BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22254_g2_i1 len=1487 path=[1:0-322 6192:323-436 6147:437-523
3680:524-726 3883:727-727 324:728-857 454:858-1486]

Length=1487
                                                                      Score     E

ref|XP_011094828.1|  PREDICTED: glycine-rich RNA-binding protein ...    191   1e-54   
ref|XP_008241409.1|  PREDICTED: glycine-rich RNA-binding protein ...    191   1e-54   
ref|XP_007027095.1|  RNA-binding family protein                         188   1e-53   
ref|XP_009374665.1|  PREDICTED: glycine-rich RNA-binding protein ...    185   2e-52   
ref|XP_009621194.1|  PREDICTED: glycine-rich RNA-binding protein ...    184   7e-52   
ref|XP_004302774.1|  PREDICTED: glycine-rich RNA-binding protein ...    183   1e-51   
gb|KDP35596.1|  hypothetical protein JCGZ_09034                         182   2e-51   
ref|XP_010047468.1|  PREDICTED: glycine-rich RNA-binding protein ...    182   2e-51   
ref|XP_004249524.1|  PREDICTED: glycine-rich RNA-binding protein ...    182   3e-51   
ref|XP_006339038.1|  PREDICTED: glycine-rich RNA-binding protein ...    182   3e-51   
gb|EYU41694.1|  hypothetical protein MIMGU_mgv1a015648mg                182   4e-51   
ref|XP_007162665.1|  hypothetical protein PHAVU_001G170000g             181   6e-51   
ref|XP_008387739.1|  PREDICTED: glycine-rich RNA-binding protein ...    180   1e-50   
ref|XP_010683908.1|  PREDICTED: glycine-rich RNA-binding protein ...    180   2e-50   
ref|XP_004493893.1|  PREDICTED: glycine-rich RNA-binding protein ...    177   2e-49   
ref|XP_010260092.1|  PREDICTED: glycine-rich RNA-binding protein ...    177   3e-49   
ref|XP_010528328.1|  PREDICTED: glycine-rich RNA-binding protein ...    176   4e-49   
gb|KHG05603.1|  Glycine-rich RNA-binding 2, mitochondrial -like p...    176   8e-49   
ref|XP_002274178.1|  PREDICTED: glycine-rich RNA-binding protein ...    174   3e-48   Vitis vinifera
ref|XP_006429060.1|  hypothetical protein CICLE_v10013045mg             174   4e-48   
gb|EYU28274.1|  hypothetical protein MIMGU_mgv1a015528mg                174   4e-48   
ref|XP_007206119.1|  hypothetical protein PRUPE_ppa013084mg             172   1e-47   
ref|XP_004142081.1|  PREDICTED: glycine-rich RNA-binding protein ...    172   2e-47   
gb|KDO47190.1|  hypothetical protein CISIN_1g032319mg                   172   2e-47   
gb|KHG01446.1|  Glycine-rich RNA-binding 2, mitochondrial -like p...    169   2e-46   
ref|XP_008447620.1|  PREDICTED: glycine-rich RNA-binding protein ...    169   3e-46   
ref|XP_003521342.1|  PREDICTED: glycine-rich RNA-binding protein ...    167   8e-46   
gb|KHN09429.1|  Glycine-rich RNA-binding protein 2, mitochondrial       167   1e-45   
ref|XP_010517020.1|  PREDICTED: glycine-rich RNA-binding protein ...    166   2e-45   
ref|XP_010509328.1|  PREDICTED: glycine-rich RNA-binding protein ...    166   2e-45   
ref|XP_010653445.1|  PREDICTED: glycine-rich RNA-binding protein ...    166   3e-45   
ref|XP_010653444.1|  PREDICTED: glycine-rich RNA-binding protein ...    165   6e-45   
gb|AFK47684.1|  unknown                                                 164   1e-44   
gb|KHN02419.1|  Glycine-rich RNA-binding protein 2, mitochondrial       164   2e-44   
ref|NP_001237071.1|  uncharacterized protein LOC100306326               162   5e-44   
ref|XP_009377087.1|  PREDICTED: glycine-rich RNA-binding protein ...    162   1e-43   
ref|XP_010505339.1|  PREDICTED: glycine-rich RNA-binding protein ...    162   1e-43   
ref|XP_008369855.1|  PREDICTED: glycine-rich RNA-binding protein ...    160   5e-43   
ref|XP_003625508.1|  RNA binding protein                                159   7e-43   
ref|XP_003558218.1|  PREDICTED: glycine-rich RNA-binding protein ...    159   2e-42   
ref|XP_006649860.1|  PREDICTED: glycine-rich RNA-binding protein ...    159   2e-42   
gb|EAY89474.1|  hypothetical protein OsI_11005                          159   3e-42   Oryza sativa Indica Group [Indian rice]
ref|NP_001049729.1|  Os03g0278800                                       159   4e-42   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001150360.1|  RNA binding protein                                158   6e-42   Zea mays [maize]
ref|XP_002465463.1|  hypothetical protein SORBIDRAFT_01g039290          156   3e-41   Sorghum bicolor [broomcorn]
gb|EMT04579.1|  Glycine-rich RNA-binding protein 2, mitochondrial       155   1e-40   
ref|XP_009404612.1|  PREDICTED: 30 kDa ribonucleoprotein, chlorop...    154   1e-40   
ref|XP_010088058.1|  Glycine-rich RNA-binding protein 2                 152   2e-40   
gb|KFK36640.1|  hypothetical protein AALP_AA4G151100                    151   1e-39   
ref|XP_004984756.1|  PREDICTED: glycine-rich RNA-binding protein ...    151   2e-39   
ref|XP_006846093.1|  hypothetical protein AMTR_s00012p00103290          149   4e-39   
ref|XP_002881512.1|  hypothetical protein ARALYDRAFT_902894             149   4e-39   
ref|XP_009766534.1|  PREDICTED: glycine-rich RNA-binding protein        147   1e-38   
ref|XP_002531336.1|  RNA binding protein, putative                      147   3e-38   Ricinus communis
ref|XP_006295200.1|  hypothetical protein CARUB_v10024280mg             147   3e-38   
emb|CDX74955.1|  BnaA05g07010D                                          145   1e-37   
emb|CDP06644.1|  unnamed protein product                                145   2e-37   
ref|XP_009143489.1|  PREDICTED: glycine-rich RNA-binding protein 2      144   2e-37   
gb|KGN54229.1|  hypothetical protein Csa_4G293880                       142   6e-37   
ref|XP_010920671.1|  PREDICTED: glycine-rich RNA-binding protein ...    143   1e-36   
emb|CDX91368.1|  BnaC04g07820D                                          142   1e-36   
ref|NP_181287.1|  RNA recognition motif-containing protein              142   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004165283.1|  PREDICTED: glycine-rich RNA-binding protein ...    139   6e-36   
ref|XP_008794999.1|  PREDICTED: LOW QUALITY PROTEIN: glycine-rich...    139   3e-35   
gb|ACN41115.1|  unknown                                                 124   7e-30   Picea sitchensis
gb|ABK26221.1|  unknown                                                 115   9e-27   Picea sitchensis
ref|XP_010558018.1|  PREDICTED: glycine-rich RNA-binding protein ...    115   2e-26   
gb|KHG12372.1|  Glycine-rich RNA-binding 2, mitochondrial -like p...    113   5e-26   
ref|XP_007021155.1|  RNA-binding family protein                         113   5e-26   
ref|XP_010443034.1|  PREDICTED: glycine-rich RNA-binding protein ...    113   6e-26   
ref|XP_008243500.1|  PREDICTED: glycine-rich RNA-binding protein ...    112   9e-26   
ref|XP_008454580.1|  PREDICTED: glycine-rich RNA-binding protein ...    113   1e-25   
ref|NP_001060964.1|  Os08g0139000                                       112   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010448336.1|  PREDICTED: glycine-rich RNA-binding protein ...    112   1e-25   
ref|XP_004972888.1|  PREDICTED: nucleolin-like                          111   2e-25   
ref|XP_010482863.1|  PREDICTED: glycine-rich RNA-binding protein ...    112   2e-25   
gb|EPS58767.1|  hypothetical protein M569_16047                         111   2e-25   
gb|EEC82875.1|  hypothetical protein OsI_27755                          111   2e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_002864345.1|  RNA recognition motif-containing protein           112   2e-25   
ref|NP_001059935.1|  Os07g0549800                                       110   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006401559.1|  hypothetical protein EUTSA_v10014908mg             111   3e-25   
ref|XP_002283144.1|  PREDICTED: glycine-rich RNA-binding protein ...    110   3e-25   Vitis vinifera
gb|EAZ04269.1|  hypothetical protein OsI_26412                          110   3e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_008226798.1|  PREDICTED: glycine-rich RNA-binding protein ...    110   4e-25   
ref|XP_010028363.1|  PREDICTED: glycine-rich RNA-binding protein ...    110   4e-25   
ref|XP_006657815.1|  PREDICTED: glycine-rich RNA-binding protein ...    109   6e-25   
gb|EPS59908.1|  hypothetical protein M569_14896                         108   6e-25   
gb|ABK95573.1|  unknown                                                 110   7e-25   Populus trichocarpa [western balsam poplar]
ref|XP_004303523.1|  PREDICTED: glycine-rich RNA-binding protein ...    109   7e-25   
ref|XP_009132436.1|  PREDICTED: glycine-rich RNA-binding protein ...    109   1e-24   
ref|XP_006452125.1|  hypothetical protein CICLE_v10009863mg             109   1e-24   
emb|CDY64931.1|  BnaCnng45530D                                          109   1e-24   
ref|NP_001148723.1|  ELAV-like protein 4                                108   1e-24   Zea mays [maize]
emb|CDY42466.1|  BnaA10g08420D                                          109   1e-24   
ref|XP_003573359.1|  PREDICTED: glycine-rich RNA-binding protein ...    109   1e-24   
ref|XP_004151968.1|  PREDICTED: nucleolysin TIAR-like                   110   1e-24   
ref|XP_010912333.1|  PREDICTED: glycine-rich RNA-binding protein ...    109   1e-24   
ref|XP_002445020.1|  hypothetical protein SORBIDRAFT_07g002960          108   2e-24   Sorghum bicolor [broomcorn]
ref|XP_002316957.1|  RNA-binding family protein                         108   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_003527307.1|  PREDICTED: glycine-rich RNA-binding protein ...    108   2e-24   
ref|XP_011030908.1|  PREDICTED: glycine-rich RNA-binding protein ...    108   2e-24   
ref|NP_200269.1|  RNA recognition motif-containing protein              108   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007203802.1|  hypothetical protein PRUPE_ppa026345mg             108   3e-24   
ref|XP_006281245.1|  hypothetical protein CARUB_v10027288mg             108   3e-24   
gb|KHN28381.1|  Glycine-rich RNA-binding protein 2                      108   3e-24   
ref|XP_009119982.1|  PREDICTED: glycine-rich RNA-binding protein ...    108   4e-24   
ref|XP_002276063.2|  PREDICTED: glycine-rich RNA-binding protein ...    107   4e-24   Vitis vinifera
ref|XP_002530915.1|  RNA binding protein, putative                      112   4e-24   Ricinus communis
ref|XP_009384210.1|  PREDICTED: glycine-rich RNA-binding protein ...    108   4e-24   
ref|XP_006659102.1|  PREDICTED: glycine-rich RNA-binding protein ...    107   4e-24   
ref|XP_011048254.1|  PREDICTED: glycine-rich RNA-binding protein ...    108   4e-24   
ref|XP_003562947.1|  PREDICTED: glycine-rich RNA-binding protein ...    107   4e-24   
ref|XP_010271589.1|  PREDICTED: glycine-rich RNA-binding protein ...    107   5e-24   
ref|XP_004505422.1|  PREDICTED: nucleolysin TIA-1 isoform p40-like      107   6e-24   
gb|KDP36187.1|  hypothetical protein JCGZ_08831                         107   7e-24   
ref|XP_006360109.1|  PREDICTED: glycine-rich RNA-binding protein ...    107   7e-24   
emb|CDP05821.1|  unnamed protein product                                107   7e-24   
emb|CDP05822.1|  unnamed protein product                                107   7e-24   
ref|XP_010520881.1|  PREDICTED: glycine-rich RNA-binding protein ...    107   8e-24   
ref|XP_007133034.1|  hypothetical protein PHAVU_011G145700g             107   8e-24   
ref|XP_004244174.1|  PREDICTED: glycine-rich RNA-binding protein ...    107   9e-24   
gb|AFK44512.1|  unknown                                                 107   9e-24   
dbj|BAJ99825.1|  predicted protein                                      107   1e-23   
ref|NP_001150207.1|  LOC100283837                                       106   1e-23   Zea mays [maize]
ref|XP_003540046.1|  PREDICTED: glycine-rich RNA-binding protein ...    106   1e-23   
gb|EYU19190.1|  hypothetical protein MIMGU_mgv1a015840mg                106   2e-23   
ref|XP_002460835.1|  hypothetical protein SORBIDRAFT_02g035890          105   2e-23   Sorghum bicolor [broomcorn]
gb|KFK27067.1|  hypothetical protein AALP_AA8G330100                    106   2e-23   
dbj|BAK04472.1|  predicted protein                                      105   3e-23   
ref|XP_006370586.1|  hypothetical protein POPTR_0001s44050g             105   3e-23   
ref|XP_006387726.1|  RNA-binding family protein                         105   3e-23   
ref|XP_011046925.1|  PREDICTED: glycine-rich RNA-binding protein ...    105   4e-23   
gb|EPS66753.1|  hypothetical protein M569_08025                         105   6e-23   
ref|XP_009588631.1|  PREDICTED: glycine-rich RNA-binding protein ...    105   6e-23   
ref|XP_009411997.1|  PREDICTED: glycine-rich RNA-binding protein ...    104   8e-23   
emb|CDY43820.1|  BnaC03g14530D                                          104   8e-23   
ref|XP_009764151.1|  PREDICTED: glycine-rich RNA-binding protein ...    104   9e-23   
ref|XP_010092279.1|  hypothetical protein L484_021140                   104   1e-22   
ref|XP_004249429.1|  PREDICTED: glycine-rich RNA-binding protein ...    103   2e-22   
ref|XP_010908156.1|  PREDICTED: glycine-rich RNA-binding protein ...    103   2e-22   
ref|XP_010694287.1|  PREDICTED: glycine-rich RNA-binding protein ...    103   2e-22   
ref|XP_006339140.1|  PREDICTED: glycine-rich RNA-binding protein ...    102   2e-22   
ref|XP_009767268.1|  PREDICTED: glycine-rich RNA-binding protein ...    102   2e-22   
ref|XP_007027846.1|  RNA binding family protein isoform 1               102   2e-22   
ref|XP_008793683.1|  PREDICTED: glycine-rich RNA-binding protein ...    103   3e-22   
ref|XP_009601004.1|  PREDICTED: glycine-rich RNA-binding protein ...    102   3e-22   
ref|XP_009355558.1|  PREDICTED: glycine-rich RNA-binding protein ...    102   3e-22   
ref|XP_008349953.1|  PREDICTED: glycine-rich RNA-binding protein ...    102   3e-22   
ref|XP_008349954.1|  PREDICTED: glycine-rich RNA-binding protein ...    102   3e-22   
gb|KDP39011.1|  hypothetical protein JCGZ_00768                         105   3e-22   
ref|XP_008784055.1|  PREDICTED: glycine-rich RNA-binding protein ...    103   4e-22   
ref|XP_006851173.1|  hypothetical protein AMTR_s00043p00170970          100   6e-22   
ref|XP_004294323.1|  PREDICTED: nucleolin-like                          102   6e-22   
gb|EYU33582.1|  hypothetical protein MIMGU_mgv1a015850mg                102   6e-22   
ref|XP_008806788.1|  PREDICTED: glycine-rich RNA-binding protein ...    102   6e-22   
ref|XP_011094286.1|  PREDICTED: glycine-rich RNA-binding protein ...    102   6e-22   
ref|XP_006430132.1|  hypothetical protein CICLE_v10012994mg             102   7e-22   
ref|XP_010241007.1|  PREDICTED: glycine-rich RNA-binding protein ...    100   9e-22   
gb|ABK22008.1|  unknown                                                 101   1e-21   Picea sitchensis
ref|XP_007212216.1|  hypothetical protein PRUPE_ppa013115mg             100   1e-21   
gb|EYU35528.1|  hypothetical protein MIMGU_mgv1a016093mg                100   1e-21   
ref|XP_006481717.1|  PREDICTED: glycine-rich RNA-binding protein ...    101   2e-21   
ref|XP_008365868.1|  PREDICTED: glycine-rich RNA-binding protein ...    100   2e-21   
ref|XP_008661991.1|  PREDICTED: LOC100283837 isoform X1                 100   2e-21   
gb|AFK43918.1|  unknown                                                 100   2e-21   
ref|XP_006288807.1|  hypothetical protein CARUB_v10002139mg             100   2e-21   
ref|XP_002530529.1|  RNA binding protein, putative                    99.8    3e-21   Ricinus communis
ref|XP_009373041.1|  PREDICTED: glycine-rich RNA-binding protein ...    100   3e-21   
ref|XP_009349614.1|  PREDICTED: glycine-rich RNA-binding protein ...    100   3e-21   
ref|XP_010931869.1|  PREDICTED: glycine-rich RNA-binding protein ...    100   3e-21   
ref|XP_009402592.1|  PREDICTED: glycine-rich RNA-binding protein ...  99.8    3e-21   
gb|KHG12622.1|  Glycine-rich RNA-binding 2, mitochondrial -like p...    100   3e-21   
ref|XP_008391940.1|  PREDICTED: glycine-rich RNA-binding protein ...  99.8    3e-21   
ref|XP_009349607.1|  PREDICTED: glycine-rich RNA-binding protein ...    100   4e-21   
ref|XP_010267842.1|  PREDICTED: glycine-rich RNA-binding protein ...  99.8    4e-21   
ref|XP_006836085.1|  hypothetical protein AMTR_s00114p00125610        99.4    4e-21   
ref|XP_010062940.1|  PREDICTED: glycine-rich RNA-binding protein ...  99.8    4e-21   
ref|XP_007207675.1|  hypothetical protein PRUPE_ppa023139mg           99.0    6e-21   
ref|XP_008241226.1|  PREDICTED: glycine-rich RNA-binding protein ...  99.0    7e-21   
ref|XP_011097943.1|  PREDICTED: glycine-rich RNA-binding protein ...  99.0    8e-21   
ref|XP_010037288.1|  PREDICTED: glycine-rich RNA-binding protein ...  98.6    8e-21   
ref|XP_008442872.1|  PREDICTED: glycine-rich RNA-binding protein ...  98.6    9e-21   
ref|NP_001150518.1|  ELAV-like protein 4                              98.6    9e-21   Zea mays [maize]
ref|XP_009355962.1|  PREDICTED: glycine-rich RNA-binding protein ...  99.8    1e-20   
ref|XP_006399088.1|  hypothetical protein EUTSA_v10014928mg           98.6    1e-20   
ref|XP_004161215.1|  PREDICTED: glycine-rich RNA-binding protein ...  97.8    2e-20   
ref|XP_006652268.1|  PREDICTED: glycine-rich RNA-binding protein ...  97.8    2e-20   
ref|XP_006424180.1|  hypothetical protein CICLE_v10029552mg           97.8    2e-20   
ref|XP_004149190.1|  PREDICTED: glycine-rich RNA-binding protein ...  97.4    3e-20   
ref|XP_010654123.1|  PREDICTED: glycine-rich RNA-binding protein ...  96.7    3e-20   
ref|XP_010452534.1|  PREDICTED: glycine-rich RNA-binding protein ...  97.4    3e-20   
ref|XP_008240373.1|  PREDICTED: glycine-rich RNA-binding protein ...  98.6    3e-20   
gb|KFK25023.1|  hypothetical protein AALP_AA8G056800                  97.8    3e-20   
ref|NP_001237108.1|  uncharacterized protein LOC100305561             98.2    3e-20   
ref|XP_004515251.1|  PREDICTED: glycine-rich RNA-binding protein ...  98.2    3e-20   
gb|EMT07034.1|  ELAV-like protein 1                                   99.4    4e-20   
ref|XP_003581210.1|  PREDICTED: glycine-rich RNA-binding protein ...  96.7    5e-20   
ref|XP_006390546.1|  hypothetical protein EUTSA_v10019191mg           97.8    5e-20   
ref|XP_010093775.1|  Cold-inducible RNA-binding protein               96.3    6e-20   
ref|XP_004301228.1|  PREDICTED: cold-inducible RNA-binding protei...  97.1    6e-20   
gb|KHN18798.1|  Glycine-rich RNA-binding protein 2                    96.7    7e-20   
ref|NP_001238370.1|  uncharacterized protein LOC100527079             95.9    7e-20   
ref|XP_002263021.1|  PREDICTED: glycine-rich RNA-binding protein ...  95.9    8e-20   Vitis vinifera
ref|XP_006430131.1|  hypothetical protein CICLE_v10012994mg           95.9    8e-20   
gb|KDO39061.1|  hypothetical protein CISIN_1g032812mg                 95.9    9e-20   
ref|XP_007152596.1|  hypothetical protein PHAVU_004G143300g           97.1    1e-19   
ref|XP_011000775.1|  PREDICTED: glycine-rich RNA-binding protein ...  96.7    1e-19   
ref|XP_006487934.1|  PREDICTED: glycine-rich RNA-binding protein ...  94.7    1e-19   
ref|XP_002964561.1|  hypothetical protein SELMODRAFT_81392            95.9    1e-19   
ref|XP_004246450.1|  PREDICTED: glycine-rich RNA-binding protein ...  95.9    1e-19   
ref|XP_002318331.1|  RNA recognition motif-containing family protein  96.3    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006340998.1|  PREDICTED: cold-inducible RNA-binding protei...  95.9    2e-19   
ref|XP_010423380.1|  PREDICTED: glycine-rich RNA-binding protein ...  95.5    2e-19   
ref|XP_006481718.1|  PREDICTED: glycine-rich RNA-binding protein ...  95.1    2e-19   
ref|XP_010519204.1|  PREDICTED: 29 kDa ribonucleoprotein, chlorop...  96.3    2e-19   
ref|XP_002888931.1|  RNA recognition motif-containing protein         95.9    2e-19   
ref|XP_009797404.1|  PREDICTED: glycine-rich RNA-binding protein ...  95.5    2e-19   
ref|XP_010519203.1|  PREDICTED: 29 kDa ribonucleoprotein, chlorop...  96.3    2e-19   
ref|XP_010278062.1|  PREDICTED: RNA-binding protein 1                 95.5    3e-19   
gb|EMS46042.1|  ELAV-like protein 1                                   97.4    3e-19   
emb|CDP10635.1|  unnamed protein product                              94.4    3e-19   
ref|XP_006855610.1|  hypothetical protein AMTR_s00044p00073410        94.4    6e-19   
ref|XP_006430133.1|  hypothetical protein CICLE_v10012994mg           93.2    7e-19   
ref|XP_009606687.1|  PREDICTED: LOW QUALITY PROTEIN: transformer-...  94.4    7e-19   
ref|XP_009104806.1|  PREDICTED: U11/U12 small nuclear ribonucleop...  94.7    8e-19   
ref|XP_007162936.1|  hypothetical protein PHAVU_001G192800g           93.6    8e-19   
ref|XP_009407328.1|  PREDICTED: glycine-rich RNA-binding protein ...  93.6    8e-19   
gb|KDP45799.1|  hypothetical protein JCGZ_17406                       94.0    9e-19   
ref|XP_008439477.1|  PREDICTED: glycine-rich RNA-binding protein ...  94.0    9e-19   
ref|XP_002271224.1|  PREDICTED: glycine-rich RNA-binding protein ...  94.0    1e-18   Vitis vinifera
ref|XP_009401002.1|  PREDICTED: glycine-rich RNA-binding protein ...  93.6    1e-18   
ref|XP_006301161.1|  hypothetical protein CARUB_v10021559mg           94.0    1e-18   
ref|XP_010491168.1|  PREDICTED: glycine-rich RNA-binding protein ...  92.8    1e-18   
ref|XP_009125638.1|  PREDICTED: glycine-rich RNA-binding protein ...  92.8    1e-18   
ref|XP_010683644.1|  PREDICTED: glycine-rich RNA-binding protein ...  92.4    1e-18   
ref|XP_010069494.1|  PREDICTED: glycine-rich RNA-binding protein ...  93.6    1e-18   
ref|XP_004975582.1|  PREDICTED: glycine-rich RNA-binding protein ...  92.4    2e-18   
ref|XP_010428279.1|  PREDICTED: glycine-rich RNA-binding protein ...  93.6    2e-18   
gb|KHG05363.1|  Glycine-rich RNA-binding 2, mitochondrial -like p...  96.7    2e-18   
emb|CDX82066.1|  BnaC02g22240D                                        90.9    2e-18   
gb|AFK48620.1|  unknown                                               92.8    2e-18   
gb|KFK41789.1|  hypothetical protein AALP_AA2G172300                  93.2    2e-18   
gb|KHG27904.1|  Nucleolin                                             91.7    2e-18   
ref|XP_010683152.1|  PREDICTED: glycine-rich RNA-binding protein ...  93.2    3e-18   
ref|XP_009127997.1|  PREDICTED: LOW QUALITY PROTEIN: glycine-rich...  92.8    3e-18   
ref|XP_003591770.1|  RNA-binding protein                              94.7    3e-18   
ref|XP_010909424.1|  PREDICTED: polyadenylate-binding protein, cy...  96.3    3e-18   
emb|CDY14089.1|  BnaC02g02060D                                        91.7    4e-18   
gb|AFK39402.1|  unknown                                               91.3    4e-18   
emb|CDY04982.1|  BnaAnng01640D                                        91.7    4e-18   
gb|KEH24157.1|  RNA-binding (RRM/RBD/RNP motif) family protein        91.3    4e-18   
ref|XP_010471413.1|  PREDICTED: putative RNA-binding protein 3        92.4    5e-18   
ref|XP_002871204.1|  hypothetical protein ARALYDRAFT_487428           91.3    5e-18   
gb|KDP35842.1|  hypothetical protein JCGZ_10323                       95.5    5e-18   
ref|XP_006302887.1|  hypothetical protein CARUB_v10021018mg           92.0    6e-18   
ref|XP_010416165.1|  PREDICTED: glycine-rich RNA-binding protein ...  92.0    7e-18   
ref|XP_007143810.1|  hypothetical protein PHAVU_007G103400g           95.1    7e-18   
ref|XP_006606279.1|  PREDICTED: uncharacterized protein LOC100791...  95.1    7e-18   
emb|CDY19589.1|  BnaA05g19970D                                        94.7    7e-18   
gb|AFK40678.1|  unknown                                               91.7    8e-18   
ref|XP_009149350.1|  PREDICTED: glycine-rich RNA-binding protein ...  90.5    8e-18   
ref|XP_009145528.1|  PREDICTED: uncharacterized protein LOC103869...  94.7    8e-18   
emb|CDY26743.1|  BnaA06g12790D                                        90.9    8e-18   
ref|XP_009145529.1|  PREDICTED: uncharacterized protein LOC103869...  94.7    9e-18   
ref|NP_177494.1|  RNA recognition motif-containing protein            91.3    9e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011086967.1|  PREDICTED: glycine-rich RNA-binding protein ...  91.7    9e-18   
ref|XP_009615460.1|  PREDICTED: uncharacterized protein LOC104108178  94.7    1e-17   
ref|XP_006436630.1|  hypothetical protein CICLE_v10031772mg           93.2    1e-17   
emb|CDO98603.1|  unnamed protein product                              90.9    1e-17   
ref|XP_008354821.1|  PREDICTED: glycine-rich RNA-binding protein ...  90.1    1e-17   
gb|KEH26848.1|  RNA recognition motif                                 91.3    1e-17   
ref|XP_006406331.1|  hypothetical protein EUTSA_v10020913mg           94.4    1e-17   
emb|CBI35241.3|  unnamed protein product                              93.2    1e-17   
ref|NP_196239.1|  RNA recognition motif (RRM)-containing protein      90.1    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AIA26246.1|  glycine-rich RNA-binding protein 2                    89.7    1e-17   
ref|XP_010112904.1|  Cold-inducible RNA-binding protein               88.6    1e-17   
ref|XP_010459497.1|  PREDICTED: glycine-rich RNA-binding protein ...  90.5    1e-17   
ref|XP_009110330.1|  PREDICTED: glycine-rich RNA-binding protein ...  90.1    1e-17   
gb|ABK21345.1|  unknown                                               91.3    1e-17   Picea sitchensis
gb|AIA26244.1|  glycine-rich RNA-binding protein 2                    89.7    1e-17   
gb|AIA26243.1|  glycine-rich RNA-binding protein 2                    89.4    1e-17   
gb|KHN00908.1|  Glycine-rich RNA-binding protein 2, mitochondrial     95.9    1e-17   
ref|XP_006442387.1|  hypothetical protein CICLE_v10023396mg           89.0    2e-17   
ref|XP_002890291.1|  predicted protein                                90.1    2e-17   
emb|CDX96709.1|  BnaA08g22520D                                        90.1    2e-17   
ref|XP_004301114.1|  PREDICTED: polyadenylate-binding protein RBP...  92.0    2e-17   
emb|CAE01512.2|  OJ991214_12.1                                        89.7    2e-17   
gb|EYU17791.1|  hypothetical protein MIMGU_mgv1a014503mg              90.9    2e-17   
ref|XP_004169984.1|  PREDICTED: uncharacterized LOC101208465          94.0    2e-17   
gb|KGN63973.1|  hypothetical protein Csa_1G032430                     90.5    2e-17   
ref|XP_010498269.1|  PREDICTED: glycine-rich RNA-binding protein ...  90.1    2e-17   
ref|XP_010909425.1|  PREDICTED: polyadenylate-binding protein, cy...  94.0    2e-17   
ref|XP_010260084.1|  PREDICTED: cold-inducible RNA-binding protei...  89.0    2e-17   
ref|XP_004494218.1|  PREDICTED: cold-inducible RNA-binding protei...  89.7    2e-17   
emb|CDP20484.1|  unnamed protein product                              92.8    2e-17   
ref|XP_008794530.1|  PREDICTED: glycine-rich RNA-binding protein ...  90.1    2e-17   
ref|XP_010466311.1|  PREDICTED: uncharacterized protein LOC104746...  93.2    2e-17   
ref|XP_010466310.1|  PREDICTED: uncharacterized protein LOC104746...  93.2    3e-17   
ref|XP_004140988.1|  PREDICTED: uncharacterized protein LOC101208465  93.6    3e-17   
emb|CDY19230.1|  BnaC05g14310D                                        89.0    3e-17   
ref|XP_002264164.1|  PREDICTED: uncharacterized protein LOC100265361  93.6    3e-17   
ref|XP_010466309.1|  PREDICTED: uncharacterized protein LOC104746...  93.2    3e-17   
ref|XP_006436629.1|  hypothetical protein CICLE_v10031772mg           93.2    3e-17   
ref|XP_002883278.1|  RNA recognition motif-containing protein         93.2    3e-17   
ref|XP_010488083.1|  PREDICTED: uncharacterized protein LOC104765984  92.8    3e-17   
ref|XP_010477052.1|  PREDICTED: glycine-rich RNA-binding protein ...  89.4    3e-17   
ref|XP_002446436.1|  hypothetical protein SORBIDRAFT_06g016070        88.6    3e-17   
gb|KDO37466.1|  hypothetical protein CISIN_1g024012mg                 91.3    3e-17   
ref|XP_003597341.1|  Cold-inducible RNA-binding protein               87.4    3e-17   
emb|CDY06395.1|  BnaC05g31350D                                        93.2    4e-17   
ref|XP_006299199.1|  hypothetical protein CARUB_v10015346mg           92.4    4e-17   
ref|XP_011076927.1|  PREDICTED: uncharacterized protein LOC105161057  92.8    5e-17   
ref|XP_010455682.1|  PREDICTED: cold-inducible RNA-binding protei...  87.8    5e-17   
ref|XP_009789757.1|  PREDICTED: uncharacterized protein LOC104237323  92.8    5e-17   
gb|KDO37467.1|  hypothetical protein CISIN_1g024012mg                 91.3    5e-17   
gb|AAM62588.1|  glycine-rich RNA-binding protein, putative            88.6    5e-17   
gb|KFK27526.1|  hypothetical protein AALP_AA8G394900                  87.0    5e-17   
gb|KDP33116.1|  hypothetical protein JCGZ_13563                       87.4    6e-17   
ref|XP_008456591.1|  PREDICTED: uncharacterized protein LOC103496502  92.4    6e-17   
ref|NP_173298.1|  glycine-rich RNA-binding protein 6                  88.6    6e-17   
ref|XP_008453281.1|  PREDICTED: glycine-rich RNA-binding protein ...  90.5    7e-17   
ref|XP_006379465.1|  hypothetical protein POPTR_0008s02290g           92.0    7e-17   
gb|EMT21157.1|  Glycine-rich RNA-binding protein 2, mitochondrial     90.9    7e-17   
ref|XP_008453280.1|  PREDICTED: glycine-rich RNA-binding protein ...  90.5    7e-17   
emb|CAN83272.1|  hypothetical protein VITISV_001132                   92.4    7e-17   
gb|EYU19785.1|  hypothetical protein MIMGU_mgv1a007946mg              92.0    8e-17   
ref|XP_009358339.1|  PREDICTED: cold-inducible RNA-binding protei...  86.3    8e-17   
ref|XP_004240744.1|  PREDICTED: glycine-rich RNA-binding protein ...  87.8    8e-17   
ref|NP_566672.1|  RNA recognition motif-containing protein            91.7    9e-17   
ref|XP_006361451.1|  PREDICTED: uncharacterized protein LOC102599113  92.0    9e-17   
ref|XP_006284571.1|  hypothetical protein CARUB_v10005796mg           89.0    9e-17   
ref|XP_004249980.1|  PREDICTED: uncharacterized protein LOC101246778  91.7    1e-16   
ref|XP_006481719.1|  PREDICTED: glycine-rich RNA-binding protein ...  87.0    1e-16   
gb|EPS63269.1|  hypothetical protein M569_11514                       90.1    1e-16   
ref|XP_010067147.1|  PREDICTED: uncharacterized protein LOC104454104  91.7    1e-16   
ref|XP_007015762.1|  RNA-binding family protein, putative             86.7    1e-16   
ref|XP_004138320.1|  PREDICTED: uncharacterized protein LOC101218446  89.0    1e-16   
ref|XP_009380648.1|  PREDICTED: uncharacterized protein LOC103968985  91.7    1e-16   
ref|XP_004496194.1|  PREDICTED: uncharacterized protein LOC101490156  91.3    1e-16   
ref|XP_002864655.1|  predicted protein                                85.5    2e-16   
ref|XP_010509546.1|  PREDICTED: uncharacterized protein LOC104785945  90.9    2e-16   
ref|XP_006478116.1|  PREDICTED: glycine-rich RNA-binding protein ...  87.8    2e-16   
ref|XP_008359511.1|  PREDICTED: uncharacterized protein LOC103423218  88.2    2e-16   
ref|XP_010908617.1|  PREDICTED: glycine-rich RNA-binding protein ...  87.4    2e-16   
ref|XP_007211966.1|  hypothetical protein PRUPE_ppa006586mg           91.3    2e-16   
gb|ACF83757.1|  unknown                                               86.7    2e-16   
ref|XP_008788446.1|  PREDICTED: polyadenylate-binding protein, cy...  90.9    2e-16   
ref|XP_008788448.1|  PREDICTED: polyadenylate-binding protein, cy...  90.9    2e-16   
ref|XP_011024230.1|  PREDICTED: uncharacterized protein LOC105125466  90.5    2e-16   
ref|XP_010908616.1|  PREDICTED: U11/U12 small nuclear ribonucleop...  87.8    2e-16   
ref|XP_009408343.1|  PREDICTED: glycine-rich RNA-binding protein ...  86.7    2e-16   
ref|XP_006441346.1|  hypothetical protein CICLE_v10022555mg           87.0    3e-16   
ref|XP_007210100.1|  hypothetical protein PRUPE_ppa019414mg           85.9    3e-16   
gb|KGN63730.1|  hypothetical protein Csa_1G013770                     89.0    3e-16   
ref|WP_015641611.1|  putative RNA-binding protein rbpA                85.1    3e-16   
ref|XP_004154942.1|  PREDICTED: uncharacterized LOC101218446          89.0    3e-16   
gb|AFK34965.1|  unknown                                               87.4    3e-16   
ref|XP_006387922.1|  hypothetical protein POPTR_0475s00200g           89.4    3e-16   
ref|XP_006572833.1|  PREDICTED: uncharacterized protein LOC100527...  85.5    3e-16   
gb|EEE57745.1|  hypothetical protein OsJ_08262                        90.1    3e-16   
gb|EEE61562.1|  hypothetical protein OsJ_15917                        86.3    3e-16   
gb|EEC77862.1|  hypothetical protein OsI_17125                        86.3    4e-16   
gb|EPB91419.1|  hypothetical protein HMPREF1544_01741                 85.1    4e-16   
emb|CDY09244.1|  BnaA02g06700D                                        84.7    4e-16   
ref|XP_010244429.1|  PREDICTED: uncharacterized protein LOC104588267  90.1    4e-16   
ref|XP_009126650.1|  PREDICTED: cold-inducible RNA-binding protein    84.7    4e-16   
ref|XP_010450153.1|  PREDICTED: glycine-rich RNA-binding protein ...  86.3    4e-16   
ref|NP_001150093.1|  glycine-rich RNA-binding protein 2               85.5    4e-16   
ref|XP_006848599.1|  hypothetical protein AMTR_s00168p00066520        85.1    4e-16   
ref|XP_008357602.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.3    4e-16   
gb|EKD65230.1|  RNA-binding protein                                   84.3    5e-16   
ref|XP_006645227.1|  PREDICTED: glycine-rich RNA-binding protein ...  85.5    5e-16   
ref|XP_006292104.1|  hypothetical protein CARUB_v10018300mg           84.3    5e-16   
ref|NP_001048016.1|  Os02g0730800                                     89.7    5e-16   
ref|XP_006826819.1|  hypothetical protein AMTR_s00010p00058910        89.7    6e-16   
ref|WP_009553784.1|  RNA-binding protein                              85.9    6e-16   
ref|XP_008232008.1|  PREDICTED: uncharacterized protein LOC103331...  89.7    6e-16   
ref|WP_015641350.1|  RNP-1 like RNA-binding protein                   84.3    6e-16   
ref|XP_006442385.1|  hypothetical protein CICLE_v10024110mg           85.5    6e-16   
ref|XP_004962942.1|  PREDICTED: glycine-rich RNA-binding protein ...  87.0    7e-16   
dbj|BAJ84850.1|  predicted protein                                    87.8    7e-16   
ref|XP_002315443.2|  hypothetical protein POPTR_0010s24380g           90.5    7e-16   
ref|XP_004368045.1|  RNA recognition motif domain containing protein  85.1    7e-16   
ref|XP_006373086.1|  glycine-rich RNA-binding family protein          84.7    8e-16   
ref|XP_010939180.1|  PREDICTED: glycine-rich RNA-binding protein ...  87.8    8e-16   
ref|WP_036230770.1|  RNA-binding protein                              84.3    8e-16   
ref|XP_004499878.1|  PREDICTED: cold-inducible RNA-binding protei...  84.3    8e-16   
ref|XP_010088768.1|  Hippocampus abundant transcript-like protein 1   90.5    9e-16   
ref|WP_036247595.1|  RNA-binding protein                              84.3    9e-16   
gb|EMS49023.1|  Putative RNA-binding protein 3                        88.2    1e-15   
ref|XP_008345722.1|  PREDICTED: uncharacterized protein LOC103408662  89.0    1e-15   
ref|WP_019561258.1|  hypothetical protein                             84.0    1e-15   
ref|XP_011092396.1|  PREDICTED: glycine-rich RNA-binding protein ...  85.9    1e-15   
ref|XP_009356120.1|  PREDICTED: uncharacterized protein LOC103947013  89.0    1e-15   
ref|XP_010245267.1|  PREDICTED: glycine-rich RNA-binding protein      86.3    1e-15   
ref|XP_006363508.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.7    1e-15   
ref|XP_011042176.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.3    1e-15   
ref|XP_008232009.1|  PREDICTED: uncharacterized protein LOC103331...  88.6    1e-15   
ref|XP_010495842.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.7    1e-15   
ref|NP_001238088.1|  uncharacterized protein LOC100527061             83.6    1e-15   
ref|NP_001289913.1|  glycine-rich RNA-binding protein 2, mitochon...  84.7    1e-15   
ref|XP_006290234.1|  hypothetical protein CARUB_v100031200mg          83.2    1e-15   
gb|EEE50735.1|  hypothetical protein OsJ_31052                        83.6    1e-15   
ref|XP_011092398.1|  PREDICTED: glycine-rich RNA-binding protein ...  85.9    1e-15   
ref|XP_004976601.1|  PREDICTED: glycine-rich RNA-binding protein-...  84.3    1e-15   
ref|XP_008231969.1|  PREDICTED: glycine-rich RNA-binding protein ...  85.9    2e-15   
ref|XP_011072898.1|  PREDICTED: glycine-rich RNA-binding protein ...  86.7    2e-15   
ref|XP_010547757.1|  PREDICTED: glycine-rich RNA-binding protein ...  85.9    2e-15   
ref|XP_007208554.1|  hypothetical protein PRUPE_ppa024320mg           82.8    2e-15   
ref|XP_007027852.1|  RNA binding family protein isoform 7             83.2    2e-15   
ref|XP_010681376.1|  PREDICTED: uncharacterized protein LOC104896333  88.6    2e-15   
ref|WP_011831378.1|  RNA-binding protein                              84.3    2e-15   
ref|XP_010534744.1|  PREDICTED: uncharacterized protein LOC104810247  88.2    2e-15   
ref|XP_004340009.1|  RNA recognition motif domain containing protein  84.0    2e-15   
ref|XP_010483634.1|  PREDICTED: cold-inducible RNA-binding protei...  82.8    2e-15   
ref|XP_011046127.1|  PREDICTED: glycine-rich RNA-binding protein ...  85.5    2e-15   
ref|XP_006418832.1|  hypothetical protein EUTSA_v10002711mg           83.6    2e-15   
gb|EKD80418.1|  cp31AHv protein                                       83.2    2e-15   
ref|XP_010547755.1|  PREDICTED: glycine-rich RNA-binding protein ...  86.3    2e-15   
ref|XP_011003620.1|  PREDICTED: glycine-rich RNA-binding protein ...  83.6    2e-15   
ref|XP_009396794.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.0    2e-15   
ref|XP_004953815.1|  PREDICTED: protein gar2-like                     87.8    2e-15   
ref|XP_010512958.1|  PREDICTED: glycine-rich RNA-binding protein ...  83.6    2e-15   
ref|WP_010258564.1|  RNA-binding protein                              82.8    2e-15   
ref|NP_001159310.1|  uncharacterized protein LOC100304402             87.8    2e-15   
ref|XP_002299678.2|  hypothetical protein POPTR_0001s21460g           85.1    2e-15   
ref|XP_008643905.1|  PREDICTED: uncharacterized protein LOC100304...  87.8    2e-15   
gb|KDP37561.1|  hypothetical protein JCGZ_06000                       84.7    3e-15   
gb|ABK95608.1|  unknown                                               83.2    3e-15   
gb|KHG13503.1|  Glycine-rich RNA-binding 2, mitochondrial -like p...  85.9    3e-15   
ref|XP_010488462.1|  PREDICTED: glycine-rich RNA-binding protein ...  83.2    3e-15   
ref|XP_010234702.1|  PREDICTED: glycine-rich RNA-binding protein ...  85.5    3e-15   
ref|XP_007010355.1|  RNA-binding family protein isoform 1             87.4    3e-15   
ref|XP_010111854.1|  Glycine-rich RNA-binding protein                 85.1    3e-15   
ref|WP_011807205.1|  RNA-binding protein                              83.2    3e-15   
ref|XP_010669455.1|  PREDICTED: glycine-rich RNA-binding protein ...  82.4    4e-15   
ref|XP_003576265.1|  PREDICTED: glycine-rich RNA-binding protein ...  83.6    4e-15   
gb|EKV19258.1|  hypothetical protein PDIG_04180                       83.2    4e-15   
ref|XP_006388122.1|  hypothetical protein POPTR_0323s00200g           82.8    4e-15   
ref|XP_006279867.1|  hypothetical protein CARUB_v10028559mg           81.6    4e-15   
ref|WP_029462623.1|  RNA-binding protein                              82.8    5e-15   
dbj|BAO81703.1|  RNA-binding protein with RRM domain                  82.8    5e-15   
ref|WP_034111850.1|  RNA-binding protein                              82.8    5e-15   
ref|XP_001736605.1|  cold-inducible RNA-binding protein               82.8    5e-15   
dbj|BAO84044.1|  RNA-binding protein with RRM domain                  82.8    5e-15   
gb|AFK08578.1|  glycine-rich RNA binding protein 2c                   83.2    5e-15   
gb|EMT29559.1|  Putative RNA-binding protein 3                        87.4    5e-15   
ref|NP_001150574.1|  glycine-rich RNA-binding protein 7               84.7    5e-15   
ref|WP_015914691.1|  RNA-binding protein                              82.8    5e-15   
gb|EPS60357.1|  hypothetical protein M569_14446                       82.8    6e-15   
ref|XP_010466745.1|  PREDICTED: glycine-rich RNA-binding protein ...  82.4    6e-15   
ref|XP_003599157.1|  Cold-inducible RNA-binding protein               82.0    6e-15   
ref|XP_008779075.1|  PREDICTED: glycine-rich RNA-binding protein ...  81.6    6e-15   
gb|KHG16855.1|  Glycine-rich RNA-binding 2, mitochondrial -like p...  82.0    7e-15   
ref|NP_001151732.1|  RNA binding protein                              82.4    7e-15   
gb|KHG13522.1|  Glycine-rich RNA-binding 2, mitochondrial -like p...  84.7    7e-15   
ref|WP_029001629.1|  RNA-binding protein                              82.8    7e-15   
ref|XP_004137435.1|  PREDICTED: glycine-rich RNA-binding protein ...  82.8    7e-15   
ref|XP_011097944.1|  PREDICTED: glycine-rich RNA-binding protein ...  81.6    7e-15   
ref|XP_010936473.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.7    8e-15   
ref|XP_004157450.1|  PREDICTED: glycine-rich RNA-binding protein ...  82.8    8e-15   
ref|XP_010443769.1|  PREDICTED: cold-inducible RNA-binding protei...  80.9    8e-15   
ref|XP_008663450.1|  PREDICTED: cold-inducible RNA-binding protein    82.4    8e-15   
gb|AFK35450.1|  unknown                                               82.8    8e-15   
gb|ABK22494.1|  unknown                                               82.8    8e-15   
ref|XP_006374399.1|  hypothetical protein POPTR_0015s06810g           84.0    8e-15   
gb|KGO75332.1|  Nucleotide-binding, alpha-beta plait                  83.2    8e-15   
ref|WP_019149972.1|  RNA-binding protein                              81.3    8e-15   
ref|XP_006477902.1|  PREDICTED: cold-inducible RNA-binding protei...  81.6    8e-15   
ref|WP_024538271.1|  RNA-binding protein                              82.0    9e-15   
ref|XP_011006577.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.0    9e-15   
ref|WP_036803730.1|  RNA-binding protein                              82.0    9e-15   
ref|WP_012345223.1|  RNA-binding protein                              82.0    1e-14   
ref|XP_009416565.1|  PREDICTED: glycine-rich RNA-binding protein ...  83.6    1e-14   
ref|XP_010435219.1|  PREDICTED: glycine-rich RNA-binding protein ...  82.4    1e-14   
dbj|BAG92098.1|  unnamed protein product                              80.9    1e-14   
ref|XP_004971051.1|  PREDICTED: glycine-rich RNA-binding protein ...  82.4    1e-14   
dbj|BAE91897.1|  glycine-rich RNA-binding protein                     80.9    1e-14   
ref|XP_008223101.1|  PREDICTED: glycine-rich RNA-binding protein      80.5    1e-14   
emb|CCI55328.1|  PH01B001I13.24                                       82.8    1e-14   
ref|XP_006661693.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.3    1e-14   
gb|KDO40864.1|  hypothetical protein CISIN_1g048030mg                 80.5    1e-14   
ref|XP_003597342.1|  Cold-inducible RNA-binding protein               81.6    1e-14   
ref|XP_002523766.1|  dc50, putative                                   82.8    1e-14   
ref|NP_001241843.1|  putative glycine-rich protein                    83.6    1e-14   
ref|XP_002870351.1|  hypothetical protein ARALYDRAFT_493528           81.6    1e-14   
ref|XP_006845838.1|  hypothetical protein AMTR_s00154p00024620        84.3    1e-14   
gb|KHF99043.1|  Glycine-rich RNA-binding 2, mitochondrial -like p...  81.6    1e-14   
ref|NP_189025.1|  glycine-rich RNA-binding protein 4                  81.3    1e-14   
ref|WP_025498425.1|  RNA-binding protein                              80.5    1e-14   
ref|XP_011092799.1|  PREDICTED: glycine-rich RNA-binding protein ...  81.6    1e-14   
ref|WP_019426419.1|  RNA-binding protein                              81.3    1e-14   
ref|XP_009395639.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.0    1e-14   
ref|XP_009624198.1|  PREDICTED: glycine-rich RNA-binding protein ...  83.6    1e-14   
ref|XP_008791317.1|  PREDICTED: glycine-rich RNA-binding protein ...  83.6    2e-14   
ref|XP_008370514.1|  PREDICTED: glycine-rich RNA-binding protein ...  82.8    2e-14   
ref|WP_011801323.1|  RNA-binding protein                              80.9    2e-14   
ref|WP_023793171.1|  RNP-1 like protein RNA-binding protein           80.1    2e-14   
ref|WP_029527809.1|  RNA-binding protein                              81.3    2e-14   
gb|ADX97202.1|  cold-inducible RNA-binding protein                    79.7    2e-14   



