BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22257_g3_i2 len=418 path=[1436:0-94 1923:95-417]

Length=418
                                                                      Score     E

gb|AAF97591.1|AF263917_1  plasma membrane proton ATPase                 206   9e-63   Solanum lycopersicum
gb|EPS59184.1|  hypothetical protein M569_15622                         209   4e-62   
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                211   7e-61   
emb|CAC28224.1|  p-type H+-ATPase                                       199   8e-61   Sesbania rostrata
emb|CAC28223.1|  p-type H+-ATPase                                       198   1e-60   Sesbania rostrata
dbj|BAB39362.1|  plasma membrane H+-ATPase                              196   1e-60   Vallisneria gigantea
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       210   1e-60   
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          209   2e-60   
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     209   2e-60   
gb|AAQ19040.1|  P-type H+-ATPase                                        197   3e-60   Phaseolus acutifolius
emb|CDO98206.1|  unnamed protein product                                209   3e-60   
emb|CAC28221.1|  p-type H+-ATPase                                       197   3e-60   Sesbania rostrata
emb|CAA64406.1|  H(+)-transporting ATPase                               196   4e-60   Phaseolus vulgaris [French bean]
emb|CDP14275.1|  unnamed protein product                                207   4e-60   
dbj|BAB39360.1|  plasma membrane H+-ATPase                              194   5e-60   Vallisneria gigantea
gb|EPS57651.1|  hypothetical protein M569_17165                         209   6e-60   
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4                209   6e-60   
gb|AAQ19038.1|  P-type H+-ATPase                                        196   9e-60   Vicia faba [broad bean]
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             208   1e-59   
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    208   1e-59   
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    208   1e-59   
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     208   1e-59   
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    208   1e-59   
gb|AAK32119.1|  plasmalemma H+-ATPase 2                                 196   1e-59   Hordeum vulgare [barley]
gb|AAA81348.1|  p-type H+-ATPase                                        199   1e-59   Vicia faba [broad bean]
emb|CAC28222.1|  p-type H+-ATPase                                       196   1e-59   Sesbania rostrata
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    207   1e-59   
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...    207   2e-59   
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          207   2e-59   
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    207   2e-59   
gb|AEH41439.1|  plasma membrane H+-ATPase                               196   2e-59   
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     207   3e-59   
emb|CBN72504.1|  putative autoinhibited H+ ATPase                       195   3e-59   
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    205   3e-59   Ricinus communis
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          207   3e-59   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          206   3e-59   
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type-like     206   3e-59   
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       206   3e-59   
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...    206   3e-59   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             206   4e-59   
dbj|BAD16688.1|  plasma membrane H+-ATPase                              206   4e-59   Daucus carota [Queen Anne's lace]
gb|KEH39623.1|  plasma membrane H+-ATPase                               206   4e-59   
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           206   4e-59   
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             206   4e-59   
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                206   4e-59   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     206   4e-59   
gb|KHN22411.1|  ATPase 9, plasma membrane-type                          206   5e-59   
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     206   5e-59   
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    206   5e-59   
emb|CDY03545.1|  BnaC03g68040D                                          204   5e-59   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    206   5e-59   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     204   6e-59   Vitis vinifera
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     206   6e-59   
gb|AAK32118.1|  plasmalemma H+-ATPase 1                                 196   6e-59   Hordeum vulgare [barley]
ref|XP_007012006.1|  H(+)-ATPase 8                                      206   6e-59   
gb|ACL37322.1|  plasma membrane H+-ATPase                               196   8e-59   Eichhornia crassipes
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           206   8e-59   
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  206   8e-59   
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          204   8e-59   Vitis vinifera
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             206   8e-59   
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     205   9e-59   
emb|CAC28220.1|  p-type H+-ATPase                                       193   9e-59   Sesbania rostrata
ref|XP_008346827.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    201   1e-58   
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             205   1e-58   
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     205   1e-58   
ref|XP_006848753.1|  hypothetical protein AMTR_s00026p00031590          199   1e-58   
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     205   1e-58   
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    205   1e-58   
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           205   1e-58   
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                205   1e-58   
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    205   2e-58   
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           204   2e-58   
gb|KHN01287.1|  Plasma membrane ATPase 4                                204   2e-58   
gb|ACE77057.1|  plasma membrane proton pump                             204   2e-58   Cucumis sativus [cucumbers]
emb|CAN78639.1|  hypothetical protein VITISV_031738                     204   2e-58   Vitis vinifera
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             204   2e-58   
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     204   2e-58   
gb|EYU24620.1|  hypothetical protein MIMGU_mgv1a001404mg                204   2e-58   
gb|KGN60742.1|  hypothetical protein Csa_2G009310                       204   2e-58   
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             204   2e-58   Vitis vinifera
sp|P23980.1|PMA2_SOLLC  RecName: Full=Plasma membrane ATPase 2; A...    202   2e-58   Solanum lycopersicum
ref|XP_004159431.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 8, pl...    204   2e-58   
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like     204   2e-58   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             204   2e-58   
gb|EYU35893.1|  hypothetical protein MIMGU_mgv1a0008591mg               202   2e-58   
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  204   2e-58   
ref|XP_001771404.1|  predicted protein                                  199   3e-58   
gb|EYU45222.1|  hypothetical protein MIMGU_mgv1a026587mg                199   3e-58   
ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like           204   3e-58   
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                203   3e-58   
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           204   3e-58   
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          204   3e-58   
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          204   3e-58   
gb|AAD46186.1|  plasma membrane proton ATPase                           204   3e-58   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CDP14278.1|  unnamed protein product                                206   3e-58   
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           204   4e-58   
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                204   4e-58   
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     204   4e-58   
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     204   4e-58   
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      204   4e-58   
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          204   4e-58   
gb|AAB17186.1|  plasma membrane H+-ATPase                               204   4e-58   Solanum lycopersicum
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    204   4e-58   
emb|CAB85497.1|  H+-ATPase                                              192   4e-58   Medicago truncatula
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     204   4e-58   
gb|AAO72564.1|  plasma membrane H+-ATPase-like protein                  199   4e-58   Oryza sativa Japonica Group [Japonica rice]
gb|AAV49159.1|  plasma membrane proton ATPase 5                         203   4e-58   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     202   4e-58   
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           203   5e-58   
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                203   5e-58   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           203   5e-58   
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                     203   5e-58   
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             203   5e-58   
gb|AAD20330.1|  plasma membrane proton-ATPase gene OSA3                 192   5e-58   Oryza sativa [red rice]
dbj|BAB39361.1|  plasma membrane H+-ATPase                              189   5e-58   Vallisneria gigantea
emb|CDY67153.1|  BnaAnng23670D                                          203   6e-58   
gb|KDP38637.1|  hypothetical protein JCGZ_03990                         203   6e-58   
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          203   7e-58   
dbj|BAD16686.1|  plasma membrane H+-ATPase                              203   7e-58   Daucus carota [Queen Anne's lace]
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     203   7e-58   
dbj|BAM20988.1|  plasma membrane H+-ATPase                              197   7e-58   
ref|XP_007011593.1|  Plasma membrane ATPase 4 isoform 2                 201   7e-58   
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    203   8e-58   
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like     202   8e-58   
gb|KFK29576.1|  h(+)-atpase 2                                           203   8e-58   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                202   8e-58   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     202   9e-58   
dbj|BAO02511.1|  predicted H+ ATPase ortholog                           201   9e-58   
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    202   9e-58   
emb|CBI35956.3|  unnamed protein product                                202   9e-58   
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             202   1e-57   
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    202   1e-57   
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           202   1e-57   
dbj|BAJ34124.1|  unnamed protein product                                202   1e-57   
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like     202   1e-57   
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             202   1e-57   
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    202   1e-57   
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         202   1e-57   
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-like     199   1e-57   
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             202   1e-57   
ref|XP_002304716.2|  H+-ATPase family protein                           202   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004251768.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    202   1e-57   
ref|XP_006350073.1|  PREDICTED: ATPase 8, plasma membrane-type-like     202   1e-57   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                202   1e-57   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          202   1e-57   
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           202   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010313836.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    202   1e-57   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             202   1e-57   
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     202   1e-57   
dbj|BAO45902.1|  plasma membrane H+-ATPase                              202   1e-57   
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    202   1e-57   
ref|XP_002991931.1|  hypothetical protein SELMODRAFT_430150             201   1e-57   
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    202   1e-57   
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                202   1e-57   
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             202   1e-57   
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             202   1e-57   
ref|XP_009126895.1|  PREDICTED: ATPase 3, plasma membrane-type-like     201   1e-57   
gb|EPS66977.1|  hypothetical protein M569_07799                         202   1e-57   
gb|KHF98166.1|  Plasma membrane ATPase 4                                200   1e-57   
ref|XP_002864812.1|  AHA11-ATPASE 11                                    202   1e-57   
emb|CDY30730.1|  BnaA02g33520D                                          201   1e-57   
gb|KHG26452.1|  Plasma membrane ATPase 4                                200   1e-57   
gb|AAB41898.1|  H+-transporting ATPase                                  202   1e-57   Mesembryanthemum crystallinum
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             201   2e-57   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             202   2e-57   
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                202   2e-57   
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type-like    202   2e-57   
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     202   2e-57   
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          202   2e-57   
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                199   2e-57   
gb|AAA81349.1|  VHA1                                                    192   2e-57   Vicia faba [broad bean]
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           202   2e-57   
emb|CAB69823.1|  plasma membrane H+ ATPase                              202   2e-57   Prunus persica
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           202   2e-57   
emb|CDY14186.1|  BnaA08g13170D                                          202   2e-57   
gb|ACL37321.1|  plasma membrane H+-ATPase                               192   2e-57   Eichhornia crassipes
ref|NP_001234477.1|  plasma membrane H+-ATPase                          202   2e-57   
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          202   2e-57   
ref|NP_201073.1|  H(+)-ATPase 11                                        202   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             201   2e-57   
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          202   2e-57   
gb|AAB84204.1|  plasma membrane H+-ATPase                               190   2e-57   Kosteletzkya virginica [seashore mallow]
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like           202   2e-57   
gb|AFM52333.1|  plasma membrane H+-ATPase                               201   2e-57   
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      201   2e-57   
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    201   2e-57   
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                201   2e-57   
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                201   2e-57   
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...    201   2e-57   
gb|AAA34052.1|  H+-translocating ATPase                                 201   2e-57   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KFK27283.1|  h(+)-atpase 3                                           201   2e-57   
gb|AAB84203.1|  plasma membrane H+-ATPase                               190   2e-57   Kosteletzkya virginica [seashore mallow]
dbj|BAM20989.1|  plasma membrane H+-ATPase                              201   2e-57   
ref|XP_002307856.1|  ATPase 6 family protein                            201   2e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                201   2e-57   
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    201   3e-57   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CDP02997.1|  unnamed protein product                                201   3e-57   
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         201   3e-57   
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     201   3e-57   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             201   3e-57   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   201   3e-57   
dbj|BAM20990.1|  plasma membrane H+-ATPase                              201   3e-57   
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                   199   3e-57   
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...    201   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           201   3e-57   
dbj|BAD16689.1|  plasma membrane H+-ATPase                              201   3e-57   Daucus carota [Queen Anne's lace]
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           201   3e-57   
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 201   3e-57   
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             201   3e-57   
gb|KHG28536.1|  Plasma membrane ATPase 4                                199   3e-57   
emb|CAA59799.1|  H(+)-transporting ATPase                               201   3e-57   Phaseolus vulgaris [French bean]
gb|KGN65225.1|  hypothetical protein Csa_1G267210                       200   3e-57   
ref|XP_007151191.1|  hypothetical protein PHAVU_004G025700g             201   3e-57   
gb|AAA98916.1|  Theoretical protein with similarity to Swiss-Prot...    194   3e-57   
gb|KGN62872.1|  hypothetical protein Csa_2G378540                       197   3e-57   
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          201   4e-57   
gb|EAZ21357.1|  hypothetical protein OsJ_37014                          201   4e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  201   4e-57   
gb|KEH39757.1|  plasma membrane H+-ATPase                               200   4e-57   
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     201   4e-57   
gb|EEC69747.1|  hypothetical protein OsI_39279                          201   4e-57   Oryza sativa Indica Group [Indian rice]
ref|NP_194748.1|  H(+)-ATPase 2                                         201   4e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KHN13245.1|  Plasma membrane ATPase 1                                201   4e-57   
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     201   4e-57   
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     201   4e-57   
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             201   4e-57   
gb|KHN34200.1|  ATPase 11, plasma membrane-type                         201   4e-57   
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          201   4e-57   
gb|AAQ55291.1|  plasma membrane H+-ATPase                               201   4e-57   Juglans regia
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           201   5e-57   
ref|NP_001067382.1|  Os12g0638700                                       201   5e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           201   5e-57   
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein            199   5e-57   
emb|CDY62140.1|  BnaCnng39300D                                          199   5e-57   
gb|KEH37844.1|  plasma membrane H+-ATPase                               200   5e-57   
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                201   5e-57   
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          201   5e-57   
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    200   5e-57   
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                   200   5e-57   
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like           201   5e-57   
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    201   6e-57   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     200   6e-57   
gb|KGN63646.1|  hypothetical protein Csa_1G008520                       199   6e-57   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     200   6e-57   
dbj|BAD16684.1|  plasma membrane H+-ATPase                              200   6e-57   Daucus carota [Queen Anne's lace]
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   200   6e-57   
gb|AEQ27822.1|  PM H+-ATPase R                                          200   6e-57   
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  200   6e-57   
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         200   6e-57   
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       199   6e-57   
gb|ACN34067.1|  unknown                                                 199   6e-57   Zea mays [maize]
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             200   6e-57   
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    200   7e-57   
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           200   7e-57   
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like    200   7e-57   
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             200   7e-57   
ref|XP_010111939.1|  Plasma membrane ATPase 4                           200   7e-57   
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                     200   7e-57   
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 200   7e-57   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    200   7e-57   
gb|EPS73574.1|  hypothetical protein M569_01174                         199   7e-57   
gb|AAF27113.1|AC018849_1  aha9, 5' partial; 1-2403                      197   8e-57   
ref|XP_002324564.1|  ATPase 6 family protein                            200   8e-57   Populus trichocarpa [western balsam poplar]
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     200   8e-57   
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     200   8e-57   
dbj|BAF03589.1|  P-type H+-ATPase                                       200   8e-57   Zostera marina
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          200   8e-57   
emb|CBW30211.1|  Plasma membrane ATPase                                 200   8e-57   
emb|CDY45757.1|  BnaC02g42250D                                          200   8e-57   
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     200   8e-57   
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           200   8e-57   
emb|CBW30173.1|  Plasma membrane ATPase 4                               200   8e-57   
dbj|BAJ33915.1|  unnamed protein product                                200   8e-57   
gb|KEH39758.1|  plasma membrane H+-ATPase                               200   8e-57   
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                   199   8e-57   
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          200   8e-57   
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    200   8e-57   
gb|ABW25091.1|  plasma membrane proton pump                             200   9e-57   Cucumis sativus [cucumbers]
ref|XP_009150710.1|  PREDICTED: ATPase 1, plasma membrane-type-like     200   9e-57   
ref|XP_006595243.1|  PREDICTED: plasma membrane ATPase 1-like           199   9e-57   
ref|XP_002979990.1|  hypothetical protein SELMODRAFT_419690             201   9e-57   
ref|XP_002309321.1|  ATPase 6 family protein                            200   9e-57   
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          199   9e-57   
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 200   9e-57   
gb|KHN38020.1|  Plasma membrane ATPase                                  199   9e-57   
gb|AAY42949.1|  plasma membrane H+ ATPase                               200   1e-56   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     200   1e-56   
ref|XP_007023381.1|  H(+)-ATPase 9                                      196   1e-56   
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          200   1e-56   
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like           200   1e-56   
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    200   1e-56   
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         200   1e-56   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   200   1e-56   
gb|AAR32129.2|  proton P-ATPase                                         200   1e-56   
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525              199   1e-56   
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like     200   1e-56   
gb|KDO76027.1|  hypothetical protein CISIN_1g005866mg                   197   1e-56   
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   199   1e-56   
ref|XP_003554288.1|  PREDICTED: plasma membrane ATPase 1-like           199   1e-56   
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                199   1e-56   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          199   1e-56   
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             199   1e-56   
gb|KCW49373.1|  hypothetical protein EUGRSUZ_K02916                     199   1e-56   
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             199   1e-56   
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     199   1e-56   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     199   1e-56   
emb|CDP14881.1|  unnamed protein product                                199   1e-56   
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             199   1e-56   
ref|XP_011034499.1|  PREDICTED: plasma membrane ATPase 4-like           199   1e-56   
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     199   1e-56   
ref|XP_004138147.1|  PREDICTED: ATPase 4, plasma membrane-type-like     199   1e-56   
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...    198   1e-56   
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3                199   1e-56   
dbj|BAA37150.1|  p-type H+-ATPase                                       199   1e-56   
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    199   1e-56   
gb|KDO76029.1|  hypothetical protein CISIN_1g005866mg                   197   1e-56   
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    199   1e-56   
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             199   1e-56   
ref|NP_179486.1|  H(+)-ATPase 1                                         199   1e-56   
ref|XP_002511508.1|  H(\+)-transporting atpase plant/fungi plasma...    198   1e-56   
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   199   1e-56   
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         199   1e-56   
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          199   1e-56   
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             199   1e-56   
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                199   2e-56   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             199   2e-56   
dbj|BAH56991.1|  AT4G30190                                              198   2e-56   
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    199   2e-56   
ref|XP_002517457.1|  H(\+)-transporting atpase plant/fungi plasma...    198   2e-56   
gb|KCW49372.1|  hypothetical protein EUGRSUZ_K02916                     199   2e-56   
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           199   2e-56   
emb|CAN64375.1|  hypothetical protein VITISV_014422                     199   2e-56   
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                199   2e-56   
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                199   2e-56   
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          199   2e-56   
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     199   2e-56   
emb|CDX82608.1|  BnaC07g02580D                                          199   2e-56   
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             199   2e-56   
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           199   2e-56   
ref|XP_009335819.1|  PREDICTED: plasma membrane ATPase 1-like           199   2e-56   
gb|EPS65442.1|  hypothetical protein M569_09334                         199   2e-56   
ref|NP_200545.1|  H(+)-ATPase 3                                         199   2e-56   
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type         199   2e-56   
emb|CDY56511.1|  BnaCnng30540D                                          199   2e-56   
ref|XP_004955721.1|  PREDICTED: plasma membrane ATPase 1-like           199   2e-56   
ref|XP_002466646.1|  hypothetical protein SORBIDRAFT_01g011610          198   2e-56   
gb|AAL09726.1|  AT5g57350/MJB24_16                                      199   2e-56   
gb|KHG12451.1|  ATPase 4, plasma membrane-type -like protein            197   2e-56   
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          199   2e-56   
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     199   2e-56   
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...    197   2e-56   
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                199   2e-56   
dbj|BAG94605.1|  unnamed protein product                                198   2e-56   
ref|XP_002459489.1|  hypothetical protein SORBIDRAFT_02g005440          199   2e-56   
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             199   2e-56   
gb|EPS63245.1|  hypothetical protein M569_11541                         199   2e-56   
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     199   2e-56   
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         199   2e-56   
dbj|BAC77532.1|  plasma membrane H+-ATPase                              199   3e-56   
emb|CDY47940.1|  BnaA02g08160D                                          199   3e-56   
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like           199   3e-56   
gb|KHN22686.1|  Plasma membrane ATPase 4                                199   3e-56   
ref|NP_001234775.1|  plasma membrane ATPase 1                           199   3e-56   
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           199   3e-56   
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    199   3e-56   
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...    199   3e-56   
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    199   3e-56   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              199   3e-56   
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    199   3e-56   
ref|XP_010429431.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    197   3e-56   
gb|KHN17608.1|  Plasma membrane ATPase 4                                199   3e-56   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     198   3e-56   
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             198   3e-56   
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    199   3e-56   
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                198   3e-56   
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g             197   3e-56   
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    198   3e-56   
gb|AEO22063.1|  plasma membrane H+-ATPase                               198   3e-56   
emb|CAC50884.1|  plasma membrane H+-ATPase                              196   3e-56   
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           198   3e-56   
ref|NP_001049185.2|  Os03g0183900                                       187   3e-56   
ref|NP_001054118.1|  Os04g0656100                                       198   3e-56   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          198   4e-56   
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          198   4e-56   
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    198   4e-56   
ref|XP_010094202.1|  Plasma membrane ATPase 4                           198   4e-56   
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    198   4e-56   
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                198   4e-56   
gb|KGN64262.1|  hypothetical protein Csa_1G045600                       197   4e-56   
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    198   4e-56   
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             198   4e-56   
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg                198   4e-56   
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like           198   4e-56   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             198   4e-56   
ref|XP_006837363.1|  hypothetical protein AMTR_s00111p00107570          199   4e-56   
emb|CAD29313.1|  plasma membrane H+-ATPase                              198   4e-56   
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                198   4e-56   
ref|NP_001169274.1|  uncharacterized protein LOC100383137               198   4e-56   
ref|XP_008650970.1|  PREDICTED: uncharacterized protein LOC100216...    198   4e-56   
ref|XP_008677590.1|  PREDICTED: uncharacterized protein LOC100383...    198   5e-56   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     198   5e-56   
ref|XP_007037195.1|  H(+)-transporting atpase plant/fungi plasma ...    200   5e-56   
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    198   5e-56   
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type          198   5e-56   
emb|CDY38294.1|  BnaA10g11420D                                          198   5e-56   
ref|XP_008341531.1|  PREDICTED: plasma membrane ATPase 1-like           198   5e-56   
gb|KHN15309.1|  Plasma membrane ATPase 4                                198   5e-56   
ref|XP_010531800.1|  PREDICTED: ATPase 4, plasma membrane-type-like     198   6e-56   
gb|ABA18112.1|  putative plasma membrane ATPase                         197   6e-56   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             197   6e-56   
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g             197   6e-56   
gb|ABR18001.1|  unknown                                                 197   6e-56   
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             197   6e-56   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             197   6e-56   
emb|CBI20766.3|  unnamed protein product                                197   6e-56   
gb|AAY42950.1|  plasma membrane H+ ATPase                               197   7e-56   
ref|NP_189850.1|  H(+)-ATPase 8                                         197   7e-56   
gb|KFK32649.1|  hypothetical protein AALP_AA6G270500                    197   7e-56   
ref|XP_004171391.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 4, pl...    197   7e-56   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     197   7e-56   
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                197   7e-56   
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    197   7e-56   
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          197   7e-56   
ref|XP_006382164.1|  H+-ATPase family protein                           197   7e-56   
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             197   7e-56   
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             197   7e-56   
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    197   8e-56   
emb|CDY64741.1|  BnaCnng44750D                                          197   8e-56   
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           198   8e-56   
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         197   8e-56   
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     197   8e-56   
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like    197   8e-56   
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                197   8e-56   
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         197   8e-56   
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             197   8e-56   
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             197   9e-56   
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    197   9e-56   
emb|CDX72218.1|  BnaC07g42400D                                          197   1e-55   
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...    197   1e-55   
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         197   1e-55   
gb|KDO72464.1|  hypothetical protein CISIN_1g0021762mg                  196   1e-55   
ref|XP_002297804.2|  H+-ATPase family protein                           197   1e-55   
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    197   1e-55   
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           197   1e-55   
gb|KHG14131.1|  ATPase 4, plasma membrane-type -like protein            195   1e-55   
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                197   1e-55   
emb|CDY25913.1|  BnaC09g32850D                                          197   1e-55   
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                197   1e-55   
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210          197   1e-55   
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    197   1e-55   
gb|AEQ27823.1|  PM H+-ATPase L                                          197   1e-55   
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                197   1e-55   
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    197   1e-55   
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             197   1e-55   
ref|XP_011081303.1|  PREDICTED: plasma membrane ATPase 1-like           197   1e-55   
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    197   1e-55   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             196   2e-55   
gb|EMS63640.1|  Plasma membrane ATPase 1                                197   2e-55   
ref|NP_190378.2|  H(+)-ATPase 4                                         196   2e-55   
ref|NP_001185450.1|  H(+)-ATPase 9                                      196   2e-55   
gb|KDO72462.1|  hypothetical protein CISIN_1g0021762mg                  196   2e-55   
ref|NP_178181.1|  H(+)-ATPase 9                                         196   2e-55   
dbj|BAL41366.1|  plasma membrane H+-ATPase                              196   2e-55   
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           196   2e-55   
ref|XP_004508788.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    196   2e-55   
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 196   2e-55   
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...    196   2e-55   
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like           196   2e-55   
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg             196   2e-55   
ref|XP_004508787.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    196   2e-55   
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    196   2e-55   
ref|XP_011045013.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     195   2e-55   
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                196   2e-55   
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         196   2e-55   
ref|XP_006482527.1|  PREDICTED: plasma membrane ATPase 1-like           196   2e-55   
gb|EEC83158.1|  hypothetical protein OsI_28372                          195   2e-55   
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         196   2e-55   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    196   2e-55   
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           196   2e-55   
gb|EEC81667.1|  hypothetical protein OsI_25220                          196   3e-55   
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           196   3e-55   
emb|CAC29436.1|  P-type H+-ATPase                                       196   3e-55   
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type         196   3e-55   
ref|NP_001059093.1|  Os07g0191200                                       196   3e-55   
gb|AFC88896.1|  plasma membrane H+-ATPase                               196   3e-55   
dbj|BAA06629.1|  plasma membrane H+-ATPase                              196   3e-55   
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    196   3e-55   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          196   3e-55   
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    196   3e-55   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             196   3e-55   
gb|AAN15220.1|  plasma membrane P-type proton pump ATPase               196   3e-55   
gb|EYU19268.1|  hypothetical protein MIMGU_mgv1a024366mg                196   3e-55   
dbj|BAA01058.1|  H-ATPase                                               196   3e-55   
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          196   3e-55   
ref|XP_003594954.1|  Plasma membrane ATPase                             196   3e-55   
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             196   3e-55   
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          196   4e-55   
emb|CAB85496.1|  H+-ATPase                                              185   4e-55   
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                196   4e-55   
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    195   4e-55   



