  P   GN +  
Sbjct  313  VMASFALGEQFFLGGIIGAVLIIAGLYFVLWGKSEERKF-ALEKAAILSAPDHSGNNRTP  371

Query  134  E  132
             
Sbjct  372  P  372



>gb|EYU32879.1| hypothetical protein MIMGU_mgv1a008013mg [Erythranthe guttata]
Length=387

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFVERD + W + SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  252  AFVERDPQAWLVHSGSELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  311

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEET  174
            +MA +++G+  Y GGIIG V I++GLY VLWGK ++RK   Q   E+
Sbjct  312  IMASLLLGEEFYLGGIIGAVLIISGLYFVLWGKNEERKFAQQAAIES  358



>ref|XP_011028934.1| PREDICTED: protein WALLS ARE THIN 1-like [Populus euphratica]
Length=399

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W  QSG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  262  AFMERDPQAWIFQSGGELFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  321

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKP  162
            +MA + +G+  Y GGIIG V I+ GLYLVLWGK++++K  + E       P
Sbjct  322  IMASIALGEEFYLGGIIGAVLIIIGLYLVLWGKSEEKKFLALEKAAIQSTP  372



>ref|XP_006665158.1| PREDICTED: protein WALLS ARE THIN 1-like, partial [Oryza brachyantha]
Length=162

 Score =   107 bits (267),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W   SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  20   AFMERDADAWAFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  79

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            +MA + +G++ Y GGIIG V I+AGLYLVLWGK ++R 
Sbjct  80   IMASLTLGEKFYLGGIIGAVLIIAGLYLVLWGKNQERA  117



>ref|XP_009387815.1| PREDICTED: protein WALLS ARE THIN 1-like [Musa acuminata subsp. 
malaccensis]
Length=387

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W+  SG E+  ILYAG V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  243  AFIERDAEAWKFHSGSELFTILYAGFVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  302

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKK-PLLDG  150
            +MA + + +  Y GGIIG VFI+AGLYLVLWGK+++R   ++E   T    P  DG
Sbjct  303  IMASIALREEFYLGGIIGAVFIIAGLYLVLWGKSEERAFAAKEAALTASSTPDHDG  358



>ref|NP_001132593.1| uncharacterized protein LOC100194065 [Zea mays]
 gb|ACF81508.1| unknown [Zea mays]
 gb|AFW66802.1| hypothetical protein ZEAMMB73_878596 [Zea mays]
Length=395

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ERD   W + SG E++ ILYAG+V+SG+  ++QTWCI +GGPVFVA +QPVQT+LVA
Sbjct  259  AVFERDAAAWALGSGSELLTILYAGLVASGVAFAVQTWCIDRGGPVFVAVYQPVQTLLVA  318

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR  204
            VMA +++G++ Y GGI+G VFI+AGLYLVLWGK+++R
Sbjct  319  VMASLLLGEQFYLGGIMGAVFIIAGLYLVLWGKSQER  355



>ref|XP_009386212.1| PREDICTED: protein WALLS ARE THIN 1-like [Musa acuminata subsp. 
malaccensis]
Length=387

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W   SG E+  ILYAG V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  247  AFIERDADAWIFHSGGELFTILYAGFVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  306

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G++ Y GGIIG VFI+AGLYLVLWGK+++R   ++E
Sbjct  307  IMASIALGEQFYLGGIIGAVFIIAGLYLVLWGKSEERAFAAKE  349



>ref|XP_002307691.1| nodulin MtN21 family protein [Populus trichocarpa]
 gb|ABK93351.1| unknown [Populus trichocarpa]
 gb|EEE94687.1| nodulin MtN21 family protein [Populus trichocarpa]
Length=384

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   SG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  247  AFMERDPQAWIFHSGGELFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  306

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKP  162
            +MA + +G+  Y GGIIG V I+AGLYLVLWGK++++K  + E       P
Sbjct  307  IMASIALGEEFYLGGIIGAVLIIAGLYLVLWGKSEEKKFLALEKAAIQAAP  357



>ref|XP_010061252.1| PREDICTED: protein WALLS ARE THIN 1-like [Eucalyptus grandis]
 gb|KCW68178.1| hypothetical protein EUGRSUZ_F01847 [Eucalyptus grandis]
Length=385

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 82/136 (60%), Gaps = 17/136 (13%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD   W I SG E+  + YAG+V+SGI  ++Q WCI KGGPVFVA +QPVQT++VA
Sbjct  249  AFTERDPHAWLIHSGGELFSVFYAGVVASGIAFAVQIWCIDKGGPVFVAVYQPVQTLVVA  308

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI-----------------NSQE  186
            +MA V +G+  Y GGIIG V IV GLYLVLWGK ++RK                   S  
Sbjct  309  IMASVALGEEFYLGGIIGAVLIVVGLYLVLWGKNEERKFAKPKVAIQSTQDHGNNRTSSH  368

Query  185  NEETLKKPLLDGNKKD  138
               +L +PLL     D
Sbjct  369  IAPSLAQPLLPPTSDD  384



>ref|XP_007222733.1| hypothetical protein PRUPE_ppa006496mg [Prunus persica]
 gb|EMJ23932.1| hypothetical protein PRUPE_ppa006496mg [Prunus persica]
Length=409

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 4/125 (3%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ERD + W   +G E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  269  AIFERDAQAWIFHNGGEVFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  328

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKIN--SQENEET--LKKPLLDGN  147
            +MA V +G+  Y GGIIG V I+ GLYLVLWGK ++RK    +Q N     L  P    N
Sbjct  329  IMASVALGEEFYLGGIIGAVLIIVGLYLVLWGKNEERKFGLIAQANSRAGILSTPEHANN  388

Query  146  KKDEE  132
            +K + 
Sbjct  389  RKSQA  393



>gb|ABK93004.1| unknown [Populus trichocarpa]
Length=384

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   SG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  247  AFMERDPQAWIFHSGGELFTILYAGVVASGIAFAVQIWCIGRGGPVFVAVYQPVQTLVVA  306

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKP  162
            +MA + +G+  Y GGIIG V I+AGLYLVLWGK++++K  + E       P
Sbjct  307  IMASIALGEEFYLGGIIGAVLIIAGLYLVLWGKSEEKKFLALEKAAIQAAP  357



>ref|XP_007222734.1| hypothetical protein PRUPE_ppa006496mg [Prunus persica]
 gb|EMJ23933.1| hypothetical protein PRUPE_ppa006496mg [Prunus persica]
Length=409

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 4/125 (3%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ERD + W   +G E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  269  AIFERDAQAWIFHNGGEVFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  328

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKIN--SQENEET--LKKPLLDGN  147
            +MA V +G+  Y GGIIG V I+ GLYLVLWGK ++RK    +Q N     L  P    N
Sbjct  329  IMASVALGEEFYLGGIIGAVLIIVGLYLVLWGKNEERKFGLIAQANSRAGILSTPEHANN  388

Query  146  KKDEE  132
            +K + 
Sbjct  389  RKSQA  393



>gb|AFW61678.1| hypothetical protein ZEAMMB73_110601 [Zea mays]
Length=267

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W+  SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  117  AFMERDADAWKFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  176

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR  204
            +MA + +G++ Y GGIIG V I+AGLYLVLWGK+++R
Sbjct  177  IMASLTMGEKFYLGGIIGAVLIIAGLYLVLWGKSEER  213



>ref|XP_002510467.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF52654.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=384

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ERD + W   SG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  247  AIFERDTQAWMFHSGGELFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  306

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQEN  183
            +MA + +G+  Y GG+IG V I+ GLYLVLWGK++++K  ++E+
Sbjct  307  IMASIALGEEFYLGGMIGAVLIIIGLYLVLWGKSEEKKFAAKES  350



>gb|KHN22214.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=390

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            VERD + W  QSG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+M
Sbjct  256  VERDAQAWIFQSGGEVFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIM  315

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            A + +G+  Y GGIIG V IV GLY VLWGK+++RK  ++E+      P   G +    
Sbjct  316  ASIALGEEFYLGGIIGAVLIVVGLYFVLWGKSEERKF-AKEHAAITSTPEHSGIRSSSH  373



>ref|XP_003577657.1| PREDICTED: protein WALLS ARE THIN 1 [Brachypodium distachyon]
Length=389

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   SG EI  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  247  AFLERDAEAWVFHSGSEIFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  306

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G++ Y GGIIG   I+ GLYLVLWGK+++R    +E
Sbjct  307  IMASLTLGEKFYLGGIIGAALIITGLYLVLWGKSEERARMGKE  349



>ref|XP_003527860.1| PREDICTED: protein WALLS ARE THIN 1 [Glycine max]
Length=389

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            VERD + W  QSG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+M
Sbjct  255  VERDAQAWIFQSGGEVFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIM  314

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            A + +G+  Y GGIIG V IV GLY VLWGK+++RK  ++E+      P   G +    
Sbjct  315  ASIALGEEFYLGGIIGAVLIVVGLYFVLWGKSEERKF-AKEHAAITSTPEHSGIRSSSH  372



>ref|XP_010536384.1| PREDICTED: protein WALLS ARE THIN 1 [Tarenaya hassleriana]
Length=390

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERDL+ W   SG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  251  AFAERDLQAWSFHSGWELFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  310

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQEN  183
            +MA + +G+  Y GGIIG V I+ GLY VL+GK+++RK  + E 
Sbjct  311  IMASIALGEEFYLGGIIGAVLIITGLYFVLYGKSEERKFAALEK  354



>dbj|BAJ53175.1| JHL18I08.9 [Jatropha curcas]
 gb|KDP38576.1| hypothetical protein JCGZ_04501 [Jatropha curcas]
Length=384

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   SG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  247  AFMERDPQAWIFHSGGELFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  306

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKP  162
            +MA + + +  Y GGIIG V I+ GLYLVLWGK++++K  ++E+      P
Sbjct  307  IMASIALAEEFYLGGIIGAVLIIVGLYLVLWGKSEEKKFAAKESAVIQSTP  357



>ref|NP_001150116.1| nodulin-like protein 5NG4 [Zea mays]
 gb|ACG37892.1| nodulin-like protein 5NG4 [Zea mays]
Length=387

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W+  SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  235  AFMERDAEAWKFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  294

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR  204
            +MA + +G++ Y GGIIG V IVAGLYLVLWGK+++R
Sbjct  295  IMASLTLGEKFYLGGIIGAVLIVAGLYLVLWGKSEER  331



>ref|XP_006302285.1| hypothetical protein CARUB_v10020328mg, partial [Capsella rubella]
 gb|EOA35183.1| hypothetical protein CARUB_v10020328mg, partial [Capsella rubella]
Length=430

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 89/127 (70%), Gaps = 4/127 (3%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  290  AFMERDSQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  349

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E + T++ P   G    E
Sbjct  350  IMASLALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALE-KATIQSPAEHG---IE  405

Query  134  ECPVGAD  114
              PV  +
Sbjct  406  RAPVSRN  412



>ref|XP_008677722.1| PREDICTED: nodulin-like protein 5NG4 isoform X1 [Zea mays]
 tpg|DAA48593.1| TPA: nodulin-like protein 5NG4 [Zea mays]
Length=393

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W+  SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  241  AFMERDAEAWKFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  300

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR  204
            +MA + +G++ Y GGIIG V IVAGLYLVLWGK+++R
Sbjct  301  IMASLTLGEKFYLGGIIGAVLIVAGLYLVLWGKSEER  337



>gb|KHG23354.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=392

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  485  ERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMA  306
            ERD + W   SG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+MA
Sbjct  250  ERDSQAWMFHSGGELFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIMA  309

Query  305  FVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
             + +G+  Y GGIIG V I+ GLYLVLWGK+++RK  ++E
Sbjct  310  SIALGEEFYLGGIIGAVLIIVGLYLVLWGKSEERKFAAKE  349



>ref|XP_003523716.1| PREDICTED: protein WALLS ARE THIN 1-like [Glycine max]
Length=388

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            VERD + W  QSG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+M
Sbjct  254  VERDAQAWIFQSGGEVFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIM  313

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            A + +G+  Y GGIIG V IV GLY VLWGK+++RK  ++E+      P   G +    
Sbjct  314  ASLALGEEFYLGGIIGAVLIVVGLYFVLWGKSEERKF-AKEHAAITSTPEHSGIRSSSH  371



>gb|KHN45892.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=389

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            VERD + W  QSG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+M
Sbjct  255  VERDAQAWIFQSGGEVFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIM  314