>ref|XP_011094828.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
[Sesamum indicum]
Length=149

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 116/148 (78%), Gaps = 5/148 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTL---TTSKLFVSGLSRYTSDEGLNKAF  903
             MAF+SAFR IL G   PS   +SQ A++R  STL   T+ KLFVSGLSR T+DE L KAF
Sbjct  1     MAFASAFRRILSGSTTPSLNIRSQFAAIRLNSTLATLTSPKLFVSGLSRNTTDENLYKAF  60

Query  904   EQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE  1083
               FG+L+EAKVI DR +GRSKGFGFVTYET+EEA+KAREGMNAKFLDGWVIFVDPA+P+E
Sbjct  61    APFGRLLEAKVIIDRGSGRSKGFGFVTYETVEEAEKAREGMNAKFLDGWVIFVDPARPRE  120

Query  1084  FRP--PPQPESDSTTFGIRSNKTIGWSG  1161
              +P  PP+ +  ST  G  +NKT+GWSG
Sbjct  121   AQPRQPPRQDMQSTETGFTTNKTVGWSG  148



>ref|XP_008241409.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
[Prunus mume]
Length=140

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S+FR +LGG    SS  QSQ  S+R  STLT+ KLF+SGLSR T+DE L +AF  F
Sbjct  1     MAFISSFRRVLGGS---SSALQSQFVSIRHNSTLTSPKLFISGLSRLTTDEKLQEAFSPF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G++V+A+V+ DRA+GRSKGFGF+TY +IEEA++AR+GMNAKFLDGWVIFVDPAKP+E RP
Sbjct  58    GQIVDARVVIDRASGRSKGFGFITYTSIEEAEQARQGMNAKFLDGWVIFVDPAKPREPRP  117

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             PPQ + + +  G R+NKTIGW G
Sbjct  118   PPQAQPNPSETGFRTNKTIGWCG  140



>ref|XP_007027095.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY07597.1| RNA-binding family protein [Theobroma cacao]
Length=139

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 114/143 (80%), Gaps = 4/143 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF+S FR IL G   PS +  SQ AS+R  STLT+ KLF+SGLSR T+DE  N+AF  F
Sbjct  1     MAFASRFRRILTG---PSPLC-SQFASVRLNSTLTSPKLFISGLSRETTDEQFNEAFTPF  56

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G++VEAKVI DRATGRSKGFGFVTY  IEEA+KARE MNAKFL GWVIFVDPAKP+E R 
Sbjct  57    GQIVEAKVIRDRATGRSKGFGFVTYTAIEEAEKAREEMNAKFLHGWVIFVDPAKPREPRA  116

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             PP+ ES+S+ FG R+NKT+GW G
Sbjct  117   PPRSESESSEFGFRTNKTVGWCG  139



>ref|XP_009374665.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009350094.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial-like 
[Pyrus x bretschneideri]
Length=142

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 112/145 (77%), Gaps = 5/145 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S FR +LGG    SS   SQ A++R  STLT+ +LF+SGLSR T+DE L +AF  F
Sbjct  1     MAFISTFRRVLGGS---SSALHSQFAAIRHNSTLTSPRLFISGLSRLTTDEKLREAFSPF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFR-  1089
             G++V+AKV+ DR + RSKGFGF+TY ++EEA+KAREGMNAKFLDGWVIFVDPAKP+E R 
Sbjct  58    GQIVDAKVVMDRVSQRSKGFGFITYASVEEAEKAREGMNAKFLDGWVIFVDPAKPREPRY  117

Query  1090  -PPPQPESDSTTFGIRSNKTIGWSG  1161
              PPPQ + D +  G RSNKTIGW G
Sbjct  118   APPPQAQQDPSETGFRSNKTIGWCG  142



>ref|XP_009621194.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Nicotiana tomentosiformis]
Length=140

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 117/144 (81%), Gaps = 6/144 (4%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF   FR I  G    S+IFQSQ +S+RF STLT+ KLFVSGLSRYTSDE L KAFEQF
Sbjct  1     MAF---FRRIFSGS--SSTIFQSQLSSIRFNSTLTSPKLFVSGLSRYTSDENLKKAFEQF  55

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             GKLVEAKVITDRATGRSKGFGFV+YET+EEA+KAREGMNAKFLDGWVIFVDPA+P   RP
Sbjct  56    GKLVEAKVITDRATGRSKGFGFVSYETVEEAEKAREGMNAKFLDGWVIFVDPARPSMPRP  115

Query  1093  PPQPESDST-TFGIRSNKTIGWSG  1161
             PP P       FGI +NKT+GW+G
Sbjct  116   PPPPPPQDPLNFGITTNKTVGWTG  139



>ref|XP_004302774.1| PREDICTED: glycine-rich RNA-binding protein 2-like [Fragaria 
vesca subsp. vesca]
Length=140

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 111/143 (78%), Gaps = 3/143 (2%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S+FR +LG   + +S   SQ A++R  +TLT+ KLF+SGLSR T+DE L + F +F
Sbjct  1     MAFMSSFRRVLG---VSASALPSQFAAIRHNTTLTSPKLFISGLSRLTTDEKLKQTFSEF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G++  AKVITDR TGRSKGF FVTY +IEEA+KA+EGMN KFLDGWVIFVDPAKP+E+RP
Sbjct  58    GQIEHAKVITDRQTGRSKGFAFVTYSSIEEAEKAKEGMNGKFLDGWVIFVDPAKPREYRP  117

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             PP  + +S+  G + NKTIGW G
Sbjct  118   PPPAQQESSDSGFKVNKTIGWCG  140



>gb|KDP35596.1| hypothetical protein JCGZ_09034 [Jatropha curcas]
Length=139

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 107/143 (75%), Gaps = 4/143 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S  R +L G    S   QS+     F STLT+ KLF+SGLSR T+DE L +AF  F
Sbjct  1     MAFVSTVRRVLIGSSSASPTLQSRL----FYSTLTSPKLFISGLSRLTTDEKLKEAFSPF  56

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G+LVEAKV+ DRA+GRS+GFGFV+Y TIEEA+KARE MNAK+LDGWVIFVDPAKP+E RP
Sbjct  57    GQLVEAKVVVDRASGRSRGFGFVSYTTIEEAEKARENMNAKYLDGWVIFVDPAKPREQRP  116

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             PP P  + T  G R+NKTIGW G
Sbjct  117   PPSPVQEPTDTGYRTNKTIGWCG  139



>ref|XP_010047468.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
[Eucalyptus grandis]
 gb|KCW88912.1| hypothetical protein EUGRSUZ_A01243 [Eucalyptus grandis]
Length=143

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S+ R  L    +  S+FQSQ +   F STLT  KLFVSGLSR T+DE L +AF  F
Sbjct  1     MAFFSSIRNALAKSSVSPSVFQSQPSLSSFYSTLTAPKLFVSGLSRMTTDEKLQEAFAAF  60

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G LVEAKVITDR +GRSKGFGFVTYETIEEA+KAREGMNAKFLDGWVIFVDPAKP+E RP
Sbjct  61    GNLVEAKVITDRMSGRSKGFGFVTYETIEEAEKAREGMNAKFLDGWVIFVDPAKPRELRP  120

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             PPQ E   +  G R+NKT+GW G
Sbjct  121   PPQQEPQPSETGFRTNKTVGWCG  143



>ref|XP_004249524.1| PREDICTED: glycine-rich RNA-binding protein 2, mitochondrial 
[Solanum lycopersicum]
Length=138

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +1

Query  751   FRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEA  930
             FR I  G    S+I QSQ +S+R  STLT+ KLFVSGLSRYT DE L KAFE+FG L EA
Sbjct  4     FRRIFSG---SSTIVQSQFSSIRLNSTLTSPKLFVSGLSRYTGDENLRKAFEEFGCLTEA  60

Query  931   KVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPES  1110
             KVITDRATGRSKGFGFV+YETIEEA+KAREGMNAKFLDGWVIFVDPAKP   R PP P  
Sbjct  61    KVITDRATGRSKGFGFVSYETIEEAEKAREGMNAKFLDGWVIFVDPAKPSMPRAPPPPPQ  120

Query  1111  DSTTFGIRSNKTIGWSG  1161
             D   FGI +NKT+GW+G
Sbjct  121   DLVNFGITTNKTVGWTG  137



>ref|XP_006339038.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial-like 
[Solanum tuberosum]
Length=138

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 110/137 (80%), Gaps = 3/137 (2%)
 Frame = +1

Query  751   FRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEA  930
             FR I  G    S+I QSQ +S+R  STLT+ KLFVSGLSRYTSDE L KAFE+FG L EA
Sbjct  4     FRRIFSG---SSTILQSQFSSIRLNSTLTSPKLFVSGLSRYTSDENLKKAFEEFGCLTEA  60

Query  931   KVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPES  1110
             KVITDRATGRSKGFGFV+YETIEEA+KAREGMNAKFLDGWVIFVDPAKP   R PP P  
Sbjct  61    KVITDRATGRSKGFGFVSYETIEEAEKAREGMNAKFLDGWVIFVDPAKPSMPRAPPPPPQ  120

Query  1111  DSTTFGIRSNKTIGWSG  1161
             D   FGI +NKT+GW+G
Sbjct  121   DPLNFGITTNKTVGWTG  137



>gb|EYU41694.1| hypothetical protein MIMGU_mgv1a015648mg [Erythranthe guttata]
Length=150