>gb|AAF97591.1|AF263917_1 plasma membrane proton ATPase, partial [Solanum lycopersicum]
Length=321

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL+LGVNVKMITGDQLAIGKETG
Sbjct  137  QTVPEKTKESAGGPWKFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETG  196

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS++LLGQ KDESI+S+P++ELIEKADGFAGVFPEHKYE
Sbjct  197  RRLGMGTNMYPSATLLGQSKDESISSIPVDELIEKADGFAGVFPEHKYE  245



>gb|EPS59184.1| hypothetical protein M569_15622, partial [Genlisea aurea]
Length=522

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  GGPW+FVGLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  36   QTVPEKTKESPGGPWVFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIGKETG  95

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQH+DESIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  96   RRLGMGTNMYPSSSLLGQHRDESIAHLPVDELIEKADGFAGVFPEHKYE  144



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score =   211 bits (538),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKEG GGPW FVGLLPLFDPPRHDSAETI++ALELGVNVKMITGDQLAIGKETG
Sbjct  466  QTVPEKTKEGSGGPWEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIAS+PI+ELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSSLLGQCKDESIASMPIDELIEKADGFAGVFPEHKYE  574


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC+LKG   K+A D ID FA+RGLR+    RQ    + +EG G
Sbjct  430  EQIIELCQLKGAVLKKAHDIIDNFANRGLRSLGIARQTVPEKTKEGSG  477



>emb|CAC28224.1| p-type H+-ATPase [Sesbania rostrata]
Length=245

 Score =   199 bits (505),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VP+  KE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  124  QEVPDGRKESAGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  183

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  184  RRLGMGTNMYPSSALLGQDKDESIAALPIDELIEKADGFAGVFPEHKYE  232



>emb|CAC28223.1| p-type H+-ATPase [Sesbania rostrata]
Length=245

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+K+  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  124  QEVPEKSKDSAGGPWQFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  183

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQ KD SIA+LPIEELIEKADGFAGVFPEHKYE
Sbjct  184  RRLGMGTNMYPSASLLGQDKDASIAALPIEELIEKADGFAGVFPEHKYE  232



>dbj|BAB39362.1| plasma membrane H+-ATPase [Vallisneria gigantea]
Length=174

 Score =   196 bits (498),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLLPLFDPPRHDSA+TI+RAL LGVNVKMITGDQLAI KETG
Sbjct  44   QEVPEKSKESAGGPWQFVGLLPLFDPPRHDSAKTIRRALNLGVNVKMITGDQLAIAKETG  103

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLG HKDES+ ++ +EELIEKADGFAGVFPEHK+E
Sbjct  104  RRLGMGTNMYPSSSLLGNHKDESLGTIAVEELIEKADGFAGVFPEHKFE  152