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            A + +G+  Y GGIIG V IV GLY VLWGK+++RK  ++E+      P   G +    
Sbjct  315  ASLALGEEFYLGGIIGAVLIVVGLYFVLWGKSEERKF-AKEHAAITSTPEHSGIRSSSH  372



>ref|XP_009394641.1| PREDICTED: protein WALLS ARE THIN 1-like [Musa acuminata subsp. 
malaccensis]
Length=379

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   SG E   ILYAG V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  239  AFIERDAEAWMFHSGGEFFTILYAGFVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  298

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR  204
            +MA + +G+  Y GGIIG +FI+AGLYLVLWGK+++R
Sbjct  299  IMAAIALGEEFYLGGIIGAIFIIAGLYLVLWGKSEER  335



>ref|XP_009104704.1| PREDICTED: protein WALLS ARE THIN 1-like [Brassica rapa]
Length=386

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 6/124 (5%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  248  AFCERDSQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  307

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  +      L+K ++      E
Sbjct  308  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAA------LEKAMIHAEHVIE  361

Query  134  ECPV  123
              PV
Sbjct  362  RAPV  365



>ref|XP_010268621.1| PREDICTED: protein WALLS ARE THIN 1-like [Nelumbo nucifera]
Length=381

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 86/123 (70%), Gaps = 1/123 (1%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ER+ + W + SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  244  AFIERNSQAWIVHSGAELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  303

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA + +G++ Y GGIIG V I+ GLYLVLWGK+++RK  ++E    +      G+ +  
Sbjct  304  IMASIALGEQFYLGGIIGAVLIIIGLYLVLWGKSEERKF-AKETAAIITSASEQGSNRMS  362

Query  134  ECP  126
              P
Sbjct  363  SHP  365



>emb|CDX68127.1| BnaA07g21670D [Brassica napus]
Length=386

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 6/124 (5%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  248  AFCERDSQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  307

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  +      L+K ++      E
Sbjct  308  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAA------LEKAMIHAEHVIE  361

Query  134  ECPV  123
              PV
Sbjct  362  RAPV  365



>gb|EPS59354.1| hypothetical protein M569_15453, partial [Genlisea aurea]
Length=338

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A VERD + W + SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  231  AVVERDPQAWMVHSGGEVFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  290

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEE  177
            +MA +++G++ Y GGIIG V I+ GLY VLWGK ++RK+  Q   E
Sbjct  291  IMASLLLGEQFYLGGIIGAVLIITGLYFVLWGKNEERKLAIQCGAE  336



>ref|XP_010935825.1| PREDICTED: protein WALLS ARE THIN 1-like [Elaeis guineensis]
Length=385

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  246  AFIERDAEAWIFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  305

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G++ Y GGIIG + I+AGLYLVLWGK+++R   + E
Sbjct  306  IMASIALGEQFYLGGIIGAILIIAGLYLVLWGKSEERAFAAME  348



>emb|CDY39037.1| BnaA02g17260D [Brassica napus]
Length=309

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  169  AFCERDSQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  228

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEE  177
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E  E
Sbjct  229  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALEKAE  274



>ref|XP_002300735.1| nodulin MtN21 family protein [Populus trichocarpa]
 gb|ABK94275.1| unknown [Populus trichocarpa]
 gb|EEE80008.1| nodulin MtN21 family protein [Populus trichocarpa]
Length=384

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   SG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  247  AFMERDPQAWIFHSGGELFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  306

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKP  162
            +MA + +G+  Y GGIIG   I+ GLYLVLWGK++++K  + E       P
Sbjct  307  IMASIALGEEFYLGGIIGAALIIIGLYLVLWGKSEEKKFLALEKAAIQSTP  357



>ref|XP_010940523.1| PREDICTED: protein WALLS ARE THIN 1-like [Elaeis guineensis]
Length=386

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  246  AFIERDSEAWIFHSGTELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  305

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G++ Y GGIIG + I+AGLYLVLWGK+++R   ++E
Sbjct  306  IMASIALGEQFYLGGIIGAILIIAGLYLVLWGKSEERAFAAKE  348



>ref|NP_001145901.1| hypothetical protein [Zea mays]
 gb|ACL52814.1| unknown [Zea mays]
 gb|AFW61679.1| hypothetical protein ZEAMMB73_110601 [Zea mays]
Length=392

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W+  SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  242  AFMERDADAWKFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  301

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR  204
            +MA + +G++ Y GGIIG V I+AGLYLVLWGK+++R
Sbjct  302  IMASLTMGEKFYLGGIIGAVLIIAGLYLVLWGKSEER  338



>ref|XP_011048851.1| PREDICTED: protein WALLS ARE THIN 1-like [Populus euphratica]
Length=384

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   SG E+  I YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  247  AFMERDPQAWIFHSGGELFTIFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  306

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKP  162
            +MA + +G+  Y GGIIG V I+ GLYLVLWGK++++K  + E       P
Sbjct  307  IMASIALGEEFYLGGIIGAVLIIVGLYLVLWGKSEEKKFLALEKAAIQATP  357



>ref|XP_010533584.1| PREDICTED: protein WALLS ARE THIN 1-like [Tarenaya hassleriana]
Length=391

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERDL  W   SG E+  I YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  252  AFAERDLTAWAFHSGWELFTIFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  311

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G+  Y GGIIG V I+ GLY VL+GK ++RK+ + E
Sbjct  312  IMASIALGEEFYLGGIIGAVLIITGLYFVLYGKNEERKLAAME  354



>ref|XP_003565262.1| PREDICTED: WAT1-related protein At3g18200-like [Brachypodium 
distachyon]
Length=377

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E DL  W++ SG E+  ILYAG+V+SG+  +LQ WCI +GGP+F A FQPVQTV VA
Sbjct  245  AFTEEDLSRWKVSSGGELFTILYAGLVASGVAFALQIWCIDRGGPLFTAVFQPVQTVAVA  304

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINS-QENEETLKKPLLDGNKKD  138
            VMA VI+GD+LYTGGIIG V IV GLY VLWGK+++++     ++ +T+ + LL G +  
Sbjct  305  VMAAVILGDQLYTGGIIGAVLIVIGLYFVLWGKSEEKRTKVLNQDPDTVTRHLLAGQQDS  364

Query  137  EEC  129
               
Sbjct  365  SPA  367



>ref|XP_009128107.1| PREDICTED: protein WALLS ARE THIN 1 [Brassica rapa]
Length=389

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  249  AFCERDSQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  308

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEE  177
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E  E
Sbjct  309  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALEKAE  354



>ref|XP_010030394.1| PREDICTED: protein WALLS ARE THIN 1-like [Eucalyptus grandis]
 gb|KCW54392.1| hypothetical protein EUGRSUZ_I00346 [Eucalyptus grandis]
Length=393

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD   W I +G E+  I YAG+V+SGI  ++Q WCI KGGPVFVA +QPVQT++VA
Sbjct  249  AFTERDPHEWLIHNGGELFGIFYAGVVASGIAFAVQIWCIDKGGPVFVAVYQPVQTLIVA  308

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            +MA +++G+  + GGIIG VFIVAGLYLVLWGK+++RK
Sbjct  309  IMASIVLGEEFHLGGIIGAVFIVAGLYLVLWGKSEERK  346



>emb|CDY20378.1| BnaC02g24380D [Brassica napus]
Length=386

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  246  AFCERDSQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  305

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEE  177
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E  E
Sbjct  306  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALEKAE  351



>dbj|BAJ91525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD   W   SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  245  AFFERDAGAWVFHSGSEVFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  304

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR-KINSQE  186
            +MA + +G++ Y GGIIG   I+ GLYLVLWGK+++R +I  +E
Sbjct  305  IMASLTLGEKFYLGGIIGAALIITGLYLVLWGKSEERSRIGKEE  348



>ref|XP_010271523.1| PREDICTED: protein WALLS ARE THIN 1-like [Nelumbo nucifera]
Length=383

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 86/126 (68%), Gaps = 6/126 (5%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ER+ + W + SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  245  AFMERNSQAWLVHSGAELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  304

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQ------ENEETLKKPLLD  153
            +MA + +G+  Y GGIIG V I+ GLYLVLWGK+++RK   +       +E+   +P+  
Sbjct  305  IMASISLGEEFYLGGIIGAVLIIVGLYLVLWGKSEERKFTKETAAIAPASEQGNNRPVSS  364

Query  152  GNKKDE  135
             +K   
Sbjct  365  HSKPSS  370



>ref|XP_008779069.1| PREDICTED: protein WALLS ARE THIN 1-like [Phoenix dactylifera]
Length=383

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   +G E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  246  AFIERDAEAWIFHTGTELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  305

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G++ Y GGIIG + I+AGLYLVLWGK+++R   ++E
Sbjct  306  IMASIALGEQFYLGGIIGAILIIAGLYLVLWGKSEERAFAAKE  348



>ref|XP_002457483.1| hypothetical protein SORBIDRAFT_03g008060 [Sorghum bicolor]
 gb|EES02603.1| hypothetical protein SORBIDRAFT_03g008060 [Sorghum bicolor]
Length=375

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 87/131 (66%), Gaps = 9/131 (7%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F E DL  W++ SG E+  ILYAG+V+SG+  +LQ WCI +GGP+F A FQPVQTV VAV
Sbjct  241  FTEEDLSRWKVHSGVELFTILYAGLVASGVAFALQIWCIDRGGPLFTAVFQPVQTVAVAV  300

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLK-------KPLLD  153
            MA  I+GD+LYTGGIIG V IV GLY VLWGK+ ++K      ++  +       + LL 
Sbjct  301  MAAAILGDQLYTGGIIGAVLIVIGLYFVLWGKSAEKKAARNLQDQLARHQGGDVTRHLLG  360

Query  152  GNK--KDEECP  126
            G    KDEE P
Sbjct  361  GEASVKDEEAP  371



>ref|XP_004500966.1| PREDICTED: protein WALLS ARE THIN 1-like [Cicer arietinum]
Length=394

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 18/135 (13%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            VERD + W  QSG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT+ VA+M
Sbjct  259  VERDAQAWIFQSGAEVFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLAVAIM  318

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI------------------NSQEN  183
            A + +G+  Y GGIIG V I+ GLYLVLWGK +++K                   +S   
Sbjct  319  ASLALGEEFYLGGIIGAVLIIVGLYLVLWGKNEEKKFAREQAAIISSTPEHSIIRSSSHA  378

Query  182  EETLKKPLLDGNKKD  138
            + +L +PLL  + ++
Sbjct  379  KTSLNQPLLPSSTEN  393



>ref|XP_006660389.1| PREDICTED: protein WALLS ARE THIN 1-like [Oryza brachyantha]
Length=390

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W   SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  248  AFMERDADAWAFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  307

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR  204
            +MA + +G++ Y GGIIG V I+AGLYLVLWGK ++R
Sbjct  308  IMASLTLGEKFYLGGIIGAVLIIAGLYLVLWGKNQER  344



>emb|CDX85897.1| BnaC06g22370D [Brassica napus]
Length=388

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  248  AFCERDSQAWAFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  307

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQEN  183
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E 
Sbjct  308  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALEK  351



>emb|CDP07454.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W I SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  219  AFMERDAQAWLIHSGSELFSVFYAGMVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  278

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNK  144
            + A + +G+  Y GGIIG V I+ GLYLVLWGK +++K    E       P   G+ 
Sbjct  279  ITASIALGEEFYLGGIIGAVLIIIGLYLVLWGKNEEQKFAKLEAAAIQAPPADHGSN  335



>gb|KEH36221.1| auxin-induced 5NG4-like protein [Medicago truncatula]
Length=267

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 87/136 (64%), Gaps = 19/136 (14%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +ERD + W  QSG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+M
Sbjct  131  LERDAQAWIFQSGGEVFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIM  190

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI-------------------NSQE  186
            A + +G+  Y GGIIG V I+ GLYLVLWGK +++K                    +S  
Sbjct  191  ASLALGEEFYLGGIIGAVLIIVGLYLVLWGKNEEKKFARELAAITSTPEHSNIIRSSSHH  250

Query  185  NEETLKKPLLDGNKKD  138
             + +L +PLL  + ++
Sbjct  251  AKTSLSQPLLPSSTEN  266



>gb|EMT17329.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=388

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD   W   SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  246  AFFERDAGAWVFHSGSEVFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  305

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G++ Y GGIIG   I+ GLYLVLWGK+++R    +E
Sbjct  306  IMASLTLGEKFYLGGIIGAALIITGLYLVLWGKSEERSRIGKE  348