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 111/149 (74%), Gaps = 6/149 (4%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTT---SKLFVSGLSRYTSDEGLNKAF  903
             MAF+S FR IL G   PS   +SQ AS+R  ST+TT    KLF+SGL+R TSDE L KAF
Sbjct  1     MAFASIFRRILNGSSTPSLTVRSQFASIRLNSTVTTLTAPKLFISGLNRNTSDENLYKAF  60

Query  904   EQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE  1083
               FG+L+EAKVI DR +GRSKGF FVTYE++EEA+KAREGMNAK+LDGWVIFVDPA P+E
Sbjct  61    APFGRLLEAKVIVDRGSGRSKGFAFVTYESVEEAEKAREGMNAKYLDGWVIFVDPANPRE  120

Query  1084  FRPPPQPESD---STTFGIRSNKTIGWSG  1161
              +P   P  D   ST  G  SNKT+GW+G
Sbjct  121   AQPRLPPRQDNIQSTEPGFTSNKTVGWTG  149



>ref|XP_007162665.1| hypothetical protein PHAVU_001G170000g [Phaseolus vulgaris]
 gb|ESW34659.1| hypothetical protein PHAVU_001G170000g [Phaseolus vulgaris]
Length=139

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +1

Query  775   LMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRAT  954
             L  + +  S  AS+RF STLT+ KLFVSGLSR T+DE L +AF  FG+LVEAKVITDRA+
Sbjct  11    LRHTPLLHSHHASIRFASTLTSPKLFVSGLSRLTTDEKLKEAFTSFGQLVEAKVITDRAS  70

Query  955   GRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIR  1134
             GRSKGF FVTY +IEEA+KAREGMNAKFLDGWVIFVDPAKP+E RPP Q +S  +  G  
Sbjct  71    GRSKGFAFVTYTSIEEAEKAREGMNAKFLDGWVIFVDPAKPREPRPPQQSQSRPSESGFT  130

Query  1135  SNKTIGWSG  1161
              NKT+GW G
Sbjct  131   VNKTVGWCG  139



>ref|XP_008387739.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial-like 
[Malus domestica]
Length=142

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 110/145 (76%), Gaps = 5/145 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S F+ +LG     SS   SQ A++R  STLT+ +LF+SGLSR T+DE L +AF  F
Sbjct  1     MAFISTFQRVLGXS---SSALHSQFAAIRHNSTLTSPRLFISGLSRLTTDEKLKEAFSPF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFR-  1089
             G++V+AKV+ DR + RSKGFGF+TY ++EEA+KAREGMNAKFLDGWVIFVDPAKP+E R 
Sbjct  58    GQIVDAKVVMDRVSQRSKGFGFITYASVEEAEKAREGMNAKFLDGWVIFVDPAKPREPRY  117

Query  1090  -PPPQPESDSTTFGIRSNKTIGWSG  1161
              PPPQ   D +  G RSNKTIGW G
Sbjct  118   APPPQASQDPSETGFRSNKTIGWCG  142



>ref|XP_010683908.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=144

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF+   R I       S I QSQ +S+R  +TLT+ KLFVSGLSR T+DE   +AF  F
Sbjct  1     MAFAQNLRNIYNRLSSASPILQSQLSSIRLNATLTSPKLFVSGLSRQTTDEKFKEAFAAF  60

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G+LVEAKV+ DR TG+SKGFGFVTY  IE+A++AREGMN+KFLDGWVIFVDPAKP+E R 
Sbjct  61    GELVEAKVVVDRPTGKSKGFGFVTYANIEDAERAREGMNSKFLDGWVIFVDPAKPREPRQ  120

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             PPQ ES     G   NKT+GW G
Sbjct  121   PPQHESQPQQSGFTVNKTVGWCG  143



>ref|XP_004493893.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial-like 
[Cicer arietinum]
Length=139

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 106/143 (74%), Gaps = 4/143 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S F+ ++      + +  S   S+R  STLT+ KLFVSGLSR T+DE L +AF  F
Sbjct  1     MAFLSGFQRLIRH----TPLLNSHFTSIRLNSTLTSPKLFVSGLSRLTTDEKLTEAFSPF  56

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G+L EAKVI DRA+GRSKGF FV+Y T+EEA+KAREGMNAKFLDGWVIFVDPAKP+E RP
Sbjct  57    GQLTEAKVIIDRASGRSKGFAFVSYATVEEAEKAREGMNAKFLDGWVIFVDPAKPREPRP  116

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             PPQ +S+    G   NKT+GW G
Sbjct  117   PPQSQSEQPQTGFTVNKTVGWCG  139



>ref|XP_010260092.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
[Nelumbo nucifera]
Length=143

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF SAFR  L G   PSS+ Q + AS+R  STLTT KLF+SGLSR T+DE L +AF  F
Sbjct  1     MAFVSAFRRALSGSSTPSSLLQWRLASIRLNSTLTTPKLFISGLSRLTTDEKLKEAFSPF  60

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G L+EAKVI DR +GRSKGFGFVTY TIE+A+KAREGMNAKFLDGWVIFVDPAKP+E RP
Sbjct  61    GHLLEAKVIADRVSGRSKGFGFVTYATIEDAEKAREGMNAKFLDGWVIFVDPAKPREPRP  120

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             PPQPE + +  G R+NKT+GW G
Sbjct  121   PPQPEPEPSETGFRTNKTVGWCG  143



>ref|XP_010528328.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
[Tarenaya hassleriana]
Length=142

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 112/146 (77%), Gaps = 7/146 (5%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S+FR I  G   P+S+  SQ   +R CS LT+ KLFVSGLSR T+DE L +AF  F
Sbjct  1     MAFVSSFRRIFSG---PNSL-SSQSFWVRHCSFLTSPKLFVSGLSRATTDEKLQEAFSPF  56

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G LVEAKVITDRATGRS+G+GF+TY ++EEA+KA+EGMNAKFLDGWVIFVDPAKP+E RP
Sbjct  57    GNLVEAKVITDRATGRSRGYGFITYSSVEEAEKAKEGMNAKFLDGWVIFVDPAKPREPRP  116

Query  1093  PPQPESD---STTFGIRSNKTIGWSG  1161
              P+ + D   S+  G  +NKT+GW G
Sbjct  117   LPRQQQDDPSSSGHGFTTNKTVGWCG  142



>gb|KHG05603.1| Glycine-rich RNA-binding 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=144

 Score =   176 bits (445),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 106/144 (74%), Gaps = 5/144 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S       G   P S      AS+R  STLT+ KLF+SGLSR T+DE   +AF  F
Sbjct  1     MAFISRALRTFTGPFPPCSYL----ASIRLSSTLTSPKLFISGLSRETTDEQFQEAFYPF  56

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G++VEAKV+ DRATGRSKGFGFVTY +IEEA+KARE MNAKFL GWVIFVDPAKP+E+RP
Sbjct  57    GQIVEAKVVRDRATGRSKGFGFVTYTSIEEAEKAREEMNAKFLHGWVIFVDPAKPREYRP  116

Query  1093  PPQ-PESDSTTFGIRSNKTIGWSG  1161
             PPQ PES  +  G R+NKT+GW G
Sbjct  117   PPQRPESGPSESGFRTNKTVGWCG  140



>ref|XP_002274178.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
isoform X1 [Vitis vinifera]
 emb|CBI32608.3| unnamed protein product [Vitis vinifera]
Length=140

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 3/143 (2%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF+S+FR +L G    S+I QSQ +  RF ST+T+ KLFVSGLSR T+DE L +AF  F
Sbjct  1     MAFASSFRRVLTGS---STILQSQFSPARFNSTVTSPKLFVSGLSRLTTDEKLKEAFSPF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G+L+EAKVITDR +GRSKGFGFVTY T+EEA+KAREGMNAKFLDGWVIFVDPAKP+E RP
Sbjct  58    GQLLEAKVITDRVSGRSKGFGFVTYTTLEEAEKAREGMNAKFLDGWVIFVDPAKPREPRP  117

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             PPQ E +S+  G R+NKTIGW G
Sbjct  118   PPQQEPESSETGFRTNKTIGWCG  140



>ref|XP_006429060.1| hypothetical protein CICLE_v10013045mg [Citrus clementina]
 ref|XP_006480792.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial-like 
[Citrus sinensis]
 gb|ESR42300.1| hypothetical protein CICLE_v10013045mg [Citrus clementina]
Length=145

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 8/148 (5%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF+S+FR  L      SSI +SQ  S+R+ STLT+ +LFVSGLSR T+DE L +AF  F
Sbjct  1     MAFASSFRRALSSG---SSILKSQLGSIRYNSTLTSPRLFVSGLSRLTTDEKLKEAFAPF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFR-  1089
             G+LV +KVITDRATGRSKGFGFV+Y +IEEA++AREGMNAK+LDGWVIFVDPAK +E R 
Sbjct  58    GQLVYSKVITDRATGRSKGFGFVSYTSIEEAERAREGMNAKYLDGWVIFVDPAKSREARP  117

Query  1090  ----PPPQPESDSTTFGIRSNKTIGWSG  1161
                 PPP PE   +  G R+NKTIGWSG
Sbjct  118   PPPPPPPYPEQQPSEMGFRTNKTIGWSG  145



>gb|EYU28274.1| hypothetical protein MIMGU_mgv1a015528mg [Erythranthe guttata]
Length=154

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 109/158 (69%), Gaps = 19/158 (12%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTL---TTSKLFVSGLSRYTSDEGLNKAF  903
             MAF+SAFR IL G    S   +SQ AS RF STL   T+ KLF+SGLSR TSDE L  AF
Sbjct  1     MAFASAFRRILSGSSTQSPNIRSQLASFRFSSTLVTLTSPKLFISGLSRNTSDESLYNAF  60

Query  904   EQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE  1083
               FG+L+EAKVI DR +GRSK FGFVTYET+EEA+KAR+GMNAK+LDGWVIFVDPA+PKE
Sbjct  61    TPFGRLLEAKVIVDRGSGRSKNFGFVTYETVEEAEKARDGMNAKYLDGWVIFVDPARPKE  120

Query  1084  ------------FRPPPQPESDSTTFGIRSNKTIGWSG  1161
                          R P   E  S T    SNKTIGWSG
Sbjct  121   AYQPRPPPPRQDLRNPLSTEPASFT----SNKTIGWSG  154



>ref|XP_007206119.1| hypothetical protein PRUPE_ppa013084mg [Prunus persica]
 gb|EMJ07318.1| hypothetical protein PRUPE_ppa013084mg [Prunus persica]
Length=140

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 113/143 (79%), Gaps = 3/143 (2%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S+FR +LGG    SS  QSQ   +R  STLT+ KLF+SGLSR T+DE L +AF  F
Sbjct  1     MAFISSFRRVLGGS---SSALQSQFVCIRHNSTLTSPKLFISGLSRLTTDEKLQEAFSPF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G++++AKV+ DRA+GRSKGFGF+TY +IEEA++AR+GMNAKFLDGWVIFVDPAKP+E RP
Sbjct  58    GQIIDAKVVIDRASGRSKGFGFITYTSIEEAEQARQGMNAKFLDGWVIFVDPAKPREPRP  117

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             PPQ +   +  G R+NKTIGW G
Sbjct  118   PPQAQPSPSETGFRTNKTIGWCG  140



>ref|XP_004142081.1| PREDICTED: glycine-rich RNA-binding protein 2, mitochondrial-like 
[Cucumis sativus]
Length=146

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 117/146 (80%), Gaps = 3/146 (2%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSS---IFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAF  903
             MAF S  R +L G    SS   I +SQ  ++R  STLT+ KLF+SGLSR T+DE L +AF
Sbjct  1     MAFFSTVRRVLNGSSSSSSSSSILRSQWNAVRLSSTLTSPKLFISGLSRLTTDEKLREAF  60

Query  904   EQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE  1083
               FG+LV+AKV+TDRATGRSKGF FVTY TI+EA+KARE MNAKFLDGWVIFVDPAKP+E
Sbjct  61    SSFGQLVDAKVVTDRATGRSKGFAFVTYSTIDEAEKAREEMNAKFLDGWVIFVDPAKPRE  120

Query  1084  FRPPPQPESDSTTFGIRSNKTIGWSG  1161
              RPPPQP+S+++ FGIR+NKTIGW G
Sbjct  121   PRPPPQPQSETSEFGIRTNKTIGWCG  146



>gb|KDO47190.1| hypothetical protein CISIN_1g032319mg [Citrus sinensis]
Length=143

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 114/146 (78%), Gaps = 6/146 (4%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF+S+FR  L      SSI +SQ  S+R+ STLT+ +LFVSGLSR T+DE L +AF  F
Sbjct  1     MAFASSFRRALSSG---SSILKSQLGSIRYNSTLTSPRLFVSGLSRLTTDEKLKEAFAPF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFR-  1089
             G+LV +KVITDRATGRSKGFGFV+Y +IEEA++AREGMNAK+LDGWVIFVDPAK +E R 
Sbjct  58    GQLVYSKVITDRATGRSKGFGFVSYTSIEEAERAREGMNAKYLDGWVIFVDPAKSREARP  117

Query  1090  --PPPQPESDSTTFGIRSNKTIGWSG  1161
               PPP PE   +  G R+NKT+GWSG
Sbjct  118   PPPPPYPEQQPSEMGFRTNKTVGWSG  143



>gb|KHG01446.1| Glycine-rich RNA-binding 2, mitochondrial -like protein [Gossypium 
arboreum]
 gb|KHG19675.1| Glycine-rich RNA-binding 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=139

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 109/143 (76%), Gaps = 4/143 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MA +S  R +     +PS++  SQ AS+R  STLT+ KLF+SGLSR T+D    +AF  F
Sbjct  1     MALASRLRRVF---TVPSTL-SSQFASIRLNSTLTSPKLFISGLSRETTDGQFKEAFNPF  56

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G++V+AK++ DRATGRSKGFGFVTY +IEEA+KARE MNAKFL GWVIFVDPAKP+EF+P
Sbjct  57    GQIVDAKIVRDRATGRSKGFGFVTYTSIEEAEKAREEMNAKFLHGWVIFVDPAKPREFKP  116

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
              P+ ES  +  G R++KT+GW G
Sbjct  117   TPKSESGPSETGFRTSKTVGWCG  139



>ref|XP_008447620.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Cucumis melo]
Length=145

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 117/145 (81%), Gaps = 2/145 (1%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSS--IFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFE  906
             MAF S  R +L G    SS  I +SQ  ++R  STLT+ KLF+SGLSR T+DE L +AF 
Sbjct  1     MAFFSTVRRVLSGSSPSSSSSILRSQWNAVRLSSTLTSPKLFISGLSRLTTDEKLREAFS  60

Query  907   QFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEF  1086
              FG+LV+AKV+TDRATGRSKGF FVTY TIEEA++AR+ MNAKFLDGWVIFVDPAKP+E 
Sbjct  61    SFGQLVDAKVVTDRATGRSKGFAFVTYSTIEEAERARQEMNAKFLDGWVIFVDPAKPREP  120

Query  1087  RPPPQPESDSTTFGIRSNKTIGWSG  1161
             RPPPQP+S+++ FGIR+NKTIGW G
Sbjct  121   RPPPQPQSETSEFGIRTNKTIGWCG  145



>ref|XP_003521342.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
[Glycine max]
Length=139

 Score =   167 bits (424),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = +1

Query  775   LMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRAT  954
             L  + +  S  AS+R  STLT+ KLFVSGLSR T DE L +AF  FG+LVEAKVITDRA+
Sbjct  11    LRHTPLVHSHYASIRLSSTLTSPKLFVSGLSRLTKDENLKEAFSSFGQLVEAKVITDRAS  70

Query  955   GRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIR  1134
             GRSKGF FVTY TIEEA++AREGMNAKFLDGWVIFVDPAKP+E RPP Q +S  +  G  
Sbjct  71    GRSKGFAFVTYTTIEEAERAREGMNAKFLDGWVIFVDPAKPREPRPPQQSQSQPSEIGFT  130

Query  1135  SNKTIGWSG  1161
              NKT+GW G
Sbjct  131   VNKTVGWCG  139



>gb|KHN09429.1| Glycine-rich RNA-binding protein 2, mitochondrial [Glycine soja]
Length=139

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = +1

Query  775   LMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRAT  954
             L  + +  S  AS+R  STLT+ KLFVSGLSR T DE L  AF  FG+LVEAKVITDRA+
Sbjct  11    LRHTPLVHSHYASIRLSSTLTSPKLFVSGLSRLTKDENLKDAFSSFGQLVEAKVITDRAS  70

Query  955   GRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIR  1134
             GRSKGF FVTY TIEEA++AREGMNAKFLDGWVIFVDPAKP+E RPP Q +S  +  G  
Sbjct  71    GRSKGFAFVTYTTIEEAERAREGMNAKFLDGWVIFVDPAKPREPRPPQQSQSQPSEIGFT  130

Query  1135  SNKTIGWSG  1161
              NKT+GW G
Sbjct  131   VNKTVGWCG  139



>ref|XP_010517020.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Camelina sativa]
Length=143

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 108/144 (75%), Gaps = 6/144 (4%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAFSS+FR +  G         S C  +R CSTLT+ KLFVSGLSR T++E L +AF  F
Sbjct  1     MAFSSSFRRLFAGSNNSLLSSSSSC--VRHCSTLTSPKLFVSGLSRLTTNEKLQEAFASF  58

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G+LV+A+VITDR TGRSKGFGFVTY TIE+A+KA++ MNAKFLDGWVIFVDPAKP+E R 
Sbjct  59    GELVDARVITDRETGRSKGFGFVTYATIEDAEKAKKEMNAKFLDGWVIFVDPAKPREPRR  118

Query  1093  PPQ---PESDSTTFGIRSNKTIGW  1155
             P Q   P+S S + G  +NKTIGW
Sbjct  119   PLQQEPPQSYSGS-GFTTNKTIGW  141



>ref|XP_010509328.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Camelina sativa]
Length=143

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 108/144 (75%), Gaps = 6/144 (4%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAFSS+FR ++ G         S C  +R+CSTLT+ KLFVSGLSR T++E L  AF  F
Sbjct  1     MAFSSSFRRLIAGSNNSLLSSPSSC--VRYCSTLTSPKLFVSGLSRLTTNEKLQDAFASF  58

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G+LV+A+VITDR TGRSKGFGFVTY TIE+A+KA++ MNAKFLDGWVIFVDPAKP+E R 
Sbjct  59    GELVDARVITDRETGRSKGFGFVTYATIEDAEKAKKEMNAKFLDGWVIFVDPAKPREPRR  118

Query  1093  PPQ---PESDSTTFGIRSNKTIGW  1155
             P Q   P+S S + G  +NKT GW
Sbjct  119   PLQQEPPQSYSGS-GFTTNKTFGW  141



>ref|XP_010653445.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
isoform X3 [Vitis vinifera]
Length=137

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 112/138 (81%), Gaps = 3/138 (2%)
 Frame = +1

Query  748   AFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVE  927
             +FR +L G    S+I QSQ +  RF ST+T+ KLFVSGLSR T+DE L +AF  FG+L+E
Sbjct  3     SFRRVLTGS---STILQSQFSPARFNSTVTSPKLFVSGLSRLTTDEKLKEAFSPFGQLLE  59

Query  928   AKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPE  1107
             AKVITDR +GRSKGFGFVTY T+EEA+KAREGMNAKFLDGWVIFVDPAKP+E RPPPQ E
Sbjct  60    AKVITDRVSGRSKGFGFVTYTTLEEAEKAREGMNAKFLDGWVIFVDPAKPREPRPPPQQE  119

Query  1108  SDSTTFGIRSNKTIGWSG  1161
              +S+  G R+NKTIGW G
Sbjct  120   PESSETGFRTNKTIGWCG  137



>ref|XP_010653444.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
isoform X2 [Vitis vinifera]
Length=139

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +1

Query  751   FRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEA  930
             FR +L G    S+I QSQ +  RF ST+T+ KLFVSGLSR T+DE L +AF  FG+L+EA
Sbjct  6     FRRVLTGS---STILQSQFSPARFNSTVTSPKLFVSGLSRLTTDEKLKEAFSPFGQLLEA  62

Query  931   KVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPES  1110
             KVITDR +GRSKGFGFVTY T+EEA+KAREGMNAKFLDGWVIFVDPAKP+E RPPPQ E 
Sbjct  63    KVITDRVSGRSKGFGFVTYTTLEEAEKAREGMNAKFLDGWVIFVDPAKPREPRPPPQQEP  122

Query  1111  DSTTFGIRSNKTIGWSG  1161
             +S+  G R+NKTIGW G
Sbjct  123   ESSETGFRTNKTIGWCG  139



>gb|AFK47684.1| unknown [Lotus japonicus]
Length=138

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 97/119 (82%), Gaps = 2/119 (2%)
 Frame = +1

Query  811   SLRFCST-LTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTY  987
             S+R CST LTT KLF+SGLSR T+D  LN+AF  FG+L+EAKVITDRA+GRSKGFGFV+Y
Sbjct  20    SVRLCSTTLTTPKLFISGLSRQTTDRKLNEAFAPFGQLIEAKVITDRASGRSKGFGFVSY  79

Query  988   ETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDS-TTFGIRSNKTIGWSG  1161
              +IEEA+KA +GMNAKFLDGWVIFVDPAKP+E RPP Q ES   +  G   NKT+GW G
Sbjct  80    ASIEEAEKAGKGMNAKFLDGWVIFVDPAKPREPRPPMQSESQQPSETGFTVNKTVGWCG  138



>gb|KHN02419.1| Glycine-rich RNA-binding protein 2, mitochondrial [Glycine soja]
Length=139

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 105/143 (73%), Gaps = 4/143 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S  + +L      + +  S  AS+R  STLT+ KLFVSGL R T+DE L +AF  F
Sbjct  1     MAFMSGVQRLL----RRTPLVHSHYASIRLSSTLTSPKLFVSGLCRLTTDEKLKEAFSSF  56

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G+LVEAKVI DRA+GRSKGF FVTY TIEEA+KAREGMNAKFLDGWVIFVDPAKP+E RP
Sbjct  57    GQLVEAKVIIDRASGRSKGFAFVTYTTIEEAEKAREGMNAKFLDGWVIFVDPAKPREPRP  116

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             P Q +S  +  G   NKT+GW G
Sbjct  117   PQQSQSQPSETGFTVNKTVGWCG  139



>ref|NP_001237071.1| uncharacterized protein LOC100306326 [Glycine max]
 gb|ACU14449.1| unknown [Glycine max]
Length=139

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 104/143 (73%), Gaps = 4/143 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S  + +L      + +  S  AS+R  STLT+ KLFVSGL R T DE L +AF  F
Sbjct  1     MAFMSGVQRLL----RRTPLVHSHYASIRLSSTLTSPKLFVSGLCRLTIDEKLKEAFSSF  56

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G+LVEAKVI DRA+GRSKGF FVTY TIEEA+KAREGMNAKFLDGWVIFVDPAKP+E RP
Sbjct  57    GQLVEAKVIIDRASGRSKGFAFVTYTTIEEAEKAREGMNAKFLDGWVIFVDPAKPREPRP  116

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             P Q +S  +  G   NKT+GW G
Sbjct  117   PQQSQSQPSETGFTVNKTVGWCG  139



>ref|XP_009377087.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial-like 
[Pyrus x bretschneideri]
Length=142

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 110/145 (76%), Gaps = 5/145 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF SAFR +LGG    SS   SQ A++R  STLT+ +LF+SGLSR T+DE L +AF  F
Sbjct  1     MAFISAFRRVLGG---SSSALHSQFAAIRHNSTLTSPRLFISGLSRLTTDEKLREAFSPF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAK--PKEF  1086
             G++V+AKV+ DR + RSKGFGF+TY ++EEA+KAREGMNAKFLDGWVIFVDPAK     F
Sbjct  58    GQIVDAKVVIDRVSQRSKGFGFITYASVEEAEKAREGMNAKFLDGWVIFVDPAKPREPRF  117

Query  1087  RPPPQPESDSTTFGIRSNKTIGWSG  1161
              PPPQ + D +  G RSNKTIGW G
Sbjct  118   PPPPQAQQDPSETGFRSNKTIGWCG  142



>ref|XP_010505339.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Camelina sativa]
Length=143

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 107/144 (74%), Gaps = 6/144 (4%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAFSS+FR +  G         S  + +R CSTLT+ KLFVSGLSR T++E L  AF  F
Sbjct  1     MAFSSSFRRLFAGSSNSLL--SSPSSYVRHCSTLTSPKLFVSGLSRLTTNEKLQDAFASF  58

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G+LV+A+VITDR TGRSKGFGFVTY TIE+A+KA++ MNAKFLDGWVIFVDPAKP+E R 
Sbjct  59    GELVDARVITDRETGRSKGFGFVTYATIEDAEKAKKEMNAKFLDGWVIFVDPAKPREPRR  118

Query  1093  PPQ---PESDSTTFGIRSNKTIGW  1155
             P Q   P+S S + G  +NKTIGW
Sbjct  119   PLQQEPPQSYSGS-GFTTNKTIGW  141



>ref|XP_008369855.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
[Malus domestica]
Length=142

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 109/145 (75%), Gaps = 5/145 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF SAFR I GG    SS   SQ A++R  STLT+ +LF+SGLSR T+DE L +AF  F
Sbjct  1     MAFISAFRRIHGG---SSSALHSQFAAIRHNSTLTSPRLFISGLSRLTTDEKLREAFSPF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAK--PKEF  1086
             G++V+AKV+ DR + RSKGFGF+TY ++EEA+KAREGMNAKFLDGWVIFVDPAK     F
Sbjct  58    GQIVDAKVVIDRVSQRSKGFGFITYASVEEAEKAREGMNAKFLDGWVIFVDPAKPREPRF  117

Query  1087  RPPPQPESDSTTFGIRSNKTIGWSG  1161
              PPPQ + D +  G RSNKTIGW G
Sbjct  118   PPPPQAQQDPSETGFRSNKTIGWCG  142



>ref|XP_003625508.1| RNA binding protein [Medicago truncatula]
 gb|AES81726.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=141

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF   F  +L     P  +  S   S+R  STLT+ KLF+SGLSR T+DE L +AF  F
Sbjct  1     MAFFFGFHRLLRHSQSP--LVSSHFTSIRLNSTLTSPKLFISGLSRLTTDEKLTEAFSPF  58

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G+L+EAKVITDR +GRSKGF FV+Y TIEEA+KAREGMNAKFLDGWVIFVDPAKP+E RP
Sbjct  59    GQLLEAKVITDRGSGRSKGFAFVSYSTIEEAEKAREGMNAKFLDGWVIFVDPAKPREPRP  118

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             P Q +S  +  G   NKT+GW G
Sbjct  119   PQQSQSQPSQTGFTVNKTVGWCG  141



>ref|XP_003558218.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Brachypodium distachyon]
Length=168

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +1

Query  832   LTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQK  1011
             LTT KLFVSGLSR T+DE L  AF  FG+++EAKVITDR +GRSKGFGFV Y +++EA+ 
Sbjct  59    LTTPKLFVSGLSRLTTDEKLKNAFIPFGQVLEAKVITDRISGRSKGFGFVRYVSLQEAEA  118

Query  1012  AREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             AR+GMNAKFLDGWVIFVDPAKP+E +P PQP+S S+  G  +NKT+GW G
Sbjct  119   ARQGMNAKFLDGWVIFVDPAKPREQKPAPQPDSASSHTGFTTNKTVGWCG  168



>ref|XP_006649860.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Oryza brachyantha]
Length=163

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  832   LTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQK  1011
             LTT KLF+SGLSR T+DE L  AF  FG+L+E+KVITDR +GRSKGFGFV Y T+EEA+ 
Sbjct  54    LTTPKLFISGLSRLTTDEKLKNAFAPFGQLLESKVITDRISGRSKGFGFVRYATLEEAEN  113

Query  1012  AREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             AR+ MNAKFLDGWVIFVDPAKP+E +P PQP++ S+  G  ++KT+GW G
Sbjct  114   ARQEMNAKFLDGWVIFVDPAKPREHKPAPQPDTHSSHTGFTTHKTVGWCG  163



>gb|EAY89474.1| hypothetical protein OsI_11005 [Oryza sativa Indica Group]
Length=173

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  832   LTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQK  1011
             LT  KLF+SGLSR T+DE L  AF  FG+L+EAKVITDR +GRSKGFGFV Y T+EEA+ 
Sbjct  64    LTAPKLFISGLSRLTTDEKLKNAFAPFGQLLEAKVITDRISGRSKGFGFVRYATLEEAEN  123

Query  1012  AREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             AR+ MNAKFLDGWVIFVDPAKP++ +P P+P++DS+  G  +NKT+GW G
Sbjct  124   ARQEMNAKFLDGWVIFVDPAKPRQQKPAPRPDTDSSHTGFTTNKTVGWCG  173



>ref|NP_001049729.1| Os03g0278800 [Oryza sativa Japonica Group]
 gb|ABF95288.1| RNA-binding protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11643.1| Os03g0278800 [Oryza sativa Japonica Group]
 gb|EAY89472.1| hypothetical protein OsI_11004 [Oryza sativa Indica Group]
 gb|EAZ26461.1| hypothetical protein OsJ_10350 [Oryza sativa Japonica Group]
Length=173

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = +1

Query  784   SSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRS  963
             SS+F    A +     LT  KLF+SGLSR T+DE L  AF  FG+L+EAKVITDR +GRS
Sbjct  49    SSVF-GDGAEVSNVPPLTAPKLFISGLSRLTTDEKLKNAFAPFGQLLEAKVITDRISGRS  107

