BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2224_g1_i1 len=805 path=[1:0-364 366:365-804]

Length=805
                                                                      Score     E

ref|XP_009592278.1|  PREDICTED: la-related protein 6B-like              140   8e-35   
emb|CDP19151.1|  unnamed protein product                                133   8e-33   
ref|XP_009800734.1|  PREDICTED: la-related protein 6B-like              133   4e-32   
ref|XP_006342440.1|  PREDICTED: la-related protein 6-like               133   4e-32   
ref|XP_004253040.1|  PREDICTED: la-related protein 6B-like              130   3e-31   
ref|XP_009798623.1|  PREDICTED: la-related protein 6B-like              125   2e-29   
ref|XP_009761351.1|  PREDICTED: la-related protein 6B-like              121   4e-28   
ref|XP_006353141.1|  PREDICTED: uncharacterized protein LOC102593695    121   6e-28   
ref|XP_009603304.1|  PREDICTED: la-related protein 6B-like              120   1e-27   
ref|XP_004251985.1|  PREDICTED: la-related protein 6B                   120   1e-27   
ref|XP_007026488.1|  RNA-binding protein, putative isoform 2            114   8e-26   
ref|XP_007026487.1|  RNA-binding protein, putative isoform 1            114   1e-25   
ref|XP_010672517.1|  PREDICTED: la-related protein 6B                   114   2e-25   
ref|XP_006351071.1|  PREDICTED: la-related protein 6-like isoform X1    113   3e-25   
emb|CBI24756.3|  unnamed protein product                                111   5e-25   
ref|XP_002275950.2|  PREDICTED: LOW QUALITY PROTEIN: la-related p...    112   9e-25   Vitis vinifera
ref|XP_004244780.1|  PREDICTED: la-related protein 6B                   111   1e-24   
gb|KDP29552.1|  hypothetical protein JCGZ_19265                         110   4e-24   
ref|XP_007026489.1|  RNA-binding protein, putative isoform 3            110   5e-24   
ref|XP_009598306.1|  PREDICTED: la-related protein 6B                   108   1e-23   
ref|XP_011074010.1|  PREDICTED: la-related protein 6B-like              107   3e-23   
ref|XP_008243073.1|  PREDICTED: la-related protein 6B                   107   4e-23   
ref|XP_007202011.1|  hypothetical protein PRUPE_ppa005181mg             105   3e-22   
ref|XP_010101330.1|  La-related protein 7                               104   5e-22   
ref|XP_006493132.1|  PREDICTED: lateral signaling target protein ...    102   3e-21   
ref|XP_006442037.1|  hypothetical protein CICLE_v10019649mg             102   4e-21   
gb|KDO51612.1|  hypothetical protein CISIN_1g009251mg                   100   1e-20   
ref|XP_008447188.1|  PREDICTED: la-related protein 6B isoform X5      97.8    3e-20   
ref|XP_009343678.1|  PREDICTED: la-related protein 6B                 99.4    3e-20   
ref|XP_004139806.1|  PREDICTED: uncharacterized protein LOC101207485  98.2    7e-20   
gb|KDO51614.1|  hypothetical protein CISIN_1g009251mg                 98.6    8e-20   
gb|KDO51613.1|  hypothetical protein CISIN_1g009251mg                 98.6    9e-20   
ref|XP_002310383.2|  hypothetical protein POPTR_0007s00450g           97.8    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_008447184.1|  PREDICTED: la-related protein 6B isoform X1      97.1    2e-19   
ref|XP_002529112.1|  lupus la ribonucleoprotein, putative             96.7    3e-19   Ricinus communis
ref|XP_011085064.1|  PREDICTED: la-related protein 6B-like isofor...  95.9    3e-19   
ref|XP_008803782.1|  PREDICTED: la-related protein 6C                 93.6    1e-18   
gb|KHG02211.1|  La-related 7                                          93.2    2e-18   
ref|XP_002323712.2|  hypothetical protein POPTR_0017s04020g           93.6    3e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011011377.1|  PREDICTED: la-related protein 6B-like isofor...  92.8    5e-18   
ref|XP_011001839.1|  PREDICTED: la-related protein 6B-like isofor...  92.8    5e-18   
ref|XP_008801106.1|  PREDICTED: la-related protein 6B-like            92.8    6e-18   
ref|XP_010930308.1|  PREDICTED: la-related protein 6B-like            92.4    7e-18   
ref|XP_008394254.1|  PREDICTED: la-related protein 6B                 92.8    7e-18   
ref|XP_011092741.1|  PREDICTED: la-related protein 6C-like isofor...  91.7    8e-18   
ref|XP_011092740.1|  PREDICTED: la-related protein 6C-like isofor...  91.7    8e-18   
ref|XP_010251419.1|  PREDICTED: la-related protein 6B isoform X2      91.7    1e-17   
ref|XP_006858735.1|  hypothetical protein AMTR_s00066p00125170        90.9    2e-17   
ref|XP_003554803.1|  PREDICTED: la-related protein 6-like isoform 1   90.1    5e-17   
ref|XP_008788265.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  90.1    5e-17   
ref|XP_010069204.1|  PREDICTED: la-related protein 6B                 88.2    5e-17   
gb|KCW57477.1|  hypothetical protein EUGRSUZ_H00248                   88.2    5e-17   
ref|XP_009393796.1|  PREDICTED: la-related protein 6B-like isofor...  89.7    5e-17   
ref|XP_009393795.1|  PREDICTED: la-related protein 6B-like isofor...  89.4    8e-17   
ref|XP_009404917.1|  PREDICTED: la-related protein 6B-like            89.4    8e-17   
ref|XP_010912744.1|  PREDICTED: la-related protein 6B-like            88.2    2e-16   
ref|XP_004292453.1|  PREDICTED: uncharacterized protein LOC101311941  87.4    3e-16   
ref|XP_011005266.1|  PREDICTED: la-related protein 6B-like            87.8    3e-16   
ref|XP_006380251.1|  hypothetical protein POPTR_0007s00450g           87.8    3e-16   
ref|XP_006380252.1|  hypothetical protein POPTR_0007s00450g           87.0    4e-16   
ref|XP_002878301.1|  hypothetical protein ARALYDRAFT_907506           85.9    7e-16   
ref|XP_009366258.1|  PREDICTED: la-related protein 6B-like            86.7    7e-16   
ref|XP_006296119.1|  hypothetical protein CARUB_v10025271mg           86.7    8e-16   
gb|EPS58875.1|  hypothetical protein M569_15937                       84.0    1e-15   
gb|EYU36643.1|  hypothetical protein MIMGU_mgv1a013239mg              83.6    1e-15   
ref|XP_010930389.1|  PREDICTED: la-related protein 6C                 85.1    1e-15   
ref|XP_009398953.1|  PREDICTED: la-related protein 6C                 85.5    1e-15   
gb|EEC75591.1|  hypothetical protein OsI_12289                        85.5    1e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001050504.1|  Os03g0566500                                     85.5    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EYU42655.1|  hypothetical protein MIMGU_mgv1a007130mg              85.1    1e-15   
ref|XP_008447187.1|  PREDICTED: la-related protein 6B isoform X4      84.7    2e-15   
ref|XP_003521844.1|  PREDICTED: la-related protein 6-like isoformX1   85.5    2e-15   
ref|XP_002281817.1|  PREDICTED: la-related protein 6C isoform X1      84.7    2e-15   Vitis vinifera
ref|XP_008447186.1|  PREDICTED: la-related protein 6B isoform X3      84.7    2e-15   
ref|XP_008447185.1|  PREDICTED: la-related protein 6B isoform X2      85.1    2e-15   
ref|XP_010469262.1|  PREDICTED: la-related protein 6B-like            84.0    2e-15   
ref|XP_010506300.1|  PREDICTED: la-related protein 6B                 85.1    3e-15   
ref|XP_011088295.1|  PREDICTED: la-related protein 6C                 84.0    3e-15   
ref|XP_010647782.1|  PREDICTED: la-related protein 6C isoform X2      84.0    4e-15   
ref|XP_010508353.1|  PREDICTED: la-related protein 6B-like            84.7    4e-15   
emb|CAN81423.1|  hypothetical protein VITISV_035943                   85.5    4e-15   Vitis vinifera
ref|XP_010251418.1|  PREDICTED: la-related protein 6B isoform X1      83.6    7e-15   
ref|XP_006651554.1|  PREDICTED: uncharacterized protein LOC102719286  82.8    9e-15   
ref|XP_010248222.1|  PREDICTED: la-related protein 6C-like            82.4    1e-14   
ref|XP_010517979.1|  PREDICTED: la-related protein 6B-like isofor...  83.2    1e-14   
ref|XP_010524198.1|  PREDICTED: la-related protein 6B-like            82.8    2e-14   
gb|KFK37220.1|  hypothetical protein AALP_AA4G229300                  82.8    2e-14   
ref|XP_006845325.1|  hypothetical protein AMTR_s00141p00064150        82.0    2e-14   
emb|CDY17896.1|  BnaC04g03230D                                        82.0    2e-14   
ref|XP_010107985.1|  La-related protein 7                             81.6    2e-14   
dbj|BAK04171.1|  predicted protein                                    82.0    2e-14   
ref|XP_011011378.1|  PREDICTED: la-related protein 6B-like isofor...  81.6    2e-14   
ref|XP_011001840.1|  PREDICTED: la-related protein 6B-like isofor...  81.6    2e-14   
ref|XP_009389160.1|  PREDICTED: la-related protein 6B-like            81.6    3e-14   
ref|XP_010526876.1|  PREDICTED: la-related protein 6B                 81.6    3e-14   
ref|XP_006397570.1|  hypothetical protein EUTSA_v10001395mg           81.6    4e-14   
gb|EMS67153.1|  La-related protein 7                                  81.3    4e-14   
gb|KDO51615.1|  hypothetical protein CISIN_1g009251mg                 80.9    5e-14   
ref|XP_002881943.1|  hypothetical protein ARALYDRAFT_322062           80.9    6e-14   
ref|XP_004293535.1|  PREDICTED: la-related protein 6-like             80.1    7e-14   
ref|XP_008790044.1|  PREDICTED: la-related protein 6A                 80.1    7e-14   
ref|XP_010228482.1|  PREDICTED: la-related protein 6C                 80.5    8e-14   
gb|AAL06505.1|AF412052_1  At2g43970/F6E13.10                          79.3    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512276.1|  PREDICTED: la-related protein 6B-like            79.7    1e-13   
ref|XP_011001196.1|  PREDICTED: la-related protein 6C                 79.7    1e-13   
emb|CDX79791.1|  BnaA05g03650D                                        80.1    1e-13   
ref|XP_009360880.1|  PREDICTED: la-related protein 6A                 79.3    1e-13   
ref|XP_006351072.1|  PREDICTED: la-related protein 6-like isoform X2  79.0    1e-13   
ref|XP_009142983.1|  PREDICTED: la-related protein 6B                 79.7    1e-13   
ref|XP_010999935.1|  PREDICTED: la-related protein 6C-like            79.0    2e-13   
gb|EMT10567.1|  26S proteasome non-ATPase regulatory subunit 11       79.7    2e-13   
dbj|BAH57224.1|  AT2G43970                                            79.0    3e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KDO51616.1|  hypothetical protein CISIN_1g009251mg                 78.6    3e-13   
ref|XP_010691018.1|  PREDICTED: la-related protein 6C                 79.0    3e-13   
ref|NP_566004.1|  RNA-binding protein                                 79.0    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969999.1|  PREDICTED: la-related protein 7-like isoform X1  78.2    3e-13   
ref|XP_010665825.1|  PREDICTED: la-related protein 6A                 77.4    4e-13   
gb|KEH24675.1|  LA-related protein 6 LA RNA-binding domain protei...  78.2    4e-13   
ref|XP_006290446.1|  hypothetical protein CARUB_v10019416mg           77.8    6e-13   
ref|XP_007211445.1|  hypothetical protein PRUPE_ppa007255mg           77.4    6e-13   
gb|KDO51617.1|  hypothetical protein CISIN_1g009251mg                 77.4    7e-13   
ref|XP_010517978.1|  PREDICTED: la-related protein 6B-like isofor...  77.4    1e-12   
ref|XP_008383487.1|  PREDICTED: la-related protein 6A-like            76.6    1e-12   
ref|XP_004162617.1|  PREDICTED: la protein homolog                    75.1    1e-12   
ref|XP_003542932.1|  PREDICTED: stress response protein NST1-like...  76.6    1e-12   
gb|KHG28356.1|  La-related 7                                          76.3    2e-12   
ref|XP_004293591.1|  PREDICTED: uncharacterized protein LOC101309803  74.7    2e-12   
ref|XP_008225473.1|  PREDICTED: la-related protein 6A                 75.9    2e-12   
ref|XP_010257771.1|  PREDICTED: la-related protein 6A isoform X2      75.5    2e-12   
ref|XP_004134576.1|  PREDICTED: la protein homolog                    75.5    3e-12   
gb|KDP38238.1|  hypothetical protein JCGZ_04881                       75.9    3e-12   
ref|NP_001241310.1|  uncharacterized protein LOC100807619             75.1    4e-12   
ref|XP_008371601.1|  PREDICTED: la-related protein 6A-like isofor...  74.7    4e-12   
ref|NP_001176849.1|  Os12g0225100                                     72.8    6e-12   
ref|XP_010257773.1|  PREDICTED: la-related protein 6A isoform X4      73.2    7e-12   
ref|XP_004159060.1|  PREDICTED: la-related protein 7-like             73.9    7e-12   
gb|ABG21923.1|  transposon protein, putative, Mutator sub-class, ...  72.8    7e-12   
ref|XP_007139081.1|  hypothetical protein PHAVU_009G2633000g          73.9    7e-12   
ref|XP_002453408.1|  hypothetical protein SORBIDRAFT_04g005500        74.3    9e-12   Sorghum bicolor [broomcorn]
ref|XP_010908488.1|  PREDICTED: la-related protein 6B-like            74.3    1e-11   
ref|XP_004494976.1|  PREDICTED: uncharacterized protein LOC101512171  74.3    1e-11   
gb|KHN33140.1|  La-related protein 7                                  73.9    1e-11   
ref|XP_010257770.1|  PREDICTED: la-related protein 6A isoform X1      72.8    2e-11   
ref|XP_010257772.1|  PREDICTED: la-related protein 6A isoform X3      72.8    2e-11   
ref|XP_006577368.1|  PREDICTED: la-related protein 6-like isoform X2  72.4    3e-11   
emb|CDO97143.1|  unnamed protein product                              72.8    3e-11   
ref|XP_009772752.1|  PREDICTED: la-related protein 6C-like            72.8    3e-11   
ref|XP_004986415.1|  PREDICTED: la-related protein 6-like             72.4    3e-11   
ref|XP_009402690.1|  PREDICTED: la-related protein 6A                 72.4    3e-11   
gb|KEH24676.1|  LA-related protein 6 LA RNA-binding domain protei...  72.0    3e-11   
gb|EAY82629.1|  hypothetical protein OsI_37849                        72.4    3e-11   Oryza sativa Indica Group [Indian rice]
gb|ABA96797.2|  transposon protein, putative, Mutator sub-class, ...  72.4    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ20013.1|  hypothetical protein OsJ_35608                        72.4    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008666613.1|  PREDICTED: la-related protein 6C-like            72.0    5e-11   
ref|XP_002521842.1|  lupus la ribonucleoprotein, putative             72.0    6e-11   Ricinus communis
ref|XP_006664435.1|  PREDICTED: la-related protein 7-like             71.6    6e-11   
ref|XP_006423072.1|  hypothetical protein CICLE_v10028506mg           71.6    6e-11   
ref|XP_006398322.1|  hypothetical protein EUTSA_v10000879mg           71.6    7e-11   
ref|XP_008392294.1|  PREDICTED: la-related protein 6C                 71.2    7e-11   
ref|XP_010919805.1|  PREDICTED: la-related protein 6A                 70.9    1e-10   
gb|ABA96798.2|  transposon protein, putative, Mutator sub-class, ...  70.1    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EPS74002.1|  hypothetical protein M569_00755                       70.1    2e-10   
ref|XP_006279625.1|  hypothetical protein CARUB_v10026475mg           70.5    2e-10   
ref|XP_008371602.1|  PREDICTED: la-related protein 6A-like isofor...  70.1    2e-10   