>emb|CDM80143.1| unnamed protein product [Triticum aestivum]
 emb|CDM80155.1| unnamed protein product [Triticum aestivum]
Length=390

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD   W   SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  245  AFFERDAGAWVFHSGSEVFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  304

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G++ Y GGIIG   I+ GLYLVLWGK+++R    +E
Sbjct  305  IMASLTLGEKFYLGGIIGAALIITGLYLVLWGKSEERSRIGKE  347



>gb|KEH36220.1| auxin-induced 5NG4-like protein [Medicago truncatula]
Length=339

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 87/136 (64%), Gaps = 19/136 (14%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +ERD + W  QSG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+M
Sbjct  203  LERDAQAWIFQSGGEVFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIM  262

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI-------------------NSQE  186
            A + +G+  Y GGIIG V I+ GLYLVLWGK +++K                    +S  
Sbjct  263  ASLALGEEFYLGGIIGAVLIIVGLYLVLWGKNEEKKFARELAAITSTPEHSNIIRSSSHH  322

Query  185  NEETLKKPLLDGNKKD  138
             + +L +PLL  + ++
Sbjct  323  AKTSLSQPLLPSSTEN  338



>gb|KHN39450.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=389

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 88/134 (66%), Gaps = 16/134 (12%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
             +ERD + W   SG E   ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT +VA+
Sbjct  255  LLERDAQAWLFHSGGEAFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVAI  314

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK-------INSQEN---------E  180
            MA + +G+  Y GGIIG V IVAGLYLVLWGK+++RK       I S E+         +
Sbjct  315  MASIALGEEFYLGGIIGAVLIVAGLYLVLWGKSEERKFAREQLAIASTEHSIIRPASHAK  374

Query  179  ETLKKPLLDGNKKD  138
             +L +PLL  + ++
Sbjct  375  ASLAQPLLSSSTEN  388



>gb|AAF87121.1|AC006434_17 F10A5.28 [Arabidopsis thaliana]
Length=355

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  215  AFCERDSQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  274

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E
Sbjct  275  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALE  317



>gb|KEH36219.1| auxin-induced 5NG4-like protein [Medicago truncatula]
Length=394

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 87/136 (64%), Gaps = 19/136 (14%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +ERD + W  QSG E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+M
Sbjct  258  LERDAQAWIFQSGGEVFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIM  317

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI-------------------NSQE  186
            A + +G+  Y GGIIG V I+ GLYLVLWGK +++K                    +S  
Sbjct  318  ASLALGEEFYLGGIIGAVLIIVGLYLVLWGKNEEKKFARELAAITSTPEHSNIIRSSSHH  377

Query  185  NEETLKKPLLDGNKKD  138
             + +L +PLL  + ++
Sbjct  378  AKTSLSQPLLPSSTEN  393



>ref|XP_003545052.1| PREDICTED: protein WALLS ARE THIN 1-like [Glycine max]
Length=389

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 88/134 (66%), Gaps = 16/134 (12%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
             +ERD + W   SG E   ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT +VA+
Sbjct  255  LLERDAQAWLFHSGGEAFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVAI  314

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK-------INSQEN---------E  180
            MA + +G+  Y GGIIG V IVAGLYLVLWGK+++RK       I S E+         +
Sbjct  315  MASIALGEEFYLGGIIGAVLIVAGLYLVLWGKSEERKFAREQLAIASTEHSIIRPASHAK  374

Query  179  ETLKKPLLDGNKKD  138
             +L +PLL  + ++
Sbjct  375  ASLAQPLLSSSTEN  388



>emb|CDY64209.1| BnaC06g43970D [Brassica napus]
Length=388

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  252  AFCERDSQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  311

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E
Sbjct  312  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALE  354



>ref|XP_009106202.1| PREDICTED: protein WALLS ARE THIN 1-like [Brassica rapa]
Length=388

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  252  AFCERDSQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  311

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E
Sbjct  312  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALE  354



>emb|CDY47518.1| BnaAnng09160D [Brassica napus]
Length=388

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  252  AFCERDSQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  311

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E
Sbjct  312  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALE  354



>gb|EAZ08018.1| hypothetical protein OsI_30283 [Oryza sativa Indica Group]
Length=387

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W   SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  244  AFMERDADAWAFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  303

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR  204
            +MA + +G+  Y GGIIG VFI+AGLYLVLWGK+ +R
Sbjct  304  IMASLTLGESFYLGGIIGAVFIIAGLYLVLWGKSHER  340



>dbj|BAD13218.1| putative MtN21 [Oryza sativa Japonica Group]
Length=387

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W   SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  244  AFMERDADAWAFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  303

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR  204
            +MA + +G+  Y GGIIG VFI+AGLYLVLWGK+ +R
Sbjct  304  IMASLTLGESFYLGGIIGAVFIIAGLYLVLWGKSHER  340



>ref|NP_565111.1| protein walls are thin 1 [Arabidopsis thaliana]
 ref|NP_001185403.1| protein walls are thin 1 [Arabidopsis thaliana]
 sp|Q94AP3.1|WAT1_ARATH RecName: Full=Protein WALLS ARE THIN 1 [Arabidopsis thaliana]
 gb|AAK76570.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAM14389.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAN31815.1| putative nodulin [Arabidopsis thaliana]
 dbj|BAE98595.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEE35726.1| protein walls are thin 1 [Arabidopsis thaliana]
 gb|AEE35727.1| protein walls are thin 1 [Arabidopsis thaliana]
Length=389

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  249  AFCERDSQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  308

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E
Sbjct  309  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALE  351



>ref|XP_010428578.1| PREDICTED: protein WALLS ARE THIN 1-like [Camelina sativa]
Length=390

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  249  AFCERDSQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  308

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E
Sbjct  309  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALE  351



>gb|EAZ13316.1| hypothetical protein OsJ_03238 [Oryza sativa Japonica Group]
Length=387

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W   SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  244  AFMERDADAWAFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  303

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR  204
            +MA + +G+  Y GGIIG VFI+AGLYLVLWGK+ +R
Sbjct  304  IMASLTLGESFYLGGIIGAVFIIAGLYLVLWGKSHER  340



>ref|XP_011083629.1| PREDICTED: protein WALLS ARE THIN 1-like [Sesamum indicum]
Length=387

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W + SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  252  AFLERDPQAWLVHSGGELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  311

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            +MA + +G+  Y GGIIG V I+ GLY VLWGK+++RK
Sbjct  312  IMASLALGEEFYLGGIIGAVLIITGLYFVLWGKSEERK  349



>ref|XP_006390298.1| hypothetical protein EUTSA_v10018690mg [Eutrema salsugineum]
 gb|ESQ27584.1| hypothetical protein EUTSA_v10018690mg [Eutrema salsugineum]
Length=389

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  249  AFCERDSQAWIFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  308

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E
Sbjct  309  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALE  351



>ref|XP_006435087.1| hypothetical protein CICLE_v10001438mg [Citrus clementina]
 gb|ESR48327.1| hypothetical protein CICLE_v10001438mg [Citrus clementina]
Length=390

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ER+L  W   +G E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  252  AIFERNLDAWIFHNGGEVFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  311

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA   +G+  Y GGIIG V IV GLYLVLWGK++++K  S+E
Sbjct  312  IMASFALGEEFYLGGIIGAVLIVVGLYLVLWGKSEEKKFASKE  354



>ref|XP_002445672.1| hypothetical protein SORBIDRAFT_07g023970 [Sorghum bicolor]
 gb|EES15167.1| hypothetical protein SORBIDRAFT_07g023970 [Sorghum bicolor]
Length=401

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W+  SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  247  AFMERDADAWKFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  306

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKD  207
            +MA + +G++ Y GGIIG V I+AGLYLVLWGK+++
Sbjct  307  IMASLTLGEKFYLGGIIGAVLIIAGLYLVLWGKSEE  342



>gb|KDO84715.1| hypothetical protein CISIN_1g016399mg [Citrus sinensis]
Length=390

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ER+L  W   +G E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  252  AIFERNLDAWIFHNGGEVFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  311

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA   +G+  Y GGIIG V IV GLYLVLWGK++++K  S+E
Sbjct  312  IMASFALGEEFYLGGIIGAVLIVVGLYLVLWGKSEEKKFASKE  354



>ref|XP_006473582.1| PREDICTED: protein WALLS ARE THIN 1-like [Citrus sinensis]
Length=390

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ER+L  W   +G E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  252  AIFERNLDAWIFHNGGEVFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  311

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA   +G+  Y GGIIG V IV GLYLVLWGK++++K  S+E
Sbjct  312  IMASFALGEEFYLGGIIGAVLIVVGLYLVLWGKSEEKKFASKE  354



>ref|XP_004974226.1| PREDICTED: protein WALLS ARE THIN 1-like [Setaria italica]
Length=395

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD   W+  SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  255  AFMERDADAWKFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  314

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKD  207
            +MA + +G++ Y GGIIG   I+ GLYLVLWGK+++
Sbjct  315  IMASLTLGEKFYLGGIIGAALIIVGLYLVLWGKSEE  350



>ref|XP_010416441.1| PREDICTED: protein WALLS ARE THIN 1-like [Camelina sativa]
Length=391

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 88/127 (69%), Gaps = 4/127 (3%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ER+ + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  251  AFCERESQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  310

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E + +++ P   G    E
Sbjct  311  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALE-KASIQSPAEHG---IE  366

Query  134  ECPVGAD  114
              PV  +
Sbjct  367  RAPVSRN  373



>ref|XP_010061007.1| PREDICTED: protein WALLS ARE THIN 1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW67906.1| hypothetical protein EUGRSUZ_F01611 [Eucalyptus grandis]
Length=386

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ER+   W + +G E+  I YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  249  AFIERNSSAWLVHTGAEVFSIFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  308

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            +MA   +G++ Y GGIIG V I+AGLYLVLWGK ++RK
Sbjct  309  IMASFALGEQFYLGGIIGAVLIIAGLYLVLWGKNEERK  346



>gb|KHN12669.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=395

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 86/131 (66%), Gaps = 14/131 (11%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +ERD + W   S  E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT +VA+M
Sbjct  264  LERDAQAWLFHSAGEVFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVAIM  323

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK-------INSQENEE-------TL  171
            A + +G+  Y GGIIG V IVAGLY VLWGK+++RK       I S E+         +L
Sbjct  324  ASIALGEEFYLGGIIGAVLIVAGLYFVLWGKSEERKFAMEQLAIASTEHNSIASHVKASL  383

Query  170  KKPLLDGNKKD  138
             +PLL  + ++
Sbjct  384  AQPLLSSSTEN  394



>ref|XP_004499208.1| PREDICTED: protein WALLS ARE THIN 1-like isoform X1 [Cicer arietinum]
 ref|XP_004499209.1| PREDICTED: protein WALLS ARE THIN 1-like isoform X2 [Cicer arietinum]
Length=383

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = -3

Query  485  ERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMA  306
            ER+ + W   SG E   ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT +VA+MA
Sbjct  253  ERNSQAWIFHSGGEAFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVAIMA  312

Query  305  FVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK---INSQENEETLKKP  162
             + +G++ Y GGIIG V IV GLYLVLWGK++++K   I S   E ++ +P
Sbjct  313  SIALGEQFYLGGIIGAVLIVTGLYLVLWGKSEEKKFALIGSSTTEHSIIRP  363



>ref|XP_008377184.1| PREDICTED: protein WALLS ARE THIN 1-like [Malus domestica]
Length=406

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ERD + W   +G E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  265  AVFERDYQAWIFHNGGEVFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  324

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            +MA V +G+  Y GGIIG V I+ GLYLVLWGK+++RK
Sbjct  325  IMASVALGEEFYLGGIIGAVLIIVGLYLVLWGKSEERK  362



>ref|XP_007136044.1| hypothetical protein PHAVU_009G013400g [Phaseolus vulgaris]
 gb|ESW08038.1| hypothetical protein PHAVU_009G013400g [Phaseolus vulgaris]
Length=387

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  485  ERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMA  306
            ERD + W   SG E+  I YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+MA
Sbjct  253  ERDAQAWIFNSGGEVFTIFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIMA  312

Query  305  FVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEET  174
             + +G+  Y GGIIG V IV GLY VLWGKT++RK   ++   T
Sbjct  313  SLALGEEFYLGGIIGAVLIVVGLYFVLWGKTEERKFAKEQAAIT  356