Query  964   KGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNK  1143
             KGFGFV Y T+EEA+ AR+ MNAKFLDGWVIFVDPAKP++ +P P+P++DS+  G  +NK
Sbjct  108   KGFGFVRYATLEEAENARQEMNAKFLDGWVIFVDPAKPRQQKPAPRPDTDSSHTGFTTNK  167

Query  1144  TIGWSG  1161
             T+GW G
Sbjct  168   TVGWCG  173



>ref|NP_001150360.1| RNA binding protein [Zea mays]
 gb|ACG38787.1| RNA binding protein [Zea mays]
 tpg|DAA44702.1| TPA: RNA binding protein [Zea mays]
Length=166

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 96/131 (73%), Gaps = 1/131 (1%)
 Frame = +1

Query  769   GHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDR  948
             G   PSSIF      +     LTT  LFVSGLSR T+DE L  AF  FG+L+EAKV+TDR
Sbjct  37    GSSSPSSIF-GDATEVANVPPLTTPNLFVSGLSRLTTDEKLQGAFAPFGRLLEAKVVTDR  95

Query  949   ATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFG  1128
              +GRSKGFGFV Y TIEEA++AR+ MNAKFLDGWVIFVDPAKP++ +P PQ ++ S+  G
Sbjct  96    VSGRSKGFGFVRYATIEEAERARQEMNAKFLDGWVIFVDPAKPRQPKPAPQQDTGSSHAG  155

Query  1129  IRSNKTIGWSG  1161
               +NKT+GW G
Sbjct  156   FTTNKTVGWCG  166



>ref|XP_002465463.1| hypothetical protein SORBIDRAFT_01g039290 [Sorghum bicolor]
 gb|EER92461.1| hypothetical protein SORBIDRAFT_01g039290 [Sorghum bicolor]
Length=169

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  832   LTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQK  1011
             LTT KLFVSGLSR T+DE L  AF  FG+++EAKV+TDR +GRSKGFGFV Y TIEEA+K
Sbjct  60    LTTPKLFVSGLSRLTTDEKLQGAFAPFGRILEAKVVTDRVSGRSKGFGFVRYATIEEAEK  119

Query  1012  AREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             AR+ MNAKFLDGWVIFVDPAKP++ +P P+ ++ S+  G  +NKT+GW G
Sbjct  120   ARQEMNAKFLDGWVIFVDPAKPRQPKPAPEQDTSSSHVGFTTNKTVGWCG  169



>gb|EMT04579.1| Glycine-rich RNA-binding protein 2, mitochondrial [Aegilops tauschii]
Length=172

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  832   LTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQK  1011
             LTT KLFVSGLSR T+DE L  AF  FG+L+EAKVITDR +GRSKGFGFV Y ++EEA+ 
Sbjct  63    LTTPKLFVSGLSRLTTDEKLKSAFAPFGQLLEAKVITDRVSGRSKGFGFVRYASLEEAET  122

Query  1012  AREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             AR+ MNAKFLDGWVIFVDPAK +E +P PQP++ S+  G   NKT+GW G
Sbjct  123   ARQEMNAKFLDGWVIFVDPAKQREQKPAPQPDTASSHAGFTINKTVGWCG  172



>ref|XP_009404612.1| PREDICTED: 30 kDa ribonucleoprotein, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=176

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +1

Query  832   LTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQK  1011
             LTT KLFVSGLSR T+D+ L +AF  +G+L+EAKVI DR +GRSKGFGFV Y TIEEA K
Sbjct  67    LTTPKLFVSGLSRLTTDDKLKEAFSPYGQLLEAKVIADRISGRSKGFGFVRYATIEEADK  126

Query  1012  AREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             AR GMNAKFLDGWVIFVDPAKP+E RP    E +    G+R NKT+GW G
Sbjct  127   ARHGMNAKFLDGWVIFVDPAKPREPRPQKPAEPEPFEAGLRINKTVGWCG  176



>ref|XP_010088058.1| Glycine-rich RNA-binding protein 2 [Morus notabilis]
 gb|EXB31277.1| Glycine-rich RNA-binding protein 2 [Morus notabilis]
Length=111

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = +1

Query  856   SGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAK  1035
             +GLSR T+DE L +AF  FG++V+AKV+TDR +GRSKGFGF+TY +IEEA+KAREGMNAK
Sbjct  11    TGLSRLTTDEKLTEAFSSFGQIVDAKVVTDRVSGRSKGFGFITYRSIEEAEKAREGMNAK  70

Query  1036  FLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             FLDGWVIFVDPAKP+E RPPPQ +S  +  G  SNKTIGW G
Sbjct  71    FLDGWVIFVDPAKPRE-RPPPQSQSGPSETGFTSNKTIGWCG  111



>gb|KFK36640.1| hypothetical protein AALP_AA4G151100 [Arabis alpina]
Length=144

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 111/146 (76%), Gaps = 9/146 (6%)
 Frame = +1

Query  733   MAF-SSAFRGILGGHLMPSSIFQSQCASL--RFCSTLTTSKLFVSGLSRYTSDEGLNKAF  903
             MAF SS FR IL G    S+ F S  +SL  R CSTLT+ KLFVSGLSR T++E L  AF
Sbjct  1     MAFVSSTFRRILAG----SNCFSSSPSSLWVRHCSTLTSPKLFVSGLSRLTTNEKLQDAF  56

Query  904   EQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE  1083
               FG+LV+A+VITDR TGRSKGFGFVTY T+E+A+KA+EGMNAKFLDGWVIFVDPA+P+E
Sbjct  57    ASFGELVDARVITDRETGRSKGFGFVTYATLEDAEKAKEGMNAKFLDGWVIFVDPARPRE  116

Query  1084  FRPPPQ--PESDSTTFGIRSNKTIGW  1155
              R P Q  P+S S+  G   NKTIGW
Sbjct  117   PRRPMQQEPQSSSSGSGFTINKTIGW  142



>ref|XP_004984756.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial-like 
[Setaria italica]
Length=172

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +1

Query  832   LTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQK  1011
             LTT KLFVSGLSR T+DE L  AF  FG+L++AKV+TD+ +GRSKGFGFV Y TIEEA+K
Sbjct  64    LTTPKLFVSGLSRLTTDEKLQGAFAPFGRLLDAKVVTDKVSGRSKGFGFVRYATIEEAEK  123

Query  1012  AREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             AR+ MNAKFLDGWVIFVDPAKP++ +P PQ ++ S   G  +NKT+GW G
Sbjct  124   ARQEMNAKFLDGWVIFVDPAKPRQPKPAPQQDTRSHA-GFTTNKTVGWCG  172



>ref|XP_006846093.1| hypothetical protein AMTR_s00012p00103290 [Amborella trichopoda]
 gb|ERN07768.1| hypothetical protein AMTR_s00012p00103290 [Amborella trichopoda]
Length=136

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +1

Query  793   FQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGF  972
               S    +R  STL+T+KLFVSGLSR T+ E L++AF  FG+LVEA V+TDRA+GRSKGF
Sbjct  14    LSSHLTQIRANSTLSTTKLFVSGLSRLTTSEKLSEAFSPFGRLVEATVVTDRASGRSKGF  73

Query  973   GFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIG  1152
             GFV Y T +EA KAREGMNAKFLDGWVIFVDPA+ +E +PPPQ E + +  G R+NKTIG
Sbjct  74    GFVRYATEDEANKAREGMNAKFLDGWVIFVDPARLREPKPPPQQEPEQSDVGFRTNKTIG  133

Query  1153  WSG  1161
             W G
Sbjct  134   WCG  136



>ref|XP_002881512.1| hypothetical protein ARALYDRAFT_902894 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57771.1| hypothetical protein ARALYDRAFT_902894 [Arabidopsis lyrata subsp. 
lyrata]
Length=142

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 106/146 (73%), Gaps = 11/146 (8%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S+FR ++ G    +S+  S    +R CSTLT+ +LFVSGLSR T++E L  AF  F
Sbjct  1     MAFVSSFRRLVAGS---NSLLSSPSFCVRRCSTLTSPRLFVSGLSRLTTNEKLQDAFASF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEF--  1086
             G+LV+A+VITDR TGRSKGFGFVTY TIE+A+KA+  MNAKFLDGWVIFVDPA+P+E   
Sbjct  58    GQLVDARVITDRETGRSKGFGFVTYATIEDAEKAKAEMNAKFLDGWVIFVDPARPREPRR  117

Query  1087  ---RPPPQPESDSTTFGIRSNKTIGW  1155
                R PP+  S S   G  +NKTIGW
Sbjct  118   PLQREPPRSSSGS---GFTTNKTIGW  140



>ref|XP_009766534.1| PREDICTED: glycine-rich RNA-binding protein [Nicotiana sylvestris]
Length=108

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 84/103 (82%), Gaps = 1/103 (1%)
 Frame = +1

Query  856   SGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAK  1035
             +GLSRYTSDE L KAFEQFGKLVEAKVITDRATGRSKGFGFV+YETIE+A+KAREGMNAK
Sbjct  5     AGLSRYTSDENLKKAFEQFGKLVEAKVITDRATGRSKGFGFVSYETIEDAEKAREGMNAK  64

Query  1036  FLDGWVIFVD-PAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             FLDGWVIFVD         PP  P  D   FGI +NKT+GW+G
Sbjct  65    FLDGWVIFVDPARPSMPRPPPSPPPQDPLNFGITTNKTVGWTG  107



>ref|XP_002531336.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF31043.1| RNA binding protein, putative [Ricinus communis]
Length=144

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 103/145 (71%), Gaps = 3/145 (2%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAFSS  R  L G         +   + RF STLT  +LFVSGLSR T+DE L +AF  F
Sbjct  1     MAFSSIIRRGLFGSSSSLPASPALFLT-RFHSTLTCPRLFVSGLSRLTTDEKLKEAFSPF  59

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRP  1092
             G+LV+AKVI DRA+GRSKGFGF+TY TIEEA+KAREGMNAKFLDGWVIFVDPAKP+E R 
Sbjct  60    GQLVDAKVIIDRASGRSKGFGFITYATIEEAEKAREGMNAKFLDGWVIFVDPAKPREQRL  119

Query  1093  PPQPESDSTT--FGIRSNKTIGWSG  1161
             PP P     T   G + N+TIGW G
Sbjct  120   PPPPPPQPETSETGYKINRTIGWCG  144



>ref|XP_006295200.1| hypothetical protein CARUB_v10024280mg [Capsella rubella]
 gb|EOA28098.1| hypothetical protein CARUB_v10024280mg [Capsella rubella]
Length=141

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 103/145 (71%), Gaps = 10/145 (7%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAFSS+FR +  G    +S+  S  + +R CSTLT+ +LFVSGLSR T++E L  AF  F
Sbjct  1     MAFSSSFRRLFAG---ANSLSSSPSSCVRHCSTLTSPRLFVSGLSRLTTNEKLQDAFASF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVD----PAKPK  1080
             G+LV+A+VITDR TGRSKGFGFVTY TIE+A+KA++GMNAKFLDGWVIFVD        +
Sbjct  58    GELVDARVITDRETGRSKGFGFVTYATIEDAEKAKKGMNAKFLDGWVIFVDPARPREPRR  117

Query  1081  EFRPPPQPESDSTTFGIRSNKTIGW  1155
               +  PQ  S S   G  +NKTIGW
Sbjct  118   PQQETPQSYSGS---GYTTNKTIGW  139



>emb|CDX74955.1| BnaA05g07010D [Brassica napus]
Length=145

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 100/145 (69%), Gaps = 6/145 (4%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S FR IL G     S   S  + +  CSTL++ KLFVSGLSR T++E L  AF  F
Sbjct  1     MAFVSTFRRILAGSNNSLS--SSSFSLVHHCSTLSSPKLFVSGLSRLTTNEKLQDAFAPF  58

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVD----PAKPK  1080
             G+LV+A+VITDR TGRSKGFGFVTY TI++A+KA+EGMNAKFLDGWVIFVD        +
Sbjct  59    GELVDARVITDRETGRSKGFGFVTYATIQDAEKAKEGMNAKFLDGWVIFVDPARPREPRR  118

Query  1081  EFRPPPQPESDSTTFGIRSNKTIGW  1155
                   QP+S S+  G  +NKTIGW
Sbjct  119   PLHQDHQPQSSSSGSGFTTNKTIGW  143



>emb|CDP06644.1| unnamed protein product [Coffea canephora]
Length=149

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 99/149 (66%), Gaps = 6/149 (4%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSS----IFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKA  900
             MA +S FR IL      +S    I     AS R  STLT+ KLF+SGLSR T+DE LN A
Sbjct  1     MAIASGFRRILSLASSTNSSSSSIRPCLLASTRLHSTLTSPKLFISGLSRTTNDEALNNA  60

Query  901   FEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVD--PAK  1074
             F QFGK VE KVITDRATGRSKGFGFVTYETIEEA+KAR+ M+ KFLDGWVIFVD    +
Sbjct  61    FSQFGKPVEVKVITDRATGRSKGFGFVTYETIEEAEKARQEMSGKFLDGWVIFVDPAKPR  120

Query  1075  PKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
                  PP Q +   +  G   N+TIGW G
Sbjct  121   EPRPPPPAQSQGQPSQPGYTVNRTIGWCG  149



>ref|XP_009143489.1| PREDICTED: glycine-rich RNA-binding protein 2 [Brassica rapa]
Length=144

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 104/144 (72%), Gaps = 5/144 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S FR IL G     S      A  R CSTL++ KLFVSGLSR T++E L  AF  F
Sbjct  1     MAFVSTFRRILAGSNNSLSSSSFSWA--RHCSTLSSPKLFVSGLSRLTTNEKLQDAFAPF  58

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFR-  1089
             G+LV+A+VITDR TGRSKGFGFVTY TI++A+KA+EGMNAKFLDGWVIFVDPA+P+E R 
Sbjct  59    GELVDARVITDRETGRSKGFGFVTYATIQDAEKAKEGMNAKFLDGWVIFVDPARPREPRR  118

Query  1090  --PPPQPESDSTTFGIRSNKTIGW  1155
                   P+S S+  G  +NKTIGW
Sbjct  119   PLHQDHPQSSSSGSGFTTNKTIGW  142



>gb|KGN54229.1| hypothetical protein Csa_4G293880 [Cucumis sativus]
Length=118

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  856   SGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAK  1035
             +GLSR T+DE L +AF  FG+LV+AKV+TDRATGRSKGF FVTY TI+EA+KARE MNAK
Sbjct  17    TGLSRLTTDEKLREAFSSFGQLVDAKVVTDRATGRSKGFAFVTYSTIDEAEKAREEMNAK  76

Query  1036  FLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             FLDGWVIFVDPAKP+E RPPPQP+S+++ FGIR+NKTIGW G
Sbjct  77    FLDGWVIFVDPAKPREPRPPPQPQSETSEFGIRTNKTIGWCG  118



>ref|XP_010920671.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
[Elaeis guineensis]
Length=160

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  832   LTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQK  1011
             LTT KLFVSGLSR T+DE L +AF  +G+L+EAKVITDR +GRSKGF FV Y TIEEA K
Sbjct  51    LTTPKLFVSGLSRLTTDEKLREAFSPYGQLLEAKVITDRVSGRSKGFAFVRYATIEEADK  110

Query  1012  AREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             AR GMNAKFLDGWVIFVDPAKP+E +PP     + +  GIR+NKTIGW G
Sbjct  111   ARHGMNAKFLDGWVIFVDPAKPREPKPPRPAAPEPSETGIRTNKTIGWCG  160



>emb|CDX91368.1| BnaC04g07820D [Brassica napus]
Length=145

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S FR IL G    S    S  + +R CS L++ KLFVSGLSR T++E L  AF  F
Sbjct  1     MAFVSTFRRILAGSNNNSLS-SSSFSWVRHCSALSSPKLFVSGLSRLTTNEKLQDAFAPF  59

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFR-  1089
             G+LV+A+VITDR TGRSKGFGFVTY T+++A+KA+EGMNAKFLDGWVIFVDPA+P+E R 
Sbjct  60    GELVDARVITDRETGRSKGFGFVTYATVQDAEKAKEGMNAKFLDGWVIFVDPARPREPRR  119

Query  1090  --PPPQPESDSTTFGIRSNKTIGW  1155
                  QP+S S+  G  +NKTIGW
Sbjct  120   PLHQDQPQSSSSGSGFTTNKTIGW  143



>ref|NP_181287.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AAM15089.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AAM61313.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|ABI49488.1| At2g37510 [Arabidopsis thaliana]
 gb|AEC09410.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=142

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 105/146 (72%), Gaps = 11/146 (8%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S+FR ++ G     S   S    +R CSTLT+ +LFVSGLSR T++E L  AF  F
Sbjct  1     MAFVSSFRRLVAGSSSLLS---SPSLCVRRCSTLTSPRLFVSGLSRLTTNEKLQDAFASF  57

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEF--  1086
             G+LV+A+VITDR +GRSKGFGFVTY TIE+A+KA+  MNAKFLDGWVIFVDPA+P+E   
Sbjct  58    GQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKAEMNAKFLDGWVIFVDPARPREPRR  117

Query  1087  ---RPPPQPESDSTTFGIRSNKTIGW  1155
                + P +P S+S   G  +NKTIGW
Sbjct  118   PLQQEPLRPSSES---GFTTNKTIGW  140



>ref|XP_004165283.1| PREDICTED: glycine-rich RNA-binding protein 2-like, partial [Cucumis 
sativus]
Length=100

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +1

Query  862   LSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFL  1041
             LSR T+DE L +AF  FG+L +AKV+TDRATGRSKGF FVTY TI+EA+KARE MNAKFL
Sbjct  1     LSRLTTDEKLREAFSSFGQLADAKVVTDRATGRSKGFAFVTYSTIDEAEKAREEMNAKFL  60

Query  1042  DGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             DGWVIFVDPAKP+E RPPPQP+S+++ FGIR+NKTIGW G
Sbjct  61    DGWVIFVDPAKPREPRPPPQPQSETSEFGIRTNKTIGWCG  100



>ref|XP_008794999.1| PREDICTED: LOW QUALITY PROTEIN: glycine-rich RNA-binding protein 
6, mitochondrial [Phoenix dactylifera]
Length=159

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  832   LTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQK  1011
             LTT KLFVSGLSR T+DE L +AF  +G+L+EAKV+TDR +GRSKGFGFV + TIEEA K
Sbjct  50    LTTPKLFVSGLSRLTTDEKLREAFSAYGQLLEAKVVTDRVSGRSKGFGFVRFATIEEADK  109

Query  1012  AREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
             AR GMNAKFLDGWV FVDPAKP+E +PP  PE + +  GIR+NKTIGW G
Sbjct  110   ARHGMNAKFLDGWVXFVDPAKPREPKPPRPPEPEPSETGIRTNKTIGWCG  159



>gb|ACN41115.1| unknown [Picea sitchensis]
Length=149

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 97/154 (63%), Gaps = 16/154 (10%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLT-----------TSKLFVSGLSRYTS  879
             MA  S  R +LGG    +S  +   A   FC+  +           T+KLF+SGLSR T+
Sbjct  1     MALLSGIRRVLGG----TSTGRLLLAKDPFCAVRSSPIGLGAVRDFTTKLFISGLSRQTT  56

Query  880   DEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIF  1059
             DEGL   F +FG+LVEA+V+TDR +GRS+GFGFV Y T+E+A K +EGM+ KFLDGWVIF
Sbjct  57    DEGLRAKFSEFGQLVEARVVTDRISGRSRGFGFVRYATLEDAAKGKEGMDGKFLDGWVIF  116

Query  1060  VDPAKPKEFRPPPQPESDSTTFGIRSNKTIGWSG  1161
              D AKP+E   PP P  +    G+   KTIGW G
Sbjct  117   ADFAKPRE-PKPPPPPEEPNPHGLNIQKTIGWCG  149



>gb|ABK26221.1| unknown [Picea sitchensis]
Length=151

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
             KLFVSGLS+ T+DEGL +AF +FG+++EA+V+TD+  G SKGF FV Y T EEA K +EG
Sbjct  48    KLFVSGLSKRTTDEGLREAFSKFGRVLEARVVTDKMNGVSKGFAFVRYATQEEADKGKEG  107

Query  1024  MNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTT  1122
             M+ KFLDGWVIF D A+P+  R    PE  +TT
Sbjct  108   MDGKFLDGWVIFADYARPRPPRTYDNPEGGNTT  140



>ref|XP_010558018.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Tarenaya hassleriana]
Length=155

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 80/127 (63%), Gaps = 8/127 (6%)
 Frame = +1

Query  748   AFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVE  927
             A   I+GGHL    +F S  A L        SKLFV GLS YTS++GL++AF Q G++VE
Sbjct  2     ALSRIVGGHLKSVGVFNSSAAFLFSQRRGVASKLFVGGLSFYTSEQGLSEAFSQSGQVVE  61

Query  928   AKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE--------  1083
             AK+I DR + RSKGFGFVT+ + +EAQKA   MN K L+G VIFV  AKPK+        
Sbjct  62    AKIIMDRVSDRSKGFGFVTFASDDEAQKAITEMNGKQLNGRVIFVGYAKPKQSFRSGMPI  121

Query  1084  FRPPPQP  1104
              R PP P
Sbjct  122   ARGPPHP  128



>gb|KHG12372.1| Glycine-rich RNA-binding 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=157

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGL++ T+ E L +AF QFG++++A+V+TDR +G SKGFGFV Y TIEEA+K R
Sbjct  55    STNLFVSGLNKRTNSEKLREAFSQFGRVIDARVVTDRVSGYSKGFGFVRYATIEEAEKGR  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
              GM+ KFL+GWVIF + A+P+  R PPQ
Sbjct  115   VGMDGKFLEGWVIFAEYARPRPERTPPQ  142



>ref|XP_007021155.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY12680.1| RNA-binding family protein [Theobroma cacao]
Length=156

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGL++ T+ E L +AF QFG++V+A+V+TDR +G SKGFGFV Y T+EEA+K R
Sbjct  55    STNLFVSGLNKRTTMEKLREAFSQFGQVVDARVVTDRVSGYSKGFGFVRYATLEEAEKGR  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTF  1125
             EGM+ KFLDGWVIF + A+P+  R P    ++S  +
Sbjct  115   EGMDGKFLDGWVIFAEYARPRPERTPQNNMTNSNGY  150



>ref|XP_010443034.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Camelina sativa]
Length=156

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G SKGFGFV Y T+E++ K  
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYTTLEDSAKGI  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
              GM+ KFLDGWVIF + A+P+E  P  QP+S+
Sbjct  115   AGMDGKFLDGWVIFAEYARPREQMPSYQPQSN  146



>ref|XP_008243500.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Prunus mume]
Length=132

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 9/111 (8%)
 Frame = +1

Query  808   ASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTY  987
             A L  C  LTT KLFV GLS YT+D+GL++AF Q+G+++EA+++TDR + RSKGFGFVT+
Sbjct  23    ALLISCRGLTT-KLFVGGLSFYTNDKGLSEAFSQYGQVIEAQIVTDRVSDRSKGFGFVTF  81

Query  988   ETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPESDS  1116
              + +EA KA E MN K L+G VIFVD AKPK          R PP P  DS
Sbjct  82    ASEDEAHKALEEMNGKALNGRVIFVDYAKPKANYGGGMPIARGPPDPTKDS  132



>ref|XP_008454580.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Cucumis melo]
Length=173

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 94/160 (59%), Gaps = 17/160 (11%)
 Frame = +1

Query  649   MSRLLS*WES*TLIGKQCFLFLFLRS*KMAFSSAFRGILGGHLMPSSIFQSQCASLRFCS  828
             +S+ +  WE   +     FLF  L      FSSA         +P S  Q + A      
Sbjct  29    ISQAIHDWEK-PVPSTNSFLFGRL------FSSASTSSFVPPPLPPSAQQREVAE-----  76

Query  829   TLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQ  1008
                ++ LFVSGLS+ T+ E L++AF +FG++V A+V+TDRATG SKGFGFV Y T+E+A 
Sbjct  77    --PSTNLFVSGLSKRTTTEKLHEAFSKFGEVVHARVVTDRATGYSKGFGFVKYATLEDAA  134

Query  1009  KAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFG  1128
             K  EGM+ KFLDGWVIF + A+P   RPPP+  +    +G
Sbjct  135   KGIEGMDGKFLDGWVIFAEYARP---RPPPENNNGFAPYG  171



>ref|NP_001060964.1| Os08g0139000 [Oryza sativa Japonica Group]
 dbj|BAD03017.1| putative RNA recognition motif (RRM)-containing protein [Oryza 
sativa Japonica Group]
 dbj|BAF22878.1| Os08g0139000 [Oryza sativa Japonica Group]
 dbj|BAG99802.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68016.1| hypothetical protein OsJ_25986 [Oryza sativa Japonica Group]
Length=141

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
              LF+SGLS+ T+ +GL +AF +FG+++ A+V+TDR TG SKGFGFV Y T+E+A K  EG
Sbjct  37    NLFISGLSKRTTTDGLKEAFAKFGEVIHARVVTDRVTGFSKGFGFVRYATVEDAAKGIEG  96

Query  1024  MNAKFLDGWVIFVDPAKPKEFRPPPQPESDS  1116
             M+ KFLDGWVIF + A+P+   PP QPE +S
Sbjct  97    MDGKFLDGWVIFAEYARPRT--PPQQPEMNS  125



>ref|XP_010448336.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Camelina sativa]
Length=156

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G SKGFGFV Y T+E++ K  
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEIADAKVVTDRVSGYSKGFGFVRYTTLEDSAKGI  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
              GM+ KFLDGWVIF + A+P+E  P  QP+++
Sbjct  115   AGMDGKFLDGWVIFAEYARPREQMPSYQPQNN  146



>ref|XP_004972888.1| PREDICTED: nucleolin-like [Setaria italica]
Length=140

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             +  LFVSGLS+ T+ EGL +AF  FG++V A+V+TDR +G SKGFGFV Y T+E+A K  
Sbjct  34    SPNLFVSGLSKRTTTEGLREAFAAFGEVVHARVVTDRVSGFSKGFGFVRYATVEDATKGI  93

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             EGM+ KFLDGWVIF + AKP   RPPPQ
Sbjct  94    EGMDGKFLDGWVIFAEYAKP---RPPPQ  118



>ref|XP_010482863.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Camelina sativa]
Length=156

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G SKGFGFV Y T+E++ K  
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYTTLEDSAKGI  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
              GM+ KFLDGWVIF + A+P+E  P  QP+++
Sbjct  115   AGMDGKFLDGWVIFAEYARPREQMPSYQPQNN  146



>gb|EPS58767.1| hypothetical protein M569_16047 [Genlisea aurea]
Length=139

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 87/138 (63%), Gaps = 16/138 (12%)
 Frame = +1

Query  745   SAFRGILGGHLMPSSIFQSQCASLRFCSTLT---------TSKLFVSGLSRYTSDEGLNK  897
             +A R +    ++PS I +S  + LR  S  +          SKLF+ GLS YTS++GL+ 
Sbjct  2     AALRNLSRNLMLPSHIPKSNSSLLRLPSRASPILFTCRGIASKLFIGGLSFYTSEQGLSD  61

Query  898   AFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKP  1077
             AF ++G+++EA ++TDRAT RSKGFGFVTY + +EA+ A   MN K L+G VIFVD AKP
Sbjct  62    AFSKYGQVIEATIVTDRATDRSKGFGFVTYASEDEAENAILEMNGKPLNGRVIFVDYAKP  121

Query  1078  KE-------FRPPPQPES  1110
             +         R PP+P+S
Sbjct  122   RSSSRDMPIARGPPEPDS  139



>gb|EEC82875.1| hypothetical protein OsI_27755 [Oryza sativa Indica Group]
Length=141

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
              LF+SGLS+ T+ +GL +AF +FG+++ A+V+TDR TG SKGFGF+ Y T+E+A K  EG
Sbjct  37    NLFISGLSKRTTTDGLKEAFAKFGEVIHARVVTDRVTGFSKGFGFIRYATVEDAAKGIEG  96

Query  1024  MNAKFLDGWVIFVDPAKPKEFRPPPQPESDS  1116
             M+ KFLDGWVIF + A+P+   PP QPE +S
Sbjct  97    MDGKFLDGWVIFAEYARPRT--PPQQPEMNS  125



>ref|XP_002864345.1| RNA recognition motif-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH40604.1| RNA recognition motif-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=156

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G SKGFGFV Y T+E++ K  
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGI  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
              GM+ KFLDGWVIF + A+P+E   P QP+++
Sbjct  115   AGMDGKFLDGWVIFAEYARPREQSQPYQPQNN  146



>ref|NP_001059935.1| Os07g0549800 [Oryza sativa Japonica Group]
 dbj|BAC57733.1| RNA recognition motif (RRM)-containing protein-like [Oryza sativa 
Japonica Group]
 dbj|BAF21849.1| Os07g0549800 [Oryza sativa Japonica Group]
 gb|EAZ40220.1| hypothetical protein OsJ_24665 [Oryza sativa Japonica Group]
 dbj|BAH00209.1| unnamed protein product [Oryza sativa Japonica Group]
Length=133

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             + LFVSGL++ T+ +GL +AF +FG+++EA+VITDR +G S+GFGFV Y T+EEA +  +
Sbjct  35    NNLFVSGLNKRTTSDGLREAFSKFGQVIEARVITDRISGYSRGFGFVKYATVEEAGEGIK  94

Query  1021  GMNAKFLDGWVIFVDPAKPKEFRPPPQPESDST  1119
             GM+ KFLDGWVIF + AK +E + P QP + ++
Sbjct  95    GMDGKFLDGWVIFAEYAKQREAQQPAQPAASTS  127