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score =   210 bits (534),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  404  QTVPEKTKESAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  463

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIASLP++ELIEKADGFAGVFPEHKYE
Sbjct  464  RRLGMGTNMYPSSSLLGQSKDESIASLPVDELIEKADGFAGVFPEHKYE  512


 Score = 49.7 bits (117),  Expect(2) = 1e-60, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ  113
            EQI+ELC+L+ D KK+A   IDKFADRGLR+    RQ
Sbjct  368  EQIIELCDLREDIKKKAHSIIDKFADRGLRSLAVCRQ  404



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   209 bits (533),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  465  QTVPEKTKESAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIASLP++ELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSSLLGQSKDESIASLPVDELIEKADGFAGVFPEHKYE  573


 Score = 49.7 bits (117),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ  113
            EQI+ELC+L+ D KK+A   IDKFADRGLR+    RQ
Sbjct  429  EQIIELCDLRDDIKKKAHSIIDKFADRGLRSLAVCRQ  465



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =   209 bits (533),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  465  QTVPEKTKESAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIASLP++ELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSSLLGQSKDESIASLPVDELIEKADGFAGVFPEHKYE  573


 Score = 49.3 bits (116),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ  113
            EQI+ELC+L+ D KK+A   IDKFADRGLR+    RQ
Sbjct  429  EQIIELCDLREDIKKKAHSIIDKFADRGLRSLAVCRQ  465



>gb|AAQ19040.1| P-type H+-ATPase [Phaseolus acutifolius]
Length=244

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+K+G GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  137  QEVPEKSKDGAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  196

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKY  415
            R LGMGTNMYPSS+LLGQ KD SI++LP++ELIEKADGFAGVFPEHKY
Sbjct  197  RSLGMGTNMYPSSALLGQDKDASISALPVDELIEKADGFAGVFPEHKY  244



>emb|CDO98206.1| unnamed protein product [Coffea canephora]
Length=956

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +2

Query  95   SVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGR  274
            +VPEKTKEG+GGPW+FVGLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGR
Sbjct  471  TVPEKTKEGQGGPWVFVGLLPLFDPPRHDSGETIKRALHLGVNVKMITGDQLAIAKETGR  530

Query  275  RLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RLGMG NMYPSSSLLGQHKDE+I++LP+EELIEKADGFAGVFPEHKYE
Sbjct  531  RLGMGINMYPSSSLLGQHKDETISNLPVEELIEKADGFAGVFPEHKYE  578



>emb|CAC28221.1| p-type H+-ATPase [Sesbania rostrata]
Length=245

 Score =   197 bits (501),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VP+  KE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  124  QEVPDGRKESAGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  183

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESI++LPI+ELIEKADGFAGVFPEHKYE
Sbjct  184  RRLGMGTNMYPSSALLGQDKDESISALPIDELIEKADGFAGVFPEHKYE  232



>emb|CAA64406.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=227

 Score =   196 bits (499),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VP+  KE  GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  99   QDVPDGKKESPGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  158

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESI++LPI+ELIEKADGFAGVFPEHKYE
Sbjct  159  RRLGMGTNMYPSSALLGQDKDESISALPIDELIEKADGFAGVFPEHKYE  207



>emb|CDP14275.1| unnamed protein product [Coffea canephora]
Length=635

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK KE  GGPW F+GLLPLFDPPRHDSAETI++AL+LGVNVKMITGDQLAIGKETG
Sbjct  150  QAVPEKNKESAGGPWEFIGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETG  209

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIAS+PI+ELIEKADGFAGVFPEHKYE
Sbjct  210  RRLGMGTNMYPSSSLLGQSKDESIASIPIDELIEKADGFAGVFPEHKYE  258


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI++LCELKG+ +K+A D ID FA+RGLR+    RQ    + +E  G
Sbjct  114  EQIIDLCELKGEVRKKAHDIIDNFANRGLRSLGVARQAVPEKNKESAG  161



>dbj|BAB39360.1| plasma membrane H+-ATPase [Vallisneria gigantea]
Length=174

 Score =   194 bits (494),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + V EK+KE  GGPW FVGLLPLFDPPRHDSAETI++AL LGVNVKMITGDQLAI KETG
Sbjct  44   QEVHEKSKESAGGPWQFVGLLPLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIAKETG  103

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLG+GTNMYPSSSLLGQ KD SIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  104  RRLGLGTNMYPSSSLLGQDKDASIAALPVDELIEKADGFAGVFPEHKYE  152



>gb|EPS57651.1| hypothetical protein M569_17165 [Genlisea aurea]
Length=955

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +SVPEKTKEG GGPW FVGLLPLFDPPRHDSAETI++AL+LGVNVKMITGDQLAIGKETG
Sbjct  472  QSVPEKTKEGAGGPWEFVGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETG  531

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ +DESIAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  532  RRLGMGTNMYPSSALLGQTRDESIASIPVDELIEKADGFAGVFPEHKYE  580



>ref|XP_004235922.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=954

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  G PW+FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  469  QTVPEKTKESPGSPWVFVGLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIGKETG  528

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDESIA+LP++ELIE ADGFAGVFPEHKYE
Sbjct  529  RRLGMGTNMYPSSSLLGQHKDESIANLPVDELIEMADGFAGVFPEHKYE  577



>gb|AAQ19038.1| P-type H+-ATPase [Vicia faba]
Length=244

 Score =   196 bits (498),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK K+G G PW FVGLLPLFDPPRHDSAETI RAL LGVNVKMITGDQLAI KETG
Sbjct  137  QEVPEKNKDGPGAPWQFVGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETG  196

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKY  415
            RRLGMGTNMYPSSSLLGQ KD ++A+LP++ELIEKADGFAGVFPEHKY
Sbjct  197  RRLGMGTNMYPSSSLLGQSKDAAVAALPVDELIEKADGFAGVFPEHKY  244



>ref|XP_006453678.1| hypothetical protein CICLE_v10007374mg [Citrus clementina]
 gb|ESR66918.1| hypothetical protein CICLE_v10007374mg [Citrus clementina]
Length=949

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE +G PW FVGLLPLFDPPRHDSAETI+RAL+LGVNVKMITGDQLAIGKETG
Sbjct  465  QTVPEKTKESEGSPWEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSSLLGQSKDESIASMPVEELIEKADGFAGVFPEHKYE  573



>ref|XP_010033995.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=931

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTK+  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QTVPEKTKDSAGEPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDESIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSSLLGQHKDESIAALPIDELIEKADGFAGVFPEHKYE  575



>ref|XP_010033996.1| PREDICTED: ATPase 9, plasma membrane-type isoform X3 [Eucalyptus 
grandis]
Length=920

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTK+  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  456  QTVPEKTKDSAGEPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  515

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDESIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  516  RRLGMGTNMYPSSSLLGQHKDESIAALPIDELIEKADGFAGVFPEHKYE  564



>ref|XP_006473964.1| PREDICTED: ATPase 8, plasma membrane-type-like [Citrus sinensis]
 gb|KDO59386.1| hypothetical protein CISIN_1g041450mg [Citrus sinensis]
Length=949

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE +G PW FVGLLPLFDPPRHDSAETI+RAL+LGVNVKMITGDQLAIGKETG
Sbjct  465  QTVPEKTKESEGSPWEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSSLLGQSKDESIASMPVEELIEKADGFAGVFPEHKYE  573



>ref|XP_010033994.1| PREDICTED: ATPase 9, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW53878.1| hypothetical protein EUGRSUZ_J03094 [Eucalyptus grandis]
Length=929

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTK+  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  465  QTVPEKTKDSAGEPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDESIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSSLLGQHKDESIAALPIDELIEKADGFAGVFPEHKYE  573



>gb|AAK32119.1| plasmalemma H+-ATPase 2 [Hordeum vulgare]
Length=240

 Score =   196 bits (497),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+K+  GGPW F+GLLPLFDPPRHDSAETI++AL LGVNVKMITGDQLAIGKETG
Sbjct  51   QEVPEKSKDSAGGPWQFIGLLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETG  110

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD S+ SLP++ELIEKADGFAGVFPEHKYE
Sbjct  111  RRLGMGTNMYPSSALLGQSKDGSLESLPVDELIEKADGFAGVFPEHKYE  159



>gb|AAA81348.1| p-type H+-ATPase, partial [Vicia faba]
Length=373

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  130  QEVPEKTKESAGGPWQFVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETG  189

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS++LLGQ KD SIA+LP+EELIEKADGFAGVFPEHKYE
Sbjct  190  RRLGMGTNMYPSATLLGQDKDASIAALPVEELIEKADGFAGVFPEHKYE  238



>emb|CAC28222.1| p-type H+-ATPase [Sesbania rostrata]
Length=245

 Score =   196 bits (497),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  124  QEVPEKSKESAGGPWQFVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETG  183

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS++LLGQ KD +IA+LP+EELIEKADGFAGVFPEHKYE
Sbjct  184  RRLGMGTNMYPSATLLGQGKDSNIAALPVEELIEKADGFAGVFPEHKYE  232



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =   207 bits (526),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  465  QTVPEKTKESAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIXKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIASLP++ELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSSLLGQSKDESIASLPVDELIEKADGFAGVFPEHKYE  573


 Score = 49.3 bits (116),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ  113
            EQI+ELC+L+ D KK+A   IDKFADRGLR+    RQ
Sbjct  429  EQIIELCDLREDIKKKAHSIIDKFADRGLRSLAVCRQ  465



>ref|XP_009341818.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Pyrus x 
bretschneideri]
Length=939

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETG
Sbjct  457  QTVPEKTKESAGNPWEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETG  516

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  517  RRLGMGTNMYPSSTLLGQSKDESIASMPVDELIEKADGFAGVFPEHKYE  565



>ref|XP_008384624.1| PREDICTED: ATPase 8, plasma membrane-type [Malus domestica]
Length=947

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETG
Sbjct  465  QTVPEKTKESAGSPWEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSTLLGQSKDESIASMPVDELIEKADGFAGVFPEHKYE  573



>ref|XP_009341817.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009341823.1| PREDICTED: ATPase 8, plasma membrane-type [Pyrus x bretschneideri]
Length=947

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETG
Sbjct  465  QTVPEKTKESAGNPWEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSTLLGQSKDESIASMPVDELIEKADGFAGVFPEHKYE  573



>gb|AEH41439.1| plasma membrane H+-ATPase [Melastoma malabathricum]
Length=268

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQ AIGKETG
Sbjct  140  QEVPEGRKESPGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQFAIGKETG  199

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG NMYPSS+LLGQ+KDESIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  200  RRLGMGINMYPSSALLGQNKDESIAALPVDELIEKADGFAGVFPEHKYE  248



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +++PEK KE  GGPW FVGLLPLFDPPRHDSAETI++AL+LGVNVKMITGDQLAIGKETG
Sbjct  466  QTIPEKNKESAGGPWEFVGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSSLLGQSKDESIASMPVEELIEKADGFAGVFPEHKYE  574


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELCELKG+  KRA + ID FA+RGLR+    RQ    + +E  G
Sbjct  430  EQIIELCELKGETLKRAHEIIDNFANRGLRSLGVARQTIPEKNKESAG  477



>emb|CBN72504.1| putative autoinhibited H+ ATPase [Populus x canadensis]
Length=246

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  101  PEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRRL  280
            PEK+K+  G PW  VGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRRL
Sbjct  1    PEKSKDAAGAPWQLVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRL  60

Query  281  GMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            GMGTNMYPSS+LLGQ KD SIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  61   GMGTNMYPSSALLGQDKDASIAALPVDELIEKADGFAGVFPEHKYE  106



>ref|XP_002527322.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF35074.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=733

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI RAL LGVNVKMITGDQLAIGKETG
Sbjct  248  QAVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETINRALNLGVNVKMITGDQLAIGKETG  307

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  308  RRLGMGTNMYPSSALLGQNKDESIAGLPVDELIEKADGFAGVFPEHKYE  356


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC L+ DAKK+A   IDKFADRGLR+    +Q    + +E PG
Sbjct  212  EQIIELCNLRDDAKKKAHAIIDKFADRGLRSLAVSKQAVPEKTKESPG  259



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +++PEK KE  GGPW FVGLLPLFDPPRHDSAETI++AL+LGVNVKMITGDQLAIGKETG
Sbjct  466  QTIPEKNKESAGGPWEFVGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSSLLGQSKDESIASMPVEELIEKADGFAGVFPEHKYE  574


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELCELKG+  KRA + ID FA+RGLR+    RQ    + +E  G
Sbjct  430  EQIIELCELKGETLKRAHEIIDNFANRGLRSLGVARQTIPEKNKESAG  477



>gb|KHN31888.1| ATPase 9, plasma membrane-type [Glycine soja]
Length=841

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  355  QEVPEKSKESAGGPWTFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  414

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPSSSLLG+HKDESIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  415  RRLGMGSNMYPSSSLLGEHKDESIAGLPVDELIEKADGFAGVFPEHKYE  463


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC+L+ D KK+AL  IDKFADRGLR+    +Q    + +E  G
Sbjct  319  EQIIELCKLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESAG  366



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=954

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK KE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QTVPEKNKESAGTPWQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLG+HKDES+ASLPI+ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGEHKDESVASLPIDELIEKADGFAGVFPEHKYE  576


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPGS  140
            EQI++LCELK DA+K+A   IDKFADRGLR+    RQ    + +E  G+
Sbjct  432  EQIIDLCELKDDARKKAHAIIDKFADRGLRSLAVCRQTVPEKNKESAGT  480



>ref|XP_010691622.1| PREDICTED: plasma membrane ATPase isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=950

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK+K+  GGPW FV LLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  463  QAVPEKSKDSPGGPWKFVALLPLFDPPRHDSAETIRRALGLGVNVKMITGDQLAIGKETG  522

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDESIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  523  RRLGMGTNMYPSSSLLGQHKDESIASIPVEELIEKADGFAGVFPEHKYE  571



>ref|XP_010691624.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=933

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK+K+  GGPW FV LLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  463  QAVPEKSKDSPGGPWKFVALLPLFDPPRHDSAETIRRALGLGVNVKMITGDQLAIGKETG  522

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDESIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  523  RRLGMGTNMYPSSSLLGQHKDESIASIPVEELIEKADGFAGVFPEHKYE  571



>ref|XP_007150788.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
 gb|ESW22782.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
Length=949