>emb|CBI19781.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +ER+ + W I SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+M
Sbjct  223  IERNSQAWLIHSGAELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIM  282

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQEN  183
            A V +G+  Y GGIIG V I++GLY VLWGK++++K  ++E 
Sbjct  283  ASVALGEEFYLGGIIGAVLIISGLYFVLWGKSEEKKFAAKEK  324



>ref|XP_007160706.1| hypothetical protein PHAVU_001G010100g [Phaseolus vulgaris]
 gb|ESW32700.1| hypothetical protein PHAVU_001G010100g [Phaseolus vulgaris]
Length=392

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +ERD + W   SG E   ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT +VA+M
Sbjct  258  LERDAQAWLFHSGGEAFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVAIM  317

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            A + +G+  Y GGIIG V IVAGLY VLWGK+++RK   ++
Sbjct  318  ATIALGEEFYLGGIIGAVLIVAGLYFVLWGKSEERKFAREQ  358



>ref|XP_003550406.1| PREDICTED: protein WALLS ARE THIN 1-like [Glycine max]
Length=394

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 87/131 (66%), Gaps = 14/131 (11%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +ERD + W   S  E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT +VA+M
Sbjct  263  LERDAQAWLFHSAGEVFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVAIM  322

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI--------NSQEN------EETL  171
            A + +G+  Y GGIIG V IVAGLY VLWGK+++RK         +++ N      + +L
Sbjct  323  ASIALGEEFYLGGIIGAVLIVAGLYFVLWGKSEERKFAMEQLAMASTEHNSIASHVKASL  382

Query  170  KKPLLDGNKKD  138
             +PLL  + ++
Sbjct  383  AQPLLSSSTEN  393



>ref|XP_002280062.1| PREDICTED: protein WALLS ARE THIN 1 [Vitis vinifera]
Length=383

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +ER+ + W I SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+M
Sbjct  248  IERNSQAWLIHSGAELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIM  307

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQEN  183
            A V +G+  Y GGIIG V I++GLY VLWGK++++K  ++E 
Sbjct  308  ASVALGEEFYLGGIIGAVLIISGLYFVLWGKSEEKKFAAKEK  349



>ref|XP_009612893.1| PREDICTED: protein WALLS ARE THIN 1-like [Nicotiana tomentosiformis]
Length=378

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W + S  E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  237  AFCERDPQAWLVHSAAELFTVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  296

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            +MA V +G+  Y GGIIG V I+AGLYLVLWGK ++ K
Sbjct  297  IMASVALGEEFYLGGIIGAVLIIAGLYLVLWGKNEESK  334



>ref|XP_002889028.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65287.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ER+ + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  251  AFCERESQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  310

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E
Sbjct  311  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALE  353



>ref|XP_010471663.1| PREDICTED: protein WALLS ARE THIN 1 [Camelina sativa]
Length=391

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ER+ + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  251  AFCERESQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  310

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            +MA + +G+  Y GGIIG V I+AGLY VL+GK+++RK  + E
Sbjct  311  IMASIALGEEFYLGGIIGAVLIIAGLYFVLYGKSEERKFAALE  353



>ref|XP_009787760.1| PREDICTED: protein WALLS ARE THIN 1-like [Nicotiana sylvestris]
Length=386

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD   W + SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  248  AFCERDPNAWLVHSGGELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  307

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            +MA V +G+  Y GGIIG V I+ GLY VLWGK ++ K
Sbjct  308  IMASVALGEEFYLGGIIGAVLIITGLYFVLWGKNEESK  345



>ref|XP_009611297.1| PREDICTED: protein WALLS ARE THIN 1-like [Nicotiana tomentosiformis]
Length=385

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD   W + SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  248  AFCERDPNAWLVHSGGELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  307

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            +MA V +G+  Y GGIIG V I+ GLY VLWGK ++ K
Sbjct  308  IMASVALGEEFYLGGIIGAVLIITGLYFVLWGKNEESK  345



>ref|XP_008221332.1| PREDICTED: protein WALLS ARE THIN 1 [Prunus mume]
Length=408

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 78/109 (72%), Gaps = 2/109 (2%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ERD + W   +G E+  I+YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  268  AIFERDGQAWIFHNGGEVFSIVYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  327

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKIN--SQENEET  174
            +MA V +G+  Y GGIIG V I+ GLYLVLWGK+++RK    +Q N   
Sbjct  328  IMASVALGEEFYLGGIIGAVLIIVGLYLVLWGKSEERKFGQIAQANSRA  376



>gb|KFK41985.1| hypothetical protein AALP_AA2G197400 [Arabis alpina]
Length=393

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ER+ + W   SG E+  ILYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  253  AFCEREPQAWVFHSGWELFTILYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  312

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQEN  183
            +MA + +G++ Y GGIIG V I+AGLY VL+GK+++RK  + E 
Sbjct  313  IMASIALGEQFYLGGIIGAVLIIAGLYFVLYGKSEERKFLALEK  356



>ref|XP_004952146.1| PREDICTED: protein WALLS ARE THIN 1-like [Setaria italica]
Length=385

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 81/119 (68%), Gaps = 14/119 (12%)
 Frame = -3

Query  467  WQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMAFVIIGD  288
            W + SG E++ +LYAG+V+SG+  ++QTWCI + GPVFVA +QPVQT+LVAVMA +I+G+
Sbjct  260  WALGSGAELLTVLYAGLVASGVAFAVQTWCIDRSGPVFVAVYQPVQTLLVAVMASLILGE  319

Query  287  RLYTggiiggvfivaGLYLVLWGKTKDRK--------------INSQENEETLKKPLLD  153
            R Y GGIIG V I+AGLYLVLWGK+++R                +       LK+PLL 
Sbjct  320  RFYLGGIIGAVLIIAGLYLVLWGKSEERALAAKEDAAAAAGTICDEAAAASCLKQPLLP  378



>ref|XP_009335645.1| PREDICTED: protein WALLS ARE THIN 1 [Pyrus x bretschneideri]
Length=406

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ERD + W   +G E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  265  AVFERDGQAWIFHNGGEVFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  324

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            +MA V +G+  Y GGIIG V I+ GLYLVLWGK ++RK
Sbjct  325  IMASVALGEEFYLGGIIGAVLIIVGLYLVLWGKNEERK  362



>ref|XP_008387993.1| PREDICTED: protein WALLS ARE THIN 1 [Malus domestica]
Length=406

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A  ERD + W   +G E+  ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  265  AVFERDGQAWIFHNGGEVFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  324

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            +MA V +G+  Y GGIIG V I+ GLYLVLWGK ++RK
Sbjct  325  IMASVALGEEFYLGGIIGAVLIIVGLYLVLWGKNEERK  362



>ref|XP_008787458.1| PREDICTED: protein WALLS ARE THIN 1-like [Phoenix dactylifera]
Length=386

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF+ERD + W   SG E+  ILYAG ++SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  246  AFIERDAEAWIFHSGSELFTILYAGFIASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  305

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKT  213
            +MA + +G++ Y GGIIG V I+AGLYLVLWGK+
Sbjct  306  IMASIALGEQFYLGGIIGAVLIIAGLYLVLWGKS  339



>ref|XP_010672402.1| PREDICTED: protein WALLS ARE THIN 1 [Beta vulgaris subsp. vulgaris]
Length=378

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 86/124 (69%), Gaps = 14/124 (11%)
 Frame = -3

Query  485  ERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMA  306
            ERD + W+  SG E+  I+YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+MA
Sbjct  249  ERDFEAWKFHSGGELFTIMYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIMA  308

Query  305  FVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK------INSQEN--------EETLK  168
               +G++ Y GGI+G V I+AGLY VLWGK+++ K      ++S E+         +TL 
Sbjct  309  SFALGEQFYLGGILGAVLIIAGLYQVLWGKSEEAKFAKAAILSSAEHGNNRTSSQSKTLT  368

Query  167  KPLL  156
            +PLL
Sbjct  369  QPLL  372



>ref|XP_004238311.1| PREDICTED: protein WALLS ARE THIN 1 [Solanum lycopersicum]
Length=385

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W + SG E+  + YAG+V+SG+  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  248  AFCERDPQAWLVHSGAELFSVFYAGVVASGVAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  307

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI  198
            +MA   +G+  Y GGIIG + I++GLY VLWGK ++ K 
Sbjct  308  LMASFALGEEFYLGGIIGAILIISGLYFVLWGKNEESKF  346



>ref|XP_009777724.1| PREDICTED: protein WALLS ARE THIN 1-like [Nicotiana sylvestris]
Length=377

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W + S  E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  236  AFCERDPQAWLVHSAAELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  295

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            +MA V +G+  Y GGIIG V I+AGLY VLWGK ++ K
Sbjct  296  IMASVALGEEFYLGGIIGAVLIIAGLYFVLWGKNEESK  333



>ref|XP_004291402.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=400

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -3

Query  485  ERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMA  306
            ERD + W   SG E   ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+MA
Sbjct  263  ERDAQAWIFHSGGEAFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIMA  322

Query  305  FVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
             V +G+  Y GGIIG V I+ GLY VLWGK+++RK  +  
Sbjct  323  SVALGEEFYLGGIIGAVLIIVGLYAVLWGKSEERKFAAAS  362



>ref|XP_006341994.1| PREDICTED: protein WALLS ARE THIN 1-like [Solanum tuberosum]
Length=385

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF ERD + W + SG E+  + YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT++VA
Sbjct  248  AFCERDPQAWLVHSGAELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVA  307

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +MA   +G+  Y GGIIG V I++GLY VLWGK ++ K  ++     ++ P+ + N +  
Sbjct  308  LMASFALGEEFYLGGIIGAVLIISGLYFVLWGKNEESKF-AKAAAAAIQSPVDNCNNRPT  366

Query  134  E  132
             
Sbjct  367  S  367



>ref|XP_006393368.1| hypothetical protein EUTSA_v10011671mg [Eutrema salsugineum]
 gb|ESQ30654.1| hypothetical protein EUTSA_v10011671mg [Eutrema salsugineum]
Length=315

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE D K+W I S EE+  ILYAGIV+SG+V+ LQTWCI KGGPVFVA FQP+QT+LVA 
Sbjct  242  FVETDPKNWIIVSWEELFTILYAGIVASGLVVYLQTWCIYKGGPVFVAVFQPLQTLLVAG  301

Query  311  MAFVIIGDRLYT  276
            MA V++GD+LY+
Sbjct  302  MAIVLLGDQLYS  313



>ref|XP_004289105.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=381

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            VER+ + WQI SG E+  ILYAG+V+S +  ++Q W I+KGGPVFV+ + P+QT+LVA+M
Sbjct  257  VERESQAWQIHSGGEVFAILYAGVVASAMAFAIQIWVIEKGGPVFVSVYLPLQTLLVALM  316

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENE  180
            A VI+G++ Y GGIIG V IVAGLYLV+WGK ++ K   +  E
Sbjct  317  ASVILGEQFYMGGIIGAVLIVAGLYLVVWGKNEESKFGKERGE  359



>gb|ACN31266.1| unknown [Zea mays]
Length=358

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F E DL+ W+I SG E+  ILYAG+V  GI   L  WCI KGGP FV+ FQP+QTV+VA+
Sbjct  239  FFESDLERWKISSGGELFTILYAGVVVLGIAWYLMIWCINKGGPHFVSVFQPLQTVMVAI  298

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            MA + +GD LY GG+IG V IVAGLY VLW K+K+ K
Sbjct  299  MAAIFLGDTLYIGGVIGAVIIVAGLYCVLWAKSKETK  335



>ref|XP_004152669.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 ref|XP_004173068.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN62642.1| Mtn21-like protein [Cucumis sativus]
Length=396

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  485  ERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMA  306
            ERD + W   SG E   I+YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT +VA+MA
Sbjct  263  ERDAQAWLFHSGAEAFSIVYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVALMA  322

Query  305  FVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI  198
               +G+  Y GGIIG V I+ GLYLVLWGK++++KI
Sbjct  323  SFALGEEFYLGGIIGAVLIITGLYLVLWGKSEEKKI  358



>ref|XP_008444764.1| PREDICTED: protein WALLS ARE THIN 1 [Cucumis melo]
Length=395

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  485  ERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMA  306
            ERD + W   SG E   I+YAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT +VA+MA
Sbjct  265  ERDAQAWLFHSGAEAFSIVYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVALMA  324

Query  305  FVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI  198
               +G+  Y GGIIG V I+ GLYLVLWGK++++KI
Sbjct  325  SFALGEEFYLGGIIGAVLIITGLYLVLWGKSEEKKI  360