>ref|XP_006401559.1| hypothetical protein EUTSA_v10014908mg [Eutrema salsugineum]
 gb|ESQ43012.1| hypothetical protein EUTSA_v10014908mg [Eutrema salsugineum]
Length=156

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G SKGFGFV Y T+E++ K  
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYMTLEDSAKGI  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
              GM+ KFLDGWVIF + A+P+E  P  QP+++
Sbjct  115   AGMDGKFLDGWVIFAEYARPREQSPSYQPQNN  146



>ref|XP_002283144.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial 
[Vitis vinifera]
 emb|CAN78606.1| hypothetical protein VITISV_024164 [Vitis vinifera]
 emb|CBI20473.3| unnamed protein product [Vitis vinifera]
Length=135

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 73/92 (79%), Gaps = 3/92 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL++AF +FG++V A+V+TDR +G SKGFGFV Y ++E+A +  
Sbjct  40    STNLFVSGLSKRTTSEGLHEAFSKFGQVVNARVVTDRVSGYSKGFGFVRYVSLEDAAEGI  99

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
             +GM+ KFLDGWVIF + A+P   RPPP P+++
Sbjct  100   KGMDGKFLDGWVIFAEYARP---RPPPSPQNN  128



>gb|EAZ04269.1| hypothetical protein OsI_26412 [Oryza sativa Indica Group]
Length=133

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             + LFVSGL++ T+ +GL +AF +FG+++EA+VITDR +G S+GFGFV Y T+EEA +  +
Sbjct  35    NNLFVSGLNKRTTSDGLREAFSKFGQVIEARVITDRISGYSRGFGFVKYATVEEAGEGIK  94

Query  1021  GMNAKFLDGWVIFVDPAKPKEFRPPPQPESDS  1116
             GM+ KFLDGWVIF + AK +E + P QP + +
Sbjct  95    GMDGKFLDGWVIFAEYAKQREAQQPAQPAAST  126



>ref|XP_008226798.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Prunus mume]
Length=142

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ E L +AF QFG++V A+V+TDR +G SKGFGFV Y T+E+A K  
Sbjct  45    STNLFVSGLSKRTTSEKLQEAFSQFGEVVHARVVTDRVSGYSKGFGFVRYATLEDAGKGI  104

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
             EGM+ KFLDGWVIF + A+P++  PP  PE++
Sbjct  105   EGMDGKFLDGWVIFAEYARPRQ--PPSPPENN  134



>ref|XP_010028363.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW55107.1| hypothetical protein EUGRSUZ_I01065 [Eucalyptus grandis]
Length=142

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = +1

Query  832   LTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQK  1011
             + +  LFVSGL++ T+ E L+++F QFG++V AKV+TDR +G SKGFGFV Y +IE+A K
Sbjct  42    IPSDTLFVSGLNKRTTTEKLHESFSQFGQVVHAKVVTDRNSGYSKGFGFVKYASIEDAGK  101

Query  1012  AREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRSN  1140
               EGM+AKFLDGWVIF + A+P   RPPP       T+  RS 
Sbjct  102   GIEGMDAKFLDGWVIFAEYARP---RPPPGQAPTQDTYTRRSG  141



>ref|XP_006657815.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like 
[Oryza brachyantha]
Length=130

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             + LFVSGL++ T+ EGL +AF +FG+++EA+VITDR +G S+GFGFV Y T+ EA +  +
Sbjct  35    NNLFVSGLNKRTTSEGLREAFSKFGQVIEARVITDRISGYSRGFGFVKYATVIEAGEGIK  94

Query  1021  GMNAKFLDGWVIFVDPAKPKEFRPPPQPES  1110
             GM+ KFLDGWVIF + AK +E + P QP S
Sbjct  95    GMDGKFLDGWVIFAEYAKQRETQQPAQPSS  124



>gb|EPS59908.1| hypothetical protein M569_14896, partial [Genlisea aurea]
Length=85

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 5/83 (6%)
 Frame = +1

Query  928   AKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFR-----P  1092
             AKVI DR +GRSKGFGFVT+ET+EEA+KAR+GMNAKFLDGWVIFVDPA+PKE +     P
Sbjct  3     AKVIVDRGSGRSKGFGFVTFETVEEAEKARDGMNAKFLDGWVIFVDPARPKESQPRPPPP  62

Query  1093  PPQPESDSTTFGIRSNKTIGWSG  1161
             P  P+  ++  G R+NKT+GW+G
Sbjct  63    PRSPDGSTSETGFRTNKTVGWTG  85



>gb|ABK95573.1| unknown [Populus trichocarpa]
Length=149

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              + LFVSGLS+ T+ EGL +AF +FG++V+AKV+TDR +G SKGFGFV Y T+E+A +  
Sbjct  53    NTNLFVSGLSKRTTTEGLQEAFSKFGEVVQAKVVTDRTSGYSKGFGFVRYGTLEDAAEGI  112

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
             +GM+ +FLDGWVIF + A+PK+  PP QP+++
Sbjct  113   KGMDGQFLDGWVIFAEYARPKQ--PPSQPQNN  142



>ref|XP_004303523.1| PREDICTED: glycine-rich RNA-binding protein 2, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=133

 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 9/111 (8%)
 Frame = +1

Query  808   ASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTY  987
             A L  C  L+T KLFV GLS YT+D+GL +AF Q+G++VEA+V++DR + RSKGFGFVT+
Sbjct  24    AILISCRALST-KLFVGGLSFYTTDKGLQEAFSQYGQVVEAQVVSDRVSDRSKGFGFVTF  82

Query  988   ETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPESDS  1116
              + +EA KA E MN K L+G VIFVD AKPK          R PP  ++DS
Sbjct  83    ASQDEAHKAVEEMNGKALNGRVIFVDYAKPKSDYGGGMPIARGPPNLKNDS  133



>ref|XP_009132436.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Brassica rapa]
 emb|CDY43035.1| BnaA03g11820D [Brassica napus]
Length=153

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G SKGFGFV Y T+E++ K  
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGI  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKE-FRP----PPQP  1104
              GM+ KFLDGWVIF + A+P+E +RP    PP P
Sbjct  115   AGMDGKFLDGWVIFAEYARPREPYRPQNNMPPSP  148



>ref|XP_006452125.1| hypothetical protein CICLE_v10009863mg [Citrus clementina]
 ref|XP_006475263.1| PREDICTED: glycine-rich RNA-binding protein 8-like [Citrus sinensis]
 gb|ESR65365.1| hypothetical protein CICLE_v10009863mg [Citrus clementina]
 gb|KDO74409.1| hypothetical protein CISIN_1g032702mg [Citrus sinensis]
Length=135

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+DE L   F  FG++V AK++  R +G SKGFGFV Y T+E A KA 
Sbjct  37    STNLFVSGLSKRTTDETLRDTFSAFGEVVHAKIVKHRESGYSKGFGFVKYATLEAAGKAI  96

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTF  1125
             EGM+ KFLDGWVIFV+ AKP++  PP  P  ++T F
Sbjct  97    EGMDGKFLDGWVIFVEYAKPRQ--PPTLPSQNNTNF  130



>emb|CDY64931.1| BnaCnng45530D [Brassica napus]
Length=153

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G SKGFGFV Y T+E++ K  
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYTTLEDSAKGI  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKE-FRP----PPQP  1104
              GM+ KFLDGWVIF + A+P+E +RP    PP P
Sbjct  115   AGMDGKFLDGWVIFAEYARPREPYRPHNNMPPPP  148



>ref|NP_001148723.1| ELAV-like protein 4 [Zea mays]
 gb|ACG32657.1| ELAV-like protein 4 [Zea mays]
Length=127

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             + LFVSGL++ T+ EGL +AF +FG+++EA+VITDR +G S+GFGFV Y T++EA +A E
Sbjct  34    NNLFVSGLNKRTTSEGLKEAFSKFGQVIEARVITDRISGYSRGFGFVKYATVQEAGEAIE  93

Query  1021  GMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             GM+ KFLDGWVIF + AK +E   P Q
Sbjct  94    GMDGKFLDGWVIFAEYAKQREATQPSQ  120



>emb|CDY42466.1| BnaA10g08420D [Brassica napus]
Length=153

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G SKGFGFV Y T+E++ K  
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYTTLEDSAKGI  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKE-FRP----PPQP  1104
              GM+ KFLDGWVIF + A+P+E +RP    PP P
Sbjct  115   AGMDGKFLDGWVIFAEYARPREPYRPQNNMPPPP  148



>ref|XP_003573359.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Brachypodium distachyon]
Length=153

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 68/88 (77%), Gaps = 3/88 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             +  LFVSGLS+ T+ +GL +AF +FG+++ A+V+TDR TG SKGFGFV Y ++E+A K  
Sbjct  47    SPNLFVSGLSKRTTTDGLREAFAKFGEVMHARVVTDRVTGFSKGFGFVRYASVEDASKGI  106

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             EGM+ KFLDGWVIF + A+P   RPPPQ
Sbjct  107   EGMDGKFLDGWVIFAEYARP---RPPPQ  131



>ref|XP_004151968.1| PREDICTED: nucleolysin TIAR-like [Cucumis sativus]
 ref|XP_004160266.1| PREDICTED: nucleolysin TIAR-like [Cucumis sativus]
 gb|KGN57946.1| hypothetical protein Csa_3G403980 [Cucumis sativus]
Length=174

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 72/99 (73%), Gaps = 3/99 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ E L++AF +FG++  A+V+TDR TG SKGFGFV Y T+E+A K  
Sbjct  78    STNLFVSGLSKRTTTEKLHEAFAKFGEVAHARVVTDRVTGYSKGFGFVKYATLEDAAKGI  137

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIR  1134
             EGM+ KFLDGWVIF + A+P   RPPP+  +    +G R
Sbjct  138   EGMDGKFLDGWVIFAEYARP---RPPPENNNGFAPYGRR  173



>ref|XP_010912333.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Elaeis guineensis]
Length=146

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 85/130 (65%), Gaps = 12/130 (9%)
 Frame = +1

Query  760   ILGGHLMPSSIFQSQCASL---RFCSTL-TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVE  927
             +L G+L P+    S+   L   +F S+    SKLFV GLS YT++E L+ AF Q+G+++E
Sbjct  16    VLFGNLNPNHNANSRALLLLPSQFVSSRGIASKLFVGGLSFYTTEEALSDAFSQYGQVIE  75

Query  928   AKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPK-EF------  1086
             AK+I DRA+ RSKGFGFVT+ + +EAQKAR  MN K L+G V+FVD AK K  F      
Sbjct  76    AKIIMDRASERSKGFGFVTFASEDEAQKARTEMNGKVLNGRVVFVDNAKTKLRFNDAVPI  135

Query  1087  -RPPPQPESD  1113
              R PP+P  +
Sbjct  136   ARGPPEPSGN  145



>ref|XP_002445020.1| hypothetical protein SORBIDRAFT_07g002960 [Sorghum bicolor]
 gb|EES14515.1| hypothetical protein SORBIDRAFT_07g002960 [Sorghum bicolor]
Length=140

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
              LFVSGLS+ T+ EGL  AF +FG++V A+V+TDR +G SKGFGFV Y T EEA K  EG
Sbjct  36    NLFVSGLSKRTTTEGLRDAFAKFGEVVHARVVTDRVSGFSKGFGFVRYATTEEATKGIEG  95

Query  1024  MNAKFLDGWVIFVDPAKPKEFRPPPQPESDS  1116
             M+ KFLDGWVIF + A+P+   PP Q E +S
Sbjct  96    MDGKFLDGWVIFAEYARPRA--PPEQAEMNS  124



>ref|XP_002316957.1| RNA-binding family protein [Populus trichocarpa]
 gb|EEE97569.1| RNA-binding family protein [Populus trichocarpa]
Length=153

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              + LFVSGLS+ T+ EGL +AF +FG++V+A+V+TDR +G SKGFGFV Y T+E+A +  
Sbjct  54    NTNLFVSGLSKRTTSEGLQEAFSKFGEVVQARVVTDRVSGYSKGFGFVKYATLEDAAEGI  113

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDS  1116
             +GM+ +FLDGWVIF + A+P++  PP +P++++
Sbjct  114   KGMDGQFLDGWVIFAEYARPRQ--PPSEPQNNT  144



>ref|XP_003527307.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like 
[Glycine max]
Length=145

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 5/99 (5%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              + LFVSGLS+ T+ E L + F +FG++V A+V+TDR +G SKGFGFV Y TIE+A K  
Sbjct  48    NTNLFVSGLSKRTNTERLREEFAKFGEVVHARVVTDRVSGYSKGFGFVQYATIEDAAKGI  107

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPP-QP-ESDSTTFG  1128
             EGM+ KFLDGWVIF + A+P   RPPP QP  S+S+ +G
Sbjct  108   EGMDGKFLDGWVIFAEYARP---RPPPGQPLNSNSSQYG  143



>ref|XP_011030908.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Populus euphratica]
Length=151

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              + LFVSGLS+ T+ EGL +AF +FG++V+A+V+TDR +G SKGFGFV Y T+E+A +  
Sbjct  52    NTNLFVSGLSKRTTSEGLREAFSKFGEVVQARVVTDRVSGYSKGFGFVKYATLEDAAEGI  111

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDS  1116
             +GM+ +FLDGWVIF + A+P++  PP +P++++
Sbjct  112   KGMDGQFLDGWVIFAEYARPRQ--PPSEPQNNT  142



>ref|NP_200269.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 dbj|BAB09337.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL59923.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20239.1| unknown protein [Arabidopsis thaliana]
 gb|AAM62467.1| unknown [Arabidopsis thaliana]
 gb|AED96512.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=156

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G SKGFGFV Y T+E++ K  
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGI  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
              GM+ KFLDGWVIF + A+P+E     QP+++
Sbjct  115   AGMDGKFLDGWVIFAEYARPREQSQSYQPQNN  146



>ref|XP_007203802.1| hypothetical protein PRUPE_ppa026345mg [Prunus persica]
 gb|EMJ05001.1| hypothetical protein PRUPE_ppa026345mg [Prunus persica]
Length=132

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 74/106 (70%), Gaps = 9/106 (8%)
 Frame = +1

Query  823   CSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEE  1002
             C  LTT KLFV GLS YT+D+GL++AF Q+G+++EA+++TDR + RSKGFGFVT+ + +E
Sbjct  28    CRGLTT-KLFVGGLSFYTNDKGLSEAFSQYGQVIEAQIVTDRVSDRSKGFGFVTFASEDE  86

Query  1003  AQKAREGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPESDS  1116
             A KA E MN K L+G VIFVD AKPK          R PP    DS
Sbjct  87    AHKALEEMNGKALNGRVIFVDYAKPKANYGGGMPIARGPPDTIKDS  132



>ref|XP_006281245.1| hypothetical protein CARUB_v10027288mg [Capsella rubella]
 gb|EOA14143.1| hypothetical protein CARUB_v10027288mg [Capsella rubella]
Length=156

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G SKGFGFV Y T+E++ K  
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYTTLEDSAKGI  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
              GM+ KFLDGWVIF + A+P+E     QP+++
Sbjct  115   AGMDGKFLDGWVIFAEYARPREQSQSYQPQNN  146



>gb|KHN28381.1| Glycine-rich RNA-binding protein 2 [Glycine soja]
Length=143

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 5/99 (5%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              + LFVSGLS+ T+ E L + F +FG++V A+V+TDR +G SKGFGFV Y TIE+A K  
Sbjct  46    NTNLFVSGLSKRTNTERLREEFAKFGEVVHARVVTDRVSGYSKGFGFVQYATIEDAAKGI  105

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPP-QP-ESDSTTFG  1128
             EGM+ KFLDGWVIF + A+P   RPPP QP  S+S+ +G
Sbjct  106   EGMDGKFLDGWVIFAEYARP---RPPPGQPLNSNSSQYG  141



>ref|XP_009119982.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Brassica rapa]
Length=154

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G SKGFGFV Y T+E++ K  
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYTTLEDSAKGI  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKE-FRP  1092
              GM+ KFLDGWVIF + A+P+E +RP
Sbjct  115   AGMDGKFLDGWVIFAEYARPREPYRP  140



>ref|XP_002276063.2| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
isoform X1 [Vitis vinifera]
 emb|CBI30340.3| unnamed protein product [Vitis vinifera]
Length=133

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 75/110 (68%), Gaps = 8/110 (7%)
 Frame = +1

Query  811   SLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYE  990
             +L  C     SKLFV GLS YT+++GL++ F Q+G++VEAK++ DR + RSKGFGFVT+ 
Sbjct  24    ALLICCRGIASKLFVGGLSFYTTEKGLSEHFSQYGQVVEAKIVMDRVSDRSKGFGFVTFA  83

Query  991   TIEEAQKAREGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPESDS  1116
             + EEAQKAR  M+ K L+G  IFVD AKP+          R PP+P +DS
Sbjct  84    SEEEAQKARTEMDGKELNGRTIFVDYAKPRADFGGGMPIARGPPEPTADS  133



>ref|XP_002530915.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF31464.1| RNA binding protein, putative [Ricinus communis]
Length=354

 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 83/127 (65%), Gaps = 7/127 (6%)
 Frame = +1

Query  787   SIFQSQCA---SLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATG  957
             SIF SQ     S R  +   T  LFVSGLS+ T+ EGL +AF +FG++V+A+V+TDR +G
Sbjct  32    SIFSSQANTAPSAREQAEPNT-NLFVSGLSKRTTTEGLKQAFSKFGEVVQARVVTDRVSG  90

Query  958   RSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFGIRS  1137
              SKGFGFV Y ++E+A+K  EGM+ KFLDGWVIF + A+P   RPP    +  + +G  +
Sbjct  91    YSKGFGFVRYGSLEDAEKGIEGMDGKFLDGWVIFAEYARP---RPPLPGNNTGSAYGNNT  147

Query  1138  NKTIGWS  1158
                 G S
Sbjct  148   GSAYGNS  154



>ref|XP_009384210.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=164

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 68/87 (78%), Gaps = 3/87 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGL++ T+ EGL +AF +FG++V A+V+TDR +G SKGFGFV Y T+EEA+   
Sbjct  57    STNLFVSGLNKRTTSEGLWEAFSKFGQVVHARVVTDRVSGYSKGFGFVRYATLEEAEAGI  116

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPP  1098
             +GM+ KFLDGWVIF + A+P   RPPP
Sbjct  117   KGMDGKFLDGWVIFAEYARP---RPPP  140



>ref|XP_006659102.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like 
[Oryza brachyantha]
Length=141

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             +  LFVSGLS+ T+ +GL +AF +FG+++ A+V+TDR TG SKGFGFV Y T+E+A K  
Sbjct  35    SPNLFVSGLSKRTTTDGLREAFAKFGEVLHARVVTDRVTGFSKGFGFVRYATVEDAAKGI  94

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPP-PQPESDS  1116
             EGM+ KFLDGWVIF + A+P   RPP  QPE +S
Sbjct  95    EGMDGKFLDGWVIFAEYARP---RPPQQQPEMNS  125



>ref|XP_011048254.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Populus euphratica]
Length=157

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 77/107 (72%), Gaps = 3/107 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              + LFVSGLS+ T+ EGL +AF +FG++V+AKV+TDR +G SKGFGFV Y T+E+A +  
Sbjct  52    NTNLFVSGLSKRTTTEGLQEAFSKFGEVVQAKVVTDRTSGYSKGFGFVRYATLEDAAEGI  111

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD-STTFGIRSNKTIGW  1155
             +GM+ +FLDGWVIF + A+PK+  P  QP+++    +G  +N    W
Sbjct  112   KGMDGQFLDGWVIFAEYARPKQ--PASQPQNNMGPGYGNYTNPNHRW  156



>ref|XP_003562947.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Brachypodium distachyon]
Length=138

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             + LFVSGL++ T+ +GL +AF +FG++ EA+VITDR +G S+GFGFV Y T+EEA +  +
Sbjct  40    NNLFVSGLNKRTTTDGLREAFSKFGQVTEARVITDRISGYSRGFGFVKYATVEEAGEGIK  99

Query  1021  GMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             GM+ KFLDGWVIF + AK +E + PPQ
Sbjct  100   GMDGKFLDGWVIFAEYAKQREAQQPPQ  126



>ref|XP_010271589.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Nelumbo nucifera]
Length=139

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 85/138 (62%), Gaps = 14/138 (10%)
 Frame = +1

Query  745   SAFRGILG-----GHLMPSSIFQSQCASLRFCSTL-TTSKLFVSGLSRYTSDEGLNKAFE  906
             +AFRGI         L P++I  S        S    TSKLFV GLS YT+++ L++AF 
Sbjct  2     AAFRGIPRLIKQLSRLNPNNISPSLLPPPYLISHRGITSKLFVGGLSFYTTEKALSEAFS  61

Query  907   QFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE-  1083
             QFG+++EAK+I DR + RSKGFGFVT+ + +EAQKA   MN K L+G +IFVD AKP+  
Sbjct  62    QFGQVIEAKIIMDRVSDRSKGFGFVTFASEDEAQKALTEMNGKVLNGRIIFVDNAKPRSR  121

Query  1084  -------FRPPPQPESDS  1116
                     R PP+P  D+
Sbjct  122   FDDGMPIARGPPEPTPDT  139



>ref|XP_004505422.1| PREDICTED: nucleolysin TIA-1 isoform p40-like [Cicer arietinum]
Length=142

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              + LFVSGLS+ T+ E L + F++FG++V A+V+TDR +G SKGFGFV Y TIE+A K  
Sbjct  45    NTNLFVSGLSKRTTTERLREEFQKFGEVVHARVVTDRVSGYSKGFGFVQYATIEDAAKGI  104

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPP  1098
             EGM+ KFLDGWVIF + A+P   RPPP
Sbjct  105   EGMDGKFLDGWVIFAEYARP---RPPP  128



>gb|KDP36187.1| hypothetical protein JCGZ_08831 [Jatropha curcas]
Length=130

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 73/104 (70%), Gaps = 7/104 (7%)
 Frame = +1

Query  814   LRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYET  993
             L  C     +KLFV GLS YT++ GL++AF Q+G++VEAK++TDR + +SKGFGFVT+ +
Sbjct  24    LFICCRGIVTKLFVGGLSFYTTENGLSEAFSQYGQVVEAKIVTDRVSDKSKGFGFVTFAS  83

Query  994   IEEAQKAREGMNAKFLDGWVIFVDPAKPKEF-------RPPPQP  1104
             ++EA KA   MN K L+G VI+VD AKPK +       R PP+P
Sbjct  84    VDEADKALTEMNGKTLNGRVIYVDYAKPKTYGGGIPIARGPPEP  127



>ref|XP_006360109.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like 
[Solanum tuberosum]
Length=157

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL +AF + G++V A+V+TDR +G SKGFGFV Y T+E+A+   
Sbjct  51    STNLFVSGLSKRTTSEGLREAFVKHGEVVHARVVTDRVSGYSKGFGFVRYATLEDAEAGI  110

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFG  1128
             +GM+ +FLDGWVIF + A+P+   PPP  ++++TT G
Sbjct  111   KGMDGQFLDGWVIFAEYARPRP--PPPSMQNNNTTPG  145



>emb|CDP05821.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +1

Query  835   TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKA  1014
             +T+  F+  LS+ T+ EGL  AFE+FG++V+AKV+TDRA+G SKGFGFV Y ++E+A   
Sbjct  50    STNLFFMICLSKRTTTEGLRTAFEKFGQVVDAKVVTDRASGFSKGFGFVRYASLEDAAAG  109

Query  1015  REGMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
              EGM+ KFLDGWVIF + A+P+   PPPQ
Sbjct  110   IEGMDGKFLDGWVIFAEYARPRNTLPPPQ  138



>emb|CDP05822.1| unnamed protein product [Coffea canephora]
Length=147

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T++EGL  AFE+FG +V+AKV+ DR +G SKGFGFV Y T++EA+   
Sbjct  47    STNLFVSGLSKRTTNEGLRGAFEKFGNVVDAKVVCDRVSGFSKGFGFVRYATLQEAEAGI  106

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             +GM+ +FLDGWVIF + A+P+   PP Q
Sbjct  107   KGMDGQFLDGWVIFAEYARPRNPSPPTQ  134



>ref|XP_010520881.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
[Tarenaya hassleriana]
Length=148

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF +FG++ +AKV+ DR +G SKGFGFV YETI++A K  
Sbjct  50    STNLFVSGLSKRTTSEGLRDAFAKFGQVADAKVVKDRVSGYSKGFGFVRYETIDDAAKGI  109

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFG  1128
             EGM+ KFLDGWVIF + A+P++   P Q       +G
Sbjct  110   EGMDGKFLDGWVIFAEYARPRQQPAPLQQNMSRPPYG  146



>ref|XP_007133034.1| hypothetical protein PHAVU_011G145700g [Phaseolus vulgaris]
 gb|ESW05028.1| hypothetical protein PHAVU_011G145700g [Phaseolus vulgaris]
Length=144

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 70/98 (71%), Gaps = 4/98 (4%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              + LFVSGLS+ T+ E L + F +FG++V A+V+TDR +G SKGFGFV Y T+EEA K  
Sbjct  48    NNNLFVSGLSKRTTTEKLREEFSKFGEVVHARVVTDRVSGYSKGFGFVQYATLEEAAKGI  107

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPP-QPESDSTTFG  1128
             EGM+ KFLDGWVIF + A+P   RPPP    ++S  FG
Sbjct  108   EGMDGKFLDGWVIFAEYARP---RPPPGHLNNNSPQFG  142



>ref|XP_004244174.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Solanum lycopersicum]
Length=151

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL +AF + G++V A+V+TDR +G SKGFGFV Y T+E+A+   
Sbjct  45    STNLFVSGLSKRTTSEGLREAFVKHGEVVHARVVTDRVSGYSKGFGFVRYATLEDAEAGI  104

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFG  1128
             +GM+ +FLDGWVIF + A+P+   PPP  ++++TT G
Sbjct  105   KGMDGQFLDGWVIFAEYARPRP--PPPSMQNNNTTPG  139



>gb|AFK44512.1| unknown [Medicago truncatula]
 gb|KEH30765.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=144

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 71/94 (76%), Gaps = 3/94 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ E L +AF++FG++V A+V+TDR +G SKGFGFV Y T+E+A K  
Sbjct  50    STNLFVSGLSKRTTTETLREAFQKFGEVVHARVVTDRVSGYSKGFGFVKYATLEDAAKGI  109

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDST  1119
             EGM+ KFL+GWVIF + A+P   RPPP    ++T
Sbjct  110   EGMDGKFLEGWVIFAEYARP---RPPPGEAVNNT  140



>dbj|BAJ99825.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00080.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             +  LFVSGLS+ T+ +GL +AF +FG++  A+VITDR TG SKGFGFV Y T+E+A K  
Sbjct  47    SPNLFVSGLSKRTTTDGLREAFAKFGEVEHARVITDRVTGFSKGFGFVRYVTVEDAAKGI  106

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             EGM+ +FLDGWVIF + A+P   RPPPQ
Sbjct  107   EGMDGEFLDGWVIFAEYARP---RPPPQ  131



>ref|NP_001150207.1| LOC100283837 [Zea mays]
 gb|ACG32498.1| nucleolin [Zea mays]
 gb|ACG38248.1| nucleolin [Zea mays]
 gb|ACN28245.1| unknown [Zea mays]
 gb|AFW57410.1| nucleolin [Zea mays]
Length=140

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             +  LFVSGLS+ T+ EGL +AF +FG+++ A+V+TDR +G SKGFGFV Y T EEA K  
Sbjct  34    SPNLFVSGLSKRTTSEGLREAFAEFGEVLHARVVTDRVSGFSKGFGFVRYATTEEAAKGI  93

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             EG + KFLDGWVIF + AKP   RPPP+
Sbjct  94    EGKDGKFLDGWVIFAEYAKP---RPPPE  118



>ref|XP_003540046.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like 
[Glycine max]
 gb|KHN38590.1| Nucleolin [Glycine soja]
Length=145

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
              LFVSGLS+ T+ E L + F +FG++V A+V+TDR +G SKGFGFV Y TIEEA K  EG
Sbjct  50    NLFVSGLSKRTTTERLREEFAKFGEVVHARVVTDRVSGYSKGFGFVQYATIEEAAKGIEG  109

Query  1024  MNAKFLDGWVIFVDPAKPKEFRPPP  1098
             M+ KFLDGWVIF + A+P   RPPP
Sbjct  110   MDGKFLDGWVIFAEYARP---RPPP  131



>gb|EYU19190.1| hypothetical protein MIMGU_mgv1a015840mg [Erythranthe guttata]
Length=143

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF +FG +V+A+V+TDRA+G SKGFGFV Y TI+EA +  
Sbjct  48    STNLFVSGLSKRTTTEGLRDAFAKFGAVVDARVVTDRASGYSKGFGFVRYPTIDEAAEGI  107

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPP  1095
             +GM+ +FLDGWVIF + A+P+   PP
Sbjct  108   KGMDGQFLDGWVIFAEYARPRAPLPP  133



>ref|XP_002460835.1| hypothetical protein SORBIDRAFT_02g035890 [Sorghum bicolor]
 gb|EER97356.1| hypothetical protein SORBIDRAFT_02g035890 [Sorghum bicolor]
Length=131

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             + LFVSGL++ T+  GL +AF +FG+++EA+VITDR +G S+GFGFV Y T++EA +A +
Sbjct  36    NNLFVSGLNKRTTSNGLKEAFSKFGQVIEARVITDRISGYSRGFGFVKYATVQEAGEAIK  95