ref|XP_002443059.1|  hypothetical protein SORBIDRAFT_08g007220        70.5    2e-10   Sorghum bicolor [broomcorn]
ref|XP_006662857.1|  PREDICTED: la-related protein 6-like             69.7    2e-10   
ref|XP_006449682.1|  hypothetical protein CICLE_v10015602mg           69.7    3e-10   
gb|ABG22428.1|  La domain-containing protein, putative, expressed     69.3    3e-10   
gb|AAX95155.1|  At2g43970/F6E13.10                                    69.3    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008459218.1|  PREDICTED: la-related protein 6C                 69.7    3e-10   
gb|EMT23549.1|  La-related protein 7                                  68.9    3e-10   
ref|XP_006467479.1|  PREDICTED: la-related protein 6-like             69.3    3e-10   
gb|EEE51926.1|  hypothetical protein OsJ_33536                        69.7    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067617.1|  Os11g0248200                                     69.3    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67957.1|  hypothetical protein OsI_35696                        69.7    3e-10   Oryza sativa Indica Group [Indian rice]
gb|AAX96755.1|  At2g43970/F6E13.10                                    69.7    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232344.1|  PREDICTED: la-related protein 6A                 69.7    3e-10   
ref|XP_004486031.1|  PREDICTED: la-related protein 7-like             69.3    3e-10   
ref|XP_006848537.1|  hypothetical protein AMTR_s00169p00025570        69.3    3e-10   
ref|XP_002313090.2|  hypothetical protein POPTR_0009s10970g           69.3    4e-10   Populus trichocarpa [western balsam poplar]
ref|XP_011010419.1|  PREDICTED: la-related protein 6A                 69.3    4e-10   
gb|EMS51819.1|  La-related protein 7                                  68.9    4e-10   
ref|XP_004153773.1|  PREDICTED: uncharacterized protein LOC101217948  68.9    4e-10   
ref|XP_008439642.1|  PREDICTED: la-related protein 6A                 68.9    4e-10   
dbj|BAB11080.1|  unnamed protein product                              68.9    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004145408.1|  PREDICTED: uncharacterized protein LOC101207999  68.9    5e-10   
gb|KGN61738.1|  hypothetical protein Csa_2G235610                     68.9    5e-10   
ref|NP_851141.1|  RNA-binding protein                                 68.9    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009609348.1|  PREDICTED: la-related protein 6C-like            68.9    6e-10   
ref|XP_004171643.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.9    6e-10   
ref|XP_008651912.1|  PREDICTED: la-related protein 6C-like            68.9    6e-10   
gb|EMS62383.1|  La-related protein 7                                  67.4    7e-10   
gb|AAK50577.1|AC084404_2  putative RNA-binding protein                68.2    7e-10   Oryza sativa [red rice]
emb|CDY68074.1|  BnaCnng57490D                                        68.2    1e-09   
ref|XP_006646336.1|  PREDICTED: la-related protein 7-like             67.8    1e-09   
gb|EMT07023.1|  La-related protein 7                                  67.8    1e-09   
tpg|DAA49246.1|  TPA: hypothetical protein ZEAMMB73_519082            67.8    1e-09   
emb|CDY33465.1|  BnaA06g36080D                                        67.8    1e-09   
ref|XP_003593945.1|  La-related protein                               67.8    1e-09   
ref|XP_004987293.1|  PREDICTED: la-related protein 7-like             67.8    1e-09   
ref|XP_010255219.1|  PREDICTED: la-related protein 6C-like            67.4    2e-09   
ref|XP_007042355.1|  RNA-binding protein, putative isoform 2          67.4    2e-09   
ref|XP_007042354.1|  RNA-binding protein, putative isoform 1          67.4    2e-09   
ref|XP_007025100.1|  Translation initiation factor eIF-2B subunit...  66.6    2e-09   
dbj|BAJ88869.1|  predicted protein                                    67.0    2e-09   
ref|XP_009114366.1|  PREDICTED: la-related protein 6A-like isofor...  67.0    2e-09   
ref|XP_002461300.1|  hypothetical protein SORBIDRAFT_02g000420        67.4    2e-09   Sorghum bicolor [broomcorn]
emb|CDY03229.1|  BnaC09g19270D                                        67.0    2e-09   
ref|XP_002963146.1|  hypothetical protein SELMODRAFT_35606            65.9    2e-09   
dbj|BAK05864.1|  predicted protein                                    67.0    2e-09   
ref|XP_004960758.1|  PREDICTED: la-related protein 6-like             67.0    2e-09   
ref|XP_002980176.1|  hypothetical protein SELMODRAFT_35604            65.9    3e-09   
ref|XP_006658195.1|  PREDICTED: la-related protein 6-like             66.6    3e-09   
ref|XP_002276730.2|  PREDICTED: la-related protein 6A isoform X2      66.6    3e-09   Vitis vinifera
ref|XP_009145827.1|  PREDICTED: la-related protein 6C-like            66.6    3e-09   
emb|CDX99268.1|  BnaC05g33830D                                        66.6    3e-09   
ref|XP_008667400.1|  PREDICTED: uncharacterized protein LOC100217...  66.6    3e-09   
tpg|DAA41895.1|  TPA: hypothetical protein ZEAMMB73_789693            66.2    4e-09   
ref|NP_001058684.1|  Os07g0102500                                     66.2    4e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007025095.1|  Translation initiation factor eIF-2B subunit...  66.2    4e-09   
ref|XP_007147895.1|  hypothetical protein PHAVU_006G164000g           66.2    4e-09   
ref|XP_003577639.1|  PREDICTED: la-related protein 6B                 66.2    5e-09   
ref|XP_007025097.1|  Translation initiation factor eIF-2B subunit...  65.5    6e-09   
gb|AFW56663.1|  hypothetical protein ZEAMMB73_374856                  65.9    6e-09   
gb|KHG30828.1|  La-related 7                                          65.5    6e-09   
gb|ACR36891.1|  unknown                                               65.9    6e-09   Zea mays [maize]
ref|NP_001148460.1|  LOC100282075                                     65.9    7e-09   Zea mays [maize]
gb|KFK43639.1|  hypothetical protein AALP_AA1G152700                  65.5    7e-09   
ref|XP_007025098.1|  Translation initiation factor eIF-2B subunit...  65.1    8e-09   
emb|CDY35155.1|  BnaA09g17920D                                        65.5    8e-09   
gb|AGT16157.1|  hypothetical protein SHCRBa_167_G07_R_10              64.7    9e-09   
gb|KFK39252.1|  hypothetical protein AALP_AA3G220100                  65.5    9e-09   
gb|AES90236.2|  LA-related protein 6 LA RNA-binding domain protein    65.1    1e-08   
ref|XP_002449258.1|  hypothetical protein SORBIDRAFT_05g006890        65.1    1e-08   Sorghum bicolor [broomcorn]
ref|XP_010481476.1|  PREDICTED: la-related protein 6A-like isofor...  65.1    1e-08   
ref|XP_010559250.1|  PREDICTED: la-related protein 6A isoform X2      65.1    1e-08   
ref|XP_008667401.1|  PREDICTED: uncharacterized protein LOC100217...  65.1    1e-08   
ref|XP_003574867.1|  PREDICTED: la-related protein 6B-like            64.7    2e-08   
ref|XP_010238604.1|  PREDICTED: la-related protein 6B-like            64.3    2e-08   
gb|ADE76238.1|  unknown                                               63.9    2e-08   
ref|XP_006480245.1|  PREDICTED: la-related protein 7-like             63.9    2e-08   
ref|NP_001136552.1|  uncharacterized protein LOC100216671             63.9    2e-08   Zea mays [maize]
gb|ADE76297.1|  unknown                                               63.9    2e-08   
ref|XP_009408806.1|  PREDICTED: la-related protein 6C-like            63.9    2e-08   
gb|KDO49150.1|  hypothetical protein CISIN_1g046325mg                 63.9    3e-08   
gb|KDP37969.1|  hypothetical protein JCGZ_04612                       63.5    3e-08   
ref|XP_008236634.1|  PREDICTED: la-related protein 6C isoform X1      63.5    3e-08   
gb|EPS72682.1|  hypothetical protein M569_02071                       63.2    3e-08   
ref|XP_007025101.1|  Translation initiation factor eIF-2B subunit...  62.8    4e-08   
ref|XP_006346524.1|  PREDICTED: uncharacterized protein LOC102603710  62.8    5e-08   
ref|XP_010315496.1|  PREDICTED: la-related protein 6C                 62.8    6e-08   
ref|XP_004978967.1|  PREDICTED: la-related protein 6-like             62.8    6e-08   
ref|XP_010559249.1|  PREDICTED: la-related protein 6A isoform X1      62.8    7e-08   
ref|XP_009761551.1|  PREDICTED: la-related protein 6C-like isofor...  62.4    8e-08   
ref|XP_004287183.1|  PREDICTED: uncharacterized protein LOC101304608  62.4    8e-08   
ref|XP_009761614.1|  PREDICTED: la-related protein 6C-like isofor...  62.0    1e-07   
gb|EMS68292.1|  hypothetical protein TRIUR3_13301                     61.2    1e-07   
ref|XP_010066055.1|  PREDICTED: la-related protein 6C isoform X1      61.6    1e-07   
ref|XP_007025096.1|  Translation initiation factor eIF-2B subunit...  61.6    1e-07   
ref|XP_004970000.1|  PREDICTED: la-related protein 7-like isoform X2  61.6    1e-07   
ref|XP_009601092.1|  PREDICTED: la-related protein 6A isoform X2      61.2    2e-07   
ref|XP_007156532.1|  hypothetical protein PHAVU_003G293900g           61.2    2e-07   
ref|XP_009601091.1|  PREDICTED: la-related protein 6A isoform X1      61.2    2e-07   
ref|XP_009625721.1|  PREDICTED: la-related protein 6C-like            61.2    2e-07   
gb|EMT12290.1|  La-related protein 7                                  60.8    3e-07   
gb|EPS65505.1|  hypothetical protein M569_09271                       60.5    3e-07   
ref|XP_002865201.1|  predicted protein                                60.8    3e-07   
ref|XP_009788465.1|  PREDICTED: la-related protein 6A isoform X1      60.5    3e-07   
ref|XP_010110987.1|  La-related protein 7                             60.5    3e-07   
ref|XP_009788466.1|  PREDICTED: la-related protein 6A isoform X2      60.5    3e-07   
ref|XP_003608039.1|  La-related protein                               60.5    3e-07   
ref|XP_002445763.1|  hypothetical protein SORBIDRAFT_07g025380        60.5    4e-07   Sorghum bicolor [broomcorn]
dbj|BAJ97952.1|  predicted protein                                    60.1    5e-07   
ref|XP_001774093.1|  predicted protein                                59.3    6e-07   
ref|XP_010655648.1|  PREDICTED: la-related protein 6A isoform X1      59.3    8e-07   
ref|NP_001062396.1|  Os08g0542900                                     59.3    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006398321.1|  hypothetical protein EUTSA_v10000879mg           59.3    9e-07   
ref|XP_001766431.1|  predicted protein                                59.3    9e-07   
ref|XP_003520171.1|  PREDICTED: la-related protein 6-like             59.3    1e-06   
ref|XP_009114365.1|  PREDICTED: la-related protein 6A-like isofor...  58.9    1e-06   
ref|XP_009101529.1|  PREDICTED: la-related protein 6A isoform X2      58.9    1e-06   
ref|XP_006660346.1|  PREDICTED: la-related protein 6-like             58.9    1e-06   
ref|XP_009101528.1|  PREDICTED: la-related protein 6A isoform X1      58.9    1e-06   
gb|KHN31051.1|  La-related protein 7                                  58.9    1e-06   
ref|XP_010540322.1|  PREDICTED: la-related protein 6C                 58.5    1e-06   
ref|XP_003528499.1|  PREDICTED: la-related protein 6-like             58.5    1e-06   
ref|NP_001078721.1|  RNA-binding protein                              58.5    2e-06   
ref|XP_011085065.1|  PREDICTED: la-related protein 6B-like isofor...  58.5    2e-06   
ref|XP_008664459.1|  PREDICTED: la-related protein 6B-like            58.2    2e-06   
ref|NP_568660.3|  RNA-binding protein                                 58.2    2e-06   
ref|XP_007025099.1|  Translation initiation factor eIF-2B subunit...  57.4    3e-06   
ref|XP_010487835.1|  PREDICTED: la-related protein 6C                 57.8    3e-06   
ref|XP_010066056.1|  PREDICTED: la-related protein 6C isoform X2      57.4    3e-06   
gb|EEE66426.1|  hypothetical protein OsJ_22779                        56.2    3e-06   
gb|EYU23753.1|  hypothetical protein MIMGU_mgv1a024089mg              56.2    4e-06   
ref|XP_006356602.1|  PREDICTED: la-related protein 6-like             57.4    4e-06   
ref|XP_004248744.1|  PREDICTED: la-related protein 6C-like            57.0    5e-06   
gb|KDO78159.1|  hypothetical protein CISIN_1g042134mg                 55.5    5e-06   
emb|CDP16095.1|  unnamed protein product                              57.0    5e-06   
ref|XP_011096548.1|  PREDICTED: la-related protein 6A                 56.6    6e-06   
ref|XP_004233116.1|  PREDICTED: la-related protein 6A                 56.6    6e-06   
ref|XP_010496013.1|  PREDICTED: la-related protein 6A-like isofor...  56.2    8e-06   
ref|XP_010496012.1|  PREDICTED: la-related protein 6A-like isofor...  56.2    9e-06   
ref|XP_006384451.1|  hypothetical protein POPTR_0004s15210g           56.2    9e-06   
ref|XP_010496015.1|  PREDICTED: la-related protein 6A-like isofor...  56.2    9e-06   
ref|XP_010466043.1|  PREDICTED: la-related protein 6C-like            56.2    1e-05   
ref|XP_006299563.1|  hypothetical protein CARUB_v10015738mg           55.8    1e-05   
ref|XP_010507427.1|  PREDICTED: la-related protein 6C                 55.8    1e-05   
ref|NP_188540.1|  RNA-binding protein                                 55.8    1e-05   
ref|XP_002883162.1|  predicted protein                                55.8    1e-05   
ref|XP_010481474.1|  PREDICTED: la-related protein 6A-like isofor...  55.8    1e-05   
ref|XP_010481477.1|  PREDICTED: la-related protein 6A-like isofor...  55.8    1e-05   
ref|XP_006352962.1|  PREDICTED: la-related protein 7-like             55.5    2e-05   
ref|XP_010441604.1|  PREDICTED: la-related protein 6A-like isofor...  55.1    2e-05   
ref|XP_008653874.1|  PREDICTED: uncharacterized protein LOC103634016  55.1    2e-05   
ref|XP_010441605.1|  PREDICTED: la-related protein 6A-like isofor...  55.1    2e-05   
ref|XP_010441607.1|  PREDICTED: la-related protein 6A-like isofor...  55.1    2e-05   
gb|KCW75923.1|  hypothetical protein EUGRSUZ_D00299                   55.1    3e-05   
ref|XP_010052065.1|  PREDICTED: la-related protein 6A                 54.7    3e-05   
tpg|DAA61057.1|  TPA: hypothetical protein ZEAMMB73_601196            55.1    3e-05   
emb|CDX82312.1|  BnaA03g35090D                                        54.7    3e-05   
emb|CDY22991.1|  BnaC03g40780D                                        54.7    3e-05   
ref|XP_009135612.1|  PREDICTED: la-related protein 6C-like            54.3    4e-05   
gb|AAF00075.2|AF094825_1  RNA-binding protein homolog                 54.3    4e-05   
ref|XP_002316726.2|  hypothetical protein POPTR_0011s02640g           52.8    1e-04   
ref|XP_008236635.1|  PREDICTED: la-related protein 6C isoform X2      51.6    3e-04   
ref|XP_008236636.1|  PREDICTED: la-related protein 6C isoform X3      51.2    3e-04   
ref|XP_001766501.1|  predicted protein                                51.2    6e-04   
gb|EYU33354.1|  hypothetical protein MIMGU_mgv1a008413mg              50.1    0.001   