>ref|XP_003589345.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES59596.1| auxin-induced 5NG4-like protein [Medicago truncatula]
Length=400

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 81/135 (60%), Gaps = 17/135 (13%)
 Frame = -3

Query  485  ERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMA  306
            ER+ + W   SG E   ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT +VA+MA
Sbjct  265  ERNAQAWIFHSGGEAFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVAIMA  324

Query  305  FVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI-----------------NSQENEE  177
             + +G+  Y GGIIG V IVAGLY VLWGK++++K                   S   + 
Sbjct  325  SIALGEEFYLGGIIGAVLIVAGLYFVLWGKSEEKKFAKEQLAIASSTEHSIIRPSSHAKA  384

Query  176  TLKKPLLDGNKKDEE  132
            +L +P L  +   E 
Sbjct  385  SLTQPFLSSSSSTEN  399



>ref|XP_003589346.1| Auxin-induced protein 5NG4 [Medicago truncatula]
Length=398

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 81/135 (60%), Gaps = 17/135 (13%)
 Frame = -3

Query  485  ERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMA  306
            ER+ + W   SG E   ILYAG+V+SGI  ++Q WCI +GGPVFVA +QPVQT +VA+MA
Sbjct  263  ERNAQAWIFHSGGEAFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVAIMA  322

Query  305  FVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI-----------------NSQENEE  177
             + +G+  Y GGIIG V IVAGLY VLWGK++++K                   S   + 
Sbjct  323  SIALGEEFYLGGIIGAVLIVAGLYFVLWGKSEEKKFAKEQLAIASSTEHSIIRPSSHAKA  382

Query  176  TLKKPLLDGNKKDEE  132
            +L +P L  +   E 
Sbjct  383  SLTQPFLSSSSSTEN  397



>gb|AFK36474.1| unknown [Medicago truncatula]
Length=273

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = -3

Query  485  ERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMA  306
            ER+ + W   SG E   ILYAG+V+SGI  ++Q WCI +GGP+FVA +QPVQT +VA+MA
Sbjct  138  ERNAQAWIFHSGGEAFTILYAGVVASGIAFAVQIWCIDRGGPMFVAVYQPVQTFVVAIMA  197

Query  305  FVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE------NEETLKKP  162
             + +G+  Y GGIIG V IVAGLY VLWGK++++K   ++       E ++ +P
Sbjct  198  SIALGEEFYLGGIIGAVLIVAGLYFVLWGKSEEKKFAKEQLAIASSTEHSIIRP  251



>ref|NP_001140284.1| nodulin-like protein [Zea mays]
 gb|ACF83506.1| unknown [Zea mays]
 gb|ACF85818.1| unknown [Zea mays]
 gb|ACG27676.1| nodulin-like protein [Zea mays]
 gb|AFW75467.1| nodulin-like protein [Zea mays]
Length=358

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F E D++ W+I SG E+  ILYAG+V  GI   L  WCI KGGP FV+ FQP+QTV+VA+
Sbjct  239  FFESDVERWKISSGGELFTILYAGVVVLGIAWYLMIWCINKGGPHFVSVFQPLQTVMVAI  298

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            MA + +GD LY GG+IG V IVAGLY VLW K+K+ K
Sbjct  299  MAAIFLGDTLYIGGVIGAVIIVAGLYCVLWAKSKETK  335



>ref|XP_008240210.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At3g18200 
[Prunus mume]
Length=221

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE +L++W+IQSGEE+   LYAG   SGIV++L TW IQ  GPVFVA F P+QT L AV
Sbjct  131  FVETELENWKIQSGEELFTTLYAGFWESGIVVALXTWRIQYSGPVFVAVFLPLQTTLGAV  190

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWG  219
            MA +++GD+LY+GGIIG + I+ GLY VLWG
Sbjct  191  MATLVLGDQLYSGGIIGALLIMLGLYSVLWG  221



>ref|XP_002534136.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF28253.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=376

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A+VERD + WQ+ S  E+  +LYAG+V SGI  ++Q W IQ+GGPVFV+ + P+QT+LVA
Sbjct  244  AYVERDPQTWQVHSSVELFSLLYAGMVVSGIGFAIQIWVIQRGGPVFVSGYLPLQTMLVA  303

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI  198
            V A + +G+  Y GGIIG   I+AGLYLV+WGK+++ K+
Sbjct  304  VTASIALGEEFYLGGIIGAALIIAGLYLVVWGKSEESKL  342



>ref|XP_007046789.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOX90946.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
Length=371

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 84/133 (63%), Gaps = 15/133 (11%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A++ERD + WQ+ SG E+  I YAG++ S +V ++Q W + +GGP+FV+ + P+QT+L A
Sbjct  239  AYIERDSRAWQVNSGSEVFTIFYAGLIGSAMVFAIQIWVVDRGGPLFVSMYLPLQTLLAA  298

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQEN---------------E  180
            V+A V +G+  Y GGI+G   I++GLYLV+ GK K+ K+ S+++               E
Sbjct  299  VIATVTLGEEFYLGGILGAALIISGLYLVILGKRKESKLVSEKDPIKSMSENNQVEDPGE  358

Query  179  ETLKKPLLDGNKK  141
             +L +PLL    K
Sbjct  359  SSLTQPLLPAPGK  371



>gb|AFK44308.1| unknown [Lotus japonicus]
Length=249

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 82/126 (65%), Gaps = 4/126 (3%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E+D K WQ+ S +EI  ILY+G+V SG+  +LQ W I KGGPV  + + P+QT+LVA
Sbjct  117  AFFEKDPKSWQLNSSQEIYSILYSGLVFSGLAAALQIWAIGKGGPVLASIYLPLQTLLVA  176

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            +M+ ++ G+  + GGIIG   I+ GLYLV+WG+T++ K      +E +K P+   N  + 
Sbjct  177  LMSSIVFGEDFFLGGIIGAFLIMTGLYLVVWGRTQETK----SAKEYMKVPIESENHPEA  232

Query  134  ECPVGA  117
            +   G+
Sbjct  233  KIGSGS  238



>gb|KDP32670.1| hypothetical protein JCGZ_13668 [Jatropha curcas]
Length=377

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 88/133 (66%), Gaps = 15/133 (11%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A++E D + WQ+ SG E+  +LYAG+V SGI  ++Q W IQ+GGPVFV+ + P+QT+LVA
Sbjct  245  AYIETDPQTWQVHSGGELFSLLYAGLVVSGIGFAIQIWVIQRGGPVFVSGYLPLQTMLVA  304

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI------------NSQEN---E  180
            +MA + +G+  Y GGIIG V I+AGLYLV+ GK+++ K+            NSQ N   +
Sbjct  305  LMASITLGEEFYLGGIIGAVLIIAGLYLVVLGKSEESKLVIRKAVSSLVSENSQTNSRGK  364

Query  179  ETLKKPLLDGNKK  141
             +  +PLL  + +
Sbjct  365  SSFLQPLLPSSSE  377



>gb|EMT27043.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=528

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 56/129 (43%), Positives = 75/129 (58%), Gaps = 26/129 (20%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYA--------------------------GIVSSGIVIS  393
            AF ERD   W   SG EI  ILYA                          G ++SG+  +
Sbjct  319  AFFERDADAWVFHSGSEIFTILYARYGNDYVGLCIYRELAADMANENGNAGFIASGVAFA  378

Query  392  LQTWCIQKGGPVFVASFQPVQTVLVAVMAFVIIGDRLYTggiiggvfivaGLYLVLWGKT  213
            +Q  CI +GGPVFVA +QPVQT++VA+MA + +G++ Y GGIIG   I+ GLYLVLWGK+
Sbjct  379  VQICCIDRGGPVFVAVYQPVQTLVVAIMASITLGEKFYLGGIIGAAPIITGLYLVLWGKS  438

Query  212  KDRKINSQE  186
            ++R  N +E
Sbjct  439  EERSRNGKE  447



>ref|XP_006827501.1| hypothetical protein AMTR_s00009p00175310 [Amborella trichopoda]
 gb|ERM94917.1| hypothetical protein AMTR_s00009p00175310 [Amborella trichopoda]
Length=351

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A VERD K W +    ++  I+YAG+V SG++I +Q WC ++ GPVFV  F P+ TV VA
Sbjct  231  AIVERDPKAWTVGFNIDMWSIIYAGVVCSGVIIFIQLWCTKEKGPVFVTMFNPLSTVFVA  290

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEE  177
            ++A+ + G++LY G ++GGV ++ GLYLVLWGK  D+  +   ++E
Sbjct  291  ILAYSVFGEKLYVGSVLGGVMVIIGLYLVLWGKEADQTTSDMPSQE  336



>gb|KCW78781.1| hypothetical protein EUGRSUZ_C00215 [Eucalyptus grandis]
Length=362

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 84/138 (61%), Gaps = 11/138 (8%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F+E+D + W+I S   I  ILYAGIV SGI   +Q+WCI + GP+F A F P+ TV+V +
Sbjct  217  FLEQDPEAWKIDSKLGIATILYAGIVGSGISFFVQSWCISQRGPLFSAMFNPLATVIVTI  276

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLK-------KPLLD  153
            +A + + + +YTG + G + +VAGLYLVLWGK KD    ++E E  L+       KP +D
Sbjct  277  LAAIFLHEEIYTGSLAGAIGVVAGLYLVLWGKAKDLVEINEETEPKLQIDYDHTVKPAVD  336

Query  152  GNKKDEEC----PVGADI  111
                  +C    P+ +D+
Sbjct  337  EKLSSCKCDLSKPLLSDV  354



>ref|XP_010047033.1| PREDICTED: WAT1-related protein At4g30420 isoform X1 [Eucalyptus 
grandis]
Length=374

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 7/128 (5%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F+E+D + W+I S   I  ILYAGIV SGI   +Q+WCI + GP+F A F P+ TV+V +
Sbjct  229  FLEQDPEAWKIDSKLGIATILYAGIVGSGISFFVQSWCISQRGPLFSAMFNPLATVIVTI  288

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLK-------KPLLD  153
            +A + + + +YTG + G + +VAGLYLVLWGK KD    ++E E  L+       KP +D
Sbjct  289  LAAIFLHEEIYTGSLAGAIGVVAGLYLVLWGKAKDLVEINEETEPKLQIDYDHTVKPAVD  348

Query  152  GNKKDEEC  129
                  +C
Sbjct  349  EKLSSCKC  356



>ref|XP_010047034.1| PREDICTED: WAT1-related protein At4g30420 isoform X2 [Eucalyptus 
grandis]
Length=335

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 79/129 (61%), Gaps = 7/129 (5%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
             F+E+D + W+I S   I  ILYAGIV SGI   +Q+WCI + GP+F A F P+ TV+V 
Sbjct  189  CFLEQDPEAWKIDSKLGIATILYAGIVGSGISFFVQSWCISQRGPLFSAMFNPLATVIVT  248

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLK-------KPLL  156
            ++A + + + +YTG + G + +VAGLYLVLWGK KD    ++E E  L+       KP +
Sbjct  249  ILAAIFLHEEIYTGSLAGAIGVVAGLYLVLWGKAKDLVEINEETEPKLQIDYDHTVKPAV  308

Query  155  DGNKKDEEC  129
            D      +C
Sbjct  309  DEKLSSCKC  317



>ref|XP_002528209.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34166.1| conserved hypothetical protein [Ricinus communis]
Length=258

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F+ERDL  W++ S  E++  L+AGIVSSG+   LQ WCI + GP+F A F P+ TV+V V
Sbjct  105  FLERDLNQWKLHSYLELICCLFAGIVSSGLSFFLQAWCISQRGPLFTAMFNPLGTVIVTV  164

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLK  168
             A + + + +Y G +IG V ++ GLY+VLW K KD   N ++ +  LK
Sbjct  165  CAAMFLHEEIYMGSLIGAVGVIIGLYVVLWSKAKDVVRNEEDKDPKLK  212



>dbj|BAF01728.1| nodulin-like protein [Arabidopsis thaliana]
Length=120

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -3

Query  431  LYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMAFVIIGDRLYTggiiggvf  252
            LYAGIV+SGI  ++Q WCI +GGPVFVA +QPVQT++VA+MA + +G+  Y GGIIG V 
Sbjct  1    LYAGIVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIMASIALGEEFYLGGIIGAVL  60