Query  1021  GMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             GM+ KFLDGWVIF + AK +E   P Q
Sbjct  96    GMDGKFLDGWVIFAEYAKQREATQPSQ  122



>gb|KFK27067.1| hypothetical protein AALP_AA8G330100 [Arabis alpina]
Length=156

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G SKGFGFV Y T+E++ K  
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRLSGFSKGFGFVRYATLEDSAKGI  114

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
              GM+ KFLDGWVIF + A+P+E     QP+++
Sbjct  115   AGMDGKFLDGWVIFAEYARPREQSLSYQPQNN  146



>dbj|BAK04472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             + LFVSGL++ T+ +GL +AF +FG++ +A+VITDR +G S+GFGFV Y T+EEA +  +
Sbjct  40    NNLFVSGLNKRTTSDGLREAFSKFGQVTDARVITDRISGYSRGFGFVKYATVEEAAEGIK  99

Query  1021  GMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             GM+ KF DGWVIF + AK +E + PPQ
Sbjct  100   GMDGKFFDGWVIFAEYAKQREAQQPPQ  126



>ref|XP_006370586.1| hypothetical protein POPTR_0001s44050g [Populus trichocarpa]
 gb|ERP67155.1| hypothetical protein POPTR_0001s44050g [Populus trichocarpa]
Length=137

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 77/110 (70%), Gaps = 3/110 (3%)
 Frame = +1

Query  787   SIFQSQCASLR-FCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRS  963
              +F   C  +  +   L + + F  GLS+ T+ EGL +AF +FG++V+AKV+TDR +G S
Sbjct  23    HVFWDFCKGVEVWKGILNSLQNFFYGLSKRTTTEGLQEAFSKFGEVVQAKVVTDRTSGYS  82

Query  964   KGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
             KGFGFV Y T+E+A +  +GM+ +FLDGWVIF + A+PK+  PP QP+++
Sbjct  83    KGFGFVRYGTLEDAAEGIKGMDGQFLDGWVIFAEYARPKQ--PPSQPQNN  130



>ref|XP_006387726.1| RNA-binding family protein [Populus trichocarpa]
 gb|ERP46640.1| RNA-binding family protein [Populus trichocarpa]
Length=139

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 83/134 (62%), Gaps = 12/134 (9%)
 Frame = +1

Query  739   FSSAFRGILG-GHLMPSSIFQSQCAS---LRFCSTLTTSKLFVSGLSRYTSDEGLNKAFE  906
              ++A R I G    M SSI     A+   L       T+KLFV GLS YT++ GL++AF 
Sbjct  1     MAAALRRIAGEKSFMLSSIRAKLVAAPTALFIWQRGITTKLFVGGLSIYTTENGLSEAFS  60

Query  907   QFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE-  1083
             Q+G++VEAK++ DRA  RSKGFGFVTY + +EAQKA + MN K L+G VI+VD AK K  
Sbjct  61    QYGQVVEAKIVMDRALDRSKGFGFVTYASEDEAQKALDEMNGKALNGRVIYVDYAKLKTN  120

Query  1084  -------FRPPPQP  1104
                     R PP+P
Sbjct  121   FGGGIPIARGPPEP  134



>ref|XP_011046925.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Populus euphratica]
 ref|XP_011004186.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Populus euphratica]
Length=139

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 88/148 (59%), Gaps = 29/148 (20%)
 Frame = +1

Query  685   LIGKQCFLFLFLRS*KMAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGL  864
             + G++CF+   +R+  +A              P+++F  Q           T+KLFV GL
Sbjct  8     IAGEKCFMLSSIRAKLVA-------------APTALFIWQRG--------ITTKLFVGGL  46

Query  865   SRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLD  1044
             S YT++ GL++AF Q+G++VEAK++ DRA  RSKGFGFVTY + +EAQKA + MN K L+
Sbjct  47    SIYTTENGLSEAFSQYGQVVEAKIVMDRALDRSKGFGFVTYASEDEAQKALDEMNGKSLN  106

Query  1045  GWVIFVDPAKPKE--------FRPPPQP  1104
             G VI+VD AK K          R PP+P
Sbjct  107   GRVIYVDYAKLKTNFGGGIPIARGPPEP  134



>gb|EPS66753.1| hypothetical protein M569_08025, partial [Genlisea aurea]
Length=151

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 68/94 (72%), Gaps = 6/94 (6%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF +FG++V A+V+TDR +G SKGFGFV Y T+E+A+   
Sbjct  52    STNLFVSGLSKRTTTEGLRDAFAKFGEVVNARVVTDRVSGHSKGFGFVKYATLEDAESGI  111

Query  1018  EGMNAKFLDGWVIFVDPAKPK------EFRPPPQ  1101
             +GM+ +FLDGWVIF + A+P+         PPPQ
Sbjct  112   KGMDGQFLDGWVIFAEYARPRPPIPSLNNAPPPQ  145



>ref|XP_009588631.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial 
[Nicotiana tomentosiformis]
Length=154

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL +AF + G++V A+V+TDR +G SKGFGFV Y T+E+A    
Sbjct  46    STNLFVSGLSKRTTSEGLREAFAKHGEVVNARVVTDRVSGYSKGFGFVRYATLEDAAAGI  105

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFG  1128
             +G++ +FLDGWVIF + A+P+   PPP  ++D+T  G
Sbjct  106   KGLDGQFLDGWVIFAEYARPRP--PPPSIQNDNTAGG  140



>ref|XP_009411997.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=135

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LF+SGLS+ T+ EGL +AF +FG++V A+V+TDR +G SKGFGFV Y T+EEA +  
Sbjct  32    STNLFISGLSKRTTSEGLREAFSKFGQIVYARVVTDRISGFSKGFGFVRYATLEEAAEGI  91

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             +GM+ KFLDGWVIF + A+P   R PP 
Sbjct  92    KGMDGKFLDGWVIFAEYARP---RLPPS  116



>emb|CDY43820.1| BnaC03g14530D [Brassica napus]
Length=157

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 70/98 (71%), Gaps = 9/98 (9%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRS----KGFGFVTYETIEEA  1005
             ++ LFVSGLS+ T+ EGL  AF QFG++ +AKV+TDR +G S    KGFGFV Y T+E++
Sbjct  55    STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSCGYSKGFGFVRYATLEDS  114

Query  1006  QKAREGMNAKFLDGWVIFVDPAKPKE-FRP----PPQP  1104
              K   GM+ KFLDGWVIF + A+P+E +RP    PP P
Sbjct  115   AKGIAGMDGKFLDGWVIFAEYARPREPYRPQNNMPPSP  152



>ref|XP_009764151.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial 
[Nicotiana sylvestris]
Length=154

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL +AF + G+++ A+V+TDR +G SKGFGFV Y T+E+A    
Sbjct  46    STNLFVSGLSKRTTSEGLREAFAKHGEVINARVVTDRVSGYSKGFGFVRYATLEDAAAGI  105

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDSTTFG  1128
             +G++ +FLDGWVIF + A+P+   PPP  ++D+T  G
Sbjct  106   KGLDGQFLDGWVIFAEYARPRP--PPPSLQNDNTAGG  140



>ref|XP_010092279.1| hypothetical protein L484_021140 [Morus notabilis]
 gb|EXB50913.1| hypothetical protein L484_021140 [Morus notabilis]
Length=143

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 3/86 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ E L++AF QFG++  A+V+TDR +G SKGFGFV Y T+E+A K  
Sbjct  46    SANLFVSGLSKRTTTEKLHEAFSQFGEVEHARVVTDRVSGFSKGFGFVKYTTLEDAAKGI  105

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPP  1095
             EGM+ KFLDGWVIF + A+P   RPP
Sbjct  106   EGMDGKFLDGWVIFAEYARP---RPP  128



>ref|XP_004249429.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial 
[Solanum lycopersicum]
Length=129

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 70/95 (74%), Gaps = 7/95 (7%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             SKLFV GLS YT+++ L++AF Q G+++EAK++TDR + RSKGFGFVTY + +EA+KA +
Sbjct  31    SKLFVGGLSFYTTEKALSEAFSQHGQVIEAKIVTDRVSDRSKGFGFVTYASEDEAEKALQ  90

Query  1021  GMNAKFLDGWVIFVDPAKPKE-------FRPPPQP  1104
              MN K L+G V+FVD AKPK         R PP+P
Sbjct  91    EMNGKPLNGRVVFVDYAKPKTDGGSTPIARGPPEP  125



>ref|XP_010908156.1| PREDICTED: glycine-rich RNA-binding protein 2-like [Elaeis guineensis]
Length=138

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             + LFVSGLS+ T+ EGL +AF +FG++V A+V+TDR +G SKGFGFV Y T+EEA++  +
Sbjct  33    TNLFVSGLSKRTTSEGLGEAFAKFGQVVHARVVTDRVSGYSKGFGFVRYATVEEAEEGIK  92

Query  1021  GMNAKFLDGWVIFVDPAK  1074
             GM+ KFLDGWVIF + A+
Sbjct  93    GMDGKFLDGWVIFAEYAR  110



>ref|XP_010694287.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=143

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  847   LFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGM  1026
             LFVSGLS+ T+ EGL +AF +FG++V A+V+TDR +G SKGFGFV Y TIE+A    +GM
Sbjct  46    LFVSGLSKRTTTEGLQEAFSKFGEVVHARVVTDRVSGYSKGFGFVKYATIEDATAGIKGM  105

Query  1027  NAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             + +FLDGWVIF + A+P+   P  Q
Sbjct  106   DGQFLDGWVIFAEYARPRPTTPTQQ  130



>ref|XP_006339140.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like 
[Solanum tuberosum]
Length=129

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 70/95 (74%), Gaps = 7/95 (7%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             SKLFV GLS YT+++ L++AF Q G+++EAK++TDR + RSKGFGFVTY + +EA+KA +
Sbjct  31    SKLFVGGLSFYTTEKALSEAFSQHGQVIEAKIVTDRVSDRSKGFGFVTYASEDEAEKALQ  90

Query  1021  GMNAKFLDGWVIFVDPAKPKE-------FRPPPQP  1104
              MN K L+G V+FVD AKPK         R PP+P
Sbjct  91    EMNGKPLNGRVVFVDYAKPKTDGGGMPIARGPPEP  125



>ref|XP_009767268.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Nicotiana sylvestris]
Length=129

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 81/129 (63%), Gaps = 14/129 (11%)
 Frame = +1

Query  745   SAFRGILGGHLMPSSIFQSQCASLRFCSTL-TTSKLFVSGLSRYTSDEGLNKAFEQFGKL  921
             +AFR      L+P++       S  F S     SKLFV GLS YTS+ GL++AF Q G++
Sbjct  2     AAFR-----RLLPTNRSTIPSTSALFLSHRGVASKLFVGGLSFYTSENGLSEAFSQHGQV  56

Query  922   VEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE------  1083
             +EAK++ DR + +SKGFGFVTY + +EA+KA + MN K L+G VIFVD AKPK       
Sbjct  57    IEAKIVMDRVSDKSKGFGFVTYASEDEAKKALQEMNGKPLNGRVIFVDYAKPKADFGGGV  116

Query  1084  --FRPPPQP  1104
                R PP+P
Sbjct  117   PIARGPPEP  125



>ref|XP_007027846.1| RNA binding family protein isoform 1 [Theobroma cacao]
 ref|XP_007027847.1| RNA binding family protein isoform 1 [Theobroma cacao]
 ref|XP_007027849.1| RNA binding family protein isoform 1 [Theobroma cacao]
 ref|XP_007027853.1| RNA binding family protein isoform 1 [Theobroma cacao]
 gb|EOY08348.1| RNA binding family protein isoform 1 [Theobroma cacao]
 gb|EOY08349.1| RNA binding family protein isoform 1 [Theobroma cacao]
 gb|EOY08351.1| RNA binding family protein isoform 1 [Theobroma cacao]
 gb|EOY08355.1| RNA binding family protein isoform 1 [Theobroma cacao]
Length=129

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 80/127 (63%), Gaps = 10/127 (8%)
 Frame = +1

Query  745   SAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLV  924
             +A R ++ G+   SS+      +L  C     SKLFV GLS YT+++GL  AF Q+G+++
Sbjct  2     AALRRLITGNPKHSSLIPP---TLLICRRGIASKLFVGGLSFYTTEKGLLDAFSQYGQVM  58

Query  925   EAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE-------  1083
             EAK++TDR +G+SKGFGFVTY   +EA+KA   M+ + L+G VIFVD AKP         
Sbjct  59    EAKIVTDRVSGKSKGFGFVTYACEDEAEKAITQMDRRALNGRVIFVDYAKPTSNLGGSPI  118

Query  1084  FRPPPQP  1104
              R PP P
Sbjct  119   ARGPPDP  125



>ref|XP_008793683.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Phoenix dactylifera]
Length=162

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
              LFVSGLS+ T+ EGLN+AF +FG++V+A+V+TDR +G SKGFGFV Y T+EEA +  +G
Sbjct  75    NLFVSGLSKRTTSEGLNEAFSKFGQVVQARVVTDRVSGYSKGFGFVRYTTVEEAAEGIKG  134

Query  1024  MNAKFLDGWVIFVDPA  1071
             M+ KFLDGWVIF + A
Sbjct  135   MDGKFLDGWVIFAEYA  150



>ref|XP_009601004.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=129

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 84/133 (63%), Gaps = 16/133 (12%)
 Frame = +1

Query  745   SAFRGILGGHLMPS--SIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGK  918
             +AFR      L+P+  SI  S  A +        SKLFV GLS YT++ GL++AF Q G+
Sbjct  2     AAFR-----RLLPTNRSILPSTSA-IFLSHRGVASKLFVGGLSFYTTENGLSEAFSQHGQ  55

Query  919   LVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE-----  1083
             ++EAK++ DR + +SKGFGFVTY + +EA+KA + MN K L+G VIFVD AKPK      
Sbjct  56    VIEAKIVMDRVSDKSKGFGFVTYASEDEAEKALQEMNGKPLNGRVIFVDYAKPKADFGGG  115

Query  1084  ---FRPPPQPESD  1113
                 R PP+P ++
Sbjct  116   MPIARGPPEPPTE  128



>ref|XP_009355558.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Pyrus x bretschneideri]
Length=142

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ E L++AF QFG++V A+V+TDR +G SKGFGFV Y T+E+A K  
Sbjct  45    STNLFVSGLSKRTTTEKLHEAFSQFGEVVHARVVTDRVSGYSKGFGFVKYATLEDAAKGI  104

Query  1018  EGMNAKFLDGWVIFVDPA  1071
             EGM+ KFLDGWVIF + A
Sbjct  105   EGMDGKFLDGWVIFAEYA  122



>ref|XP_008349953.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
isoform X1 [Malus domestica]
Length=142

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ E L++AF QFG++V A+V+TDR +G SKGFGFV Y T+E+A K  
Sbjct  45    STNLFVSGLSKRTTTEKLHEAFSQFGEVVHARVVTDRVSGYSKGFGFVKYXTLEDAAKGI  104

Query  1018  EGMNAKFLDGWVIFVDPA  1071
             EGM+ KFLDGWVIF + A
Sbjct  105   EGMDGKFLDGWVIFAEYA  122



>ref|XP_008349954.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial-like 
isoform X2 [Malus domestica]
Length=137

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ E L++AF QFG++V A+V+TDR +G SKGFGFV Y T+E+A K  
Sbjct  45    STNLFVSGLSKRTTTEKLHEAFSQFGEVVHARVVTDRVSGYSKGFGFVKYXTLEDAAKGI  104

Query  1018  EGMNAKFLDGWVIFVDPA  1071
             EGM+ KFLDGWVIF + A
Sbjct  105   EGMDGKFLDGWVIFAEYA  122



>gb|KDP39011.1| hypothetical protein JCGZ_00768 [Jatropha curcas]
Length=277

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
             +LFVSGL++ T+ E L ++F QFG++V AKV+TDR +G SKGFGFV Y TIE+A KA +G
Sbjct  49    QLFVSGLNKRTTTEKLKESFSQFGEVVHAKVVTDRVSGYSKGFGFVRYATIEDAAKAIQG  108

Query  1024  MNAKFLDGWVIFVDPAKPKEF  1086
             M+ KFLDGWVIF + ++PK+ 
Sbjct  109   MDGKFLDGWVIFAEYSRPKQL  129



>ref|XP_008784055.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Phoenix dactylifera]
Length=163

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 76/116 (66%), Gaps = 12/116 (10%)
 Frame = +1

Query  790   IFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKG  969
             +  SQ  S R  +    SKLFV G+S YT++E L++AF Q+G+++EAK+I DRA+ RSKG
Sbjct  51    LLPSQLVSFRGIA----SKLFVGGISFYTTEEALSEAFSQYGQVIEAKIIMDRASERSKG  106

Query  970   FGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPK--------EFRPPPQPESD  1113
             FGFVT+ + +EA+ AR  MN K L+G VIFVD AK K          R PP+P  +
Sbjct  107   FGFVTFASEDEAKTARTEMNGKVLNGRVIFVDNAKAKLRFNDPLPVARGPPEPSGN  162



>ref|XP_006851173.1| hypothetical protein AMTR_s00043p00170970 [Amborella trichopoda]
 gb|ERN12754.1| hypothetical protein AMTR_s00043p00170970 [Amborella trichopoda]
Length=93

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  856   SGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAK  1035
             +GLS+ T+ EGL +AF +FG++V A+V+TDR +G SKGFGFV Y T EEA +   GM+ K
Sbjct  7     AGLSKRTTTEGLREAFSKFGQVVHARVVTDRVSGYSKGFGFVKYATQEEAAEGIAGMDGK  66

Query  1036  FLDGWVIFVDPAKPKEFRPPPQPE  1107
             FLDGWVIF + A+P+   PP Q E
Sbjct  67    FLDGWVIFAEYARPRTPNPPSQTE  90



>ref|XP_004294323.1| PREDICTED: nucleolin-like [Fragaria vesca subsp. vesca]
Length=141

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGL++ T+ EGL+KAF  FG++V+A+V+TDR +G SKGFGFV Y T+E+A K +
Sbjct  45    STNLFVSGLNKRTTSEGLHKAFAAFGEVVQARVVTDRVSGFSKGFGFVRYATLEDAAKGK  104

Query  1018  EGMNAKFLDGWVIFVDPA  1071
             +GM+ +FLDGWVIF + A
Sbjct  105   QGMDGQFLDGWVIFAEYA  122



>gb|EYU33582.1| hypothetical protein MIMGU_mgv1a015850mg [Erythranthe guttata]
 gb|EYU33583.1| hypothetical protein MIMGU_mgv1a015850mg [Erythranthe guttata]
Length=143

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF +FG+++ A+V+TDR +G SKG+GFV Y T++EA+   
Sbjct  48    STNLFVSGLSKRTTTEGLRDAFAKFGEVLHARVMTDRVSGYSKGYGFVRYATLQEAEAGI  107

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPP  1095
             +GM+ +FLDGWVIF + A+P+   PP
Sbjct  108   KGMDGQFLDGWVIFAEYARPRPPVPP  133



>ref|XP_008806788.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial 
[Phoenix dactylifera]
Length=139

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             + LFVSGLS+ T+ EGL +AF +FG+++ A+V+TDR +G SKGFGFV Y T+EEA +  +
Sbjct  33    TNLFVSGLSKRTTSEGLREAFSKFGQVIHARVVTDRVSGYSKGFGFVRYTTVEEAAEGIK  92

Query  1021  GMNAKFLDGWVIFVDPAK  1074
             GM+ KFLDGWVIF + A+
Sbjct  93    GMDGKFLDGWVIFAEYAR  110



>ref|XP_011094286.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Sesamum indicum]
Length=146

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              SKLFV GLS YT+++GL++AF Q+G++VEAK++ DR + RSKGFGFVTY + +EA+KA 
Sbjct  42    ASKLFVGGLSFYTTEQGLSEAFSQYGQVVEAKIVMDRVSDRSKGFGFVTYASEDEAEKAI  101

Query  1018  EGMNAKFLDGWVIFVDPAKPK  1080
               MN K L+G V+FVD AKP+
Sbjct  102   AEMNGKPLNGRVVFVDYAKPR  122



>ref|XP_006430132.1| hypothetical protein CICLE_v10012994mg [Citrus clementina]
 gb|ESR43372.1| hypothetical protein CICLE_v10012994mg [Citrus clementina]
Length=155

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 77/121 (64%), Gaps = 16/121 (13%)
 Frame = +1

Query  775   LMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRAT  954
             L+P ++F S C  +        SKLFV GLS YTS++GL+ AF Q+G++VEA ++ DR +
Sbjct  27    LIPPTLFIS-CRGI-------ASKLFVGGLSFYTSNKGLSDAFSQYGQVVEANIVMDRVS  78

Query  955   GRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPES  1110
              +SKGFGFVT+ + EEA+KA   MN K LDG VI VD AKPK          R PP+  +
Sbjct  79    DKSKGFGFVTFASHEEAEKALSEMNGKTLDGRVIVVDYAKPKTSFRSGMPIARGPPESIA  138

Query  1111  D  1113
             D
Sbjct  139   D  139



>ref|XP_010241007.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like 
[Nelumbo nucifera]
Length=123

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGL++ T+ EGL ++F +FG++V A+V+TDR +G SKGFGFV Y T+E+A +  
Sbjct  39    STNLFVSGLNKRTTSEGLRESFSKFGEVVYARVVTDRVSGYSKGFGFVRYATLEQAAEGI  98

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPP  1098
             +GM+ KFLDGWVIF + A+P   R PP
Sbjct  99    KGMDGKFLDGWVIFAEYARP---RTPP  122



>gb|ABK22008.1| unknown [Picea sitchensis]
Length=140

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 84/141 (60%), Gaps = 9/141 (6%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCA-SLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQ  909
             M+    FR +LG +L       S C  S  F S   T+KLFV GLS YT+++ L +AF +
Sbjct  1     MSMVPGFRRLLGNYL------SSPCPRSTVFFSRGVTTKLFVGGLSFYTTEKALTEAFSR  54

Query  910   FGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFR  1089
             FG++VE KV+ DR + RSKGFGFV Y +  +A++A+  MN K L G +IFVD  KPK   
Sbjct  55    FGEVVEVKVVMDRVSQRSKGFGFVQYASEADAERAKAEMNGKVLSGRIIFVDTVKPKSQL  114

Query  1090  PPPQPESDSTTFGIRSNKTIG  1152
                 P   +T   + S+KT+G
Sbjct  115   SGDLP--SATVPPVLSSKTVG  133



>ref|XP_007212216.1| hypothetical protein PRUPE_ppa013115mg [Prunus persica]
 gb|EMJ13415.1| hypothetical protein PRUPE_ppa013115mg [Prunus persica]
Length=139

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ E L +AF QFG++V A+V+TDR +G SKGFGFV Y T+E+A K  
Sbjct  42    STNLFVSGLSKRTTSEKLQEAFSQFGEVVHARVVTDRVSGYSKGFGFVRYATLEDAGKGI  101

Query  1018  EGMNAKFLDGWVIFVDPAK  1074
             +GM+ KFLDGWVIF + A+
Sbjct  102   DGMDGKFLDGWVIFAEYAR  120



>gb|EYU35528.1| hypothetical protein MIMGU_mgv1a016093mg [Erythranthe guttata]
Length=134

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 79/129 (61%), Gaps = 9/129 (7%)
 Frame = +1

Query  745   SAFRG-ILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKL  921
             +AFR  I+    +P S       +L   S    SKLFV GLS YT+++GL++AF Q G++
Sbjct  2     AAFRNLIMFSSRLPKSNSTVLIPALLISSRGIASKLFVGGLSFYTTEQGLSEAFSQHGQV  61

Query  922   VEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE------  1083
             +EA ++ DR + RSKGFGFVTY + +EA+KA   MN K L+G  +FVD AKP+       
Sbjct  62    IEATIVMDRVSDRSKGFGFVTYASEDEAEKAIAEMNGKPLNGRTVFVDYAKPRSGSSNSM  121

Query  1084  --FRPPPQP  1104
                R PP+P
Sbjct  122   PIARGPPEP  130



>ref|XP_006481717.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like 
isoform X1 [Citrus sinensis]
Length=155

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 77/121 (64%), Gaps = 16/121 (13%)
 Frame = +1

Query  775   LMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRAT  954
             L+P ++F S C  +        SKLFV GLS YTS++GL+ AF Q+G++VEA ++ DR +
Sbjct  27    LIPPTLFIS-CRGI-------ASKLFVGGLSFYTSNKGLSDAFSQYGQVVEANIVVDRVS  78

Query  955   GRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPES  1110
              +SKGFGFVT+ + +EA+KA   MN K LDG VI VD AKPK          R PP+  +
Sbjct  79    DKSKGFGFVTFASHDEAEKALSEMNGKTLDGRVIIVDYAKPKTSFRSGMPIARGPPESIA  138

Query  1111  D  1113
             D
Sbjct  139   D  139



>ref|XP_008365868.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Malus domestica]
Length=142

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ E L++ F QFG++V A+V+TDR +G SKGFGFV Y T+E+A K  
Sbjct  45    STNLFVSGLSKRTTTEKLHETFSQFGEVVHARVVTDRVSGYSKGFGFVKYATLEDAAKGI  104

Query  1018  EGMNAKFLDGWVIFVDPA  1071
             EGM+ KFLDGWVIF + A
Sbjct  105   EGMDGKFLDGWVIFAEYA  122



>ref|XP_008661991.1| PREDICTED: LOC100283837 isoform X1 [Zea mays]
Length=151

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 67/95 (71%), Gaps = 4/95 (4%)
 Frame = +1

Query  820   FCSTLTTSKL-FVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETI  996
             F S L    +  ++GLS+ T+ EGL +AF +FG+++ A+V+TDR +G SKGFGFV Y T 
Sbjct  38    FVSGLMFPNMGLLAGLSKRTTSEGLREAFAEFGEVLHARVVTDRVSGFSKGFGFVRYATT  97

Query  997   EEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             EEA K  EG + KFLDGWVIF + AKP   RPPP+
Sbjct  98    EEAAKGIEGKDGKFLDGWVIFAEYAKP---RPPPE  129



>gb|AFK43918.1| unknown [Lotus japonicus]
Length=141

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGL++ T+ E L + F +FG++V A+V+TDR +G SKGFGFV Y TIEEA K  
Sbjct  43    STNLFVSGLNKRTTTEKLREEFAKFGEVVHARVVTDRVSGYSKGFGFVKYATIEEASKGI  102

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESDST  1119
             +GM+ KFLDGWVIF + AK     P  QP ++ T
Sbjct  103   QGMDGKFLDGWVIFAEYAKSSP-APGQQPANNMT  135



>ref|XP_006288807.1| hypothetical protein CARUB_v10002139mg [Capsella rubella]
 gb|EOA21705.1| hypothetical protein CARUB_v10002139mg [Capsella rubella]
Length=163

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 79/129 (61%), Gaps = 9/129 (7%)
 Frame = +1

Query  745   SAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLV  924
             +A   I G HL  + +  S  +          SKLFV GLS YT+++GL++AF + G++V
Sbjct  21    AALARIGGRHLKSAGLINSSASCFFTQRRGVASKLFVGGLSFYTTEQGLSEAFSKCGQVV  80

Query  925   EAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEF------  1086
             EA+++ DR + RSKGFGFVT+ + +EAQKA    N + L+G VIFVD AKPK+       
Sbjct  81    EAQIVMDRVSDRSKGFGFVTFASSDEAQKALMEFNGQQLNGRVIFVDYAKPKQILGGGGF  140

Query  1087  ---RPPPQP  1104
                R PP+P
Sbjct  141   PIARGPPEP  149



>ref|XP_002530529.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF31861.1| RNA binding protein, putative [Ricinus communis]
Length=127

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 76/128 (59%), Gaps = 12/128 (9%)
 Frame = +1

Query  745   SAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLV  924
             +A R I G      S   S   S R  +T    KLFV GLS YT+D+GL +AF Q+G++V
Sbjct  3     TAMRRIAGKSAATISTSPSLFVSYRGIAT----KLFVGGLSFYTTDKGLTEAFSQYGQVV  58

Query  925   EAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE-------  1083
             EA +++DR   RSKGFGFVT+ + +EA  A   MN K L+G VI+VD AKP+        
Sbjct  59    EATIVSDRVLDRSKGFGFVTFASEDEAHNALSEMNGKTLNGRVIYVDYAKPRTDSRNEVP  118

Query  1084  -FRPPPQP  1104
               R PP+P
Sbjct  119   IARGPPEP  126



>ref|XP_009373041.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Pyrus x bretschneideri]
Length=134

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +1

Query  823   CSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEE  1002
             C  + T KLFV GLS YT+++GL++AF Q+G+++EA++++DR + RSKGFGFVT+ + +E
Sbjct  30    CRGIAT-KLFVGGLSFYTNEKGLSEAFSQYGQVIEAQIVSDRVSERSKGFGFVTFASEDE  88

Query  1003  AQKAREGMNAKFLDGWVIFVDPAKPK  1080
             A KA E MN K L+G VIFVD AKP+
Sbjct  89    AHKALEEMNGKPLNGRVIFVDYAKPR  114



>ref|XP_009349614.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
isoform X2 [Pyrus x bretschneideri]
Length=134

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +1

Query  823   CSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEE  1002
             C  + T KLFV GLS YT+++GL++AF Q+G+++EA++++DR + RSKGFGFVT+ + +E
Sbjct  30    CRGIAT-KLFVGGLSFYTNEKGLSEAFSQYGQVIEAQIVSDRVSERSKGFGFVTFASEDE  88

Query  1003  AQKAREGMNAKFLDGWVIFVDPAKPK  1080
             A KA E MN K L+G VIFVD AKP+
Sbjct  89    AHKALEEMNGKPLNGRVIFVDYAKPR  114