>ref|XP_009592278.1| PREDICTED: la-related protein 6B-like [Nicotiana tomentosiformis]
Length=469

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 118/211 (56%), Gaps = 51/211 (24%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R+ KSDST++SNKLH FVEYE++ELAEKA+ ELND ++WRNGLKVR LL+RTAKS   +
Sbjct  257  SRSVKSDSTLYSNKLHVFVEYESVELAEKAVLELNDVDNWRNGLKVRLLLRRTAKSGQAQ  316

Query  182  ALKAGHESEATFKEDDMFG----HKHQIssehsesqsselvgeeegekegVWRAHNRGRG  349
              K GHES   FKEDD F      KH+  S     QS+++  +     +   + HNRGRG
Sbjct  317  EKKVGHESGLNFKEDDDFASELNEKHEEESPCHFEQSNDVADKHGSNGKR--KGHNRGRG  374

Query  350  KGQAV----------GRPQFGVNNQ------------------RGP--------------  403
            K Q            G  QF  NN+                   GP              
Sbjct  375  KVQGPGPGQTRVRGRGAAQFQQNNRGGRTGASTTNLNRGSNVASGPSNTNGVSVAGQPAV  434

Query  404  MCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            +C+Q    +G+Q+SVPRMPDGTRGFSMGRGK
Sbjct  435  VCDQ---SAGKQSSVPRMPDGTRGFSMGRGK  462



>emb|CDP19151.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 108/193 (56%), Gaps = 37/193 (19%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R AK D   FSNKLHAFVEYE++ELAEKA+ ELN+ N WRNGLKVR LLKR+ K++  R
Sbjct  138  SRAAKGDPVNFSNKLHAFVEYESVELAEKAVLELNEGN-WRNGLKVRLLLKRSPKAAQAR  196

Query  182  ALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAH---------  334
              KAGHE E +FK++D FG +H       +     L    +   E +W  H         
Sbjct  197  DKKAGHEGEYSFKDEDGFGPEH------IQQHEKCLDDYVQPPNEPMWEEHGNNKEGGLR  250

Query  335  ----------NRGRGKGQAVGRPQFGVNNQRG---------PMCEQLQMVSGRQASVPRM  457
                      N  RG G+  GRP +  NN RG         P+  + Q  + +Q  VPRM
Sbjct  251  KSRSREFREVNENRGWGKGRGRPAYNSNN-RGNHPGVASNVPLNIE-QPTAAKQPPVPRM  308