 Score =   206 bits (524),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  463  QDVPEKTKESSGGPWQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETG  522

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPSSSLLGQ+KDESI++LPI+ELIEKADGFAGVFPEHKYE
Sbjct  523  RRLGMGSNMYPSSSLLGQNKDESISALPIDELIEKADGFAGVFPEHKYE  571


 Score = 48.5 bits (114),  Expect(2) = 4e-59, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ  113
            EQI+ELC L+ D KK+AL  I KFADRGLR+    +Q
Sbjct  427  EQIIELCNLREDVKKKALSIIGKFADRGLRSLAVAKQ  463



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  89   SRSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKET  268
            S+ VPEK+K+  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KET
Sbjct  463  SQVVPEKSKDSAGGPWQFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKET  522

Query  269  GRRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            GRRLGMGTNMYPSSSLLGQHKDESIA+LPIEELIEKADGFAGVFPEHKYE
Sbjct  523  GRRLGMGTNMYPSSSLLGQHKDESIAALPIEELIEKADGFAGVFPEHKYE  572



>gb|KEH39623.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  463  QEVPEKSKESSGGPWTFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  522

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPSSSLLG+HKD SIASLP++ELIEKADGFAGVFPEHKYE
Sbjct  523  RRLGMGSNMYPSSSLLGEHKDASIASLPVDELIEKADGFAGVFPEHKYE  571



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QTVPEKNKESAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQCKDESIASIPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKTKESAGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKD+SIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDDSIAGLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKTKESPGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDESIA LP+EELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDESIAGLPVEELIEKADGFAGVFPEHKYE  576



>ref|XP_003543699.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  463  QEVPEKSKESAGGPWTFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  522

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPSSSLLG+HKDESIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  523  RRLGMGSNMYPSSSLLGEHKDESIAGLPVDELIEKADGFAGVFPEHKYE  571


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC+L+ D KK+AL  IDKFADRGLR+    +Q    + +E  G
Sbjct  427  EQIIELCKLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESAG  474



>gb|KHN22411.1| ATPase 9, plasma membrane-type [Glycine soja]
Length=916

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  430  QEVPEKSKESAGGPWTFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  489

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPSSSLLG+HKDESIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  490  RRLGMGSNMYPSSSLLGEHKDESIAGLPVDELIEKADGFAGVFPEHKYE  538


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC+L+ D KK+AL  IDKFADRGLR+    +Q    + +E  G
Sbjct  394  EQIIELCKLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESAG  441



>ref|XP_003547446.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  463  QEVPEKSKESAGGPWTFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  522

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPSSSLLG+HKDESIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  523  RRLGMGSNMYPSSSLLGEHKDESIAGLPVDELIEKADGFAGVFPEHKYE  571


 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC+L+ D KK+AL  IDKFADRGLR+    +Q    + +E  G
Sbjct  427  EQIIELCKLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESAG  474



>ref|XP_011078615.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Sesamum 
indicum]
Length=932

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +++PEKTKE  GGPW FVGLLPLFDPPRHDSAETI++AL+LGVNVKMITGDQLAIGKETG
Sbjct  466  QTIPEKTKESAGGPWEFVGLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSTLLGQSKDESIASIPVDELIEKADGFAGVFPEHKYE  574



>emb|CDY03545.1| BnaC03g68040D [Brassica napus]
Length=660

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  177  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  236

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  237  LGMGTNMYPSSALLGTHKDANLASIPVEELIEKADGFAGVFPEHKYE  283



>ref|XP_011078614.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X1 [Sesamum 
indicum]
Length=952

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +++PEKTKE  GGPW FVGLLPLFDPPRHDSAETI++AL+LGVNVKMITGDQLAIGKETG
Sbjct  466  QTIPEKTKESAGGPWEFVGLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSTLLGQSKDESIASIPVDELIEKADGFAGVFPEHKYE  574



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =   204 bits (519),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +++PEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  481  QTIPEKTKESXGKPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  540

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIA++P++ELIEKADGFAGVFPEHKYE
Sbjct  541  RRLGMGTNMYPSSSLLGQSKDESIATIPVDELIEKADGFAGVFPEHKYE  589


 Score = 50.1 bits (118),  Expect(2) = 6e-59, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ  113
            EQI++LCELKGD K +A   ID +ADRGLR+    RQ
Sbjct  445  EQIIDLCELKGDVKDKAHSIIDNYADRGLRSLAVARQ  481



>ref|XP_010687728.1| PREDICTED: ATPase 8, plasma membrane-type-like [Beta vulgaris 
subsp. vulgaris]
Length=954

 Score =   206 bits (524),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +SVPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL+LGVNVKMITGDQLAIGKETG
Sbjct  468  QSVPEKTKESAGSPWEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+ DESIAS+P+EELIE+ADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSTLLGQNMDESIASIPVEELIEQADGFAGVFPEHKYE  576


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPGS  140
            EQI+ELC+LKG+  K+A   ID +ADRGLR+    RQ    + +E  GS
Sbjct  432  EQIIELCDLKGEIMKKAHAVIDSYADRGLRSLAVARQSVPEKTKESAGS  480



>gb|AAK32118.1| plasmalemma H+-ATPase 1 [Hordeum vulgare]
Length=329

 Score =   196 bits (499),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+K+  GGPW F+GLLPLFDPPRHDSAETI++AL LGVNVKMITGDQLAIGKETG
Sbjct  142  QEVPEKSKDSAGGPWQFIGLLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETG  201

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD S+ SLP++ELIEKADGFAGVFPEHKYE
Sbjct  202  RRLGMGTNMYPSSALLGQSKDGSLESLPVDELIEKADGFAGVFPEHKYE  250



>ref|XP_007012006.1| H(+)-ATPase 8 [Theobroma cacao]
 gb|EOY29625.1| H(+)-ATPase 8 [Theobroma cacao]
Length=951

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +++PEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL+LGVNVKMITGDQLAIGKETG
Sbjct  468  QTIPEKTKESAGGPWEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDE+IA++P++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQSKDEAIAAIPVDELIEKADGFAGVFPEHKYE  576



>gb|ACL37322.1| plasma membrane H+-ATPase [Eichhornia crassipes]
Length=308

 Score =   196 bits (497),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEK+KE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETGRR
Sbjct  204  VPEKSKESPGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRR  263

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHK  412
            LGMGTNMYPSSSLLGQ+KD SIA+LP++ELIEKADGFAGVFPEHK
Sbjct  264  LGMGTNMYPSSSLLGQNKDASIAALPVDELIEKADGFAGVFPEHK  308



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =   206 bits (523),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VP KTKE  GGPW FVGLLPLFDPPRHDSAETI++AL LGVNVKMITGDQLAI KETG
Sbjct  469  QEVPAKTKESSGGPWQFVGLLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETG  528

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQHKDESIA+LPIEELIEKADGFAGVFPEHKYE
Sbjct  529  RRLGMGTNMYPSASLLGQHKDESIAALPIEELIEKADGFAGVFPEHKYE  577



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   206 bits (523),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE+TKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPERTKESAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKD+SIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDDSIAGLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   204 bits (518),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +++PEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  466  QTIPEKTKESAGKPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIA++P++ELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSSLLGQSKDESIATIPVDELIEKADGFAGVFPEHKYE  574


 Score = 50.1 bits (118),  Expect(2) = 8e-59, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ  113
            EQI++LCELKGD K +A   ID +ADRGLR+    RQ
Sbjct  430  EQIIDLCELKGDVKDKAHSIIDNYADRGLRSLAVARQ  466



>ref|XP_006282289.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
 gb|EOA15187.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
Length=949

 Score =   206 bits (523),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  GGPW FVG+LPLFDPPRHDSAETI+RALELGVNVKMITGDQLAI KETG
Sbjct  464  QTVPEKTKESSGGPWEFVGVLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIAKETG  523

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLG HKDE+IA LP+EELIEKADGFAGVFPEHKYE
Sbjct  524  RRLGMGTNMYPSASLLGNHKDEAIAHLPVEELIEKADGFAGVFPEHKYE  572



>ref|XP_010539422.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Tarenaya hassleriana]
Length=885

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/107 (92%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETGRR
Sbjct  401  VPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRR  460

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPS+SLLGQ KD SIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  461  LGMGTNMYPSASLLGQDKDPSIASIPVEELIEKADGFAGVFPEHKYE  507



>emb|CAC28220.1| p-type H+-ATPase [Sesbania rostrata]
Length=245

 Score =   193 bits (491),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK K+  G PW FV LLPLFDPPRHDSAETI RAL LGVNVKMITGDQLAI KETG
Sbjct  124  QEVPEKNKDSPGAPWQFVALLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETG  183

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD S+++LP++ELIEKADGFAGVFPEHKYE
Sbjct  184  RRLGMGTNMYPSSSLLGQSKDASVSALPVDELIEKADGFAGVFPEHKYE  232



>ref|XP_008346827.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 1-like, 
partial [Malus domestica]
Length=553

 Score =   201 bits (512),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 92/109 (84%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  G PW FVG++PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  227  QEVPEGRKESAGAPWQFVGVMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  286

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESI +LPI+ELIEKADGFAGVFPEHKYE
Sbjct  287  RRLGMGTNMYPSSALLGQDKDESIVALPIDELIEKADGFAGVFPEHKYE  335



>ref|XP_007135798.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
 gb|ESW07792.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
Length=949

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE KGGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKET 
Sbjct  463  QEVPEKTKESKGGPWQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETA  522

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPSSSLLG HKDESIA+LP++ELIE+ADGFAGVFPEHKYE
Sbjct  523  RRLGMGSNMYPSSSLLGDHKDESIAALPVDELIEQADGFAGVFPEHKYE  571



>ref|XP_011084026.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +++PEK KE +G PW FVGLLPLFDPPRHDSAETI++ALELGVNVKMITGDQLAIGKETG
Sbjct  466  QTIPEKNKESEGDPWEFVGLLPLFDPPRHDSAETIKKALELGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSTLLGQNKDESIASMPVEELIEKADGFAGVFPEHKYE  574


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 5/48 (10%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ-----RREREG  131
            EQI+ELC+LKGD  KRA + ID FA+RGLR+    RQ      +E EG
Sbjct  430  EQIIELCKLKGDTLKRAHEIIDNFANRGLRSLAVARQTIPEKNKESEG  477



>ref|XP_006848753.1| hypothetical protein AMTR_s00026p00031590 [Amborella trichopoda]
 gb|ERN10334.1| hypothetical protein AMTR_s00026p00031590 [Amborella trichopoda]
Length=438

 Score =   199 bits (505),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 89/109 (82%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW FV +LPLFDPPRHDSAETI+RAL LG+NVKMITGDQLAI KETG
Sbjct  39   QEVPEATKESAGGPWEFVAVLPLFDPPRHDSAETIKRALHLGLNVKMITGDQLAIAKETG  98

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLL Q KD+S+A LP++ELI+KADGFAGVFPEHKYE
Sbjct  99   RRLGMGTNMYPSSSLLSQSKDKSLAGLPVDELIQKADGFAGVFPEHKYE  147



>ref|XP_009366133.1| PREDICTED: ATPase 8, plasma membrane-type-like [Pyrus x bretschneideri]
Length=947

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK KE  G PW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETG
Sbjct  465  QTVPEKAKESTGNPWEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSTLLGQSKDESIASMPVDELIEKADGFAGVFPEHKYE  573



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/107 (92%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETGRR
Sbjct  466  VPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRR  525

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPS+SLLGQ KD SIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  526  LGMGTNMYPSASLLGQDKDPSIASIPVEELIEKADGFAGVFPEHKYE  572



>ref|XP_011082157.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEK KE  GGPWIFVGLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRR
Sbjct  470  VPEKNKESAGGPWIFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRR  529

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSSSLLGQHKDESI+ LP+EELIE ADGFAGVFPEHKYE
Sbjct  530  LGMGTNMYPSSSLLGQHKDESISELPVEELIETADGFAGVFPEHKYE  576



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE+TKE  GGPW  VGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPERTKESLGGPWQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDE+IASLP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDEAIASLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_010539421.1| PREDICTED: ATPase 2, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=950

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/107 (92%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETGRR
Sbjct  466  VPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRR  525

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPS+SLLGQ KD SIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  526  LGMGTNMYPSASLLGQDKDPSIASIPVEELIEKADGFAGVFPEHKYE  572



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK KE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKNKESPGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDESIA LP+EELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDESIAGLPVEELIEKADGFAGVFPEHKYE  576



>gb|KHN01287.1| Plasma membrane ATPase 4 [Glycine soja]
Length=885

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKET 
Sbjct  399  QEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETA  458

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPSSSLLG HKDESIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  459  RRLGMGSNMYPSSSLLGDHKDESIAALPVDELIEKADGFAGVFPEHKYE  507



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK KE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKNKESPGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDESIA LP+EELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDESIAGLPVEELIEKADGFAGVFPEHKYE  576



>emb|CAN78639.1| hypothetical protein VITISV_031738 [Vitis vinifera]
Length=958

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  472  QTVPEKNKESAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  531

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD SIA LPI+ELIEKADGFAGVFPEHKYE
Sbjct  532  RRLGMGTNMYPSSSLLGQSKDHSIADLPIDELIEKADGFAGVFPEHKYE  580


 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC LK  AKK+A   IDKFADRGLR+    +Q    + +E  G
Sbjct  436  EQIIELCNLKDHAKKKAHAIIDKFADRGLRSLAVSQQTVPEKNKESAG  483



>ref|XP_010914190.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=957

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKSKESAGGPWQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKD+SIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDDSIAGLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_008456775.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis melo]
Length=923

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++V EKTKE  G PW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETG
Sbjct  465  QTVLEKTKESSGEPWDFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDE+IAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSSLLGQSKDEAIASIPVEELIEKADGFAGVFPEHKYE  573



>gb|EYU24620.1| hypothetical protein MIMGU_mgv1a001404mg [Erythranthe guttata]
Length=825

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW  VGLLPLFDPPR DSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  339  QDVPEKTKESAGGPWSLVGLLPLFDPPRTDSAETIRRALHLGVNVKMITGDQLAIAKETG  398

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDESIA++P+EELIEKADGFAGVFPEHKYE
Sbjct  399  RRLGMGTNMYPSSSLLGQHKDESIANIPVEELIEKADGFAGVFPEHKYE  447



>gb|KGN60742.1| hypothetical protein Csa_2G009310 [Cucumis sativus]
Length=814

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++V EKTKE  G PW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETG
Sbjct  356  QTVLEKTKESTGEPWDFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETG  415