>ref|XP_010931869.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Elaeis guineensis]
Length=138

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
              LF+SGLS+ T+ EGL +AF +FG++ +A+V+TDR +G SKGFGFV+Y T+EEA +  +G
Sbjct  34    NLFISGLSKRTTSEGLREAFSKFGQVFQARVVTDRVSGYSKGFGFVSYATVEEAAEGIKG  93

Query  1024  MNAKFLDGWVIFVDPA  1071
             M+ KFLDGWVIF + A
Sbjct  94    MDGKFLDGWVIFAEYA  109



>ref|XP_009402592.1| PREDICTED: glycine-rich RNA-binding protein 2, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=132

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LF+SGLS+ T+ EGL +AF +FG+++ A+V+TDR +G SKGFGFV Y T+ EA +  
Sbjct  32    STNLFISGLSKRTTSEGLMEAFSKFGQIIHARVVTDRVSGYSKGFGFVRYATLAEAAEGI  91

Query  1018  EGMNAKFLDGWVIFVDPAK  1074
             +GM+ KFLDGWVIF + A+
Sbjct  92    KGMDGKFLDGWVIFAEYAR  110



>gb|KHG12622.1| Glycine-rich RNA-binding 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=171

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             SKLFV GLS YT+++GL  AF Q+G+++EAK+ITDR + +SKGFGFVTY + +EA+KA  
Sbjct  63    SKLFVGGLSFYTTEKGLLDAFSQYGQVMEAKIITDRVSDKSKGFGFVTYASEDEAEKAIA  122

Query  1021  GMNAKFLDGWVIFVDPAKPKE--------FRPPPQP  1104
              MN K L+G VIFVD AKPK          R PP P
Sbjct  123   EMNGKDLNGRVIFVDYAKPKLAIGGGMPIARGPPDP  158



>ref|XP_008391940.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Malus domestica]
Length=134

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +1

Query  823   CSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEE  1002
             C  + T KLFV GLS YT+++GL++AF Q+G+++EA++++DR + RSKGFGFVT+ + +E
Sbjct  30    CRGIAT-KLFVGGLSFYTNEKGLSEAFSQYGQVIEAQIVSDRVSERSKGFGFVTFASEDE  88

Query  1003  AQKAREGMNAKFLDGWVIFVDPAKPK  1080
             A KA E MN K L+G VIFVD AKP+
Sbjct  89    AHKALEEMNGKPLNGRVIFVDYAKPR  114



>ref|XP_009349607.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
isoform X1 [Pyrus x bretschneideri]
Length=146

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +1

Query  823   CSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEE  1002
             C  + T KLFV GLS YT+++GL++AF Q+G+++EA++++DR + RSKGFGFVT+ + +E
Sbjct  30    CRGIAT-KLFVGGLSFYTNEKGLSEAFSQYGQVIEAQIVSDRVSERSKGFGFVTFASEDE  88

Query  1003  AQKAREGMNAKFLDGWVIFVDPAKPK  1080
             A KA E MN K L+G VIFVD AKP+
Sbjct  89    AHKALEEMNGKPLNGRVIFVDYAKPR  114



>ref|XP_010267842.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Nelumbo nucifera]
Length=140

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             +  LFVSGLS+ T+ EGL +AF +FG++V AKV+TDR +G SKGFGFV Y T+E+A +  
Sbjct  42    SPNLFVSGLSKRTTSEGLREAFSKFGEVVHAKVVTDRVSGYSKGFGFVRYATVEQAAEGI  101

Query  1018  EGMNAKFLDGWVIFVD  1065
             +GM+ KFLDGWVIF +
Sbjct  102   KGMDGKFLDGWVIFAE  117



>ref|XP_006836085.1| hypothetical protein AMTR_s00114p00125610 [Amborella trichopoda]
 gb|ERM98938.1| hypothetical protein AMTR_s00114p00125610 [Amborella trichopoda]
Length=135

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 70/103 (68%), Gaps = 9/103 (9%)
 Frame = +1

Query  772   HLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRA  951
             H +PS +  S+  +         SK+FV GLS YT++  L++AF QFG+++EAK+I DR 
Sbjct  21    HCLPSQLLFSRKIA---------SKVFVGGLSFYTTENALSEAFSQFGQVIEAKIIMDRV  71

Query  952   TGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPK  1080
             + RSKGFGFVTY + +EAQ+A   MN K L+G +IFVD AK K
Sbjct  72    SDRSKGFGFVTYASEDEAQRAITEMNGKVLNGRIIFVDTAKSK  114



>ref|XP_010062940.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial 
isoform X1 [Eucalyptus grandis]
 gb|KCW70091.1| hypothetical protein EUGRSUZ_F03395 [Eucalyptus grandis]
Length=140

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              + LFVSGLS+ T+ E L +AF QFG++V A+V++DR +G SKGFGFV Y T+E+A K  
Sbjct  43    NTNLFVSGLSKRTTTEKLREAFSQFGEVVHARVVSDRISGYSKGFGFVRYATLEDAAKGI  102

Query  1018  EGMNAKFLDGWVIFVD  1065
             EGMN K+LDGWVIF +
Sbjct  103   EGMNGKYLDGWVIFAE  118



>ref|XP_007207675.1| hypothetical protein PRUPE_ppa023139mg, partial [Prunus persica]
 gb|EMJ08874.1| hypothetical protein PRUPE_ppa023139mg, partial [Prunus persica]
Length=134

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFV+GL++ T+ E LN+AF QFG++V  KV+ DR +G SKGFGFV Y T+E+A+K  
Sbjct  50    STTLFVAGLNKRTTPEKLNEAFSQFGEVVNVKVVIDRDSGFSKGFGFVNYATLEDAEKGV  109

Query  1018  EGMNAKFLDGWVIFVDPAKPK  1080
             +GM+A+ LDGWVIF + A+PK
Sbjct  110   KGMDAQVLDGWVIFTEFARPK  130



>ref|XP_008241226.1| PREDICTED: glycine-rich RNA-binding protein 6, mitochondrial-like 
[Prunus mume]
Length=135

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              + LFV+GL++ T+ E LN+AF QFG++V  KV+ DR +G SKGFGFV Y T+E+A+K  
Sbjct  50    NTTLFVAGLNKRTTPEKLNEAFSQFGEVVNVKVVIDRDSGFSKGFGFVNYATLEDAEKGV  109

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
             +GM+A+ LDGWVIF + A+PK  R P Q
Sbjct  110   KGMDAQVLDGWVIFTEFARPK--RIPGQ  135



>ref|XP_011097943.1| PREDICTED: glycine-rich RNA-binding protein 2, mitochondrial 
isoform X1 [Sesamum indicum]
Length=143

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++ LFVSGLS+ T+ EGL  AF +FG++V AKV+TDR +G SKGFGFV Y TIE A+   
Sbjct  48    STNLFVSGLSKRTTTEGLRDAFAKFGEVVHAKVVTDRVSGYSKGFGFVQYATIEHAEAGI  107

Query  1018  EGMNAKFLDGWVIFVDPA  1071
             +GM+ +FLDGWVIF + A
Sbjct  108   KGMDGQFLDGWVIFAEYA  125



>ref|XP_010037288.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
isoform X1 [Eucalyptus grandis]
 gb|KCW48964.1| hypothetical protein EUGRSUZ_K02572 [Eucalyptus grandis]
Length=133

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 69/100 (69%), Gaps = 8/100 (8%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              SKLFV GLS YT+D+ L ++F QFG++VEAKV+ DR + RSKGFGFVT+ + +EA +A 
Sbjct  32    VSKLFVGGLSFYTTDKILAESFSQFGQVVEAKVVIDRVSDRSKGFGFVTFASEDEAYRAL  91

Query  1018  EGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPESD  1113
               MN K L+G ++FVD AKP+          R PP+P+ D
Sbjct  92    TQMNGKTLNGRIVFVDYAKPQLGEKLGMPIARGPPEPKVD  131



>ref|XP_008442872.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Cucumis melo]
Length=134

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 12/113 (11%)
 Frame = +1

Query  799   SQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGF  978
             S+  S R  +T    KLFV GLS YT+D+GL++AF Q+G+++EA V+ DR + +SKGFGF
Sbjct  25    SRLVSFRGIAT----KLFVGGLSYYTTDKGLSEAFSQYGQVIEATVVMDRVSDKSKGFGF  80

Query  979   VTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPESD  1113
             VT+ +I+EA  A   MN K L+G VIFV+ AKP           R PP+ ++D
Sbjct  81    VTFASIDEAHTALSEMNGKPLNGRVIFVNYAKPTTSTRGSIPIARGPPEEKTD  133



>ref|NP_001150518.1| ELAV-like protein 4 [Zea mays]
 ref|XP_008667960.1| PREDICTED: ELAV-like protein 4 isoform X1 [Zea mays]
 gb|ACG39382.1| ELAV-like protein 4 [Zea mays]
 tpg|DAA41090.1| TPA: ELAV-like protein 4 [Zea mays]
Length=129

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             + LFVSGL++ T+ EGL +AF +FG+++EA+VITDR +G S+GFGFV Y T++EA +A +
Sbjct  34    NNLFVSGLNKRTTSEGLKEAFSKFGQVIEARVITDRISGYSRGFGFVKYATVQEAGEAIK  93

Query  1021  GMNAKFLDGWVIFVD  1065
             GM+ KFLD WVIF +
Sbjct  94    GMDGKFLDSWVIFAE  108



>ref|XP_009355962.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial 
[Pyrus x bretschneideri]
Length=179

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
             KL+VSGLS  T++E L  AF+ FG+LVE K++ DR   R +GF F+ YET E++QKA EG
Sbjct  87    KLYVSGLSFRTTEESLRNAFQNFGQLVEVKLVMDRIANRPRGFAFLRYETEEQSQKAIEG  146

Query  1024  MNAKFLDGWVIFVDPAKPK-EFRPPPQ  1101
             M+ KFLDG VIFV+ AKP+ E R  P+
Sbjct  147   MHGKFLDGRVIFVEVAKPRSELRQNPK  173



>ref|XP_006399088.1| hypothetical protein EUTSA_v10014928mg [Eutrema salsugineum]
 gb|ESQ40541.1| hypothetical protein EUTSA_v10014928mg [Eutrema salsugineum]
Length=150

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 80/125 (64%), Gaps = 11/125 (9%)
 Frame = +1

Query  763   LGGHLMPSSIFQSQCASLRFCSTL-TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVI  939
             +GG  + S+   +  ASL F       SKLFV GLS YT+++GL++AF Q G++VEA+++
Sbjct  7     IGGRHLKSTGLINSPASLFFTQRRGVASKLFVGGLSFYTTEQGLSEAFSQCGQVVEAQIV  66

Query  940   TDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE----------FR  1089
              DR + RSKGFGFVT+ + +EAQKA   +N + L+G VIFVD AK K+           R
Sbjct  67    MDRVSDRSKGFGFVTFASDDEAQKALMELNGQQLNGRVIFVDYAKEKQSFGGLGGLPIAR  126

Query  1090  PPPQP  1104
              PP+P
Sbjct  127   GPPEP  131



>ref|XP_004161215.1| PREDICTED: glycine-rich RNA-binding protein 2, mitochondrial-like 
[Cucumis sativus]
Length=134

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 74/113 (65%), Gaps = 12/113 (11%)
 Frame = +1

Query  799   SQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGF  978
             S+  S R  +T    KLFV GLS YT+D+GL++AF Q+G+++EA V+ DR + +SKGFGF
Sbjct  25    SRLVSFRAIAT----KLFVGGLSYYTTDKGLSEAFSQYGQVIEATVVMDRVSDKSKGFGF  80

Query  979   VTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPESD  1113
             VT+ +++EA  A   MN K L+G VIFV+ AKP           R PP+ ++D
Sbjct  81    VTFASLDEAHTALSEMNGKPLNGRVIFVNYAKPTTSSRGAIPIARGPPEEKTD  133



>ref|XP_006652268.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Oryza brachyantha]
Length=136

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 68/102 (67%), Gaps = 9/102 (9%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             T +LF+ GLS++ +++ L  AF Q+G+++EA ++TD+ T R KGFGFV + + EEA KAR
Sbjct  35    TYRLFIGGLSQFATEDSLADAFSQYGQVLEATIVTDKMTNRPKGFGFVKFASEEEANKAR  94

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFR---------PPPQPESDS  1116
             EGMN K L+G VI+VD AK K  R          PP+P  +S
Sbjct  95    EGMNGKVLNGRVIYVDIAKAKMNRVADSSPGATGPPKPPDNS  136



>ref|XP_006424180.1| hypothetical protein CICLE_v10029552mg [Citrus clementina]
 ref|XP_006481500.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Citrus sinensis]
 gb|ESR37420.1| hypothetical protein CICLE_v10029552mg [Citrus clementina]
Length=136

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 63/101 (62%), Gaps = 8/101 (8%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             TSKLFV G+S  T++E L  AF QFG++ EA +ITD+   RSKG+G+VT+ T EEAQ A 
Sbjct  34    TSKLFVKGVSFSTTEEMLADAFSQFGQVTEATIITDKGKNRSKGYGYVTFSTEEEAQNAL  93

Query  1018  EGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPESDS  1116
               MN K LDG V+FVD  +P           R PPQ   DS
Sbjct  94    TEMNGKLLDGRVLFVDNVRPSRRYNTDVPLARQPPQSAEDS  134



>ref|XP_004149190.1| PREDICTED: glycine-rich RNA-binding protein 2, mitochondrial-like 
[Cucumis sativus]
 gb|KGN59159.1| hypothetical protein Csa_3G777670 [Cucumis sativus]
Length=134

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 74/113 (65%), Gaps = 12/113 (11%)
 Frame = +1

Query  799   SQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGF  978
             S+  S R  +T    KLFV GLS YT+D+GL++AF Q+G+++EA V+ DR + +SKGFGF
Sbjct  25    SRLVSYRGIAT----KLFVGGLSYYTTDKGLSEAFSQYGQVIEATVVMDRVSDKSKGFGF  80

Query  979   VTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPESD  1113
             VT+ +++EA  A   MN K L+G VIFV+ AKP           R PP+ ++D
Sbjct  81    VTFASLDEAHTALSEMNGKPLNGRVIFVNYAKPTTSSRGAIPIARGPPEEKTD  133



>ref|XP_010654123.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
isoform X2 [Vitis vinifera]
Length=111

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 71/101 (70%), Gaps = 8/101 (8%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             T K + +GLS YT+++GL++ F Q+G++VEAK++ DR + RSKGFGFVT+ + EEAQKAR
Sbjct  11    TWKSWKNGLSFYTTEKGLSEHFSQYGQVVEAKIVMDRVSDRSKGFGFVTFASEEEAQKAR  70

Query  1018  EGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPESDS  1116
               M+ K L+G  IFVD AKP+          R PP+P +DS
Sbjct  71    TEMDGKELNGRTIFVDYAKPRADFGGGMPIARGPPEPTADS  111



>ref|XP_010452534.1| PREDICTED: glycine-rich RNA-binding protein 5, mitochondrial-like 
[Camelina sativa]
Length=139

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 80/132 (61%), Gaps = 11/132 (8%)
 Frame = +1

Query  763   LGGHLMPSSIFQSQCASLRFCSTL-TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVI  939
             +GG  + S+   +  AS  F       SKLFV GLS YT+++GL++ F ++G++VEA+++
Sbjct  7     IGGRYLKSAGLINSSASCFFTQRRGVASKLFVGGLSFYTTEQGLSEEFSKYGQVVEAQIV  66

Query  940   TDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE----------FR  1089
              DR + RSKGFGFVT+ + +EAQKA   +N + L G VIFVD AKPK+           R
Sbjct  67    MDRVSDRSKGFGFVTFASNDEAQKALMELNGQQLHGRVIFVDYAKPKQSLGGGGGFPIAR  126

Query  1090  PPPQPESDSTTF  1125
              PP   +   TF
Sbjct  127   GPPDEPTGGPTF  138



>ref|XP_008240373.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial 
[Prunus mume]
Length=183

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  835   TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKA  1014
             T++KL+VSGLS  T++E L  AF+ FG+LVE  ++ DR   R +GF F+ Y T EE+QKA
Sbjct  88    TSTKLYVSGLSFRTTEESLRNAFQNFGQLVEVNLVMDRIANRPRGFAFLRYATEEESQKA  147

Query  1015  REGMNAKFLDGWVIFVDPAKPK-EFRPPPQ  1101
              EG++ KFLDG VIFV+ AKP+ E R  P+
Sbjct  148   IEGLHGKFLDGRVIFVEVAKPRSELRQTPK  177



>gb|KFK25023.1| hypothetical protein AALP_AA8G056800 [Arabis alpina]
Length=161

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 78/129 (60%), Gaps = 9/129 (7%)
 Frame = +1

Query  745   SAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLV  924
             +A   I   HL  + I  S  +          SKLFV GLS YT+++GL++AF QFG+++
Sbjct  2     AALARISARHLKSAGIINSSASCFFTQRRGVASKLFVGGLSFYTTEQGLSEAFSQFGQVI  61

Query  925   EAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE-------  1083
             EA+++ DR + +SKGFGFVT+ + +EA+KA   +N + L G V+FVD AK K+       
Sbjct  62    EAQIVMDRVSDKSKGFGFVTFASDDEARKALTELNGQQLHGRVVFVDYAKAKQSFRGGGF  121

Query  1084  --FRPPPQP  1104
                R PP+P
Sbjct  122   PIARGPPEP  130



>ref|NP_001237108.1| uncharacterized protein LOC100305561 [Glycine max]
 gb|ACU13305.1| unknown [Glycine max]
 gb|KHN24534.1| Glycine-rich RNA-binding protein GRP2A [Glycine soja]
Length=180

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             +KL+VSGLS  T++E L  AF+ FG+LVE K++ DR   R +GF F+ Y T EE+QKA E
Sbjct  88    TKLYVSGLSFRTTEESLRNAFKNFGQLVEVKLVMDRIANRPRGFAFLRYATEEESQKAIE  147

Query  1021  GMNAKFLDGWVIFVDPAKPK  1080
             GM+ KFLDG VIFV+ AKP+
Sbjct  148   GMHGKFLDGRVIFVEVAKPR  167



>ref|XP_004515251.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Cicer arietinum]
Length=183

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +1

Query  799   SQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGF  978
             S  A L   S+  ++KL+VSGLS  T++E L  AF+ FG+LVE  ++ D+   R +GFGF
Sbjct  78    SVLACLPSSSSSPSTKLYVSGLSFRTTEESLRNAFKNFGQLVEVNLVMDKVANRPRGFGF  137

Query  979   VTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPK  1080
             + YET EE++KA EGM+ KFLDG VIFV+ AKP+
Sbjct  138   LRYETEEESKKAIEGMHGKFLDGRVIFVEVAKPR  171



>gb|EMT07034.1| ELAV-like protein 1 [Aegilops tauschii]
Length=228

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 3/82 (4%)
 Frame = +1

Query  856   SGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAK  1035
             +GLS+ T+ +GL +AF +FG++  A+V+TDR TG SKGFGFV Y ++E+A K  EGM+ K
Sbjct  129   AGLSKRTTTDGLREAFAKFGEVEHARVVTDRVTGFSKGFGFVRYVSVEDAAKGIEGMDGK  188

Query  1036  FLDGWVIFVDPAKPKEFRPPPQ  1101
             FLDGWVIF + A+P   RPPPQ
Sbjct  189   FLDGWVIFAEYARP---RPPPQ  207



>ref|XP_003581210.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Brachypodium distachyon]
Length=137

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 71/103 (69%), Gaps = 9/103 (9%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             T KLF+ GLS++ +++ L +AF ++G+++EA ++TD+ T RSKGFGFV + + EEA KAR
Sbjct  35    THKLFIGGLSQFATEDTLAEAFARYGQVLEATIVTDKMTNRSKGFGFVKFASEEEANKAR  94

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRP---------PPQPESDST  1119
             + MN K L+G VI+VD AK K+ R          PP+P  +S+
Sbjct  95    DEMNGKVLNGRVIYVDIAKAKQDRATDVLPIASGPPKPIGNSS  137



>ref|XP_006390546.1| hypothetical protein EUTSA_v10019191mg [Eutrema salsugineum]
 gb|ESQ27832.1| hypothetical protein EUTSA_v10019191mg [Eutrema salsugineum]
Length=187

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             +KL+VSGLS  T+++ L KAFEQFGKLV   ++ D+   R +GF F+ YET EE+ KA E
Sbjct  82    TKLYVSGLSFRTTEDNLRKAFEQFGKLVFVNLVMDKVANRPRGFAFLRYETEEESMKAIE  141

Query  1021  GMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
             GM+ KFLDG VIFV+ AKP+      +P SD
Sbjct  142   GMHGKFLDGRVIFVEEAKPRSDIQRAKPRSD  172



>ref|XP_010093775.1| Cold-inducible RNA-binding protein [Morus notabilis]
 gb|EXB54608.1| Cold-inducible RNA-binding protein [Morus notabilis]
Length=134

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 8/100 (8%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             SKLFV GLS  T++  L +AF Q+G++VEAK++ ++ + +SKGFGFVT+ +++EA  A  
Sbjct  35    SKLFVGGLSFSTNETALTEAFSQYGQVVEAKIVMNKVSDKSKGFGFVTFASVDEAHNALT  94

Query  1021  GMNAKFLDGWVIFVDPAKPK-EF-------RPPPQPESDS  1116
              MN K L+G VIFVD AKPK +F       R PP+P+ D+
Sbjct  95    EMNGKALNGRVIFVDYAKPKTDFSEAVPIARGPPEPQPDT  134



>ref|XP_004301228.1| PREDICTED: cold-inducible RNA-binding protein-like [Fragaria 
vesca subsp. vesca]
Length=166

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             +KL+VSGLS  T++E L  AF+ FG+LVE  ++ DR   R +GF F+ YET EE+QKA +
Sbjct  73    TKLYVSGLSFRTTEESLRNAFQNFGRLVEVNLVMDRIANRPRGFAFLRYETEEESQKAIK  132

Query  1021  GMNAKFLDGWVIFVDPAKPK-EFRPPPQ  1101
             GM+ KFLDG VIFV+ AKP+ E R  P+
Sbjct  133   GMHGKFLDGRVIFVEEAKPRSELRQTPR  160



>gb|KHN18798.1| Glycine-rich RNA-binding protein 2 [Glycine soja]
Length=152

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 67/101 (66%), Gaps = 8/101 (8%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
             KLFV GLS YT++  L++AF  +G+++EAK++TDR + RSKGFGFVT+ + +EA+ A E 
Sbjct  52    KLFVGGLSFYTTENALSEAFSNYGQVIEAKIVTDRVSDRSKGFGFVTFASQDEAENAIED  111

Query  1024  MNAKFLDGWVIFVDPAKPK--------EFRPPPQPESDSTT  1122
             M  K L+G VIFVD AKP           R PP+P S   T
Sbjct  112   MKGKTLNGRVIFVDYAKPNINTRGEIPIARGPPEPTSTPDT  152



>ref|NP_001238370.1| uncharacterized protein LOC100527079 [Glycine max]
 gb|ACU16121.1| unknown [Glycine max]
Length=130

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 67/101 (66%), Gaps = 8/101 (8%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
             KLFV GLS YT++  L++AF  +G+++EAK++TDR + RSKGFGFVT+ + +EA+ A E 
Sbjct  30    KLFVGGLSFYTTENALSEAFSNYGQVIEAKIVTDRVSDRSKGFGFVTFASQDEAENAIED  89

Query  1024  MNAKFLDGWVIFVDPAKPK--------EFRPPPQPESDSTT  1122
             M  K L+G VIFVD AKP           R PP+P S   T
Sbjct  90    MKGKTLNGRVIFVDYAKPNINTRGEIPIARGPPEPTSTPDT  130



>ref|XP_002263021.1| PREDICTED: glycine-rich RNA-binding protein blt801 [Vitis vinifera]
 emb|CBI30580.3| unnamed protein product [Vitis vinifera]
Length=133

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 78/119 (66%), Gaps = 5/119 (4%)
 Frame = +1

Query  748   AFRGILGGHLMPSSIFQSQCASLRFC--STLTTSKLFVSGLSRYTSDEGLNKAFEQFGKL  921
             A R  L      +S+F SQ  +      + + ++ LF+SGL++ T+ E LN+   +FG++
Sbjct  2     ATRAGLLKRFFSTSMFSSQTTAAANAKPAPIPSTTLFISGLNKRTTSEKLNEEASKFGEV  61

Query  922   VEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPP  1098
             V A+V+TDR++G SKGFGFV Y TI +A++  +G++A+FLDGWVIF + A+    R PP
Sbjct  62    VHARVVTDRSSGYSKGFGFVKYATIAQAEQGIKGLDAQFLDGWVIFAEFARS---RTPP  117



>ref|XP_006430131.1| hypothetical protein CICLE_v10012994mg [Citrus clementina]
 gb|ESR43371.1| hypothetical protein CICLE_v10012994mg [Citrus clementina]
Length=139

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 8/96 (8%)
 Frame = +1

Query  850   FVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMN  1029
             +V+GLS YTS++GL+ AF Q+G++VEA ++ DR + +SKGFGFVT+ + EEA+KA   MN
Sbjct  28    YVAGLSFYTSNKGLSDAFSQYGQVVEANIVMDRVSDKSKGFGFVTFASHEEAEKALSEMN  87

Query  1030  AKFLDGWVIFVDPAKPKE--------FRPPPQPESD  1113
              K LDG VI VD AKPK          R PP+  +D
Sbjct  88    GKTLDGRVIVVDYAKPKTSFRSGMPIARGPPESIAD  123



>gb|KDO39061.1| hypothetical protein CISIN_1g032812mg [Citrus sinensis]
Length=133

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 8/96 (8%)
 Frame = +1

Query  850   FVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMN  1029
             +V+GLS YTS++GL+ AF Q+G++VEA ++ DR + +SKGFGFVT+ + EEA+KA   MN
Sbjct  22    YVAGLSFYTSNKGLSDAFSQYGQVVEANIVMDRVSDKSKGFGFVTFASHEEAEKALSEMN  81

Query  1030  AKFLDGWVIFVDPAKPKE--------FRPPPQPESD  1113
              K LDG VI VD AKPK          R PP+  +D
Sbjct  82    GKTLDGRVIVVDYAKPKTSFRSGMPIARGPPESIAD  117



>ref|XP_007152596.1| hypothetical protein PHAVU_004G143300g [Phaseolus vulgaris]
 gb|ESW24590.1| hypothetical protein PHAVU_004G143300g [Phaseolus vulgaris]
Length=188

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
             KL+VSGLS  T++E L  AF+ FG+LVE K++ DR   R +GF F+ Y T EE+QKA EG
Sbjct  97    KLYVSGLSFRTTEESLRNAFKNFGQLVEVKLVMDRIANRPRGFAFLRYATEEESQKAIEG  156

Query  1024  MNAKFLDGWVIFVDPAKPKEFRP  1092
             M+ KFLDG VIFV+ AKP+   P
Sbjct  157   MHGKFLDGRVIFVEIAKPRSELP  179



>ref|XP_011000775.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
isoform X1 [Populus euphratica]
Length=181

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             +KL+VSGLS  T++E L  AF+ FG+LV+  ++ D+   R +GF F+ YET EEAQKA E
Sbjct  90    TKLYVSGLSFRTTEESLRNAFQNFGQLVDVNLVMDKVAKRPRGFAFLRYETEEEAQKAIE  149

Query  1021  GMNAKFLDGWVIFVDPAKPK  1080
             GM+ KFLDG VIFV+ AKP+
Sbjct  150   GMHGKFLDGRVIFVEVAKPR  169



>ref|XP_006487934.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Citrus sinensis]
Length=115

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 62/101 (61%), Gaps = 8/101 (8%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             TSKLFV G+S  T++E L  AF QFG++ EA +ITD+   RSK +GFVT+ T EEAQ A 
Sbjct  13    TSKLFVKGVSFSTTEEMLADAFSQFGQVTEATIITDKGKNRSKCYGFVTFSTKEEAQNAL  72

Query  1018  EGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPESDS  1116
               MN K LDG V+FVD  +P           R PPQ   DS
Sbjct  73    TEMNGKLLDGRVLFVDNVRPSRRYNTDVPLARQPPQSAEDS  113



>ref|XP_002964561.1| hypothetical protein SELMODRAFT_81392, partial [Selaginella moellendorffii]
 ref|XP_002988836.1| hypothetical protein SELMODRAFT_128832, partial [Selaginella 
moellendorffii]
 gb|EFJ10098.1| hypothetical protein SELMODRAFT_128832, partial [Selaginella 
moellendorffii]
 gb|EFJ34894.1| hypothetical protein SELMODRAFT_81392, partial [Selaginella moellendorffii]
Length=149

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 72/117 (62%), Gaps = 0/117 (0%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             MAF S   G L G L P+ +  +   +    S   +SKLF+ GL+  T + GL  AF  F
Sbjct  1     MAFMSRLGGSLKGALKPNRLAAAALPATYTLSRGFSSKLFIGGLAWGTEERGLRDAFSPF  60

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE  1083
             G+++E +VI DR TGRS+GFGFV+Y T +EAQKA E M+ + LDG  I V+ A  ++
Sbjct  61    GEIIEVRVIQDRETGRSRGFGFVSYITDQEAQKAMEAMDGRVLDGRTIRVNYATQRQ  117



>ref|XP_004246450.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
isoform X1 [Solanum lycopersicum]
Length=160