Query  251  ivaGLYLVLWGKTKDRKINSQEN  183
            I+AGLY VL+GK+++RK  + E 
Sbjct  61   IIAGLYFVLYGKSEERKFAALEK  83



>ref|XP_006425588.1| hypothetical protein CICLE_v10025927mg [Citrus clementina]
 ref|XP_006466880.1| PREDICTED: protein WALLS ARE THIN 1-like [Citrus sinensis]
 gb|ESR38828.1| hypothetical protein CICLE_v10025927mg [Citrus clementina]
Length=363

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A+ ERD   WQ  SG EI  + Y+G+V+S +  ++Q W I +GGP+FV+++ PVQT+LVA
Sbjct  234  AYFERDSAAWQFHSGWEIFCVFYSGLVASAMSFAVQIWVIDRGGPMFVSAYLPVQTMLVA  293

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKK  165
            +MA + +G+  Y GG+IG   I+AGLYLV+ GK ++ K N+++   T+ +
Sbjct  294  IMATIALGEEFYLGGVIGASLIIAGLYLVVLGKDEESKYNTEKAMITVSE  343



>gb|KDO71057.1| hypothetical protein CISIN_1g018069mg [Citrus sinensis]
Length=361

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A+ ERD   WQ  SG EI  + Y+G+V+S +  ++Q W I +GGP+FV+++ PVQT+LVA
Sbjct  232  AYFERDSAAWQFHSGWEIFCVFYSGLVASAMSFAVQIWVIDRGGPMFVSAYLPVQTMLVA  291

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKK  165
            +MA + +G+  Y GG+IG   I+AGLYLV+ GK ++ K N+++   T+ +
Sbjct  292  IMATIALGEEFYLGGVIGASLIIAGLYLVVLGKDEESKYNTEKAMITVSE  341



>ref|XP_010918790.1| PREDICTED: WAT1-related protein At5g07050-like [Elaeis guineensis]
Length=368

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 77/117 (66%), Gaps = 4/117 (3%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            VE     W I    ++  ILY+GIV SG++I +Q WC ++ GPVFV  F P+ T++VA++
Sbjct  237  VEHKPTAWMIGFDIDLWSILYSGIVCSGLIIFIQLWCTEEKGPVFVTMFNPLSTIMVALL  296

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKD  138
            A+ + G+RLYTG IIGG+ ++ GLYLVLWGK +D+    +E  E+ K   L   KK+
Sbjct  297  AYFVFGERLYTGSIIGGLIVIIGLYLVLWGKERDQ----EEQTESKKPSFLAYGKKE  349



>ref|XP_011025888.1| PREDICTED: protein WALLS ARE THIN 1-like isoform X2 [Populus 
euphratica]
Length=337

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 84/132 (64%), Gaps = 15/132 (11%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
             + E D + W + S  E+  I YAG+V SGI  ++Q W IQ+GGPVFV+ + P+QT+LVA
Sbjct  206  GYFEGDSQAWHVHSVGELFTIFYAGLVVSGIGFAIQIWVIQRGGPVFVSGYLPLQTMLVA  265

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI------------NSQ---ENE  180
            VMA + + +  Y+GG+IG + I+AGLYLV+WGK+++ K+            NSQ     +
Sbjct  266  VMASIALSEEFYSGGMIGAMLIIAGLYLVVWGKSEETKLATAKDAIMLSSDNSQARFSGK  325

Query  179  ETLKKPLLDGNK  144
             +L +PLL+  +
Sbjct  326  SSLVQPLLNSGE  337



>ref|XP_009369498.1| PREDICTED: WAT1-related protein At4g08300-like [Pyrus x bretschneideri]
Length=361

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 76/126 (60%), Gaps = 7/126 (6%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            ++     W I    +   I+YAG+V SGI + +Q WC ++ GPVFV  F P+ TVLVAVM
Sbjct  236  IQHKRAAWSITYNNDFWSIIYAGVVCSGITVFIQLWCTKQKGPVFVTMFSPLATVLVAVM  295

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK-INSQE------NEETLKKPLLDG  150
            A+ I+G+RL+ G I+G V I  GLY+VLWGK +D+  I SQE      NE+   K  +D 
Sbjct  296  AYFILGERLHVGRILGAVIITIGLYMVLWGKDRDQNVIRSQEQTILTSNEQMKPKIQMDT  355

Query  149  NKKDEE  132
            +    +
Sbjct  356  STGSSK  361



>tpg|DAA45833.1| TPA: hypothetical protein ZEAMMB73_166425 [Zea mays]
Length=283

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 79/127 (62%), Gaps = 9/127 (7%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFV+RD + W +  G     I+YA I  +G+ + +Q WC ++ GPVFVA F P+ TV+VA
Sbjct  146  AFVQRDARDWLVGFGLNFWAIVYAAIACNGLTVVIQLWCNREKGPVFVAMFNPLLTVMVA  205

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            ++A+ + G+ LY G +IGG+ ++ GLY++LWGK KD++ +   + E           K++
Sbjct  206  LLAYFVFGENLYVGSVIGGLLVILGLYMLLWGKDKDQEQHVSSSSE---------EGKEQ  256

Query  134  ECPVGAD  114
            E P G D
Sbjct  257  EHPHGHD  263



>ref|XP_008382878.1| PREDICTED: WAT1-related protein At4g08300-like [Malus domestica]
 emb|CCX35472.1| Auxin-induced protein 5NG4-like [Malus domestica]
Length=349

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = -3

Query  467  WQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVMAFVIIGD  288
            W I+   +   I+YAG+V SGI++ +Q WC ++ GPVFV  F P+ TVLVAVMA+ I+G+
Sbjct  247  WSIRYNNDFWSIIYAGVVCSGIMVFIQLWCTKQKGPVFVTMFSPLATVLVAVMAYFILGE  306

Query  287  RLYTggiiggvfivaGLYLVLWGKTKDRK-INSQE  186
            RL+ G I+G V I  GLY+VLWGK +D+  I SQE
Sbjct  307  RLHVGRILGAVIITIGLYMVLWGKDRDQNVIRSQE  341



>ref|NP_001159175.1| hypothetical protein [Zea mays]
 gb|ACN25318.1| unknown [Zea mays]
 tpg|DAA45832.1| TPA: hypothetical protein ZEAMMB73_166425 [Zea mays]
Length=373

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 79/127 (62%), Gaps = 9/127 (7%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFV+RD + W +  G     I+YA I  +G+ + +Q WC ++ GPVFVA F P+ TV+VA
Sbjct  236  AFVQRDARDWLVGFGLNFWAIVYAAIACNGLTVVIQLWCNREKGPVFVAMFNPLLTVMVA  295

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            ++A+ + G+ LY G +IGG+ ++ GLY++LWGK KD++ +   + E           K++
Sbjct  296  LLAYFVFGENLYVGSVIGGLLVILGLYMLLWGKDKDQEQHVSSSSE---------EGKEQ  346

Query  134  ECPVGAD  114
            E P G D
Sbjct  347  EHPHGHD  353



>ref|XP_007201258.1| hypothetical protein PRUPE_ppa008369mg [Prunus persica]
 gb|EMJ02457.1| hypothetical protein PRUPE_ppa008369mg [Prunus persica]
Length=335

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 71/114 (62%), Gaps = 5/114 (4%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +E     W I    E   ILYAGIV SGI I +Q WCI++ GPVFV  F P+ T LVAVM
Sbjct  197  IEHKQAAWSISYNNEFWSILYAGIVCSGIAIFVQLWCIKQKGPVFVTMFSPLATSLVAVM  256

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENE-----ETLKKP  162
            A+ I+G+ L+ G I+G V I+ GLYLVLWGK  D   +  +++     + LKKP
Sbjct  257  AYFILGETLHVGRILGAVIIIIGLYLVLWGKDIDENHSRPQDQAILTSDELKKP  310



>gb|KHG11330.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=374

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 86/128 (67%), Gaps = 12/128 (9%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A +ERD + WQ+ SG E+  I+YAG+V+S +V ++Q + + +GGP+FV+ + P+QT+L A
Sbjct  245  ATIERDPRSWQVHSGSEVFTIIYAGLVASAMVFAIQIYVVDRGGPLFVSMYLPLQTLLAA  304

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQ--------EN---EETLK  168
            ++A V +G+  Y GG++G   IVAGLYLV+ GK+++ K  S+        EN   E T  
Sbjct  305  LIATVTLGEEFYLGGVVGAALIVAGLYLVILGKSEESKYLSENEPIYSVSENNDMESTFI  364

Query  167  KPLLDGNK  144
            +PLL G+K
Sbjct  365  RPLL-GSK  371



>ref|XP_009413154.1| PREDICTED: WAT1-related protein At2g39510-like [Musa acuminata 
subsp. malaccensis]
Length=369

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFVE     W+I    ++  ILYAG+V SG++I +Q WC +  GPVFV  F P+ T++VA
Sbjct  231  AFVEHKPAAWKIGLDVKLWSILYAGVVCSGLIIYIQLWCTEAKGPVFVTMFNPLSTIMVA  290

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEE  177
            ++A+ + G+RL+ G IIGG+ ++ GLY VLWGK +D++  +   EE
Sbjct  291  LLAYFVFGERLFLGSIIGGIVVIIGLYSVLWGKERDQEKETMSPEE  336



>ref|XP_007035083.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2, 
partial [Theobroma cacao]
 gb|EOY06009.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2, 
partial [Theobroma cacao]
Length=308

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 80/131 (61%), Gaps = 12/131 (9%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            V+     W I    +    LYAG+V SG++I +Q WC ++ GPVFV  F P+ T+LVAV+
Sbjct  179  VQHKPAAWTIGFNIDFWATLYAGVVCSGLIIFIQLWCTEEKGPVFVTMFNPLSTILVAVL  238

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK-----------INSQENEETLKKP  162
            A+ ++G++LYTG I+GGV ++ GLYL+LWGK +D++           +N QEN+   +K 
Sbjct  239  AYFVLGEKLYTGSILGGVIVIVGLYLLLWGKDRDQEARLGREEQSYSVNDQENDPKEQKS  298

Query  161  LLDGNKKDEEC  129
                 ++  +C
Sbjct  299  -FSAEREGSQC  308



>ref|XP_010262297.1| PREDICTED: WAT1-related protein At1g44800-like isoform X3 [Nelumbo 
nucifera]
Length=347

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE   + W I    +   ILYAG+V SG++I +Q WC ++ GPVFV  F P+ T++VA 
Sbjct  215  FVEHKPRAWIIGFNVDFWAILYAGVVCSGLLIFIQLWCTEQRGPVFVTMFNPLGTIMVAF  274

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            +A+ +IG++LY G ++GGV ++ GLYL+LWGK  D+K + +  E +     L   K+D+E
Sbjct  275  VAYFVIGEKLYLGRVLGGVTVIIGLYLILWGKEGDQKFSKKAQELS----SLTCEKEDKE  330



>ref|XP_011025887.1| PREDICTED: WAT1-related protein At3g53210-like isoform X1 [Populus 
euphratica]
Length=413

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 84/132 (64%), Gaps = 15/132 (11%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
             + E D + W + S  E+  I YAG+V SGI  ++Q W IQ+GGPVFV+ + P+QT+LVA
Sbjct  282  GYFEGDSQAWHVHSVGELFTIFYAGLVVSGIGFAIQIWVIQRGGPVFVSGYLPLQTMLVA  341

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKI------------NSQ---ENE  180
            VMA + + +  Y+GG+IG + I+AGLYLV+WGK+++ K+            NSQ     +
Sbjct  342  VMASIALSEEFYSGGMIGAMLIIAGLYLVVWGKSEETKLATAKDAIMLSSDNSQARFSGK  401

Query  179  ETLKKPLLDGNK  144
             +L +PLL+  +
Sbjct  402  SSLVQPLLNSGE  413



>ref|XP_006379888.1| hypothetical protein POPTR_0008s16550g [Populus trichocarpa]
 gb|ERP57685.1| hypothetical protein POPTR_0008s16550g [Populus trichocarpa]
Length=370

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A V+     W I    +   I+Y GIV SG++I  Q WC ++ GPVFV  F P+ T+LVA
Sbjct  237  AIVQHKRAAWTIGFDIDFWSIVYGGIVVSGLIIFFQLWCTEEKGPVFVTMFNPLSTILVA  296

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEET  174
            ++A+ ++G++LY G I+G V ++ GLYL+LWGK +D++++S+E E++
Sbjct  297  ILAYFVLGEKLYLGSILGAVIVIIGLYLLLWGKEEDQQVHSKEEEQS  343