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDE+IAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  416  RRLGMGTNMYPSSSLLGQSKDEAIASIPVEELIEKADGFAGVFPEHKYE  464



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  464  QTVPEKNKESAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  523

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD SIA LPI+ELIEKADGFAGVFPEHKYE
Sbjct  524  RRLGMGTNMYPSSSLLGQSKDHSIADLPIDELIEKADGFAGVFPEHKYE  572


 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC LK  AKK+A   IDKFADRGLR+    +Q    + +E  G
Sbjct  428  EQIIELCNLKDHAKKKAHAIIDKFADRGLRSLAVSQQTVPEKNKESAG  475



>sp|P23980.1|PMA2_SOLLC RecName: Full=Plasma membrane ATPase 2; AltName: Full=Proton 
pump 2, partial [Solanum lycopersicum]
Length=704

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  215  QEVPEGRKESSGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  274

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIASLPI+ELIEKADGFAGVFPEHKYE
Sbjct  275  RRLGMGTNMYPSSALLGQTKDESIASLPIDELIEKADGFAGVFPEHKYE  323



>ref|XP_004159431.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 8, plasma membrane-type-like, 
partial [Cucumis sativus]
Length=903

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++V EKTKE  G PW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETG
Sbjct  445  QTVLEKTKESTGEPWDFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETG  504

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDE+IAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  505  RRLGMGTNMYPSSSLLGQSKDEAIASIPVEELIEKADGFAGVFPEHKYE  553



>ref|XP_004139271.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=923

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++V EKTKE  G PW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETG
Sbjct  465  QTVLEKTKESTGEPWDFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDE+IAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSSLLGQSKDEAIASIPVEELIEKADGFAGVFPEHKYE  573



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI++AL LGVNVKMITGDQLAI KETG
Sbjct  467  QEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIAKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKD+SIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSSLLGQHKDDSIAGLPVDELIEKADGFAGVFPEHKYE  575



>gb|EYU35893.1| hypothetical protein MIMGU_mgv1a0008591mg, partial [Erythranthe 
guttata]
Length=689

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW FVGL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPECTKESAGGPWQFVGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIASLP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSALLGQNKDESIASLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDESIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDESIAGLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_001771404.1| predicted protein [Physcomitrella patens]
 gb|EDQ63794.1| predicted protein [Physcomitrella patens]
Length=511

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE++K+  GGPW F+GL+PLFDPPRHDSAETI+RAL LGV+VKMITGDQLAIGKETG
Sbjct  203  KDVPEQSKDSLGGPWEFLGLMPLFDPPRHDSAETIRRALNLGVSVKMITGDQLAIGKETG  262

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLG HKDESIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  263  RRLGMGTNMYPSSSLLGAHKDESIAALPVDELIEKADGFAGVFPEHKYE  311



>gb|EYU45222.1| hypothetical protein MIMGU_mgv1a026587mg, partial [Erythranthe 
guttata]
Length=471

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE+TKE  GGPW  VGLLPLFDPPRHDSAETI+RAL LGVNVKM TGDQLAI KETG
Sbjct  299  QEVPERTKESLGGPWQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMTTGDQLAIAKETG  358

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDE+IASLP++ELIEKADGFAGV PEHKYE
Sbjct  359  RRLGMGTNMYPSSSLLGQHKDEAIASLPLDELIEKADGFAGVCPEHKYE  407



>ref|XP_009773901.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana sylvestris]
Length=954

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPE+TKE  GGPW+FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  469  QTVPERTKESPGGPWLFVGLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIAKETG  528

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDE+ A+LP++ELIE ADGFAGVFPEHKYE
Sbjct  529  RRLGMGTNMYPSSSLLGQHKDENTANLPVDELIEMADGFAGVFPEHKYE  577


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+E+C L  D K+R    IDKFADRGLR+    +Q    R +E PG
Sbjct  433  EQIIEICGLSEDVKRRVHSVIDKFADRGLRSLAVAQQTVPERTKESPG  480



>ref|XP_008360343.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=885

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VP KTKE  GGPW FVGLLPLFDPPRHDSAETI++AL LGVNVKMITGDQLAI KETG
Sbjct  399  QEVPAKTKESSGGPWQFVGLLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETG  458

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQHKD SIA+LPIEELIEKADGFAGVFPEHKYE
Sbjct  459  RRLGMGTNMYPSASLLGQHKDASIAALPIEELIEKADGFAGVFPEHKYE  507



>ref|XP_003529784.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKET 
Sbjct  463  QEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETA  522

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPSSSLLG HKDESIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  523  RRLGMGSNMYPSSSLLGDHKDESIAALPVDELIEKADGFAGVFPEHKYE  571



>ref|XP_009334638.1| PREDICTED: ATPase 9, plasma membrane-type [Pyrus x bretschneideri]
Length=954

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QTVPEKTKESAGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLG  KDESIASLPI+ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGDTKDESIASLPIDELIEKADGFAGVFPEHKYE  576


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPGS  140
            EQI+ELC LKGDA+K+A   I KFADRGLR+    RQ    + +E  G+
Sbjct  432  EQIIELCNLKGDAEKKAHAIIGKFADRGLRSLAVARQTVPEKTKESAGT  480



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QTVPEKTKESAGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLG  KDESIASLPI+ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGDTKDESIASLPIDELIEKADGFAGVFPEHKYE  576


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPGS  140
            EQI+ELC LKGDA+K+A   I KFADRGLR+    RQ    + +E  G+
Sbjct  432  EQIIELCNLKGDAEKKAHAIIGKFADRGLRSLAVARQTVPEKTKESAGT  480



>gb|AAD46186.1| plasma membrane proton ATPase [Nicotiana plumbaginifolia]
Length=954

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPE+TKE  GGPW+FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  469  QTVPERTKESPGGPWLFVGLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIAKETG  528

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDE+ A+LP++ELIE ADGFAGVFPEHKYE
Sbjct  529  RRLGMGTNMYPSSSLLGQHKDENTANLPVDELIEMADGFAGVFPEHKYE  577


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC L  D K+RA   IDKFADRGLR+    +Q    R +E PG
Sbjct  433  EQIIELCGLSEDVKRRAHSVIDKFADRGLRSLAVAQQTVPERTKESPG  480



>emb|CDP14278.1| unnamed protein product [Coffea canephora]
Length=1297

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK KE  GGPW F+GLLPLFDPPRHDSAETI++AL+LGVNVKMITGDQLAIGKETG
Sbjct  466  QAVPEKNKESAGGPWEFIGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIAS+PI+ELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSSLLGQSKDESIASIPIDELIEKADGFAGVFPEHKYE  574


 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK KE  GGPW F+GLLPLFDPPRHDSAETI++AL+LGVNVKMITGDQLAIGKETG
Sbjct  812  QAVPEKNKESAGGPWEFIGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETG  871

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIAS+PI+ELIEKADGFAGVFPEHKYE
Sbjct  872  RRLGMGTNMYPSSSLLGQSKDESIASIPIDELIEKADGFAGVFPEHKYE  920


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI++LCELKG+ +K+A D ID FA+RGLR+    RQ    + +E  G
Sbjct  430  EQIIDLCELKGEVRKKAHDIIDNFANRGLRSLGVARQAVPEKNKESAG  477


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI++LCELKG+ +K+A D ID FA+RGLR+    RQ    + +E  G
Sbjct  776  EQIIDLCELKGEVRKKAHDIIDNFANRGLRSLGVARQAVPEKNKESAG  823



>ref|XP_003531728.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKET 
Sbjct  463  QEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETA  522

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPSSSLLG HKDESIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  523  RRLGMGSNMYPSSSLLGDHKDESIAALPVDELIEKADGFAGVFPEHKYE  571



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  466  QEVPEKSKESTGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQ KD SIASLP+EELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSASLLGQDKDSSIASLPVEELIEKADGFAGVFPEHKYE  574



>ref|XP_010525721.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSSSLLGQ KD +IAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSSLLGQDKDSNIASIPVEELIEKADGFAGVFPEHKYE  571



>ref|XP_011084028.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +++PEK KE  G PW FVGLLPLFDPPRHDSAETI++AL+LGVNVKMITGDQLAIGKETG
Sbjct  466  QTIPEKNKESAGDPWEFVGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSTLLGQSKDESIASMPVEELIEKADGFAGVFPEHKYE  574


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC+LKGD  KRA + ID FA+RGLR+    RQ    + +E  G
Sbjct  430  EQIIELCQLKGDNLKRAHEIIDNFANRGLRSLAVARQTIPEKNKESAG  477



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  466  QEVPEKSKESAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQ KD SIASLP+EELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSASLLGQDKDSSIASLPVEELIEKADGFAGVFPEHKYE  574



>ref|XP_010443420.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  G PW FVG+LPLFDPPRHDSAETI+RALELGVNVKMITGDQLAI KETG
Sbjct  464  QTVPEKTKESSGSPWEFVGVLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIAKETG  523

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLG HKDE+IA LP+EELIEKADGFAGVFPEHKYE
Sbjct  524  RRLGMGTNMYPSASLLGNHKDEAIAHLPVEELIEKADGFAGVFPEHKYE  572



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  466  QEVPEKSKESTGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQ KD SIASLP+EELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSASLLGQDKDSSIASLPVEELIEKADGFAGVFPEHKYE  574



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  466  QQVPEKSKESPGGPWXFVGLLNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQHKD SIASLP+EELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSASLLGQHKDASIASLPVEELIEKADGFAGVFPEHKYE  574


 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQR---REREGPG  137
            EQI+ELC  + D KK+A   +DKFA+RGLR+    RQ+   + +E PG
Sbjct  430  EQILELCNAREDVKKKAHSCMDKFAERGLRSLAVARQQVPEKSKESPG  477



>emb|CAB85497.1| H+-ATPase [Medicago truncatula]
Length=266

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  89   SRSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKET  268
            ++ VP+  KE  G PW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKET
Sbjct  136  TKXVPDGRKESPGTPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKET  195

Query  269  GRRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            GRRLGMGTNMYPSS+LLGQ+KDESIA+LP+++LIEKADGFAGVF EHKYE
Sbjct  196  GRRLGMGTNMYPSSALLGQNKDESIAALPVDDLIEKADGFAGVFLEHKYE  245



>ref|XP_010483247.1| PREDICTED: ATPase 3, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  G PW FVG+LPLFDPPRHDSAETI+RALELGVNVKMITGDQLAI KETG
Sbjct  464  QTVPEKTKESSGSPWEFVGVLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIAKETG  523

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLG HKDE+IA LP+EELIEKADGFAGVFPEHKYE
Sbjct  524  RRLGMGTNMYPSASLLGNHKDEAIAHLPVEELIEKADGFAGVFPEHKYE  572



>gb|AAO72564.1| plasma membrane H+-ATPase-like protein [Oryza sativa Japonica 
Group]
Length=503

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEK+KE  GGPW FVGLLPLFDPPRHDSAETI++AL LGVNVKMITGDQLAIGKETGRR
Sbjct  17   VPEKSKESAGGPWQFVGLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRR  76

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLGQ+KD S+ +LP++ELIEKADGFAGVFPEHKYE
Sbjct  77   LGMGTNMYPSSALLGQNKDASLEALPVDELIEKADGFAGVFPEHKYE  123



>gb|AAV49159.1| plasma membrane proton ATPase 5 [Nicotiana plumbaginifolia]
 gb|AAV49160.1| plasma membrane proton ATPase 5 [Nicotiana plumbaginifolia]
Length=925

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK K+  G PW FVGLLPLFDPPRHDSAETI++ALELGVNVKMITGDQLAIGKETG
Sbjct  466  QTVPEKNKDSAGSPWEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLG HKDESIAS+P+EELIE+ADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSALLGDHKDESIASIPVEELIEQADGFAGVFPEHKYE  574


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPGS  140
            EQI+ELC+LKGD  K+A + ID FA+RGLR+    RQ    + ++  GS
Sbjct  430  EQIIELCDLKGDVLKKAHEIIDNFANRGLRSLGVARQTVPEKNKDSAGS  478



>gb|KCW80694.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=815

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + +PE+TK+  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEIPERTKDSPGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKD SIA+LP+EELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDASIAALPVEELIEKADGFAGVFPEHKYE  576



>ref|XP_009368031.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=948

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE +G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  462  QQVPEKTKESQGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  521

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD +IASLP++ELIEKADGFAGVFPEHKYE
Sbjct  522  RRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKADGFAGVFPEHKYE  570



>ref|XP_011087207.1| PREDICTED: plasma membrane ATPase 3 [Sesamum indicum]
Length=956

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGTKESSGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQNKDESIAALPIDELIEKADGFAGVFPEHKYE  575



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE +G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QQVPEKTKESQGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD +IASLP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_010097155.1| ATPase 9, plasma membrane-type [Morus notabilis]
 gb|EXB67222.1| ATPase 9, plasma membrane-type [Morus notabilis]
Length=878

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL+LGVNVKMITGDQLAIGKETG
Sbjct  391  QTVPEKTKESAGGPWQFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETG  450

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLG+ KDES A +P++ELIEKADGFAGVFPEHKYE
Sbjct  451  RRLGMGTNMYPSSTLLGESKDESTAGVPVDELIEKADGFAGVFPEHKYE  499



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE++KE  GGPW FVGLLPLFDPPRHDSAETI++AL+LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPERSKESHGGPWQFVGLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDE++A+LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDETLAALPVDELIEKADGFAGVFPEHKYE  576



>gb|AAD20330.1| plasma membrane proton-ATPase gene OSA3 [Oryza sativa Japonica 
Group]
Length=265

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  80   SWPSRSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIG  259
            S   + VPE TKE  G PW FVGL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIG
Sbjct  133  SVAYQEVPEGTKETPGAPWHFVGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIG  192

Query  260  KETGRRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            KETGRRLG GTNMYPS  LLGQ+KDESIA+LP+++LIEKADGFAGVFPEHKYE
Sbjct  193  KETGRRLGTGTNMYPSLPLLGQNKDESIAALPVDDLIEKADGFAGVFPEHKYE  245



>dbj|BAB39361.1| plasma membrane H+-ATPase [Vallisneria gigantea]
Length=173

 Score =   189 bits (480),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + V EK+KE  GGP  FVGLLPLFDPPRHDSAETI++AL LGVNVKMITGDQLAI KETG
Sbjct  43   QEVHEKSKESAGGPRQFVGLLPLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIAKETG  102