Query  458  PDGTRGFSMGRGK  496
            PDGT+GFSMGRGK
Sbjct  309  PDGTKGFSMGRGK  321



>ref|XP_009800734.1| PREDICTED: la-related protein 6B-like [Nicotiana sylvestris]
Length=535

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 102/205 (50%), Gaps = 46/205 (22%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            RT KSDST++S KLHAFVEYE++ELAEKA+ ELND N+WRNGLK+R L + T KS   R 
Sbjct  329  RTGKSDSTLYSTKLHAFVEYESVELAEKAVMELNDENNWRNGLKLRILNRCTGKSGQNRG  388

Query  185  LKAGHESEATFKEDDMFGHK----------HQIssehsesqsselvgeeegekegVWRAH  334
             K GHES   FKE+D FG +          H   +  S+                 W   
Sbjct  389  KKVGHESVLNFKEEDAFGSEASEKHNEDLWHHFDTHLSDLAEEHGTDGLRKGLNRSWI--  446

Query  335  NRGRGKGQAVGRPQFGVNNQRG-------------------------------PMCEQLQ  421
               +G+GQ  GR QF  NN+ G                               P     Q
Sbjct  447  ---KGQGQGRGRLQFHQNNRGGHLGGAPTSTMRRAYSVGSALSNFNRVSLAGHPSMLSEQ  503

Query  422  MVSGRQASVPRMPDGTRGFSMGRGK  496
                +QASVPRMPDGTRGFSMGRGK
Sbjct  504  SAPAKQASVPRMPDGTRGFSMGRGK  528



>ref|XP_006342440.1| PREDICTED: la-related protein 6-like [Solanum tuberosum]
Length=518

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 107/204 (52%), Gaps = 44/204 (22%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +RT KSDST++SNKLHAFVEYE+IELAEKA+ ELND ++WRNGLKVR L + T KS   R
Sbjct  313  SRTGKSDSTLYSNKLHAFVEYESIELAEKAVMELNDEDNWRNGLKVRILNRCTGKSGQIR  372

Query  182  ALKAGHESEATFKEDDMFGHK---------HQIssehsesqsselvgeeegekegVWRAH  334
              K G+ESE +FKEDD              H + +   +      V  +       W   
Sbjct  373  GKKVGYESEVSFKEDDTSSEASEKHSDDLWHHLDTHLYDLAEEHGVDGQRKGLNRSWV--  430

Query  335  NRGRGKGQAVGRPQFGVNNQRG-------------------------PMCEQLQMVSG--  433
               +G GQ  GRPQF   ++ G                          +  Q  M+S   
Sbjct  431  ---KGLGQGRGRPQFHQTSRGGHLGTPQASMRRAYSVGSALSSINRFSLAGQPSMLSDQS  487

Query  434  ---RQASVPRMPDGTRGFSMGRGK  496
               +QASVPRMPDGTRGFSMGRGK
Sbjct  488  APVKQASVPRMPDGTRGFSMGRGK  511



>ref|XP_004253040.1| PREDICTED: la-related protein 6B-like [Solanum lycopersicum]
Length=514

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 113/200 (57%), Gaps = 37/200 (19%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +RT KSD+T++SNKLHAFVEYE+IELAEKA+ ELND ++WRNGLKVR L + T KS   R
Sbjct  310  SRTGKSDTTLYSNKLHAFVEYESIELAEKAVMELNDEDNWRNGLKVRILNRWTGKSGQTR  369

Query  182  ALKAGHESEATFKEDDMFG-----HKHQIssehsesqsselvgeeegekegVWRAHNRGR  346
              K G+ESE +FKEDD        H   +        +       +G+++G+ R+  +G 
Sbjct  370  GKKIGYESEVSFKEDDTSSEASEKHSDDLWHHLDAHLNDLAEEHVDGQRKGLNRSWVKGL  429

Query  347  GKGQAVGRPQFGVNNQRG-------------------------PMCEQLQMVSG-----R  436
            G+G+  GRPQF   ++ G                          +  Q  M+S      +
Sbjct  430  GQGR--GRPQFHQTSRGGHLSTPPASMRRAYSVGSALSSINRFSLAGQPSMLSDQSAPVK  487

Query  437  QASVPRMPDGTRGFSMGRGK  496
            Q SVPRMPDGTRGFSMGRGK
Sbjct  488  QTSVPRMPDGTRGFSMGRGK  507



>ref|XP_009798623.1| PREDICTED: la-related protein 6B-like [Nicotiana sylvestris]
Length=483

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 105/196 (54%), Gaps = 41/196 (21%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            RTAKSDS ++SNKLHAFVEYE+I+LAE A+AELND ++WRNGLKVR LL+ T K    R 
Sbjct  290  RTAKSDSMMYSNKLHAFVEYESIKLAETAVAELNDEDNWRNGLKVRLLLRHTEKCGQARG  349

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAV  364
             K GHESE  FKEDD F        E +E  + E     +     +   H+   G  +  
Sbjct  350  KKTGHESEHNFKEDDGFA------LEVNEKLNEESSHHLDARSNELAEEHD-SDGMRKRC  402

Query  365  GR----------------PQFGVNNQRG----------------PMCEQLQMVSGRQASV  448
            GR                PQF  NN  G                P+ +  Q  + +Q+SV
Sbjct  403  GRARGKGQGQGQGRGHGRPQFHQNNCGGSVKSAPSNINRVGLGQPVFD--QSAAAKQSSV  460

Query  449  PRMPDGTRGFSMGRGK  496
            PRM DGT+GFSMGRGK
Sbjct  461  PRMSDGTKGFSMGRGK  476



>ref|XP_009761351.1| PREDICTED: la-related protein 6B-like [Nicotiana sylvestris]
Length=478

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 107/206 (52%), Gaps = 56/206 (27%)
 Frame = +2

Query  26   TVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHES  205
            T++SNKLH FVEYE++ELAEKA+ ELND ++WRNGLKVR LL+ TAKS   +  K GHES
Sbjct  273  TLYSNKLHVFVEYESVELAEKAVLELNDVDNWRNGLKVRLLLRCTAKSGQAQEKKVGHES  332

Query  206  EATFKEDDMFG----HKHQ-------------IssehsesqsselvgeeegekegVWRAH  334
               FKEDD F      KH+             I+ +H  +   +      G+ +G     
Sbjct  333  GLNFKEDDDFASELNEKHEEESPCHSDVQSNDIADKHGSNGKRKGHNRGRGKGQGPGPGQ  392

Query  335  NRGRGKGQAVGRPQFGVNN--------------------------------QRGPMCEQL  418
             RGRG+G A    QF  NN                                Q   +C+Q 
Sbjct  393  TRGRGRGPA----QFQQNNRGGRTGASTTNLNRGSNVASAPSNTNGVSIAGQPAVVCDQ-  447

Query  419  QMVSGRQASVPRMPDGTRGFSMGRGK  496
               +G+Q+SVPRMPDGTRGFSMGRGK
Sbjct  448  --SAGKQSSVPRMPDGTRGFSMGRGK  471



>ref|XP_006353141.1| PREDICTED: uncharacterized protein LOC102593695 [Solanum tuberosum]
Length=495

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 110/223 (49%), Gaps = 67/223 (30%)
 Frame = +2

Query  26   TVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHES  205
            T++SNKLHAFVEY+ +ELAEKA+ ELND ++WRNGLKV  LL+RTAKS   R  K GHES
Sbjct  267  TMYSNKLHAFVEYDAVELAEKAVLELNDVDNWRNGLKVHLLLRRTAKSGQSRVKKVGHES  326

Query  206  EATFKEDDMFG----------HKHQIssehsesqsselvgeeegekegVW----------  325
            +  FKEDD               H +  + ++   S++      ++  ++          
Sbjct  327  DPNFKEDDDVALELNEKHDGDSSHHVDVQSNDVAVSDVAMLLINQEIFLFLFPFRETEDH  386

Query  326  ------RAHNRGRGK------GQAVGR----PQF--------------------------  379
                  + +NRGRGK      GQ  GR    PQF                          
Sbjct  387  SRVGKKKGNNRGRGKVQGQGPGQMRGRGRETPQFRQTNRGGRTGGSVTKVNTGSSVASAS  446

Query  380  ----GVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
                GVN    P     Q  +G+Q+SVPRMPDGT+GFSMGRGK
Sbjct  447  SSTGGVNVAGQPAVVSDQS-AGKQSSVPRMPDGTKGFSMGRGK  488



>ref|XP_009603304.1| PREDICTED: la-related protein 6B-like [Nicotiana tomentosiformis]
Length=537

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 104/205 (51%), Gaps = 44/205 (21%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            RT KSDST++S KLHAFVEYE+IELAEKA+ ELND N+WRNGLK+R L + T K    R 
Sbjct  329  RTGKSDSTLYSTKLHAFVEYESIELAEKAVMELNDENNWRNGLKLRILNRCTGKCGQNRG  388

Query  185  LKAGHESEATFKEDDMFGHK----------HQIssehsesqsselvgeeegekegVWRAH  334
             K GHESE   KE+D FG +          H   +  S+         +       W   
Sbjct  389  KKVGHESELNLKEEDAFGSEASEKHNEDLWHHFDTHLSDLAEEHGSDGQRKGLNRSWI--  446

Query  335  NRGRGKGQAVGRPQFGVNNQRG-------------------------------PMCEQLQ  421
             +G+G+GQ  GR QF  NN+ G                               P     Q
Sbjct  447  -KGQGQGQGRGRLQFHQNNRGGHLGGAPTSTMRRAHSVGSALSNFNRVSLAGHPSMLSEQ  505

Query  422  MVSGRQASVPRMPDGTRGFSMGRGK  496
                +QASVPRMPDGTRGFSMGRGK
Sbjct  506  STPAKQASVPRMPDGTRGFSMGRGK  530



>ref|XP_004251985.1| PREDICTED: la-related protein 6B [Solanum lycopersicum]
Length=473

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 101/201 (50%), Gaps = 46/201 (23%)
 Frame = +2

Query  26   TVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHES  205
            T++SNKLHAFVEY+ +ELAEKA+ ELND ++WRNGLKV  LL+R AKS   R  K GHES
Sbjct  268  TMYSNKLHAFVEYDAVELAEKAVLELNDVDNWRNGLKVHLLLRRAAKSGQARVKKVGHES  327

Query  206  EATFKEDD----MFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGK------G  355
            +   KEDD        KH                 EE  + G  + +NRGRGK      G
Sbjct  328  DPNSKEDDDVALELNEKHD-GDSSHHVDVQSNDVAEEHGRVGKKKGNNRGRGKVQGQGPG  386

Query  356  QAVGR----PQF------------------------------GVNNQRGPMCEQLQMVSG  433
            Q  GR    PQF                              GVN    P     Q   G
Sbjct  387  QTRGRGRETPQFRQTNRGGRTGGSVTKVNTGSSVASAPSSTGGVNVTGQPAVVTDQS-GG  445

Query  434  RQASVPRMPDGTRGFSMGRGK  496
            +Q+SVPRMPDGT+GFSMGRGK
Sbjct  446  KQSSVPRMPDGTKGFSMGRGK  466



>ref|XP_007026488.1| RNA-binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY06990.1| RNA-binding protein, putative isoform 2 [Theobroma cacao]
Length=431

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 100/195 (51%), Gaps = 41/195 (21%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +RTAKSD   FSNKLHAFVEYE++ELAEKA+AELND  +WR+GL+VR +L+R +K +  R
Sbjct  241  SRTAKSDGMHFSNKLHAFVEYESVELAEKAVAELNDEGNWRSGLRVRLMLRRVSKPTHTR  300