>ref|XP_007224058.1| hypothetical protein PRUPE_ppa015276mg [Prunus persica]
 gb|EMJ25257.1| hypothetical protein PRUPE_ppa015276mg [Prunus persica]
Length=370

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +E     W I    ++  ILYAG+V SG++I +Q WC ++ GPVFV  F PV T+LVAV+
Sbjct  239  IEHRRAAWTIGFNIDLWSILYAGVVCSGLIIFIQLWCTEEKGPVFVTMFNPVSTILVAVL  298

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR-KINSQENE  180
            A+ ++G+RLYTG I+G   ++ GLYL+LWGK  D   I S+E+ 
Sbjct  299  AYFVLGERLYTGSILGAFIVILGLYLLLWGKEGDEVYIKSEESS  342



>ref|XP_002280977.1| PREDICTED: WAT1-related protein At5g07050 [Vitis vinifera]
 emb|CBI23607.3| unnamed protein product [Vitis vinifera]
Length=368

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            VE     W I    ++   +YAG+V SG++I +Q WC ++ GPVFV  F P+ TVLVAV+
Sbjct  238  VEHSRAAWTIGFNIDLWSTVYAGVVCSGLIIFVQLWCTEEKGPVFVTMFNPLSTVLVAVL  297

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDE  135
            A+ ++G++LY G I+GG  ++ GLYL+LWGK  D++   +  EE+     L G  K +
Sbjct  298  AYFVLGEKLYMGSILGGAIVIVGLYLLLWGKEGDQEAQVKSQEESYSARDLQGGHKTQ  355



>ref|XP_008224471.1| PREDICTED: WAT1-related protein At4g08300-like [Prunus mume]
Length=370

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +E     W I    ++  ILYAG+V SG++I +Q WC ++ GPVFV  F PV T+LVAV+
Sbjct  239  IEHRRAAWTIGFNIDLWSILYAGVVCSGLIIFIQLWCTKEKGPVFVTMFNPVSTILVAVL  298

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR-KINSQENE  180
            A+ ++G+RLYTG I+G   ++ GLYL+LWGK  D   I S+E+ 
Sbjct  299  AYFVLGERLYTGSILGAFIVILGLYLLLWGKEGDEVYIKSEESS  342



>ref|XP_010262296.1| PREDICTED: WAT1-related protein At1g44800-like isoform X2 [Nelumbo 
nucifera]
Length=366

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE   + W I    +   ILYAG+V SG++I +Q WC ++ GPVFV  F P+ T++VA 
Sbjct  234  FVEHKPRAWIIGFNVDFWAILYAGVVCSGLLIFIQLWCTEQRGPVFVTMFNPLGTIMVAF  293

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            +A+ +IG++LY G ++GGV ++ GLYL+LWGK  D+K + +  E +     L   K+D+E
Sbjct  294  VAYFVIGEKLYLGRVLGGVTVIIGLYLILWGKEGDQKFSKKAQELS----SLTCEKEDKE  349



>ref|XP_010262295.1| PREDICTED: WAT1-related protein At1g44800-like isoform X1 [Nelumbo 
nucifera]
Length=368

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            FVE   + W I    +   ILYAG+V SG++I +Q WC ++ GPVFV  F P+ T++VA 
Sbjct  236  FVEHKPRAWIIGFNVDFWAILYAGVVCSGLLIFIQLWCTEQRGPVFVTMFNPLGTIMVAF  295

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            +A+ +IG++LY G ++GGV ++ GLYL+LWGK  D+K + +  E +     L   K+D+E
Sbjct  296  VAYFVIGEKLYLGRVLGGVTVIIGLYLILWGKEGDQKFSKKAQELS----SLTCEKEDKE  351



>ref|XP_008235790.1| PREDICTED: WAT1-related protein At1g44800-like [Prunus mume]
Length=383

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 70/119 (59%), Gaps = 0/119 (0%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +E     W I    E   ILYAGIV SGI I +Q WCI++ GPVFV  F P+ T LVAVM
Sbjct  245  IEHKRAAWSISYNNEFWSILYAGIVCSGITIFVQLWCIKQKGPVFVTMFSPLATSLVAVM  304

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            A+ I+G+ L+ G I+G V I+ GLYLVLWGK  D   +  +++  L    L   K   E
Sbjct  305  AYFILGETLHVGRILGAVIIIIGLYLVLWGKDIDENHSRPQDQAILTSAELKKPKIQME  363



>ref|XP_007035082.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 ref|XP_007035085.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY06008.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY06011.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
Length=369

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 80/131 (61%), Gaps = 12/131 (9%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            V+     W I    +    LYAG+V SG++I +Q WC ++ GPVFV  F P+ T+LVAV+
Sbjct  238  VQHKPAAWTIGFNIDFWATLYAGVVCSGLIIFIQLWCTEEKGPVFVTMFNPLSTILVAVL  297

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK-----------INSQENEETLKKP  162
            A+ ++G++LYTG I+GGV ++ GLYL+LWGK +D++           +N QEN+   +K 
Sbjct  298  AYFVLGEKLYTGSILGGVIVIVGLYLLLWGKDRDQEARLGREEQSYSVNDQENDPKEQKS  357

Query  161  LLDGNKKDEEC  129
                 ++  +C
Sbjct  358  -FSAEREGSQC  367



>ref|XP_006651043.1| PREDICTED: WAT1-related protein At2g39510-like [Oryza brachyantha]
Length=439

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF++R  + W+I  G +   I+Y+G   +G  +  Q WC +K GPVFV  F P+ T++VA
Sbjct  306  AFMQRKPEDWRIGFGLKFWCIIYSGFACNGFTVFAQLWCTEKKGPVFVTMFNPLSTIMVA  365

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEET  174
            ++A+ I G+ LY G IIGGV ++ GLY++LWGK KD+  N+ + +E+
Sbjct  366  ILAYFIFGENLYVGSIIGGVVVILGLYMLLWGKDKDQGYNADKEQES  412



>ref|XP_010671057.1| PREDICTED: WAT1-related protein At5g07050-like [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 78/122 (64%), Gaps = 9/122 (7%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AFV+R    W I    +++  +YAG+V SG+++SLQ WC ++ GPVFV  F P+ T+LVA
Sbjct  235  AFVQRKPAAWAIGFNIDLLSTVYAGVVCSGLIVSLQLWCTEEKGPVFVTMFNPLSTILVA  294

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLD-GNKKD  138
            ++A+ ++G++LY G I+GG  ++ G+YL++WGK        +E    L    L+ GN KD
Sbjct  295  LLAYFVLGEKLYVGSIMGGGIVIIGMYLLIWGK--------EEARTNLAGLYLNYGNSKD  346

Query  137  EE  132
             +
Sbjct  347  RK  348



>ref|XP_007035084.1| Nodulin MtN21 /EamA-like transporter family protein isoform 3 
[Theobroma cacao]
 gb|EOY06010.1| Nodulin MtN21 /EamA-like transporter family protein isoform 3 
[Theobroma cacao]
Length=386

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 80/131 (61%), Gaps = 12/131 (9%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            V+     W I    +    LYAG+V SG++I +Q WC ++ GPVFV  F P+ T+LVAV+
Sbjct  255  VQHKPAAWTIGFNIDFWATLYAGVVCSGLIIFIQLWCTEEKGPVFVTMFNPLSTILVAVL  314

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK-----------INSQENEETLKKP  162
            A+ ++G++LYTG I+GGV ++ GLYL+LWGK +D++           +N QEN+   +K 
Sbjct  315  AYFVLGEKLYTGSILGGVIVIVGLYLLLWGKDRDQEARLGREEQSYSVNDQENDPKEQKS  374

Query  161  LLDGNKKDEEC  129
                 ++  +C
Sbjct  375  -FSAEREGSQC  384



>gb|ACF87060.1| unknown [Zea mays]
 tpg|DAA43388.1| TPA: hypothetical protein ZEAMMB73_056334 [Zea mays]
Length=242

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 76/121 (63%), Gaps = 0/121 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F++ + + W+I  G +   I+Y+G+  +G  + +Q WC +K GPVFV  F P+ T++VA+
Sbjct  113  FMQHEPEEWRIGFGVKFWSIVYSGLACNGFTVFVQLWCTEKKGPVFVTMFNPLSTIMVAI  172

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            +A+ I G+ LY G I+GG  ++ GLY++LWGK KD++  + +  E L+       KK  +
Sbjct  173  LAYFIFGENLYVGSIVGGGVVILGLYMLLWGKEKDQERGTGKEREQLETDCEKQAKKVSD  232

Query  131  C  129
            C
Sbjct  233  C  233



>ref|XP_011029842.1| PREDICTED: WAT1-related protein At5g07050-like [Populus euphratica]
Length=370

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            A V+     W I    +   I+Y GIV SG++I  Q WC ++ GPVFV  F P+ T+LVA
Sbjct  237  ATVQHKRAAWTIGFDIDFWSIVYGGIVVSGLIIFFQLWCTEEKGPVFVTMFNPLSTILVA  296

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEET  174
            ++A+ ++G++LY G I+G V ++ GLYL+LWGK +D++++S+E E++
Sbjct  297  ILAYFVLGEKLYLGSILGAVIVIIGLYLLLWGKEEDQQVHSKEEEQS  343



>ref|NP_001142624.1| uncharacterized protein LOC100274895 [Zea mays]
 gb|ACG25540.1| hypothetical protein [Zea mays]
 gb|ACG41747.1| hypothetical protein [Zea mays]
Length=242

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 76/121 (63%), Gaps = 0/121 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F++ + + W+I  G +   I+Y+G+  +G  + +Q WC +K GPVFV  F P+ T++VA+
Sbjct  113  FMQHEPEDWRIGFGVKFWSIVYSGLACNGFTVFVQLWCTEKKGPVFVTMFNPLSTIMVAI  172

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            +A+ I G+ LY G ++GG  ++ GLY++LWGK KD++  + +  E L+       KK  +
Sbjct  173  LAYFIFGENLYVGSVVGGGVVILGLYMLLWGKEKDQERGTGKEREQLETDCEKQAKKVSD  232

Query  131  C  129
            C
Sbjct  233  C  233



>emb|CBI17428.3| unnamed protein product [Vitis vinifera]
Length=365

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +ER+ + W   S  E+  +LY+G V SGI  S+Q W + K GPVFV+++ P+QT+LVAVM
Sbjct  235  IERNSQAWLFHSRTELFCVLYSGAVVSGIGFSIQLWAVGKAGPVFVSAYLPLQTLLVAVM  294

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            A + +G+R Y GG++G V I+ GLYLV+WGK+++ K  S++
Sbjct  295  ASLALGERFYLGGVLGAVLILVGLYLVVWGKSEEGKFASRK  335



>ref|XP_002267729.1| PREDICTED: protein WALLS ARE THIN 1 [Vitis vinifera]
 emb|CAN68618.1| hypothetical protein VITISV_000453 [Vitis vinifera]
Length=376

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            +ER+ + W   S  E+  +LY+G V SGI  S+Q W + K GPVFV+++ P+QT+LVAVM
Sbjct  246  IERNSQAWLFHSRTELFCVLYSGAVVSGIGFSIQLWAVGKAGPVFVSAYLPLQTLLVAVM  305

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQE  186
            A + +G+R Y GG++G V I+ GLYLV+WGK+++ K  S++
Sbjct  306  ASLALGERFYLGGVLGAVLILVGLYLVVWGKSEEGKFASRK  346



>ref|XP_006355962.1| PREDICTED: WAT1-related protein At3g28050-like [Solanum tuberosum]
Length=349

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 74/122 (61%), Gaps = 4/122 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F++R+L  W +Q G  +  +LY+GI  S   +S+  WCI++ GP+FVA F P+  V+ A 
Sbjct  227  FMDRNLNAWLLQPGTRLFAVLYSGIFGSAFQVSVMFWCIRRKGPLFVAMFHPLGIVIAAA  286

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETL--KKPLLDGNKKD  138
            +  + +GD  Y G ++G + IV G Y V+WGKTK+ K++  +    +  K PLL+   KD
Sbjct  287  LGIIFLGDIFYLGSLMGSIIIVVGFYAVMWGKTKEDKVDEDKLTRNINSKSPLLE--IKD  344

Query  137  EE  132
             E
Sbjct  345  AE  346



>ref|XP_010268395.1| PREDICTED: WAT1-related protein At4g30420-like isoform X3 [Nelumbo 
nucifera]
Length=271