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD SIA+LP++ELIEKADGFA VFPEHKYE
Sbjct  103  RRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKADGFAEVFPEHKYE  151



>emb|CDY67153.1| BnaAnng23670D [Brassica napus]
Length=918

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSALLGNHKDANLASIPVEELIEKADGFAGVFPEHKYE  571



>gb|KDP38637.1| hypothetical protein JCGZ_03990 [Jatropha curcas]
Length=930

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +++PEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL+LGVNVKMITGDQLAI KETG
Sbjct  465  QTIPEKTKESAGGPWEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIAKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLG  KDESIA++PI+ELIE+ADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSSLLGDSKDESIAAIPIDELIERADGFAGVFPEHKYE  573



>ref|XP_009128001.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
 emb|CDY28167.1| BnaA01g06820D [Brassica napus]
Length=948

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSALLGNHKDANLASIPVEELIEKADGFAGVFPEHKYE  571



>dbj|BAD16686.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE+ KE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPERRKESAGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQNKDESIAALPIDELIEKADGFAGVFPEHKYE  575



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKSKESPGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQHKD SIA+LP+EELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSASLLGQHKDASIAALPVEELIEKADGFAGVFPEHKYE  576



>dbj|BAM20988.1| plasma membrane H+-ATPase, partial [Marchantia polymorpha]
Length=484

 Score =   197 bits (502),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 88/102 (86%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  113  KEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRRLGMGT  292
            KE  GGPW+F G++PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETGRRLGMGT
Sbjct  1    KESVGGPWVFCGIMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGT  60

Query  293  NMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            NMYPSSSLLG++KDESIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  61   NMYPSSSLLGKNKDESIAELPVDELIEKADGFAGVFPEHKYE  102



>ref|XP_007011593.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY29212.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=674

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  399  QEVPEKTKEAPGAPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  458

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD SIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  459  RRLGMGTNMYPSSSLLGQDKDASIAALPIDELIEKADGFAGVFPEHKYE  507



>ref|XP_010444120.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Camelina 
sativa]
Length=959

 Score =   203 bits (516),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGTKESAGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQHKDESI +LPI++LIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQHKDESIGALPIDDLIEKADGFAGVFPEHKYE  575



>ref|XP_009610942.1| PREDICTED: ATPase 9, plasma membrane-type-like [Nicotiana tomentosiformis]
Length=926

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK K+  G PW FVGLLPLFDPPRHDSAETI++ALELGVNVKMITGDQLAIGKETG
Sbjct  467  QTVPEKDKDSAGSPWEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLG HKDESIAS+P+EELIE+ADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGDHKDESIASIPVEELIEQADGFAGVFPEHKYE  575


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPGS  140
            EQI+ELC+LKGD  ++A + ID FA+RGLR+    RQ    ++++  GS
Sbjct  431  EQIIELCDLKGDILRKAHEIIDNFANRGLRSLGVARQTVPEKDKDSAGS  479



>gb|KFK29576.1| h(+)-atpase 2 [Arabis alpina]
Length=948

 Score =   203 bits (516),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSALLGTHKDANLASIPVEELIEKADGFAGVFPEHKYE  571



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + +PE+TK+  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEIPERTKDSPGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKD SIA+LP+EELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDASIAALPVEELIEKADGFAGVFPEHKYE  576



>ref|XP_010047150.1| PREDICTED: ATPase 8, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW78971.1| hypothetical protein EUGRSUZ_C00401 [Eucalyptus grandis]
Length=950

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE +G PW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETGRR
Sbjct  469  VPEKTKESEGTPWEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRR  528

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSSSLLG+ KDE+IAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  529  LGMGTNMYPSSSLLGEGKDEAIASIPVDELIEKADGFAGVFPEHKYE  575



>dbj|BAO02511.1| predicted H+ ATPase ortholog [Nicotiana alata]
Length=652

 Score =   201 bits (510),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK+KE  G PW FVGLLPLFDPPRHDSAETI++AL+LGVNVKMITGDQLAIGKET 
Sbjct  167  QTVPEKSKESDGSPWEFVGLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETA  226

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLG+HKD +IAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  227  RRLGMGTNMYPSSALLGEHKDAAIASIPVDELIEKADGFAGVFPEHKYE  275


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPGS  140
            EQI+ELCELKGD +K++LD ID +A+RGLR+    RQ    + +E  GS
Sbjct  131  EQIIELCELKGDIRKKSLDIIDGYANRGLRSLAVARQTVPEKSKESDGS  179



>ref|XP_011071717.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 3 [Sesamum 
indicum]
Length=952

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  463  QEVPEGTKESAGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  522

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  523  RRLGMGTNMYPSSALLGQNKDESIAALPVDELIEKADGFAGVFPEHKYE  571



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            +PEK KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  468  IPEKNKESAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  527

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSSSLLGQ KD SIA LPI+ELIEKADGFAGVFPEHKYE
Sbjct  528  LGMGTNMYPSSSLLGQSKDHSIADLPIDELIEKADGFAGVFPEHKYE  574


 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC LK  AKK+A   IDKFADRGLR+    +Q    + +E  G
Sbjct  430  EQIIELCNLKDHAKKKAHAIIDKFADRGLRSLAVSQQVIPEKNKESAG  477



>ref|XP_006412736.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
 gb|ESQ54189.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
Length=948

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSALLGTHKDANLASIPVEELIEKADGFAGVFPEHKYE  571



>ref|XP_010459221.1| PREDICTED: ATPase 11, plasma membrane-type-like [Camelina sativa]
Length=956

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGTKESAGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQHKDESI +LPI++LIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQHKDESIGALPIDDLIEKADGFAGVFPEHKYE  575



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  467  QEVPEKSKESPGGPWQFVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG NMYPSSSLLGQHKDESIA LP+EELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGANMYPSSSLLGQHKDESIAGLPVEELIEKADGFAGVFPEHKYE  575



>dbj|BAJ34124.1| unnamed protein product [Thellungiella halophila]
Length=948

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSALLGTHKDANLASIPVEELIEKADGFAGVFPEHKYE  571



>ref|XP_009775735.1| PREDICTED: ATPase 9, plasma membrane-type-like [Nicotiana sylvestris]
Length=925

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK K+  G PW FVGLLPLFDPPRHDSAETI++ALELGVNVKMITGDQLAIGKETG
Sbjct  466  QTVPEKNKDSAGSPWEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLG HKDESIAS+P+EELIE+ADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSALLGGHKDESIASIPVEELIEQADGFAGVFPEHKYE  574


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPGS  140
            EQI+ELC+LKGD  K+A + ID FA+RGLR+    RQ    + ++  GS
Sbjct  430  EQIIELCDLKGDVLKKAHEIIDNFANRGLRSLGVARQTVPEKNKDSAGS  478



>ref|XP_011015389.1| PREDICTED: plasma membrane ATPase-like [Populus euphratica]
Length=963

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  479  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIGKETGRR  538

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLGQH DES A+LP++ELIEKADGFAGVFPEHKYE
Sbjct  539  LGMGTNMYPSSALLGQHPDESTAALPVDELIEKADGFAGVFPEHKYE  585



>ref|XP_010444121.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Camelina 
sativa]
Length=956

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGTKESAGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQHKDESI +LPI++LIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQHKDESIGALPIDDLIEKADGFAGVFPEHKYE  575



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD SIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_004287218.1| PREDICTED: ATPase 8, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=948

 Score =   199 bits (507),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++V EKTKE  G PW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETG
Sbjct  465  QTVSEKTKESAGDPWEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ  DESIA++P++ELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSTLLGQSLDESIATIPVDELIEKADGFAGVFPEHKYE  573


 Score = 50.1 bits (118),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ  113
            EQI++LC+LKG+A+K+A + ID +ADRGLR+    RQ
Sbjct  429  EQIIDLCDLKGEARKKAHEVIDNYADRGLRSLGVARQ  465



>ref|XP_011020653.1| PREDICTED: plasma membrane ATPase-like [Populus euphratica]
Length=963

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  479  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIGKETGRR  538

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLGQH DES A+LP++ELIEKADGFAGVFPEHKYE
Sbjct  539  LGMGTNMYPSSALLGQHPDESTAALPVDELIEKADGFAGVFPEHKYE  585



>ref|XP_002304716.2| H+-ATPase family protein [Populus trichocarpa]
 gb|EEE79695.2| H+-ATPase family protein [Populus trichocarpa]
Length=977

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  477  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIGKETGRR  536

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLGQH DES A+LP++ELIEKADGFAGVFPEHKYE
Sbjct  537  LGMGTNMYPSSALLGQHPDESTAALPVDELIEKADGFAGVFPEHKYE  583



>ref|XP_004251768.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X1 [Solanum 
lycopersicum]
Length=924

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK KE  G PW FVGLLPLFDPPRHDSAETI++ALELGVNVKMITGDQLAIGKETG
Sbjct  466  QTVPEKDKESAGSPWEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLG HKDESIA +P+EELIE+ADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSALLGDHKDESIAQIPVEELIEQADGFAGVFPEHKYE  574



>ref|XP_006350073.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=924

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK KE  G PW FVGLLPLFDPPRHDSAETI++ALELGVNVKMITGDQLAIGKETG
Sbjct  466  QTVPEKDKESAGSPWEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLG HKDESIA +P+EELIE+ADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSALLGDHKDESIAQIPVEELIEQADGFAGVFPEHKYE  574



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE +G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QQVPEKTKESQGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD +IASLP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_010537896.1| PREDICTED: ATPase 9, plasma membrane-type [Tarenaya hassleriana]
Length=994

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +++P+K K G GGPW F+GLLPLFDPPRHDSAETI+RAL+LGVNVKMITGDQLAIGKETG
Sbjct  507  QAIPDKDKNGPGGPWQFLGLLPLFDPPRHDSAETIKRALDLGVNVKMITGDQLAIGKETG  566

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQHKDES+  LP++ELIEKADGFAGVFPEHKYE
Sbjct  567  RRLGMGTNMYPSSALLGQHKDESVTDLPVDELIEKADGFAGVFPEHKYE  615


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQR---REREGPG  137
            EQI+ELC L+ DAKKR+   IDKFADRGLR+    +Q    +++ GPG
Sbjct  471  EQIIELCNLREDAKKRSHAIIDKFADRGLRSLAVGKQAIPDKDKNGPG  518



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  466  QQVPEKSKESPGGPWEFVGLLNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQHKD SIASLP+EELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSASLLGQHKDASIASLPVEELIEKADGFAGVFPEHKYE  574



>ref|XP_010313836.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X2 [Solanum 
lycopersicum]
Length=915

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK KE  G PW FVGLLPLFDPPRHDSAETI++ALELGVNVKMITGDQLAIGKETG
Sbjct  457  QTVPEKDKESAGSPWEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETG  516

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLG HKDESIA +P+EELIE+ADGFAGVFPEHKYE
Sbjct  517  RRLGMGTNMYPSSALLGDHKDESIAQIPVEELIEQADGFAGVFPEHKYE  565



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE+TKE  G PW FVGLLPLFDPPRHDSAETI++AL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPERTKESAGTPWQFVGLLPLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDE++A+LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDETLATLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSA+TI+RALELGVNVKMITGDQLAI KETGRR
Sbjct  473  VPEKTKESSGGPWEFVGLLPLFDPPRHDSADTIKRALELGVNVKMITGDQLAIAKETGRR  532

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMG+NMYPS+SLLGQ KD S+ASLP+EELIEKADGFAGVFPEHKYE
Sbjct  533  LGMGSNMYPSASLLGQDKDASVASLPVEELIEKADGFAGVFPEHKYE  579



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEGTKESPGGPWQFVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDE+IAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDENIASIPVEELIEKADGFAGVFPEHKYE  576



>ref|XP_010049874.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=942

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  460  VPEKTKESAGGPWEFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  519

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMG+NMYPSSSLLG+ KDESIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  520  LGMGSNMYPSSSLLGESKDESIASIPVEELIEKADGFAGVFPEHKYE  566



>ref|XP_002991931.1| hypothetical protein SELMODRAFT_430150 [Selaginella moellendorffii]
 gb|EFJ07042.1| hypothetical protein SELMODRAFT_430150 [Selaginella moellendorffii]
Length=875

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK KE  GGPW F GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  471  QDVPEKNKESPGGPWRFCGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  530

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLG HKDE++A+LP+EELIEKADGFAGVFPEHKYE
Sbjct  531  RRLGMGTNMYPSSSLLGNHKDENLAALPVEELIEKADGFAGVFPEHKYE  579



>ref|XP_010049873.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW82682.1| hypothetical protein EUGRSUZ_C04061 [Eucalyptus grandis]
Length=951

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  469  VPEKTKESAGGPWEFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  528

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMG+NMYPSSSLLG+ KDESIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  529  LGMGSNMYPSSSLLGESKDESIASIPVEELIEKADGFAGVFPEHKYE  575



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKTKESLGSPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQQKDESIAGLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_006279959.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
 gb|EOA12857.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
Length=956

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGTKESAGGPWQFMGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQHKDESI +LPI++LIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQHKDESIGALPIDDLIEKADGFAGVFPEHKYE  575



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+K+G GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  465  QEVPEKSKDGAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD SI++LP++ELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSALLGQDKDASISALPVDELIEKADGFAGVFPEHKYE  573



>ref|XP_009126895.1| PREDICTED: ATPase 3, plasma membrane-type-like, partial [Brassica 
rapa]
Length=703

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  GGPW FVG+LPLFDPPRHDSA+TI+RAL+LGVNVKMITGDQLAI KETG
Sbjct  218  QTVPEKTKESSGGPWAFVGVLPLFDPPRHDSADTIRRALDLGVNVKMITGDQLAIAKETG  277

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPS+SLLG HKD ++A++P+EELIEKADGFAGVFPEHKYE
Sbjct  278  RRLGMGSNMYPSASLLGNHKDANLAAIPVEELIEKADGFAGVFPEHKYE  326



>gb|EPS66977.1| hypothetical protein M569_07799, partial [Genlisea aurea]
Length=922

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + +PE+TKE  GGPW FVGL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  464  QELPERTKESSGGPWQFVGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  523

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  524  RRLGMGTNMYPSSALLGQNKDESIAALPVDELIEKADGFAGVFPEHKYE  572



>gb|KHF98166.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=663

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + +PEKTKE  G PW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  173  QEIPEKTKESPGSPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  232

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD SIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  233  RRLGMGTNMYPSSSLLGQDKDASIAALPIDELIEKADGFAGVFPEHKYE  281