Query  182  ALKAGHESEATFKEDDMFG-------------------HKHQIssehsesqss-----el  289
              K GH+ E  ++EDD                      H H+   E   ++         
Sbjct  301  G-KKGHDGEGHYEEDDASTSEQQSNDKQQEDPSQLSDIHSHEYPGEEHSNEKEGGQKKGR  359

Query  290  vgeeegekegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASV------P  451
                   +      +N+   +G  VG P    +N          +VS  QA+V      P
Sbjct  360  NRGRGKGRGRAQYHNNQHNSRGNHVGTPPSATSN----------LVSNEQATVAKQPPGP  409

Query  452  RMPDGTRGFSMGRGK  496
            RMPDGTRGF+MGRGK
Sbjct  410  RMPDGTRGFAMGRGK  424



>ref|XP_007026487.1| RNA-binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY06989.1| RNA-binding protein, putative isoform 1 [Theobroma cacao]
Length=500

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 100/195 (51%), Gaps = 41/195 (21%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +RTAKSD   FSNKLHAFVEYE++ELAEKA+AELND  +WR+GL+VR +L+R +K +  R
Sbjct  310  SRTAKSDGMHFSNKLHAFVEYESVELAEKAVAELNDEGNWRSGLRVRLMLRRVSKPTHTR  369

Query  182  ALKAGHESEATFKEDDMFG-------------------HKHQIssehsesqss-----el  289
              K GH+ E  ++EDD                      H H+   E   ++         
Sbjct  370  G-KKGHDGEGHYEEDDASTSEQQSNDKQQEDPSQLSDIHSHEYPGEEHSNEKEGGQKKGR  428

Query  290  vgeeegekegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASV------P  451
                   +      +N+   +G  VG P    +N          +VS  QA+V      P
Sbjct  429  NRGRGKGRGRAQYHNNQHNSRGNHVGTPPSATSN----------LVSNEQATVAKQPPGP  478

Query  452  RMPDGTRGFSMGRGK  496
            RMPDGTRGF+MGRGK
Sbjct  479  RMPDGTRGFAMGRGK  493



>ref|XP_010672517.1| PREDICTED: la-related protein 6B [Beta vulgaris subsp. vulgaris]
Length=517

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 101/187 (54%), Gaps = 27/187 (14%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R +K+D+ ++ NKLHAFVEYE+IELAEKAIAELND  +WRNGL+VR LLK  +K++  R
Sbjct  328  SRPSKTDNMLYCNKLHAFVEYESIELAEKAIAELNDEGNWRNGLRVRALLKHGSKTAQTR  387

Query  182  ALKAGHESEATFKEDD---------------------MFGHKHQIssehsesqsselvge  298
              K+G+E E T +E+D                     +   +H       +    +    
Sbjct  388  GKKSGNEGEVTCEEEDASTSEQNQNEKPSEDLSTQPDVHSQEHVEEQTLEKEGGQKKTRN  447

Query  299  eegekegVWRAHNRGRG-KGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRG  475
                K      HN  +  +G  VG P   +NN    M  +  +V+ +Q   PRMPDGTRG
Sbjct  448  RGRGKGRGRGHHNHHQNNRGIHVGSPP--INNA---MNGEHPIVAKQQPPGPRMPDGTRG  502

Query  476  FSMGRGK  496
            FSMGRG+
Sbjct  503  FSMGRGR  509



>ref|XP_006351071.1| PREDICTED: la-related protein 6-like isoform X1 [Solanum tuberosum]
Length=465

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 106/202 (52%), Gaps = 44/202 (22%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            RTAKSDST+ SNKLH FVEYET ELAE+A+ ELND N WRN LKVR LL+ + KS   + 
Sbjct  263  RTAKSDSTLHSNKLHTFVEYETAELAERAVVELNDDN-WRNALKVRLLLRSSEKSGQAQG  321

Query  185  LKAGHESEATFKEDD-----------------------MFGHKHQIssehsesqsselvg  295
             KAGHESE  FK DD                           +H    +          G
Sbjct  322  KKAGHESE-NFKGDDGSALEVNEKLNEESSHHIDAKSNELAEEHGSDGQRRGRGQGRGRG  380

Query  296  eeegekegVWRAHNRGRGKGQAVGRPQFGVN------------NQRG---PMCEQLQMVS  430
            + +G++ G  ++H   RG    +G P   VN            N+ G   P+ E  Q  +
Sbjct  381  KGQGQRRGRPQSHQNNRGGH--LGAPISNVNRGSNVRNTLSNINRAGVGQPVLE--QSAA  436

Query  431  GRQASVPRMPDGTRGFSMGRGK  496
             +Q+SVPRMPDGT+GFSMGRGK
Sbjct  437  PKQSSVPRMPDGTKGFSMGRGK  458



>emb|CBI24756.3| unnamed protein product [Vitis vinifera]
Length=325

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 99/183 (54%), Gaps = 28/183 (15%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R++K+D+ +FSNKLHAFVEYE+IELAEKA+ ELND  +WR+GL+VR + +R AKS+  R+
Sbjct  145  RSSKTDNMLFSNKLHAFVEYESIELAEKAVVELNDEGNWRSGLRVRLMHRRVAKSAQARS  204

Query  185  LKAGHESEATFKED-----------------DMFGHKH--QIssehsesqsselvgeeeg  307
             K GHE EA  +ED                 D+  H+H  +      E    +      G
Sbjct  205  RK-GHEGEAICEEDDACTSEQLPNDKQPEDPDVHSHEHAGEEHINDKEGAQRKGRSRGRG  263

Query  308  ekegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMG  487
            +  G  + H+ G  +G  VG P     N   P          +    PRMPDGTRGFSMG
Sbjct  264  KGRGRGQYHHHG-NRGNHVGTPPNSSINHEQPAV-------AKPPPGPRMPDGTRGFSMG  315

Query  488  RGK  496
            RGK
Sbjct  316  RGK  318



>ref|XP_002275950.2| PREDICTED: LOW QUALITY PROTEIN: la-related protein 6B [Vitis 
vinifera]
Length=453

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 99/183 (54%), Gaps = 28/183 (15%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R++K+D+ +FSNKLHAFVEYE+IELAEKA+ ELND  +WR+GL+VR + +R AKS+  R+
Sbjct  273  RSSKTDNMLFSNKLHAFVEYESIELAEKAVVELNDEGNWRSGLRVRLMHRRVAKSAQARS  332

Query  185  LKAGHESEATFKED-----------------DMFGHKH--QIssehsesqsselvgeeeg  307
             K GHE EA  +ED                 D+  H+H  +      E    +      G
Sbjct  333  RK-GHEGEAICEEDDACTSEQLPNDKQPEDPDVHSHEHAGEEHINDKEGAQRKGRSRGRG  391

Query  308  ekegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMG  487
            +  G  + H+ G  +G  VG P     N   P          +    PRMPDGTRGFSMG
Sbjct  392  KGRGRGQYHHHG-NRGNHVGTPPNSSINHEQPAV-------AKPPPGPRMPDGTRGFSMG  443

Query  488  RGK  496
            RGK
Sbjct  444  RGK  446



>ref|XP_004244780.1| PREDICTED: la-related protein 6B [Solanum lycopersicum]
Length=456

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 104/200 (52%), Gaps = 40/200 (20%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            RTAKSDST+ SNKLHAFVEYET ELAE+A  ELND N WRN L+VR LL+ + KS   + 
Sbjct  254  RTAKSDSTLHSNKLHAFVEYETAELAERAAVELNDDN-WRNALEVRLLLRSSEKSGQAQG  312

Query  185  LKAGHESEATFKEDD-----------------------MFGHKHQIssehsesqsselvg  295
             KAGH+SE  FK DD                           +H    +          G
Sbjct  313  KKAGHDSE-NFKGDDGSALEVNEKLNEESRHHIDAKSNELAEEHGSDGQRRGRGQGRGRG  371

Query  296  eeegekegVWRAHNRGRGKGQAVGRPQFGVN---NQRGPMCEQL----------QMVSGR  436
            + +G++ G  ++H   RG    +G P   VN   N R  +   +          Q  + +
Sbjct  372  KGQGQRRGRPQSHQNNRGGH--LGAPLSNVNRGSNVRNSLSNIIRVGVGKPVLEQSAAAK  429

Query  437  QASVPRMPDGTRGFSMGRGK  496
            Q+SVPRMPDGT+GFSMGRGK
Sbjct  430  QSSVPRMPDGTKGFSMGRGK  449



>gb|KDP29552.1| hypothetical protein JCGZ_19265 [Jatropha curcas]
Length=526

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 101/182 (55%), Gaps = 19/182 (10%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R+ K+D   FSNKLHAFVEYE++E+AEKA+ ELND   WR+GL+VR +LKRT+K +  R
Sbjct  340  SRSTKADGMHFSNKLHAFVEYESVEIAEKAVIELNDEESWRSGLRVRLMLKRTSKHTQAR  399

Query  182  ALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWR-----AHNRGR  346
              K GH+     +ED+    + Q + +  ES           +           AH +GR
Sbjct  400  G-KKGHDGSGHSEEDEASTSEQQPNEKQHESPPQHHDVHSHEQSGEDHANDKEGAHRKGR  458

Query  347  GKG---QAVGRPQFGVNNQ---------RGPMCEQLQMVSGRQASVPRMPDGTRGFSMGR  490
             KG   +  GR Q   NN+           P+  +L  V+ +Q   PRMPDGTRGF+MGR
Sbjct  459  NKGHRNKGRGRGQHHHNNRGNHVGTPPSNNPVMSELPTVA-KQPPGPRMPDGTRGFAMGR  517

Query  491  GK  496
            GK
Sbjct  518  GK  519



>ref|XP_007026489.1| RNA-binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY06991.1| RNA-binding protein, putative isoform 3 [Theobroma cacao]
Length=501

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 100/196 (51%), Gaps = 42/196 (21%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKA-IAELNDRNDWRNGLKVRPLLKRTAKSSTP  178
            +RTAKSD   FSNKLHAFVEYE++ELAEKA +AELND  +WR+GL+VR +L+R +K +  
Sbjct  310  SRTAKSDGMHFSNKLHAFVEYESVELAEKAVVAELNDEGNWRSGLRVRLMLRRVSKPTHT  369

Query  179  RALKAGHESEATFKEDDMFG-------------------HKHQIssehsesqss-----e  286
            R  K GH+ E  ++EDD                      H H+   E   ++        
Sbjct  370  RG-KKGHDGEGHYEEDDASTSEQQSNDKQQEDPSQLSDIHSHEYPGEEHSNEKEGGQKKG  428

Query  287  lvgeeegekegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASV------  448
                    +      +N+   +G  VG P    +N          +VS  QA+V      
Sbjct  429  RNRGRGKGRGRAQYHNNQHNSRGNHVGTPPSATSN----------LVSNEQATVAKQPPG  478

Query  449  PRMPDGTRGFSMGRGK  496
            PRMPDGTRGF+MGRGK
Sbjct  479  PRMPDGTRGFAMGRGK  494



>ref|XP_009598306.1| PREDICTED: la-related protein 6B [Nicotiana tomentosiformis]
Length=491

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +RTAKSDS ++SNKLHAFVEYE+I+LAE+A+AELND ++WRN LKVR LL+ T K    R
Sbjct  286  SRTAKSDSMMYSNKLHAFVEYESIKLAERAVAELNDEDNWRNCLKVRLLLRHTEKCGQAR  345

Query  182  ALKAGHESEATFKEDDMFG  238
              K GH+SE  FKEDD F 
Sbjct  346  GKKVGHDSEHNFKEDDSFA  364



>ref|XP_011074010.1| PREDICTED: la-related protein 6B-like [Sesamum indicum]
Length=445