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = +1

Query  835   TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKA  1014
             +++KLFVSGLS  T++E L K F  FG+LVE  ++ D+   R +GF F+ Y T EE+QKA
Sbjct  68    SSTKLFVSGLSFRTTEESLRKTFNHFGELVEVNLMMDKIANRPRGFAFIRYATEEESQKA  127

Query  1015  REGMNAKFLDGWVIFVDPAKPK-EFRPPPQPE  1107
              EGM+ KFLDG VIFV+ AK + E R  P+ +
Sbjct  128   IEGMHGKFLDGRVIFVEVAKSRSELRRGPKSQ  159



>ref|XP_002318331.1| RNA recognition motif-containing family protein [Populus trichocarpa]
 gb|EEE96551.1| RNA recognition motif-containing family protein [Populus trichocarpa]
Length=181

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             +KL+VSGLS  T++E L  AF+ FG+LV+  ++ D+   R +GF F+ YET EEAQKA E
Sbjct  90    TKLYVSGLSFRTTEESLRNAFQNFGQLVDVNLVMDKVAKRPRGFAFLRYETEEEAQKAIE  149

Query  1021  GMNAKFLDGWVIFVDPAKPK  1080
             GM+ KFLDG VIFV+ AKP+
Sbjct  150   GMHGKFLDGRVIFVEVAKPR  169



>ref|XP_006340998.1| PREDICTED: cold-inducible RNA-binding protein-like [Solanum tuberosum]
Length=163

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = +1

Query  835   TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKA  1014
             +++KLFVSGLS  T++E L KAF  FG+LVE  ++ D+   R +GF F+ Y T EE+QKA
Sbjct  68    SSTKLFVSGLSFRTTEESLRKAFNNFGELVEVNLMMDKIANRPRGFAFIRYATEEESQKA  127

Query  1015  REGMNAKFLDGWVIFVDPAKPK-EFRPPPQPESD  1113
              EGM+ KFLDG VIFV+ AK + E R  P   + 
Sbjct  128   IEGMHGKFLDGRVIFVEVAKSRSELRRGPNHNNS  161



>ref|XP_010423380.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Camelina sativa]
Length=161

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = +1

Query  763   LGGHLMPSSIFQSQCASLRFCSTL-TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVI  939
             +GG  + S+   +  A+  F       SKLFV GLS YT+++GL++ F ++G++VEA+++
Sbjct  19    IGGRYLKSAGLVNSSATCFFTQRRGVASKLFVGGLSFYTTEQGLSEEFSKYGQVVEAQIV  78

Query  940   TDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE  1083
              DR + RSKGFGFVT+ + +EAQKA    N + L G VIFVD AKPK+
Sbjct  79    MDRVSDRSKGFGFVTFASEDEAQKAMMEFNGQQLHGRVIFVDYAKPKQ  126



>ref|XP_006481718.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like 
isoform X2 [Citrus sinensis]
 gb|KDO70525.1| hypothetical protein CISIN_1g032528mg [Citrus sinensis]
Length=139

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +1

Query  850   FVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMN  1029
             +V+GLS YTS++GL+ AF Q+G++VEA ++ DR + +SKGFGFVT+ + +EA+KA   MN
Sbjct  28    YVAGLSFYTSNKGLSDAFSQYGQVVEANIVVDRVSDKSKGFGFVTFASHDEAEKALSEMN  87

Query  1030  AKFLDGWVIFVDPAKPK  1080
              K LDG VI VD AKPK
Sbjct  88    GKTLDGRVIIVDYAKPK  104



>ref|XP_010519204.1| PREDICTED: 29 kDa ribonucleoprotein, chloroplastic isoform X2 
[Tarenaya hassleriana]
Length=192

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 65/104 (63%), Gaps = 0/104 (0%)
 Frame = +1

Query  769   GHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDR  948
             G  M S      C S         +KL+VSGLS  T++E L KAFEQFG LV+  ++ D+
Sbjct  78    GGFMVSGCLPLDCPSSSSAYPRPKTKLYVSGLSFRTTEESLRKAFEQFGDLVDVNLVMDK  137

Query  949   ATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPK  1080
                R +GF F+ Y T EE++KA EGM+ KFLDG VIFV+ AKP+
Sbjct  138   LANRPRGFAFLRYATEEESKKAIEGMHGKFLDGRVIFVEEAKPR  181



>ref|XP_002888931.1| RNA recognition motif-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65190.1| RNA recognition motif-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=181

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 83/138 (60%), Gaps = 8/138 (6%)
 Frame = +1

Query  733   MAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQF  912
             + F+   RGI GG L+ S +     +S     + T +KL+VSGLS  T+++ L   FEQF
Sbjct  42    VIFARRRRGI-GGFLITSCLSPDSSSSPPSSPSGTKTKLYVSGLSFRTTEDTLRDTFEQF  100

Query  913   GKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPK----  1080
             GKL+   ++ D+   R +GF F+ YET EEA KA +GM+ KFLDG VIFV+ AK +    
Sbjct  101   GKLIHMNLVMDKVANRPRGFAFLRYETEEEAMKAIQGMHGKFLDGRVIFVEEAKTRSDIS  160

Query  1081  --EFRPP-PQPESDSTTF  1125
               + RP  P+P+S   TF
Sbjct  161   RAKPRPDFPKPQSKPRTF  178



>ref|XP_009797404.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Nicotiana sylvestris]
Length=160

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++KLFVSGLS  TS+E L  AF+ FG+LVE  ++ D+   R +GF F+ Y T EE+ KA 
Sbjct  70    STKLFVSGLSFRTSEESLKNAFDDFGELVEVNLVMDKIANRPRGFAFLRYATEEESHKAI  129

Query  1018  EGMNAKFLDGWVIFVDPAKPK  1080
             EGM+ KFLDG VIFV+ AKP+
Sbjct  130   EGMHGKFLDGRVIFVEVAKPR  150



>ref|XP_010519203.1| PREDICTED: 29 kDa ribonucleoprotein, chloroplastic isoform X1 
[Tarenaya hassleriana]
Length=203

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 65/104 (63%), Gaps = 0/104 (0%)
 Frame = +1

Query  769   GHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDR  948
             G  M S      C S         +KL+VSGLS  T++E L KAFEQFG LV+  ++ D+
Sbjct  78    GGFMVSGCLPLDCPSSSSAYPRPKTKLYVSGLSFRTTEESLRKAFEQFGDLVDVNLVMDK  137

Query  949   ATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPK  1080
                R +GF F+ Y T EE++KA EGM+ KFLDG VIFV+ AKP+
Sbjct  138   LANRPRGFAFLRYATEEESKKAIEGMHGKFLDGRVIFVEEAKPR  181



>ref|XP_010278062.1| PREDICTED: RNA-binding protein 1 [Nelumbo nucifera]
Length=181

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +1

Query  826   STLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEA  1005
             +T  ++KL+VSGLS  T++E L  AF+ FG+L+E  ++ DR   R +GF F+ Y T EE+
Sbjct  77    TTTVSTKLYVSGLSFRTTEESLRNAFKNFGQLIEVNLVMDRRANRPRGFAFLRYATEEES  136

Query  1006  QKAREGMNAKFLDGWVIFVDPAKPK  1080
             +KA EGM+ KFLDG VIFV+ AKP+
Sbjct  137   KKAIEGMHGKFLDGRVIFVEVAKPR  161



>gb|EMS46042.1| ELAV-like protein 1 [Triticum urartu]
Length=281

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 61/80 (76%), Gaps = 3/80 (4%)
 Frame = +1

Query  862   LSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFL  1041
             LS+ T+ +GL +AF +FG++  A+V+TDR TG SKGFGFV Y ++E+A K  EGM+ KFL
Sbjct  183   LSKRTTTDGLREAFAKFGEVEHARVVTDRVTGFSKGFGFVRYVSVEDAAKGIEGMDGKFL  242

Query  1042  DGWVIFVDPAKPKEFRPPPQ  1101
             DGWVIF + A+P   RPPPQ
Sbjct  243   DGWVIFAEYARP---RPPPQ  259



>emb|CDP10635.1| unnamed protein product [Coffea canephora]
Length=146

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 69/99 (70%), Gaps = 9/99 (9%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             SKLF+ GLS YT+++GL++AF Q+G++V AK+  D+ +GRSKGFGF+TY + +EA+ A +
Sbjct  46    SKLFIGGLSYYTTEKGLSEAFSQYGQVVGAKIPMDKVSGRSKGFGFITYASEDEAENAIK  105

Query  1021  GMNAKFLDGWVIFVDPAKPKE---------FRPPPQPES  1110
              +N K L+G VIFV  AKP+           R PP+P +
Sbjct  106   ELNGKALNGRVIFVAYAKPRTGFGGGGTPIARGPPEPAT  144



>ref|XP_006855610.1| hypothetical protein AMTR_s00044p00073410 [Amborella trichopoda]
 gb|ERN17077.1| hypothetical protein AMTR_s00044p00073410 [Amborella trichopoda]
Length=170

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = +1

Query  757   GILGGHLMPSSIFQSQC--ASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEA  930
             G+   H   SS+ +  C  A L       T KL+VSGLS  T++E L  AF+ FG+LVE 
Sbjct  47    GLKVSHNHSSSLLRQPCTVACLPSYPKAATKKLYVSGLSFRTTEESLRNAFKNFGQLVEV  106

Query  931   KVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPK  1080
             K++ D+   R +GF F+ Y T EE+++A EGM+ KFLDG VIFV+ AK K
Sbjct  107   KLVMDKRANRPRGFAFLEYATEEESRQAIEGMHGKFLDGRVIFVEVAKSK  156



>ref|XP_006430133.1| hypothetical protein CICLE_v10012994mg [Citrus clementina]
 gb|ESR43373.1| hypothetical protein CICLE_v10012994mg [Citrus clementina]
Length=131

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 8/103 (8%)
 Frame = +1

Query  829   TLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQ  1008
              LT+     +GLS YTS++GL+ AF Q+G++VEA ++ DR + +SKGFGFVT+ + EEA+
Sbjct  13    NLTSFNSNSNGLSFYTSNKGLSDAFSQYGQVVEANIVMDRVSDKSKGFGFVTFASHEEAE  72

Query  1009  KAREGMNAKFLDGWVIFVDPAKPKE--------FRPPPQPESD  1113
             KA   MN K LDG VI VD AKPK          R PP+  +D
Sbjct  73    KALSEMNGKTLDGRVIVVDYAKPKTSFRSGMPIARGPPESIAD  115



>ref|XP_009606687.1| PREDICTED: LOW QUALITY PROTEIN: transformer-2 protein homolog 
alpha [Nicotiana tomentosiformis]
Length=173

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++KLFVSGLS  T++E L  AF+ FG++VE  ++ D+   R +GF F+ Y T EE+QKA 
Sbjct  80    STKLFVSGLSFRTTEESLRNAFKDFGEIVEVNLVMDKIANRPRGFAFLHYXTEEESQKAI  139

Query  1018  EGMNAKFLDGWVIFVDPAKPK  1080
             EGM+ KFLDG VIFV+ AKP+
Sbjct  140   EGMHGKFLDGRVIFVEVAKPR  160



>ref|XP_009104806.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 35 kDa protein-like 
isoform X1 [Brassica rapa]
Length=190

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 73/124 (59%), Gaps = 0/124 (0%)
 Frame = +1

Query  742   SSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKL  921
             S+  R  +GG L+   +     +S     +   +KL+VSGLS  T+++ L   FEQFGKL
Sbjct  53    SARRRHDVGGLLVSGCLSSPDSSSPPSSISGPKTKLYVSGLSFRTTEDNLRNVFEQFGKL  112

Query  922   VEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKEFRPPPQ  1101
                 ++ D+   R +GF F+ YET EE+ KA +GM+ KFLDG VIFV+ AKPK      +
Sbjct  113   TLVNLVMDKVANRPRGFAFLRYETEEESMKAIQGMHGKFLDGRVIFVEEAKPKSDLQRAK  172

Query  1102  PESD  1113
             P SD
Sbjct  173   PRSD  176



>ref|XP_007162936.1| hypothetical protein PHAVU_001G192800g [Phaseolus vulgaris]
 gb|ESW34930.1| hypothetical protein PHAVU_001G192800g [Phaseolus vulgaris]
Length=149

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 66/99 (67%), Gaps = 8/99 (8%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
             KLFV GLS YT+++ L+ AF  +G+++EAKV+TDR + RSKGFGFVT+ + +EA+ A   
Sbjct  51    KLFVGGLSFYTTEKALSDAFSNYGQVIEAKVVTDRVSDRSKGFGFVTFASPDEAENAITE  110

Query  1024  MNAKFLDGWVIFVDPAKPK--------EFRPPPQPESDS  1116
             M  K ++G VIFVD AKP           R PP+P  D+
Sbjct  111   MKGKTINGRVIFVDYAKPNINGNAAMPIARGPPEPTPDT  149



>ref|XP_009407328.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=147

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              SKLFV GLS  T+++ L++AF QFG+++EAK+I D+ + RSKGFGFVT+ + EEAQKA 
Sbjct  47    VSKLFVGGLSSSTTEDCLSEAFSQFGQVIEAKIIMDKVSKRSKGFGFVTFASEEEAQKAL  106

Query  1018  EGMNAKFLDGWVIFVDPAKPK  1080
             E M+ K L+G V+F++ AK K
Sbjct  107   EEMDRKVLNGRVVFIEHAKVK  127



>gb|KDP45799.1| hypothetical protein JCGZ_17406 [Jatropha curcas]
Length=167

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             ++LFVSGLS  T++E L  AF+ FG+LVE  ++ D+   R +GF F+ Y T E++QKA E
Sbjct  78    TRLFVSGLSFRTTEESLRNAFQNFGQLVEMNLVMDKVANRPRGFAFLRYATEEDSQKAIE  137

Query  1021  GMNAKFLDGWVIFVDPAKPK  1080
             GM+ KFLDG VIFV+ AKP+
Sbjct  138   GMHGKFLDGRVIFVEVAKPR  157



>ref|XP_008439477.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Cucumis melo]
Length=176

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             ++L+VSGLS  T++E L  AF+ FG+LVE  ++ DR   R +GF F+ Y + EE+QKA E
Sbjct  85    TRLYVSGLSFRTTEESLRNAFKSFGQLVEVNLVMDRVANRPRGFAFLRYASEEESQKAIE  144

Query  1021  GMNAKFLDGWVIFVDPAKPK  1080
             GM+ KFLDG VIFV+ AKP+
Sbjct  145   GMHGKFLDGRVIFVEIAKPR  164



>ref|XP_002271224.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial 
[Vitis vinifera]
 emb|CBI35302.3| unnamed protein product [Vitis vinifera]
Length=170

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +1

Query  829   TLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQ  1008
             ++  ++L+VSGLS  T++E L  AFE FG+LVE  ++ D+   R +GF F+ Y T EE++
Sbjct  75    SIPKTRLYVSGLSFRTTEESLRNAFETFGQLVEVNLVMDKIANRPRGFAFLRYSTEEESE  134

Query  1009  KAREGMNAKFLDGWVIFVDPAKPK  1080
             KA EGM+ KFLDG VIFV+ AKP+
Sbjct  135   KAIEGMHGKFLDGRVIFVEVAKPR  158



>ref|XP_009401002.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=170

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             ++KL+VSGLS  T++E L  AF+ FG+LVE  ++ DR   R +GF F+ Y T EE++KA 
Sbjct  74    STKLYVSGLSFRTTEESLRNAFQNFGQLVEVNLVMDRIANRPRGFAFLRYATEEESKKAI  133

Query  1018  EGMNAKFLDGWVIFVDPAKPK  1080
             EGM+ KFLDG VIFV+ AKP+
Sbjct  134   EGMHGKFLDGRVIFVEVAKPR  154



>ref|XP_006301161.1| hypothetical protein CARUB_v10021559mg, partial [Capsella rubella]
 gb|EOA34059.1| hypothetical protein CARUB_v10021559mg, partial [Capsella rubella]
Length=182

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             +KLFVSGLS  T+++ L   FEQFGKLV   ++ D+   R KGF F+ Y+T EEA KA E
Sbjct  75    TKLFVSGLSFRTTEDTLRDTFEQFGKLVHMNLVMDKVANRPKGFAFLRYDTEEEAMKAIE  134

Query  1021  GMNAKFLDGWVIFVDPAKPKE--FRPPPQPE  1107
             GM+ KFLDG VIFV+ AK +    R  P+P+
Sbjct  135   GMHGKFLDGRVIFVEEAKSRSDISRGKPRPD  165



>ref|XP_010491168.1| PREDICTED: glycine-rich RNA-binding protein 5, mitochondrial-like 
[Camelina sativa]
Length=148

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = +1

Query  763   LGGHLMPSSIFQSQCASLRFCSTL-TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVI  939
             +GG  + S+   +  AS  F       SK+FV GLS YT+++GL++ F + G++VEA+++
Sbjct  7     IGGRYLKSAGLINSSASCFFTQRRGVASKVFVGGLSFYTTEQGLSEEFSKCGQVVEAQIV  66

Query  940   TDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAKPKE  1083
              DR + RSKGFGFVT+ + +EAQKA    N + L G VIFVD AKPK+
Sbjct  67    MDRVSDRSKGFGFVTFASEDEAQKAMMEFNGQQLHGRVIFVDYAKPKQ  114



>ref|XP_009125638.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Brassica rapa]
Length=146

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 73/108 (68%), Gaps = 12/108 (11%)
 Frame = +1

Query  835   TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKA  1014
               +KLFV GLS YT++EGL++AF Q G++VEA+++ DR + RSKGFGFVT+ + ++A+KA
Sbjct  32    VATKLFVGGLSFYTTEEGLSEAFSQCGQVVEAQIVMDRVSDRSKGFGFVTFASDDDARKA  91

Query  1015  REGMNAKFLDGWVIFVDPAKPKE-----------FRPPPQP-ESDSTT  1122
                 N + L+G VIFVD AK K+            R PP+P E+ +TT
Sbjct  92    LMEFNGQQLNGRVIFVDYAKAKQTFGGGGGGLPIARGPPRPGEAAATT  139



>ref|XP_010683644.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=139

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             SKLFV GLS YT+++ L +AF QFG++++AK++ DR + RSKGFGFVTY + +EA KA  
Sbjct  43    SKLFVGGLSFYTTEKTLAEAFSQFGQVIQAKIVHDRVSDRSKGFGFVTYASDDEADKALT  102

Query  1021  GMNAKFLDGWVIFVDPAKPK-EFR  1089
              MN   L G VIFV+ AKP+ +FR
Sbjct  103   EMNGIQLHGRVIFVEYAKPRVDFR  126



>ref|XP_010069494.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
[Eucalyptus grandis]
 gb|KCW57858.1| hypothetical protein EUGRSUZ_H00611 [Eucalyptus grandis]
Length=179

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
             KL+VSGLS  T++E L  AF+ FG+LVE  ++ D+   R +GF F+ Y T EEAQ+A EG
Sbjct  89    KLYVSGLSFRTTEESLRNAFKNFGQLVEVNLVMDKIANRPRGFAFLRYATEEEAQRAIEG  148

Query  1024  MNAKFLDGWVIFVDPAKPK  1080
             M+ KFLDG VIFV+ AKP+
Sbjct  149   MHGKFLDGRVIFVEVAKPR  167



>ref|XP_004975582.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Setaria italica]
Length=135

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 68/98 (69%), Gaps = 9/98 (9%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             T KLF+ GLS++ +++ L +AF ++G+++EA ++TD+ T + KGFGFV + + EEA  AR
Sbjct  34    TYKLFIGGLSQFATEDTLAEAFSRYGQVIEATIVTDKMTDKPKGFGFVKFASQEEANTAR  93

Query  1018  EGMNAKFLDGWVIFVDPAKPK-----EFRP----PPQP  1104
             E MN K L+G VI+VD AKPK     + RP    PP+P
Sbjct  94    EEMNGKVLNGRVIYVDIAKPKLERDADARPIARGPPKP  131



>ref|XP_010428279.1| PREDICTED: glycine-rich RNA-binding protein 2, mitochondrial-like 
[Camelina sativa]
Length=179

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = +1

Query  841   SKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKARE  1020
             +KLFVSGLS  T+++ L   FEQFGKL+   ++ D+   R KGF F+ Y+T EEA KA E
Sbjct  75    TKLFVSGLSFRTTEDTLRDTFEQFGKLIHMNLVMDKVANRPKGFAFLRYDTEEEAMKAIE  134

Query  1021  GMNAKFLDGWVIFVDPAKPK------EFRPP-PQPESDSTTF  1125
             GM+ KFLDG VIFV+ AK +      + RP  P+P+S   TF
Sbjct  135   GMHGKFLDGRVIFVEEAKTRSDISRGKPRPEYPKPQSKPRTF  176



>gb|KHG05363.1| Glycine-rich RNA-binding 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=387

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 74/121 (61%), Gaps = 13/121 (11%)
 Frame = +1

Query  766   GGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITD  945
             GG+ + +S   S+  S+R      T KLF++GLS YTS++ L   FE FG+LVE K+I D
Sbjct  273   GGNNLQNSTSASETTSIR------TKKLFITGLSFYTSEKTLRSHFEGFGELVEVKIIMD  326

Query  946   RATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPA--KPKEF-----RPPPQP  1104
             + + RSKG+ FV Y T E A  A + MN K ++GW+I VD A  KP+ F     RP  QP
Sbjct  327   KISKRSKGYAFVEYTTEEAASAALKEMNGKIINGWMIVVDVAKTKPQNFSGGRPRPTVQP  386

Query  1105  E  1107
             E
Sbjct  387   E  387



>emb|CDX82066.1| BnaC02g22240D [Brassica napus]
Length=96

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +1

Query  847   LFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGM  1026
             L  +GLS  T+++ L KAFEQFGKL    ++ D+   R +GF F+ YET EE+ KA EGM
Sbjct  3     LLCTGLSFRTTEDNLRKAFEQFGKLTLVNLVMDKVANRPRGFAFLRYETEEESMKATEGM  62

Query  1027  NAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
             + KFLDG VIFV+ AKP       +P SD
Sbjct  63    HGKFLDGRVIFVEEAKPMSDIQRAKPRSD  91



>gb|AFK48620.1| unknown [Lotus japonicus]
Length=161

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 79/127 (62%), Gaps = 1/127 (1%)
 Frame = +1

Query  709   FLFLRS*KMAFSSAFRGILGGHLMPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEG  888
              LF  S  +   +A R I G  +  S +  +  + L F  T+T SK+FV GL+  T+++ 
Sbjct  26    LLFFISNILHHMAAVREICGSLMSLSKLQHASPSQLPFLRTMT-SKIFVKGLAFSTTEDK  84

Query  889   LNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDP  1068
             L +AF Q+GK+++A ++ +RA  RSKGFG+VT+   E+AQKA+ GMN K L G V++VD 
Sbjct  85    LAEAFSQYGKVLKADIVLNRAKTRSKGFGYVTFAKEEDAQKAQIGMNRKILHGRVLYVDM  144

Query  1069  AKPKEFR  1089
               P + +
Sbjct  145   EPPDKHK  151



>gb|KFK41789.1| hypothetical protein AALP_AA2G172300 [Arabis alpina]
Length=187

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = +1

Query  835   TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKA  1014
             T +KL+VSGLS  T++E L  AFE FG LV   ++ D+   R +GF FV YET EE++KA
Sbjct  81    TKTKLYVSGLSFRTTEENLRNAFEPFGNLVFVNLVMDQVANRPRGFAFVRYETEEESKKA  140

Query  1015  REGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
              EGM+ KFLDG VIFV+ AK +      +P SD
Sbjct  141   IEGMHGKFLDGRVIFVEEAKSRSDMQRAKPRSD  173



>gb|KHG27904.1| Nucleolin [Gossypium arboreum]
Length=123

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRAT--GRSKGFGFVTYETIEEAQK  1011
             ++ LFVSGLS  T+++ L +AF  FG +++AKV+TDR++    SKG+GFV Y  +E+A+K
Sbjct  38    STTLFVSGLSGRTTNQKLREAFANFGDVIQAKVVTDRSSLSNHSKGYGFVRYSNLEDAKK  97

Query  1012  AREGMNAKFLDGWVIFVDPAKPKE  1083
               EGM+ +FLDG VIF + AKPK+
Sbjct  98    GMEGMDGQFLDGRVIFTEYAKPKD  121



>ref|XP_010683152.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=191

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
             +++L+VSGLS  T+ E L  AF++FG+L+E  ++ D+   R +GF F+ YET EE++ A 
Sbjct  96    STRLYVSGLSFRTTHESLRNAFQKFGQLMEVNLVMDKIANRPRGFAFIRYETEEESKNAI  155

Query  1018  EGMNAKFLDGWVIFVDPAKPK  1080
             EGM+ KFLDG VIFV+ AKP+
Sbjct  156   EGMHGKFLDGRVIFVEEAKPR  176



>ref|XP_009127997.1| PREDICTED: LOW QUALITY PROTEIN: glycine-rich RNA-binding protein 
4, mitochondrial [Brassica rapa]
Length=182

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +1

Query  838   TSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAR  1017
              +KL++SGLS  T+++   KAFEQFGKL    ++ D+   R +GF F+ YET EE+ KA 
Sbjct  77    NTKLYLSGLSFRTTEDNXRKAFEQFGKLTLVNLVMDKVANRPRGFAFLRYETEEESMKAI  136

Query  1018  EGMNAKFLDGWVIFVDPAKPKEFRPPPQPESD  1113
             EGM+ KFLDG VIFV+ AKP       +P SD
Sbjct  137   EGMHGKFLDGRVIFVEEAKPMSDIQRAKPRSD  168



>ref|XP_003591770.1| RNA-binding protein [Medicago truncatula]
 gb|AES62021.1| RNA-binding (RRM/RBD/RNP motif) family protein, putative [Medicago 
truncatula]
Length=284

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 66/99 (67%), Gaps = 6/99 (6%)
 Frame = +1

Query  778   MPSSIFQSQCASLRFCSTLTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATG  957
             MP+S   SQ AS++      T KLFV+GLS YTS++ L  AFE FG+LVE KVI D+ + 
Sbjct  177   MPNSSEASQEASVK------TKKLFVTGLSFYTSEKTLRAAFEGFGELVEVKVIIDKISK  230

Query  958   RSKGFGFVTYETIEEAQKAREGMNAKFLDGWVIFVDPAK  1074
             RSKG+ F+ Y T E A  A + MN K ++GW+I VD AK
Sbjct  231   RSKGYAFIEYTTEEAASAALKEMNGKIINGWMIVVDVAK  269



>ref|XP_010909424.1| PREDICTED: polyadenylate-binding protein, cytoplasmic and nuclear 
isoform X1 [Elaeis guineensis]
Length=407

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 3/99 (3%)
 Frame = +1

Query  832   LTTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQK  1011
             +T +KLFV+GLS YTS++ L  AFE FG+LVE K++ D+ + RSKG+ FV Y T E A  
Sbjct  306   VTVAKLFVTGLSFYTSEKTLRAAFEGFGELVEVKIVMDKISKRSKGYAFVEYTTEEAASA  365

Query  1012  AREGMNAKFLDGWVIFVDPAK---PKEFRPPPQPESDST  1119
             A + MN K ++GW+I VD A+   PK  R  P+P S ST
Sbjct  366   AIKEMNGKIINGWMIVVDVARSNPPKYSRARPRPPSTST  404



>emb|CDY14089.1| BnaC02g02060D [Brassica napus]
Length=146

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 73/108 (68%), Gaps = 12/108 (11%)
 Frame = +1

Query  835   TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKA  1014
               +KLFV GLS YT+++GL++AF Q G++VEA+++ DR + RSKGFGFVT+ + ++A+KA
Sbjct  32    VATKLFVGGLSFYTTEQGLSEAFSQCGQVVEAQIVMDRVSDRSKGFGFVTFASDDDARKA  91

Query  1015  REGMNAKFLDGWVIFVDPAKPKE-----------FRPPPQP-ESDSTT  1122
                 N + L+G VIFVD AK K+            R PP+P E+ +TT
Sbjct  92    LMEFNGQQLNGRVIFVDYAKAKQTFGGGGGGLPIARGPPRPGEAAATT  139



>gb|AFK39402.1| unknown [Medicago truncatula]
Length=140

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = +1

Query  844   KLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKAREG  1023
             KLFV GLS +T+++ L+ AF  +G++VEAKVITDR + +SKG+GFVT+ + +EA+KA   
Sbjct  33    KLFVGGLSFHTTEKTLSDAFSNYGQVVEAKVITDRISEKSKGYGFVTFASQDEAEKAITE  92

Query  1024  MNAKFLDGWVIFVDPAKPKEFRPPPQP  1104
             MN K L+G V+FVD AKP   R    P
Sbjct  93    MNEKALNGRVVFVDYAKPDTKRSMGMP  119



>emb|CDY04982.1| BnaAnng01640D [Brassica napus]
Length=146

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 73/108 (68%), Gaps = 12/108 (11%)
 Frame = +1

Query  835   TTSKLFVSGLSRYTSDEGLNKAFEQFGKLVEAKVITDRATGRSKGFGFVTYETIEEAQKA  1014
               +KLFV GLS YT+++GL++AF Q G++VEA+++ DR + RSKGFGFVT+ + ++A+KA
Sbjct  32    VATKLFVGGLSFYTTEQGLSEAFSQCGQVVEAQIVMDRVSDRSKGFGFVTFASDDDARKA  91

Query  1015  REGMNAKFLDGWVIFVDPAKPKE-----------FRPPPQP-ESDSTT  1122
                 N + L+G VIFVD AK K+            R PP+P E+ +TT
Sbjct  92    LMEFNGQQLNGRVIFVDYAKAKQTFGGGGGGLPIARGPPRPGEAAATT  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4065968517228