>ref|XP_002864812.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41071.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
Length=956

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGTKESAGGPWQFMGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQHKDESI +LPI++LIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQHKDESIGALPIDDLIEKADGFAGVFPEHKYE  575



>emb|CDY30730.1| BnaA02g33520D [Brassica napus]
Length=787

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW FVGL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  298  QEVPEGTKESSGGPWQFVGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  357

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESI +LP+++LIEKADGFAGVFPEHKYE
Sbjct  358  RRLGMGTNMYPSSALLGQNKDESIGALPVDDLIEKADGFAGVFPEHKYE  406



>gb|KHG26452.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEK+K+G G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETGRR
Sbjct  172  VPEKSKDGAGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRR  231

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPS+SLLGQ KD SIA+LP+EELIEKADGFAGVFPEHKYE
Sbjct  232  LGMGTNMYPSASLLGQDKDASIAALPVEELIEKADGFAGVFPEHKYE  278



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  469  QEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIKRALNLGVNVKMITGDQLAIGKETG  528

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD ++A LP++ELIEKADGFAGVFPEHKYE
Sbjct  529  RRLGMGTNMYPSSSLLGQDKDSNVAGLPVDELIEKADGFAGVFPEHKYE  577



>ref|XP_006453323.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474211.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Citrus sinensis]
 gb|ESR66563.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=885

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE+TKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  399  QEVPERTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  458

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQ KD SIA+LP+EELIEKADGFAGVFPEHKYE
Sbjct  459  RRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKADGFAGVFPEHKYE  507



>ref|XP_006427547.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
 gb|ESR40787.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
Length=962

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +SVPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  476  QSVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  535

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDE+I++LP++ELIEKADGFAGVFPEHKYE
Sbjct  536  RRLGMGTNMYPSSALLGQIKDENISALPVDELIEKADGFAGVFPEHKYE  584



>ref|XP_008367709.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=956

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE +G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  470  QQVPEKTKESQGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  529

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD +IASLP++ELIEKADGFAGVFPEHKYE
Sbjct  530  RRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKADGFAGVFPEHKYE  578



>ref|XP_004299601.1| PREDICTED: ATPase 11, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=957

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KEG GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QEVPEGIKEGAGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LPI++LIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSALLGQNKDESIAALPIDDLIEKADGFAGVFPEHKYE  576



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPS+SLLGQ KD +IA++P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSASLLGQDKDSNIAAIPVEELIEKADGFAGVFPEHKYE  571



>ref|XP_009109000.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
Length=947

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  464  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  523

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+ LG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  524  LGMGTNMYPSSAFLGSHKDANLASIPVEELIEKADGFAGVFPEHKYE  570



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =   199 bits (505),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++V EKTKE  G  W FVGLLPLFDPPRHDSAETI++AL+LGVNVKMITGDQLAIGKETG
Sbjct  464  QTVSEKTKESAGDSWEFVGLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETG  523

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESI+S+PI+ELIEKADGFAGVFPEHKYE
Sbjct  524  RRLGMGTNMYPSSSLLGQSKDESISSIPIDELIEKADGFAGVFPEHKYE  572


 Score = 50.1 bits (118),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ  113
            EQI+ELCELKG+  KRA + ID FA+RGLR+    RQ
Sbjct  428  EQIIELCELKGEVLKRAHEIIDNFANRGLRSLGVARQ  464



>gb|AAA81349.1| VHA1, partial [Vicia faba]
Length=309

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW FVGLL +FDPPRHDSAETI++AL LGVNVKMITGDQLAI KETG
Sbjct  131  QEVPEKTKESAGAPWQFVGLLSVFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETG  190

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS++LLG  KD S+AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  191  RRLGMGTNMYPSATLLGLDKDSSVASMPVEELIEKADGFAGVFPEHKYE  239



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTK+  GGPW  VGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  469  QEVPEKTKDSPGGPWQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  528

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIASLP++ELIEKADGFAGVFPEHKYE
Sbjct  529  RRLGMGTNMYPSSSLLGQDKDESIASLPVDELIEKADGFAGVFPEHKYE  577



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QQVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD SIASLP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSALLGQDKDASIASLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_006354801.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGRKESSGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIASLPI+ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQTKDESIASLPIDELIEKADGFAGVFPEHKYE  575



>emb|CDY14186.1| BnaA08g13170D [Brassica napus]
Length=939

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  456  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  515

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+ LG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  516  LGMGTNMYPSSAFLGSHKDANLASIPVEELIEKADGFAGVFPEHKYE  562



>gb|ACL37321.1| plasma membrane H+-ATPase [Eichhornia crassipes]
Length=315

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  209  QEVPEGRKESPGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  268

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHK  412
            RRLGMGTNMYPSS+LLGQ+KDESI +LP+++LIEKADGFAGVFPEHK
Sbjct  269  RRLGMGTNMYPSSALLGQNKDESIDALPVDDLIEKADGFAGVFPEHK  315



>ref|NP_001234477.1| plasma membrane H+-ATPase [Solanum lycopersicum]
 gb|AAD55399.1|AF179442_1 plasma membrane H+-ATPase isoform LHA2 [Solanum lycopersicum]
 gb|AAF98344.1|AF275745_1 plasma membrane H+-ATPase [Solanum lycopersicum]
Length=956

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGRKESSGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIASLPI+ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQTKDESIASLPIDELIEKADGFAGVFPEHKYE  575



>ref|XP_010452018.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  G  W FVG+LPLFDPPRHDSAETI+RALELGVNVKMITGDQLAI KETG
Sbjct  464  QTVPEKTKESSGSAWEFVGVLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIAKETG  523

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLG HKDE+IA LPIEELIEKADGFAGVFPEHKYE
Sbjct  524  RRLGMGTNMYPSASLLGNHKDEAIAHLPIEELIEKADGFAGVFPEHKYE  572



>ref|NP_201073.1| H(+)-ATPase 11 [Arabidopsis thaliana]
 sp|Q9LV11.1|PMA11_ARATH RecName: Full=ATPase 11, plasma membrane-type; AltName: Full=Proton 
pump 11 [Arabidopsis thaliana]
 dbj|BAA97214.1| plasma membrane proton ATPase-like [Arabidopsis thaliana]
 gb|AAM78085.1| AT5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AAR23718.1| At5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AED97641.1| H(+)-ATPase 11 [Arabidopsis thaliana]
Length=956

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGTKESAGGPWQFMGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQHKDESI +LPI++LIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQHKDESIGALPIDDLIEKADGFAGVFPEHKYE  575



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  457  QQVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  516

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD SIASLP++ELIEKADGFAGVFPEHKYE
Sbjct  517  RRLGMGTNMYPSSALLGQDKDASIASLPVDELIEKADGFAGVFPEHKYE  565



>ref|XP_010548606.1| PREDICTED: ATPase 2, plasma membrane-type [Tarenaya hassleriana]
Length=948

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPS++LLGQ KD +IAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSATLLGQDKDSNIASIPVEELIEKADGFAGVFPEHKYE  571



>gb|AAB84204.1| plasma membrane H+-ATPase [Kosteletzkya virginica]
Length=241

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+K+  G PW  +GL PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  135  QQVPEKSKDAPGAPWQLIGLFPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  194

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHK  412
            RRLGMGTNMYPSSSLLGQ KD SIASLP++ELIEKADGFAGVFPEHK
Sbjct  195  RRLGMGTNMYPSSSLLGQDKDASIASLPVDELIEKADGFAGVFPEHK  241



>ref|XP_009607951.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana tomentosiformis]
Length=954

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPE+TKE  GGPW+FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  469  QTVPERTKESPGGPWLFVGLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIAKETG  528

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ+KDE+ A+LP++ELIE ADGFAGVFPEHKYE
Sbjct  529  RRLGMGTNMYPSSSLLGQNKDENTANLPVDELIEMADGFAGVFPEHKYE  577


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC L  D K+R    IDKFADRGLR+    +Q    R +E PG
Sbjct  433  EQIIELCGLSEDVKRRVHSVIDKFADRGLRSLAVAQQTVPERTKESPG  480



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QQVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KD +IASLP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSALLGQNKDAAIASLPVDELIEKADGFAGVFPEHKYE  576



>ref|NP_001274861.1| plasma membrane ATPase 1-like [Solanum tuberosum]
 emb|CAA54046.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=956

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGRKESSGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIASLPI+ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQTKDESIASLPIDELIEKADGFAGVFPEHKYE  575



>gb|KCW81010.1| hypothetical protein EUGRSUZ_C023861, partial [Eucalyptus grandis]
Length=935

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  449  QEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  508

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQ KD +IA+LP+EELIEKADGFAGVFPEHKYE
Sbjct  509  RRLGMGTNMYPSASLLGQDKDANIAALPVEELIEKADGFAGVFPEHKYE  557



>ref|XP_009793289.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana sylvestris]
Length=956

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGRKESTGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIASLPI+ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQTKDESIASLPIDELIEKADGFAGVFPEHKYE  575



>ref|XP_009610426.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana tomentosiformis]
Length=956

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGRKESTGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIASLPI+ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQTKDESIASLPIDELIEKADGFAGVFPEHKYE  575



>pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump
 pdb|3B8C|B Chain B, Crystal Structure Of A Plasma Membrane Proton Pump
Length=885

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGAPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSALLGTHKDANLASIPVEELIEKADGFAGVFPEHKYE  571



>gb|AAA34052.1| H+-translocating ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGRKESTGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIASLPI+ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQTKDESIASLPIDELIEKADGFAGVFPEHKYE  575



>gb|KFK27283.1| h(+)-atpase 3 [Arabis alpina]
Length=951

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEKTKE  GGPW FVG+LPLFDPPRHDSAETI+RAL+LGVNVKMITGDQLAI KETG
Sbjct  466  QTVPEKTKESSGGPWEFVGVLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIAKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPS+SLLG HKDE++AS+P++ELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGSNMYPSASLLGTHKDENMASIPVDELIEKADGFAGVFPEHKYE  574



>gb|AAB84203.1| plasma membrane H+-ATPase [Kosteletzkya virginica]
Length=241

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VP+  KE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  135  QEVPDGRKESSGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  194

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHK  412
            RRLGMGT MYPSS+LLGQ KDESIA+LP++ELIEKADGFAGVFPEHK
Sbjct  195  RRLGMGTYMYPSSALLGQDKDESIAALPVDELIEKADGFAGVFPEHK  241



>dbj|BAM20989.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=957

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW F+GLLPLFDPPRHDSAETI++AL LGVNVKMITGDQLAI KETG
Sbjct  470  QEVPEKTKESPGGPWEFLGLLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETG  529

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQHKDESIA+LP++ELIE ADGFAGVFPEHKYE
Sbjct  530  RRLGMGTNMYPSSALLGQHKDESIAALPVDELIENADGFAGVFPEHKYE  578



>ref|XP_002307856.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE91379.1| ATPase 6 family protein [Populus trichocarpa]
Length=944

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            +PEK KE  G PW FVGLLPLFDPPRHDSAETI+RAL+LGVNVKMITGDQLAIGKETGRR
Sbjct  462  IPEKNKESAGAPWEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRR  521

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSSSLLG +KDESIAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  522  LGMGTNMYPSSSLLGDNKDESIASVPVDELIEKADGFAGVFPEHKYE  568


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQR---REREGPGS  140
            EQI+ELCELKG+ +K+A + I+ FADRGLR+    R R   + +E  G+
Sbjct  424  EQIIELCELKGNIRKKAHEIINNFADRGLRSLGVARHRIPEKNKESAGA  472



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQ KD +IA+LP+EELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSASLLGQDKDANIAALPVEELIEKADGFAGVFPEHKYE  576



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            R+VPEK+KE  GG W FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  466  RTVPEKSKESPGGRWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQ KD +IASLPIEELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSASLLGQDKDSAIASLPIEELIEKADGFAGVFPEHKYE  574



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VP K+K+  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QEVPAKSKDSPGGPWQFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQHKDESIA LP+EELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSASLLGQHKDESIAGLPVEELIEKADGFAGVFPEHKYE  576



>ref|XP_011042618.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
 ref|XP_011042619.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
Length=956

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGRKESAGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQNKDESIAALPIDELIEKADGFAGVFPEHKYE  575



>ref|XP_010451109.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=918

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGAPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSALLGTHKDANLASIPVEELIEKADGFAGVFPEHKYE  571



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE+TKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPERTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQ KD SIA+LP+EELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKADGFAGVFPEHKYE  576



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE+TKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  467  QEVPERTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQ KD SIA+LP+EELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKADGFAGVFPEHKYE  575



>dbj|BAM20990.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=954

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + +PE TKE  GGPW F GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  469  QKIPEGTKESAGGPWEFCGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  528

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG NMYPSSSLLGQHKDE+IA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  529  RRLGMGINMYPSSSLLGQHKDEAIAALPIDELIEKADGFAGVFPEHKYE  577



>gb|KDO67286.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=675

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + +PEKTKE  G PW  VGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QEIPEKTKESPGAPWQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD SIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_002318614.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEE96834.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=966

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  477  QEVPEGRKESAGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  536

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  537  RRLGMGTNMYPSSALLGQNKDESIAALPIDELIEKADGFAGVFPEHKYE  585



>ref|XP_004486623.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=949

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLLPLFDPPRHDSAETI++AL LGVNVKMITGDQLAIGKETG
Sbjct  463  QEVPEKSKESPGGPWQFVGLLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIGKETG  522

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG+NMYPSSSLLG+HKD ++ASLPI+ELIEKADGFAGVFPEHKYE
Sbjct  523  RRLGMGSNMYPSSSLLGEHKDSAMASLPIDELIEKADGFAGVFPEHKYE  571


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPG  137
            EQI+ELC L+ D KK+AL  IDKFADRGLR+    +Q    + +E PG
Sbjct  427  EQIIELCNLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESPG  474



>dbj|BAD16689.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE+ KE  GGPW FV L+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPERRKESAGGPWQFVSLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQNKDESIAALPIDELIEKADGFAGVFPEHKYE  575



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKTKESPGRPWQFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQHKDESIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQHKDESIAGLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKTKEAPGAPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD SIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQDKDASIAALPIDELIEKADGFAGVFPEHKYE  576



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK+KE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QTVPEKSKESPGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLG+ KDESIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGETKDESIAALPVDELIEKADGFAGVFPEHKYE  576