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 98/190 (52%), Gaps = 25/190 (13%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            ++  K D   FS K HAFVEYE+ ELAE+A+AEL D  +WRN LKVR LLK   K +  R
Sbjct  249  SKAGKGDGLQFSGKFHAFVEYESAELAERAVAELKDDGNWRNCLKVRLLLKNVVKPTNAR  308

Query  182  ALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKG--  355
            A K  HE ++T K+D+    + Q+  E+    +     ++  E +      + G+ KG  
Sbjct  309  AKKVIHEGQSTVKKDETIVAEMQVFKENHLEDTVRQSDKQNHELQLEDTVKSNGQKKGRS  368

Query  356  ----------------QAVGRPQF---GVNNQRGPMCE----QLQMVSGRQASVPRMPDG  466
                            Q+ GRPQ    G N    P  E      ++   + +SVPRMPDG
Sbjct  369  SVGGSLNGNGKGKGKGQSRGRPQHPTNGGNISASPSLEVSLSNEKLNIAKASSVPRMPDG  428

Query  467  TRGFSMGRGK  496
            T+GFSMGRGK
Sbjct  429  TKGFSMGRGK  438



>ref|XP_008243073.1| PREDICTED: la-related protein 6B [Prunus mume]
Length=473

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 97/186 (52%), Gaps = 28/186 (15%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R+ K+DST+FSNKLHAFVEYE+ ELAEKA+AELND  +WR+GLKVR +L+R +K +  R
Sbjct  288  SRSTKADSTLFSNKLHAFVEYESPELAEKAVAELNDEANWRSGLKVRLMLRRASKPAQVR  347

Query  182  ALKAGHESEATFKED---------------------DMFGHKHQIssehsesqsselvge  298
              K G + E    E+                     D + H+H     + +         
Sbjct  348  G-KKGQDGEVQLDEEDASSPEQQANEKQSVDSSQQSDAYSHEHGEEHGNDKEVGQRKGRN  406

Query  299  eegekegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGF  478
                K      ++    +G  VG P    +N  G + EQ  +   +Q   PRMPDGTRGF
Sbjct  407  RGRGKGRGRGQYHHNNNRGNHVGPPP---HNSVGSI-EQPGV--AKQPPGPRMPDGTRGF  460

Query  479  SMGRGK  496
            +MGRGK
Sbjct  461  AMGRGK  466



>ref|XP_007202011.1| hypothetical protein PRUPE_ppa005181mg [Prunus persica]
 gb|EMJ03210.1| hypothetical protein PRUPE_ppa005181mg [Prunus persica]
Length=473

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 97/186 (52%), Gaps = 28/186 (15%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R+ K+DST+FSNKLHAFVEYE+ ELAEKA+AELND  +WR+GLKVR +L+R +K++  R
Sbjct  288  SRSTKADSTLFSNKLHAFVEYESPELAEKAVAELNDEANWRSGLKVRLMLRRVSKAAQVR  347

Query  182  ALKAGHESEATFKED---------------------DMFGHKHQIssehsesqsselvge  298
              K G + E    E+                     D   H+H     + +         
Sbjct  348  G-KKGQDGEVQLDEEDASSPEQQANEKQSVDSSQQSDAHSHEHGEEHGNDKEVGQRKGRN  406

Query  299  eegekegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGF  478
                K      ++    +G  VG P    +N  G + EQ  +   +Q   PRMPDGTRGF
Sbjct  407  RGRGKGRGRGQYHHNTNRGNHVGPPP---HNLVGSI-EQPGV--AKQPPGPRMPDGTRGF  460

Query  479  SMGRGK  496
            +MGRGK
Sbjct  461  AMGRGK  466



>ref|XP_010101330.1| La-related protein 7 [Morus notabilis]
 gb|EXB88277.1| La-related protein 7 [Morus notabilis]
Length=480

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 101/190 (53%), Gaps = 34/190 (18%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R AKSD+ +FSNKLHAFVEYE++ELAEKA+ ELND  +WR+GL+VR ++KR +K S  R
Sbjct  293  SRAAKSDNMLFSNKLHAFVEYESVELAEKAVTELNDEGNWRSGLRVRLMVKRMSKPSQVR  352

Query  182  ALKAGHESEATFKEDDMF---------------------GHKH----QIssehsesqsse  286
              K GH+ +   +EDD                        H+H     +S +    +   
Sbjct  353  GRK-GHDGDMQGEEDDACTTESPVNSKQLEDASQQSDAPSHEHPGEEHVSDKEGGQKKGR  411

Query  287  lvgeeegekegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDG  466
              G  +G   G +  +NRG      VG P    NN  G        V+ +Q   PRMPDG
Sbjct  412  SRGRGKGRGRGHYHHNNRG---NNVVGTPPSN-NNSVG----MESGVAKQQPPGPRMPDG  463

Query  467  TRGFSMGRGK  496
            TRGF+MGRGK
Sbjct  464  TRGFAMGRGK  473



>ref|XP_006493132.1| PREDICTED: lateral signaling target protein 2 homolog [Citrus 
sinensis]
Length=536

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 102/203 (50%), Gaps = 51/203 (25%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            KS+  +FSNKLHAFVEYE++ELAEKAIAELND  +WR+GL+VR +L+R +K +  +  K 
Sbjct  336  KSEGMLFSNKLHAFVEYESVELAEKAIAELNDEGNWRSGLRVRLMLRRGSKPAQVKG-KK  394

Query  194  GHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVW---------RAHNRGR  346
            GHE E   +E+D    +  ++ +  +  S +   +                  +  N+GR
Sbjct  395  GHEGEWQCEEEDTSTSEQHLNEKQPDDSSQQSDVQSHDHTGEEHNNEKEGGQRKGRNKGR  454

Query  347  GKGQA-------------------------------VGRPQFG--VNNQRGPMCEQLQMV  427
            GKG+                                VG P     VNN++ PM       
Sbjct  455  GKGRGRNDRGQYHNSHHNNSHHNSNHNSHHNNRGHHVGTPPSNNMVNNEQ-PMI------  507

Query  428  SGRQASVPRMPDGTRGFSMGRGK  496
             G+Q   PRMPDGTRGF+MGRGK
Sbjct  508  -GKQPPGPRMPDGTRGFAMGRGK  529



>ref|XP_006442037.1| hypothetical protein CICLE_v10019649mg [Citrus clementina]
 gb|ESR55277.1| hypothetical protein CICLE_v10019649mg [Citrus clementina]
Length=536

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 102/204 (50%), Gaps = 52/204 (25%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            KS+  +FSNKLHAFVEYE++ELAEKAIAELND  +WR+GL+VR +L+R +K +  +  K 
Sbjct  335  KSEGMLFSNKLHAFVEYESVELAEKAIAELNDEGNWRSGLRVRLMLRRGSKPAQVKG-KK  393

Query  194  GHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVW---------RAHNRGR  346
            GHE E   +E+D    +  ++ +  +  S +   +                  +  N+GR
Sbjct  394  GHEGEWQCEEEDTSTSEQHLNEKQPDDSSQQSDVQSHDHTGEEHNNEKEGGQRKGRNKGR  453

Query  347  GKGQA--------------------------------VGRPQFG--VNNQRGPMCEQLQM  424
            GKG+                                 VG P     VNN++ PM      
Sbjct  454  GKGRGRNDRGQYHNNSHHNNSHHNSNHNNHHNNRGHHVGTPPSNNMVNNEQ-PMI-----  507

Query  425  VSGRQASVPRMPDGTRGFSMGRGK  496
              G+Q   PRMPDGTRGF+MGRGK
Sbjct  508  --GKQPPGPRMPDGTRGFAMGRGK  529



>gb|KDO51612.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=532

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 105/197 (53%), Gaps = 45/197 (23%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            KS+  +FSNKLHAFVEYE++ELAEKAIAELND  +WR+GL+VR +L+R +K +  +  K 
Sbjct  338  KSEGMLFSNKLHAFVEYESVELAEKAIAELNDEGNWRSGLRVRLMLRRGSKPAQVKG-KK  396

Query  194  GHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekeg--VWRAHNRGRGKGQA--  361
            G E E   +E+D    +  ++ +  +  S +  GEE   ++     +  N+GRGKG+   
Sbjct  397  GPEGEWQCEEEDTSTSEQHLNEKQPDDSSQQSDGEEHNNEKEGGQRKGRNKGRGKGRGRN  456

Query  362  ------------------------------VGRPQFG--VNNQRGPMCEQLQMVSGRQAS  445
                                          VG P     VNN++ PM        G+Q  
Sbjct  457  DRGQYHNNSHHNNSHHNSNHNNHHNNRGHHVGTPPSNNMVNNEQ-PMI-------GKQPP  508

Query  446  VPRMPDGTRGFSMGRGK  496
             PRMPDGTRGF+MGRGK
Sbjct  509  GPRMPDGTRGFAMGRGK  525



>ref|XP_008447188.1| PREDICTED: la-related protein 6B isoform X5 [Cucumis melo]
Length=306

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 100/186 (54%), Gaps = 24/186 (13%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +++AK+D   +SNKLHAFVEYE++ELAEKA+AELND  +WRN L++R +L  ++KS+  R
Sbjct  117  SKSAKADGMHYSNKLHAFVEYESVELAEKAVAELNDEGNWRNALRLRLMLSCSSKSAPVR  176

Query  182  ALKAGHESEATFKEDD------MFGHKHQIssehsesqsselvgeeegekegVW-RAHNR  340
              K GH  E  +K+ D      +  H   +S +       +       +  G   R  NR
Sbjct  177  G-KKGHNGEMNYKDVDASEQPAIEKHVDDLSDQVDVHPPEQREEHGNEKDGGGQRRVRNR  235

Query  341  GRGKGQAVGRPQFGVNNQRG-----------PMCEQLQMVSG---RQASVPRMPDGTRGF  478
             RGKG+  GR Q+  N+              P        +G   +Q   PRMPDGTRGF
Sbjct  236  VRGKGR--GRSQYHHNHNNIHNHGNHVGTPPPSSSTTIEQAGTMKQQPPGPRMPDGTRGF  293

Query  479  SMGRGK  496
            +MGRGK
Sbjct  294  AMGRGK  299



>ref|XP_009343678.1| PREDICTED: la-related protein 6B [Pyrus x bretschneideri]
Length=490

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 99/190 (52%), Gaps = 32/190 (17%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            K+D  +FSNKLHAFVEYE+ E+AEKA+AELND  +WR+GL+VR +L+R  K +  R  K 
Sbjct  297  KADGMLFSNKLHAFVEYESPEIAEKAVAELNDEANWRSGLRVRLMLRRATKPAQVRG-KK  355

Query  194  GHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegV-----------------  322
            G + E   +E+D    + Q + + S   S +        +E                   
Sbjct  356  GQDGEVQLEEEDASTAEQQANEKQSVDSSQQSNVHPHEHEERTNSLKYGEEHGNDKEVGQ  415

Query  323  WRAHNRGRGKGQAVGRPQFGVNNQ---RG---------PMCEQLQMVSGRQASVPRMPDG  466
             +  N+GR KG+  GR Q+  N+    RG          +    Q V  +Q   PRMPDG
Sbjct  416  RKGRNKGRVKGR--GRGQYHQNHHNINRGNHAGHPPNNSVGSTEQAVVTKQPPGPRMPDG  473

Query  467  TRGFSMGRGK  496
            TRGF+MGRGK
Sbjct  474  TRGFAMGRGK  483



>ref|XP_004139806.1| PREDICTED: uncharacterized protein LOC101207485 [Cucumis sativus]
Length=492