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 76/127 (60%), Gaps = 10/127 (8%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F+E D   W I+S  E++ ILY GIV SG+   L  WCI K GP+F A F P+ TV+  +
Sbjct  139  FLESDPTSWNIKSSFELLCILYGGIVGSGLSFFLLPWCISKRGPLFAAMFSPLSTVITTI  198

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKD-RKINSQE---NEET------LKKP  162
            +A +I+ + L+ G + G + ++ GLY VLWGKT+D   I + E   NE T      L++P
Sbjct  199  LASLILHEDLFIGSLSGAILVIGGLYAVLWGKTRDLTDIKTDERPRNESTMSCKINLEEP  258

Query  161  LLDGNKK  141
            LL  +K 
Sbjct  259  LLAHDKS  265



>ref|XP_010432988.1| PREDICTED: WAT1-related protein At4g30420-like [Camelina sativa]
Length=385

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 77/142 (54%), Gaps = 22/142 (15%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F+E+D   W + S  E    LYAGI +S +  ++Q W I K GPVF A F P+ TV+V +
Sbjct  236  FLEKDSNAWILHSYSEFATCLYAGIGASALSFTVQAWAISKRGPVFSALFNPLCTVIVTI  295

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEET--------------  174
            +A +   + +YTG +IGG+ ++ GLY VLWGK KD  IN ++N++               
Sbjct  296  LAALFFQEEIYTGSLIGGLGVIMGLYTVLWGKAKDVMINHEQNKDNDQNSEVKIHIEDSS  355

Query  173  --------LKKPLLDGNKKDEE  132
                    LK PLL  NK  EE
Sbjct  356  ETAICNGDLKNPLLSKNKLTEE  377



>ref|XP_010268394.1| PREDICTED: WAT1-related protein At4g30420-like isoform X2 [Nelumbo 
nucifera]
Length=279

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 76/127 (60%), Gaps = 10/127 (8%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F+E D   W I+S  E++ ILY GIV SG+   L  WCI K GP+F A F P+ TV+  +
Sbjct  147  FLESDPTSWNIKSSFELLCILYGGIVGSGLSFFLLPWCISKRGPLFAAMFSPLSTVITTI  206

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKD-RKINSQE---NEET------LKKP  162
            +A +I+ + L+ G + G + ++ GLY VLWGKT+D   I + E   NE T      L++P
Sbjct  207  LASLILHEDLFIGSLSGAILVIGGLYAVLWGKTRDLTDIKTDERPRNESTMSCKINLEEP  266

Query  161  LLDGNKK  141
            LL  +K 
Sbjct  267  LLAHDKS  273



>ref|XP_002310832.2| hypothetical protein POPTR_0007s13580g [Populus trichocarpa]
 gb|EEE91282.2| hypothetical protein POPTR_0007s13580g [Populus trichocarpa]
Length=379

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            + ERD + W + S  E+  I YAG+V SGI  ++Q W IQ+ GPVFV+ + P+QT+LVAV
Sbjct  249  YFERDSQAWHVHSVGELFTIFYAGLVVSGIGFAIQIWVIQRRGPVFVSGYLPLQTMLVAV  308

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKK  165
            MA + + +  Y GG+IG + I+AGLYLV+WGK+++ K+ + ++   L  
Sbjct  309  MASIALSEEFYLGGMIGAMLIIAGLYLVVWGKSEETKLATAKDAIMLSS  357



>ref|XP_007158608.1| hypothetical protein PHAVU_002G166900g [Phaseolus vulgaris]
 gb|ESW30602.1| hypothetical protein PHAVU_002G166900g [Phaseolus vulgaris]
Length=362

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 81/124 (65%), Gaps = 11/124 (9%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF E+D K WQ  S  EI  +L++G+V+SG+  ++Q W I KGGPV  + + P+QT+LVA
Sbjct  231  AFFEKDSKAWQFNSSGEIYSVLFSGLVTSGLASAIQIWTIGKGGPVLASIYLPLQTLLVA  290

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKK---PLLDGNK  144
            VMA +I G+  + GGIIG   I+ GLYLV+WG++++ K        T+K+   P+   N 
Sbjct  291  VMASIIFGEEFFLGGIIGACLIIFGLYLVVWGRSQESK--------TIKEVIVPIEAKNH  342

Query  143  KDEE  132
            ++E+
Sbjct  343  REEK  346



>dbj|BAK07585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 77/128 (60%), Gaps = 4/128 (3%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
             ++ + + W I  G +   I+Y+GI  SG  +  Q WC +K GPVFV  F PV T++VA+
Sbjct  238  LLQHEKQDWLIGFGLKFWCIVYSGIACSGFTVFAQLWCTEKKGPVFVTMFNPVSTIMVAI  297

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDR--KINSQENEETLKKPLLDGNK--  144
            +A+ I G+ LY G IIGGV ++ GLY++LWGK KD+  K  +   EE    P LD  K  
Sbjct  298  LAYFIFGENLYVGSIIGGVVVILGLYMLLWGKDKDQEYKAGAASGEEQAGSPDLDCEKQQ  357

Query  143  KDEECPVG  120
            + EE  VG
Sbjct  358  RQEEKMVG  365



>ref|XP_007144098.1| hypothetical protein PHAVU_007G128600g [Phaseolus vulgaris]
 gb|ESW16092.1| hypothetical protein PHAVU_007G128600g [Phaseolus vulgaris]
Length=355

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 73/120 (61%), Gaps = 6/120 (5%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            VE D   W +    ++   +Y G+V SG +I +Q WC +K GPVFV  F P+ T+LVAV+
Sbjct  240  VEHDSSAWTMGLNIDLWSTIYGGVVVSGFIIYIQLWCTEKRGPVFVTMFNPISTILVAVL  299

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEEC  129
            A+ ++G++LY G IIG + ++ GLYL+LWGK  D+ +  +  E++        +  D EC
Sbjct  300  AYFVLGEKLYLGSIIGSLIVIIGLYLLLWGKEGDKVVCMKTTEKS------QCSSADPEC  353



>ref|XP_004512084.1| PREDICTED: protein WALLS ARE THIN 1-like [Cicer arietinum]
Length=362

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F+E+D K WQ+ S EE   +LY+G+V+SG+  ++Q W I KGGPV  + + P+QT+LVA+
Sbjct  232  FLEKDPKAWQLNSSEEAYSVLYSGLVTSGLAAAIQIWTISKGGPVLASIYLPLQTLLVAL  291

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRK  201
            MA +  G+  + GGIIG V I++GLYLV+WG++++ K
Sbjct  292  MASIAFGEEFFLGGIIGAVLIISGLYLVVWGRSREIK  328



>gb|EMT27247.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=383

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 75/122 (61%), Gaps = 3/122 (2%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            ++ + + W I  G +   I+Y+G+  SG  +  Q WC +K GPVFV  F PV T++VA++
Sbjct  240  LQHERQDWLIGFGLKFWCIIYSGLACSGFTVFAQLWCTEKKGPVFVTMFNPVSTIMVAIL  299

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKIN---SQENEETLKKPLLDGNKKD  138
            A+ I G+ LY G IIGGV ++ GLY++LWGK KD++ N   +   EE    P LD  K+ 
Sbjct  300  AYFIFGENLYVGSIIGGVVVILGLYMLLWGKDKDQEYNAAGAATGEEQGGSPDLDCEKQQ  359

Query  137  EE  132
             +
Sbjct  360  RQ  361



>ref|XP_007144918.1| hypothetical protein PHAVU_007G194500g [Phaseolus vulgaris]
 gb|ESW16912.1| hypothetical protein PHAVU_007G194500g [Phaseolus vulgaris]
Length=370

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -3

Query  488  VERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAVM  309
            V+   + W I S  E+  ILYAG +  G++I +Q W  ++ GPVFV+ F P+ T+LVA++
Sbjct  237  VQHKPRAWFITSTVELCCILYAGAICGGLIIFIQFWTAEQKGPVFVSMFNPLGTILVAIL  296

Query  308  AFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEET  174
            A+ + G++L+TG ++G V ++ GLYL+LWGK  D+  NSQ++  T
Sbjct  297  AYFLFGEQLHTGSLLGVVIVIIGLYLLLWGKDSDQDYNSQQSLAT  341



>gb|KDP38760.1| hypothetical protein JCGZ_04113 [Jatropha curcas]
Length=160

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 77/130 (59%), Gaps = 2/130 (2%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F+ERD+  W++ S  E+   L+AGIV+S +    Q WC+ + GP+F A F P+ TV+V V
Sbjct  15   FLERDISAWKLHSYLELSCCLFAGIVASALSFFAQAWCVSQRGPLFTAMFNPLCTVIVTV  74

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKK--D  138
             A + + + +Y G ++GGV ++ GLY++LWGK KD + N +E +  L    +       D
Sbjct  75   FAALFLHEEIYIGSLLGGVGVIIGLYILLWGKAKDFRKNGEEVDPKLGIDQMQNANTLID  134

Query  137  EECPVGADIP  108
            E+C    + P
Sbjct  135  EKCKADLEEP  144



>gb|ABF93996.1| Integral membrane protein DUF6 containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAH01341.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58327.1| hypothetical protein OsJ_09421 [Oryza sativa Japonica Group]
Length=374

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF++   + W+I  G +   I+Y+G   +G  +  Q WC +K GPVFV  F P+ T++VA
Sbjct  240  AFMQHKPEDWRIGFGLKFWCIVYSGFACNGFTVFAQLWCTEKKGPVFVTMFNPLSTIMVA  299

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEET  174
            ++A+ + G+ LY G IIGGV ++ GLY++LWGK KD++ N+ + +E+
Sbjct  300  ILAYFMFGENLYVGSIIGGVVVILGLYMLLWGKDKDQEYNANKQQES  346



>ref|XP_010268393.1| PREDICTED: WAT1-related protein At4g30420-like isoform X1 [Nelumbo 
nucifera]
Length=378

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 76/127 (60%), Gaps = 10/127 (8%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F+E D   W I+S  E++ ILY GIV SG+   L  WCI K GP+F A F P+ TV+  +
Sbjct  246  FLESDPTSWNIKSSFELLCILYGGIVGSGLSFFLLPWCISKRGPLFAAMFSPLSTVITTI  305

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKD-RKINSQE---NEET------LKKP  162
            +A +I+ + L+ G + G + ++ GLY VLWGKT+D   I + E   NE T      L++P
Sbjct  306  LASLILHEDLFIGSLSGAILVIGGLYAVLWGKTRDLTDIKTDERPRNESTMSCKINLEEP  365

Query  161  LLDGNKK  141
            LL  +K 
Sbjct  366  LLAHDKS  372



>ref|NP_001142002.1| hypothetical protein [Zea mays]
 ref|XP_008668288.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF87460.1| unknown [Zea mays]
 tpg|DAA43389.1| TPA: hypothetical protein ZEAMMB73_056334 [Zea mays]
Length=377

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 76/121 (63%), Gaps = 0/121 (0%)
 Frame = -3

Query  491  FVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVAV  312
            F++ + + W+I  G +   I+Y+G+  +G  + +Q WC +K GPVFV  F P+ T++VA+
Sbjct  248  FMQHEPEEWRIGFGVKFWSIVYSGLACNGFTVFVQLWCTEKKGPVFVTMFNPLSTIMVAI  307

Query  311  MAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEETLKKPLLDGNKKDEE  132
            +A+ I G+ LY G I+GG  ++ GLY++LWGK KD++  + +  E L+       KK  +
Sbjct  308  LAYFIFGENLYVGSIVGGGVVILGLYMLLWGKEKDQERGTGKEREQLETDCEKQAKKVSD  367

Query  131  C  129
            C
Sbjct  368  C  368



>gb|EEC74527.1| hypothetical protein OsI_10035 [Oryza sativa Indica Group]
Length=390

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -3

Query  494  AFVERDLKHWQIQSGEEIVLILYAGIVSSGIVISLQTWCIQKGGPVFVASFQPVQTVLVA  315
            AF++   + W+I  G +   I+Y+G   +G  +  Q WC +K GPVFV  F P+ T++VA
Sbjct  240  AFMQHKPEDWRIGFGLKFWCIVYSGFACNGFTVFAQLWCTEKKGPVFVTMFNPLSTIMVA  299

Query  314  VMAFVIIGDRLYTggiiggvfivaGLYLVLWGKTKDRKINSQENEET  174
            ++A+ + G+ LY G IIGGV ++ GLY++LWGK KD++ N+ + +E+
Sbjct  300  ILAYFMFGENLYVGSIIGGVVVILGLYMLLWGKDKDQEYNANKQQES  346



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508931117092