 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPGS  140
            EQI+ELC LKGD  K+A   I KFADRGLR+    RQ    + +E PG+
Sbjct  432  EQIIELCNLKGDPMKKAHAIIGKFADRGLRSLAVARQTVPEKSKESPGT  480



>gb|KHG28536.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW FVGLLPLFDPPRHDSAETI++AL LGVNVKMITGDQLAI KETG
Sbjct  170  QQVPEKTKESAGTPWQFVGLLPLFDPPRHDSAETIRQALHLGVNVKMITGDQLAIAKETG  229

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQ KD SIA+LP+EELIEKADGFAGVFPEHKYE
Sbjct  230  RRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKADGFAGVFPEHKYE  278



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+K+G GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  465  QEVPEKSKDGAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD SI++LP++ELI+KADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSALLGQDKDASISALPVDELIDKADGFAGVFPEHKYE  573



>gb|KGN65225.1| hypothetical protein Csa_1G267210 [Cucumis sativus]
Length=778

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++V +K KE  G PW FVGLLPLFDPPRHDSAETI+RALELGVNVKMITGDQLAIGKETG
Sbjct  295  QTVKDKDKESAGEPWEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETG  354

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  355  RRLGMGTNMYPSSSLLGQSKDESIASIPVDELIEKADGFAGVFPEHKYE  403



>ref|XP_007151191.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
 gb|ESW23185.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
Length=956

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE +GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGIKESQGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDE+IA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQNKDEAIATLPVDELIEKADGFAGVFPEHKYE  575



>gb|AAA98916.1| Theoretical protein with similarity to Swiss-Prot Accession Number 
P19456 plasma membrane ATPase 2 (proton pump) [Arabidopsis 
thaliana]
Length=859

 Score =   194 bits (493),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++V EK K   G PW F+GLLPLFDPPRHDSAETI+RAL+LGVNVKMITGDQLAIGKETG
Sbjct  399  QTVSEKDKNSXGEPWQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETG  458

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIASLP++ELIEKADGFAGVF EHKYE
Sbjct  459  RRLGMGTNMYPSSALLGQDKDESIASLPVDELIEKADGFAGVFLEHKYE  507


 Score = 53.9 bits (128),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ  113
            EQI+ELC L+ DA KRA D IDKFADRGLR+    RQ
Sbjct  363  EQIIELCNLREDASKRAHDIIDKFADRGLRSLAVGRQ  399



>gb|KGN62872.1| hypothetical protein Csa_2G378540 [Cucumis sativus]
Length=546

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + V EKTK+  GGPW  VGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  266  QEVHEKTKDSPGGPWQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  325

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIASLP++ELIEKADGFAGVFPEHKYE
Sbjct  326  RRLGMGTNMYPSSSLLGQDKDESIASLPVDELIEKADGFAGVFPEHKYE  374



>ref|XP_008228760.1| PREDICTED: ATPase 9, plasma membrane-type [Prunus mume]
Length=954

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK+KE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QTVPEKSKESPGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLG+ KDESIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGETKDESIAALPVDELIEKADGFAGVFPEHKYE  576


 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPGS  140
            EQI+ELC LKGD  K+A   IDKFADRGLR+    RQ    + +E PG+
Sbjct  432  EQIIELCNLKGDPMKKAHAIIDKFADRGLRSLAVARQTVPEKSKESPGT  480



>gb|EAZ21357.1| hypothetical protein OsJ_37014 [Oryza sativa Japonica Group]
Length=931

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW FVGL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  442  QEVPEGTKESPGGPWHFVGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  501

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LP+++LIEKADGFAGVFPEHKYE
Sbjct  502  RRLGMGTNMYPSSALLGQNKDESIAALPVDDLIEKADGFAGVFPEHKYE  550



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK++E  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  468  QEVPEKSRESSGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ+KD S+A+LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQNKDASMAALPVDELIEKADGFAGVFPEHKYE  576



>gb|KEH39757.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=820

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE+TK+  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QEVPERTKDSPGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD SI++LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSALLGQDKDSSISALPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QQVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD +IASLP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKADGFAGVFPEHKYE  576



>gb|EEC69747.1| hypothetical protein OsI_39279 [Oryza sativa Indica Group]
Length=931

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW FVGL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  442  QEVPEGTKESPGGPWHFVGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  501

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LP+++LIEKADGFAGVFPEHKYE
Sbjct  502  RRLGMGTNMYPSSALLGQNKDESIAALPVDDLIEKADGFAGVFPEHKYE  550



>ref|NP_194748.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 sp|P19456.2|PMA2_ARATH RecName: Full=ATPase 2, plasma membrane-type; AltName: Full=Proton 
pump 2 [Arabidopsis thaliana]
 gb|AAA32751.1| H+-ATPase [Arabidopsis thaliana]
 emb|CAB52463.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 emb|CAB81012.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 gb|AAK59580.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AAN31920.1| putative H+-transporting ATPase type 2 [Arabidopsis thaliana]
 gb|AAN71968.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE85731.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=948

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGAPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSALLGTHKDANLASIPVEELIEKADGFAGVFPEHKYE  571



>gb|KHN13245.1| Plasma membrane ATPase 1 [Glycine soja]
Length=956

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VP+  KE +GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPDGKKESQGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQNKDESIATLPVDELIEKADGFAGVFPEHKYE  575



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QQVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD +IASLP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_010438207.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGAPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSALLGTHKDANLASIPVEELIEKADGFAGVFPEHKYE  571



>ref|XP_006282542.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
 gb|EOA15440.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
Length=948

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGAPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSALLGTHKDANLASIPVEELIEKADGFAGVFPEHKYE  571



>gb|KHN34200.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VP+  KE +GGPW F+GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPDGKKESQGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQNKDESIATLPVDELIEKADGFAGVFPEHKYE  575



>ref|XP_010433017.1| PREDICTED: ATPase 2, plasma membrane-type [Camelina sativa]
Length=948

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGAPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG HKD ++AS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSALLGTHKDANLASIPVEELIEKADGFAGVFPEHKYE  571



>gb|AAQ55291.1| plasma membrane H+-ATPase [Juglans regia]
Length=956

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE  KE  GGPW F+GL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGRKESAGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQNKDESIAALPIDELIEKADGFAGVFPEHKYE  575



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  465  QEVPEKSKESPGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD SI++LP++ELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGTNMYPSSALLGQDKDASISALPVDELIEKADGFAGVFPEHKYE  573



>ref|NP_001067382.1| Os12g0638700 [Oryza sativa Japonica Group]
 emb|CAD29296.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|ABA99607.1| Plasma membrane ATPase 1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30401.1| Os12g0638700 [Oryza sativa Japonica Group]
Length=956

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW FVGL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGTKESPGGPWHFVGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESIA+LP+++LIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQNKDESIAALPVDDLIEKADGFAGVFPEHKYE  575



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QQVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD +IASLP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKADGFAGVFPEHKYE  576



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+K+G G PW  +GLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  173  QDVPEKSKDGPGAPWQLIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  232

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD SIASLP++ELIEKADGFAGVFPEHKYE
Sbjct  233  RRLGMGTNMYPSSSLLGQDKDASIASLPVDELIEKADGFAGVFPEHKYE  281



>emb|CDY62140.1| BnaCnng39300D [Brassica napus]
Length=686

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  466  VPEKTKESSGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  525

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPS++LLG  +D ++AS+PIEELIEKADGFAGVFPEHKYE
Sbjct  526  LGMGTNMYPSAALLGTDRDSNMASVPIEELIEKADGFAGVFPEHKYE  572



>gb|KEH37844.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=903

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++V EKTKE  G PW+F+GLLPLFDPPRHDSAETI+RAL+LGVNVKMITGDQLAIGKETG
Sbjct  466  QTVSEKTKESAGEPWVFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ  D +IAS+PI+ELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSSLLGQSNDAAIASIPIDELIEKADGFAGVFPEHKYE  574



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+K+  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  465  QEVPEKSKDAPGGPWQFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  524

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMG NMYPS+SLLGQHKDESIA LP+EELIEKADGFAGVFPEHKYE
Sbjct  525  RRLGMGVNMYPSASLLGQHKDESIAGLPVEELIEKADGFAGVFPEHKYE  573



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE+TKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  464  QEVPEQTKESPGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  523

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD SIA+LPI+ELIEKADGFAGVFPEHKYE
Sbjct  524  RRLGMGTNMYPSSSLLGQDKDASIAALPIDELIEKADGFAGVFPEHKYE  572



>ref|XP_009130230.1| PREDICTED: ATPase 11, plasma membrane-type isoform X3 [Brassica 
rapa]
Length=939

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPE TKE  GGPW FVGL+PLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QEVPEGTKESAGGPWQFVGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ+KDESI +LP+++LIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQNKDESIGALPVDDLIEKADGFAGVFPEHKYE  575



>gb|KDO67285.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=847

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + +PEKTKE  G PW  VGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  468  QEIPEKTKESPGAPWQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  527

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD SIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  528  RRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKADGFAGVFPEHKYE  576



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + +PEKTKE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  469  QQIPEKTKESPGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  528

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KD +I+SLPI+ELIEKADGFAGVFPEHKYE
Sbjct  529  RRLGMGTNMYPSSALLGQDKDAAISSLPIDELIEKADGFAGVFPEHKYE  577



>gb|KFK40274.1| hypothetical protein AALP_AA3G353600 [Arabis alpina]
Length=949

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEKTKE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETGRR
Sbjct  465  VPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRR  524

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSS+LLG  KD +IAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  525  LGMGTNMYPSSALLGTDKDANIASIPVEELIEKADGFAGVFPEHKYE  571



>ref|XP_011002373.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=944

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + +PEK KE  G PW FVGLLPLFDPPRHDSAETI RAL+LGVNVKMITGDQLAIGKETG
Sbjct  460  QRIPEKNKESAGAPWEFVGLLPLFDPPRHDSAETICRALDLGVNVKMITGDQLAIGKETG  519

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLG +KDESIAS+P++ELIEKADGFAGVFPEHKYE
Sbjct  520  RRLGMGTNMYPSSSLLGDNKDESIASVPVDELIEKADGFAGVFPEHKYE  568


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQR---REREGPGS  140
            EQI+ELCELKG+ +K+A + I  FADRGLR+    RQR   + +E  G+
Sbjct  424  EQIIELCELKGNIRKKAHEIISNFADRGLRSLGVARQRIPEKNKESAGA  472



>gb|KGN63646.1| hypothetical protein Csa_1G008520 [Cucumis sativus]
Length=801

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VP+  KE  GGPW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  312  QEVPDGRKESAGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  371

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  372  RRLGMGTNMYPSSALLGQDKDESIAALPVDELIEKADGFAGVFPEHKYE  420



>ref|XP_011084023.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            +++PEK KE  G PW FVGLLPLFDPPR DSAETI++AL+LGVNVKMITGDQLAIGKETG
Sbjct  466  QTIPEKNKESAGDPWEFVGLLPLFDPPRDDSAETIKKALDLGVNVKMITGDQLAIGKETG  525

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KDESIAS+P+EELIEKADGFAGVFPEHKYE
Sbjct  526  RRLGMGTNMYPSSSLLGQSKDESIASMPVEELIEKADGFAGVFPEHKYE  574



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  89   SRSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKET  268
            S+ VPEK+K+  GGPW FVGLL LFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KET
Sbjct  463  SQVVPEKSKDSAGGPWQFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKET  522

Query  269  GRRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            GRRLGMGTNMYPS+SLLGQ KD SIASLP+EELIEKADGFAGVFPEHKYE
Sbjct  523  GRRLGMGTNMYPSASLLGQDKDASIASLPVEELIEKADGFAGVFPEHKYE  572



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + +PEKTKE  G PW  VGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAIGKETG
Sbjct  399  QEIPEKTKESPGAPWQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETG  458

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ KD SIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  459  RRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKADGFAGVFPEHKYE  507



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK+KE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  464  QEVPEKSKESPGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETG  523

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSSSLLGQ+KD SIA+LP++ELIEKADGFAGVFPEHKYE
Sbjct  524  RRLGMGTNMYPSSSLLGQNKDASIAALPVDELIEKADGFAGVFPEHKYE  572



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  98   VPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETGRR  277
            VPEK+KE  G PW FVGLLPLFDPPRHDSAETI+RAL LGVNVKMITGDQLAI KETGRR
Sbjct  470  VPEKSKESAGAPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRR  529

Query  278  LGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            LGMGTNMYPSSSLLGQ KD+SIA++P++ELIEKADGFAGVFPEHKYE
Sbjct  530  LGMGTNMYPSSSLLGQSKDDSIATMPVDELIEKADGFAGVFPEHKYE  576



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            ++VPEK KE  G PW FVGLLPLFDPPRHDSAETI RAL LGVNVKMITGDQLAIGKETG
Sbjct  467  QTVPEKNKESPGSPWQFVGLLPLFDPPRHDSAETIARALNLGVNVKMITGDQLAIGKETG  526

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPSS+LLGQ KDESIA LP++ELIEKADGFAGVFPEHKYE
Sbjct  527  RRLGMGTNMYPSSALLGQTKDESIAGLPVDELIEKADGFAGVFPEHKYE  575


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPGS  140
            EQI+ELC LK DAKK+AL  IDKFADRGLR+    RQ    + +E PGS
Sbjct  431  EQIIELCNLKDDAKKKALAIIDKFADRGLRSLAVGRQTVPEKNKESPGS  479



>gb|KGN65469.1| hypothetical protein Csa_1G423270 [Cucumis sativus]
Length=807

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  92   RSVPEKTKEGKGGPWIFVGLLPLFDPPRHDSAETIQRALELGVNVKMITGDQLAIGKETG  271
            + VPEK KE  G PW FVGLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETG
Sbjct  320  QEVPEKRKESPGSPWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETG  379

Query  272  RRLGMGTNMYPSSSLLGQHKDESIASLPIEELIEKADGFAGVFPEHKYE  418
            RRLGMGTNMYPS+SLLGQHKDESIA +PIEELIEKADGFAGVFPEHKYE
Sbjct  380  RRLGMGTNMYPSASLLGQHKDESIAGIPIEELIEKADGFAGVFPEHKYE  428


 Score = 48.1 bits (113),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    EQIVELCELKGDAKKRALDTIDKFADRGLRAQYQKRQ---RREREGPGS  140
            EQI+ LC  K D KK+A   IDKFA+RGLR+    RQ    + +E PGS
Sbjct  284  EQILTLCNCKEDVKKKAHAVIDKFAERGLRSLAVGRQEVPEKRKESPGS  332



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515322439940