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 97/186 (52%), Gaps = 24/186 (13%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +++AK+D   +SNKLHAFVEYE++ELAEKA+AELND  +WRN L++R +L  ++KS+  R
Sbjct  303  SKSAKADGMHYSNKLHAFVEYESVELAEKAVAELNDEGNWRNALRLRLMLSCSSKSAPVR  362

Query  182  ALKAGHESEATFKEDD------MFGHKHQIssehsesqsselvgeeegekegVW-RAHNR  340
              K GH  E  +K+ D      +  H   +S +       +       +  G   R  NR
Sbjct  363  G-KKGHNGEMNYKDVDTSEQPAIEKHVDDLSDQVDVHPPEQREEHGNEKDGGGQRRVRNR  421

Query  341  GRGKGQAVGRPQF--------------GVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGF  478
             RGKG+  GR Q+              G          +      +Q   PRMPDGTRGF
Sbjct  422  VRGKGR--GRSQYHHNHNNNHSHGNHLGTPPPSSSTTIEQAGTMKQQPPGPRMPDGTRGF  479

Query  479  SMGRGK  496
            SMGRGK
Sbjct  480  SMGRGK  485



>gb|KDO51614.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=539

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 101/204 (50%), Gaps = 52/204 (25%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            KS+  +FSNKLHAFVEYE++ELAEKAIAELND  +WR+GL+VR +L+R +K +  +  K 
Sbjct  338  KSEGMLFSNKLHAFVEYESVELAEKAIAELNDEGNWRSGLRVRLMLRRGSKPAQVKG-KK  396

Query  194  GHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVW---------RAHNRGR  346
            G E E   +E+D    +  ++ +  +  S +   +                  +  N+GR
Sbjct  397  GPEGEWQCEEEDTSTSEQHLNEKQPDDSSQQSDVQSHDHTVKEHNNEKEGGQRKGRNKGR  456

Query  347  GKGQA--------------------------------VGRPQFG--VNNQRGPMCEQLQM  424
            GKG+                                 VG P     VNN++ PM      
Sbjct  457  GKGRGRNDRGQYHNNSHHNNSHHNSNHNNHHNNRGHHVGTPPSNNMVNNEQ-PMI-----  510

Query  425  VSGRQASVPRMPDGTRGFSMGRGK  496
              G+Q   PRMPDGTRGF+MGRGK
Sbjct  511  --GKQPPGPRMPDGTRGFAMGRGK  532



>gb|KDO51613.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=539

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 101/204 (50%), Gaps = 52/204 (25%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            KS+  +FSNKLHAFVEYE++ELAEKAIAELND  +WR+GL+VR +L+R +K +  +  K 
Sbjct  338  KSEGMLFSNKLHAFVEYESVELAEKAIAELNDEGNWRSGLRVRLMLRRGSKPAQVKG-KK  396

Query  194  GHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVW---------RAHNRGR  346
            G E E   +E+D    +  ++ +  +  S +   +                  +  N+GR
Sbjct  397  GPEGEWQCEEEDTSTSEQHLNEKQPDDSSQQSDVQSHDHTGEEHNNEKEGGQRKGRNKGR  456

Query  347  GKGQA--------------------------------VGRPQFG--VNNQRGPMCEQLQM  424
            GKG+                                 VG P     VNN++ PM      
Sbjct  457  GKGRGRNDRGQYHNNSHHNNSHHNSNHNNHHNNRGHHVGTPPSNNMVNNEQ-PMI-----  510

Query  425  VSGRQASVPRMPDGTRGFSMGRGK  496
              G+Q   PRMPDGTRGF+MGRGK
Sbjct  511  --GKQPPGPRMPDGTRGFAMGRGK  532



>ref|XP_002310383.2| hypothetical protein POPTR_0007s00450g [Populus trichocarpa]
 gb|EEE90833.2| hypothetical protein POPTR_0007s00450g [Populus trichocarpa]
Length=516

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 88/183 (48%), Gaps = 25/183 (14%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            K+D   FSNKLHAFVEYETIE+AEKA+AELND  +WR+GL+VR +LKR +KS+  R  K 
Sbjct  329  KADGMHFSNKLHAFVEYETIEIAEKAVAELNDEGNWRSGLRVRLMLKRGSKSTQARG-KK  387

Query  194  GHESEATFKED---------------------DMFGHKHQIssehsesqsselvgeeege  310
            GH+ +   +ED                     D   H+H    +H+  +           
Sbjct  388  GHDGQGHSEEDEISATEQMPNDKQTEDLSQQHDAHSHEHSQGEDHANDKEGAQRKGRNRG  447

Query  311  kegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMC-EQLQMVSGRQASVPRMPDGTRGFSMG  487
            +                      G +    P+  E   M   +Q   PRMPDGTRGF+MG
Sbjct  448  RGKGRGRGQYHHNNHHNNRGNHLGTSPSNNPVIGEHPAM--AKQPPGPRMPDGTRGFAMG  505

Query  488  RGK  496
            RGK
Sbjct  506  RGK  508



>ref|XP_008447184.1| PREDICTED: la-related protein 6B isoform X1 [Cucumis melo]
Length=492

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 97/186 (52%), Gaps = 24/186 (13%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +++AK+D   +SNKLHAFVEYE++ELAEKA+AELND  +WRN L++R +L  ++KS+  R
Sbjct  303  SKSAKADGMHYSNKLHAFVEYESVELAEKAVAELNDEGNWRNALRLRLMLSCSSKSAPVR  362

Query  182  ALKAGHESEATFKEDD------MFGHKHQIssehsesqsselvgeeegekegVW-RAHNR  340
              K GH  E  +K+ D      +  H   +S +       +       +  G   R  NR
Sbjct  363  G-KKGHNGEMNYKDVDASEQPAIEKHVDDLSDQVDVHPPEQREEHGNEKDGGGQRRVRNR  421

Query  341  GRGKGQAVGRPQF--------------GVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGF  478
             RGKG+  GR Q+              G          +      +Q   PRMPDGTRGF
Sbjct  422  VRGKGR--GRSQYHHNHNNIHNHGNHVGTPPPSSSTTIEQAGTMKQQPPGPRMPDGTRGF  479

Query  479  SMGRGK  496
            +MGRGK
Sbjct  480  AMGRGK  485



>ref|XP_002529112.1| lupus la ribonucleoprotein, putative [Ricinus communis]
 gb|EEF33296.1| lupus la ribonucleoprotein, putative [Ricinus communis]
Length=524

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 98/186 (53%), Gaps = 28/186 (15%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R+AK +   FSNKLHAFVEYE++E+AEKA+AELND  +WR+GL+VR +LKR +K +  R
Sbjct  339  SRSAKGEGMHFSNKLHAFVEYESVEIAEKAVAELNDEQNWRSGLRVRLMLKRASKPTQAR  398

Query  182  ALKAGHES---------------------EATFKEDDMFGHKHQIssehsesqsselvge  298
              K GH+                      E   ++ D   H+H      +E   ++  G 
Sbjct  399  G-KKGHDGQGHSEEEEVSTSEQPPNEKQIEDPSQQYDGHSHEHSGEDHVNEKDGAQRKGR  457

Query  299  eegekegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGF  478
              G  +G  R       +G  VG P    NN    + EQ  M   +Q   PRMPDGT+GF
Sbjct  458  NRGRGKGRGRGQYHHNNRGNHVGTPP--SNNLI--INEQPSM--AKQPPGPRMPDGTKGF  511

Query  479  SMGRGK  496
            +MGRGK
Sbjct  512  AMGRGK  517



>ref|XP_011085064.1| PREDICTED: la-related protein 6B-like isoform X1 [Sesamum indicum]
Length=451

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 99/193 (51%), Gaps = 29/193 (15%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            +T K D+  F+ KLHAFVE+E++ELAEKA+ EL D  +WRNGLKV  LLK   K +  R 
Sbjct  247  KTGKGDAMHFNGKLHAFVEFESVELAEKAVIELTDEGNWRNGLKVHLLLKSVVKPTQGRG  306

Query  185  LKAGHE-----------------SEATFKED-----DMFGHKHQIssehsesqsselvge  298
             K G+E                 SE ++ ED     D   H+HQ         S     +
Sbjct  307  RKIGNEGHPIGRKDEATIPEVQCSEESYLEDSQLQSDSQFHEHQGRPFQQREDSGSSNVQ  366

Query  299  eegekegV--WRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVS-----GRQASVPRM  457
             +G        +A  + +GKGQ  GRPQ  VN    P   ++ + S      + + VPRM
Sbjct  367  RKGRNNIAGNGKAKAKSKGKGQGRGRPQHPVNGGIYPPPIEVSVSSEKPTTAKTSPVPRM  426

Query  458  PDGTRGFSMGRGK  496
            PDGT+GFSMGRGK
Sbjct  427  PDGTKGFSMGRGK  439



>ref|XP_008803782.1| PREDICTED: la-related protein 6C [Phoenix dactylifera]
Length=412

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 92/172 (53%), Gaps = 17/172 (10%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R++K+D  + SNKLHA VEYET+E AEKA+ +LND  +WR GL+VR +L+RT +S   R 
Sbjct  229  RSSKTD-VLISNKLHALVEYETVEQAEKAVEKLNDERNWRKGLRVRTMLRRTPRSVI-RT  286

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVW---RAHNRG----  343
             ++ ++    F ED+       + S H        + + +   +  W   RA   G    
Sbjct  287  RRSDYDHFDIFSEDEQSPPSQTVGSPHIGQLLEHSIEDNQNTAKKGWGRGRAKLHGMVQN  346

Query  344  -RGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
              G+G     PQ G   Q  P     Q++ G     PRMPDGTRGF+MGRGK
Sbjct  347  HNGRGLLSQSPQPGCLGQ--PEATSKQILQG-----PRMPDGTRGFTMGRGK  391



>gb|KHG02211.1| La-related 7 [Gossypium arboreum]
Length=422

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 81/165 (49%), Gaps = 31/165 (19%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R+AKSD   FSNKLHAFVEYET+ELAEKA+AELN+  +WR+GL+VR +L+   +  +  
Sbjct  282  SRSAKSDGMHFSNKLHAFVEYETVELAEKAVAELNEEGNWRSGLRVRLMLRHVGEEHSNE  341

Query  182  ALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQA  361
              K G + +   +       + Q                           +N     G  
Sbjct  342  --KEGGQKKGRNRGRGKGRGRTQYH-------------------------NNHHSSHGNH  374

Query  362  VGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            VG P    +N         Q    +Q   PRMPDGTRGF+MGRGK
Sbjct  375  VGTPPSASSN----WVSNEQATGAKQPPGPRMPDGTRGFAMGRGK  415



>ref|XP_002323712.2| hypothetical protein POPTR_0017s04020g [Populus trichocarpa]
 gb|EEF03845.2| hypothetical protein POPTR_0017s04020g [Populus trichocarpa]
Length=483

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 90/183 (49%), Gaps = 36/183 (20%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            K+D   FSNKLHAFVEYET+E+AEKA+AELND  +WR+GLKVR +LKR A+       K 
Sbjct  308  KADGMHFSNKLHAFVEYETVEIAEKAVAELNDEGNWRSGLKVRLMLKRGAQG------KK  361

Query  194  GHESEATFKED---------------------DMFGHKHQIssehsesqsselvgeeege  310
            GH+ +   +ED                     D+  H+H      ++ + ++        
Sbjct  362  GHDGQGHSEEDEVSAFEQMPNEKLTEDQAQQHDVHSHEHSGEDHANDKEGAQRKRNRGRG  421

Query  311  kegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMC-EQLQMVSGRQASVPRMPDGTRGFSMG  487
            K      ++         G P         P+  E L M   +Q   PRMPDGTRGF+MG
Sbjct  422  KGRGRGQYHHNNHHSNHGGTPP------SNPVLGEHLTM--AKQPPGPRMPDGTRGFAMG  473

Query  488  RGK  496
            RGK
Sbjct  474  RGK  476



>ref|XP_011011377.1| PREDICTED: la-related protein 6B-like isoform X1 [Populus euphratica]
Length=483

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 90/183 (49%), Gaps = 36/183 (20%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            K+D   FSNKLHAFVEYET+E+AEKA+AELND  +WR+GLKVR +LKR A+       K 
Sbjct  308  KADGMHFSNKLHAFVEYETVEIAEKAVAELNDEGNWRSGLKVRLMLKRGAQG------KK  361

Query  194  GHESEATFKED---------------------DMFGHKHQIssehsesqsselvgeeege  310
            GH+ +   ++D                     D+  H+H      ++ + ++        
Sbjct  362  GHDGQGNSEDDEVSAFEQMPNEKLTEDQAQQHDVHSHEHYGEDHANDKEGAQRKRNRGRG  421

Query  311  kegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMC-EQLQMVSGRQASVPRMPDGTRGFSMG  487
            K      ++        VG P         P+  E   M   +Q   PRMPDGTRGF+MG
Sbjct  422  KGRGRGQYHHNNHHSNHVGTP------PSNPVLGEHPAM--AKQPPGPRMPDGTRGFAMG  473

Query  488  RGK  496
            RGK
Sbjct  474  RGK  476



>ref|XP_011001839.1| PREDICTED: la-related protein 6B-like isoform X1 [Populus euphratica]
Length=483

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 90/183 (49%), Gaps = 36/183 (20%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            K+D   FSNKLHAFVEYET+E+AEKA+AELND  +WR+GLKVR +LKR A+       K 
Sbjct  308  KADGMHFSNKLHAFVEYETVEIAEKAVAELNDEGNWRSGLKVRLMLKRGAQG------KK  361

Query  194  GHESEATFKED---------------------DMFGHKHQIssehsesqsselvgeeege  310
            GH+ +   ++D                     D+  H+H      ++ + ++        
Sbjct  362  GHDGQGNSEDDEVSAFEQMPNEKLTEDQAQQHDVHSHEHYGEDHANDKEGAQRKRNRGRG  421

Query  311  kegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMC-EQLQMVSGRQASVPRMPDGTRGFSMG  487
            K      ++        VG P         P+  E   M   +Q   PRMPDGTRGF+MG
Sbjct  422  KGRGRGQYHHNNHHSNHVGTP------PSNPVLGEHPAM--AKQPPGPRMPDGTRGFAMG  473

Query  488  RGK  496
            RGK
Sbjct  474  RGK  476



>ref|XP_008801106.1| PREDICTED: la-related protein 6B-like [Phoenix dactylifera]
Length=461

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 90/185 (49%), Gaps = 26/185 (14%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            ++AK D  +F N+LHAFVEYET+E AEKAIAELND  +WR+GL+VR LLK   K    R 
Sbjct  274  KSAKLD-MLFGNRLHAFVEYETVEDAEKAIAELNDERNWRSGLRVRLLLKCMTKHGPARG  332

Query  185  LKAGHESEATFKED----DMFGHKH-----------------QIssehsesqsselvgee  301
             K GHE +   + D    D    K                   + SE             
Sbjct  333  RKGGHEGDVNGEGDVSTSDQPNEKQVEDPSQLSEASHENVGEALYSEKDGGLRRGRGRGR  392

Query  302  egekegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFS  481
             G+  G  + HN     G  +G      +    P+  +  +V+ +Q   PRMPDGTRGF+
Sbjct  393  GGKGRGRGQYHNNNLNGGHMIG----SSSPLSHPVHTEQPVVANKQPPGPRMPDGTRGFT  448

Query  482  MGRGK  496
            MGRGK
Sbjct  449  MGRGK  453



>ref|XP_010930308.1| PREDICTED: la-related protein 6B-like [Elaeis guineensis]
Length=458

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 89/181 (49%), Gaps = 23/181 (13%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            ++AK D  +F N+LHAF+EYET+E AEKAIAELND  +WR+GL+VR LLK   K    R 
Sbjct  276  KSAKLD-MLFGNRLHAFIEYETVEDAEKAIAELNDEKNWRSGLRVRLLLKCMTKHGPVRG  334

Query  185  LKAGHE---------SEATFKEDDMFGHKHQIs--------sehsesqsselvgeeegek  313
             K  HE         S +    D +     Q+         SE              G+ 
Sbjct  335  RKGAHEGDVNGEGDVSTSDQPNDKLVEDPSQLYENVGEALFSEKDGGLRRGRGRGRGGKG  394

Query  314  egVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRG  493
             G  + HN     G  +G      +    P+  +  +V+ +Q   PRMPDGTRGF+MGRG
Sbjct  395  RGRGQYHNNNLNGGHMIGS-----SPSSHPVHTEQPVVANKQPPGPRMPDGTRGFTMGRG  449

Query  494  K  496
            K
Sbjct  450  K  450



>ref|XP_008394254.1| PREDICTED: la-related protein 6B [Malus domestica]
Length=490

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 93/186 (50%), Gaps = 28/186 (15%)
 Frame = +2

Query  20   DSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGH  199
            D  +FSNKLHAFVEYE+ E+AEKA+AELND  +WR+GL+VR +L+R +K       K G 
Sbjct  299  DGMLFSNKLHAFVEYESPEIAEKAVAELNDEANWRSGLRVRLMLRRASKXVQVWG-KKGQ  357

Query  200  ESEATFKEDD------MFGHKHQIssehsesqsselvgeeege---------kegVWRAH  334
            + E   +E+D          KH + S    +       E              + V +  
Sbjct  358  DGEVQLEEEDASTAEQQANEKHLVDSSQQSNVHPHEHKERTNSLKYGEEHGNDKDVGQRK  417

Query  335  NRGRGKGQAVGRPQFGVNNQ---RG---------PMCEQLQMVSGRQASVPRMPDGTRGF  478
             R +G+ +  GR Q+  N+    RG          +    Q V  +Q   PRMPDGTRGF
Sbjct  418  GRNKGRVKGRGRGQYHQNHHNINRGNHAGHPPNNSVGSTEQAVJTKQPPGPRMPDGTRGF  477

Query  479  SMGRGK  496
            +MGRGK
Sbjct  478  AMGRGK  483



>ref|XP_011092741.1| PREDICTED: la-related protein 6C-like isoform X2 [Sesamum indicum]
Length=406

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 91/172 (53%), Gaps = 20/172 (12%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R++K D  V SNKLHA VEYE  E AEKA  +LND  +WR G++VR +L+R     +P+
Sbjct  242  SRSSKGD-VVISNKLHALVEYENAETAEKAAEKLNDERNWRKGMRVRLMLRR-----SPK  295

Query  182  ALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQA  361
            ++    +SE     DD     HQ   + S   S+    + E     + R+ +R RGK + 
Sbjct  296  SVLKSRKSEFDVCLDDDGLSTHQSHEDASGRLSTSEATDSEENSAILKRSWSRNRGKSK-  354

Query  362  VGRPQF-------GVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
              RPQ          ++  G  C  LQ   G     PRMPDGT+GF+MGRGK
Sbjct  355  -HRPQLQGARSLPTPSSNGGLSCPGLQPAKG-----PRMPDGTKGFTMGRGK  400



>ref|XP_011092740.1| PREDICTED: la-related protein 6C-like isoform X1 [Sesamum indicum]
Length=410

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 92/172 (53%), Gaps = 16/172 (9%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R++K D  V SNKLHA VEYE  E AEKA  +LND  +WR G++VR +L+R+  +  P+
Sbjct  242  SRSSKGD-VVISNKLHALVEYENAETAEKAAEKLNDERNWRKGMRVRLMLRRSV-NLQPK  299

Query  182  ALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQA  361
            ++    +SE     DD     HQ   + S   S+    + E     + R+ +R RGK + 
Sbjct  300  SVLKSRKSEFDVCLDDDGLSTHQSHEDASGRLSTSEATDSEENSAILKRSWSRNRGKSK-  358

Query  362  VGRPQF-------GVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
              RPQ          ++  G  C  LQ   G     PRMPDGT+GF+MGRGK
Sbjct  359  -HRPQLQGARSLPTPSSNGGLSCPGLQPAKG-----PRMPDGTKGFTMGRGK  404



>ref|XP_010251419.1| PREDICTED: la-related protein 6B isoform X2 [Nelumbo nucifera]
Length=471

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            K D+ +FSNKLHAFVEYET+ELAEKAI ELND  +WR+GL+VR LL+RT KS+ PR  KA
Sbjct  277  KLDNMLFSNKLHAFVEYETVELAEKAITELNDERNWRSGLRVRLLLRRTPKSAQPRGRKA  336

Query  194  GHESEATFKEDDM  232
            GHE E  ++EDD+
Sbjct  337  GHEGEGNYEEDDV  349



>ref|XP_006858735.1| hypothetical protein AMTR_s00066p00125170 [Amborella trichopoda]
 gb|ERN20202.1| hypothetical protein AMTR_s00066p00125170 [Amborella trichopoda]
Length=432

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 87/184 (47%), Gaps = 25/184 (14%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTP--  178
            R+ K D  V SNKLHAFVEYET+E AEKA+AELND  +WR+GL+VR LL+ TAKS  P  
Sbjct  247  RSPKMDMLV-SNKLHAFVEYETVEQAEKAVAELNDERNWRSGLRVRLLLRHTAKSEKPGR  305

Query  179  --RALKAGHESEATFKEDDMFGHKHQIssehsesqssel---------------vgeeeg  307
              RA   G E EA+  E  +   KH      S   S++                      
Sbjct  306  AKRADGNGEEDEASTSE--LLSEKHVDDQSPSPELSNDSIGDEGSHEREGGGRRSRGRGR  363

Query  308  ekegVWRAHNRGRGKG-QAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSM  484
             K      H  G G    +VG P    NN                   PRMPDGTRGF+M
Sbjct  364  GKARARGQHPNGWGTTMHSVGTPPTSSNNNHA--LTMPPPEPKHPPPGPRMPDGTRGFTM  421

Query  485  GRGK  496
            GRGK
Sbjct  422  GRGK  425



>ref|XP_003554803.1| PREDICTED: la-related protein 6-like isoform 1 [Glycine max]
 gb|KHN11343.1| La-related protein 7 [Glycine soja]
Length=467

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 92/179 (51%), Gaps = 19/179 (11%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R  K D    SNKLHAFVEYE++ELAE+A+AELN+  +WR+GL+VR +L+R +K +  R
Sbjct  287  SRLGKVDGMPLSNKLHAFVEYESVELAERAVAELNEEGNWRSGLRVRLMLRRMSKPAQGR  346

Query  182  ALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQA  361
              K G + E   +ED  +  + Q     SE Q  +    +    E V   H   +  GQ 
Sbjct  347  G-KKGLDVEVGCEEDSPYVPEPQ----ASEKQLEDASFPDTQLHEYVGEEHGHDKESGQR  401

Query  362  VGRPQFGVNNQRGPMCEQ--------------LQMVSGRQASVPRMPDGTRGFSMGRGK  496
             GR +     +    C Q                 V  +Q   PRMPDGTRGFSMGRGK
Sbjct  402  KGRSRGRGKGRGRVHCHQNNRVGTPSSNNTIFTDQVVAKQPPGPRMPDGTRGFSMGRGK  460



>ref|XP_008788265.1| PREDICTED: LOW QUALITY PROTEIN: la-related protein 6B-like [Phoenix 
dactylifera]
Length=499

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 84/184 (46%), Gaps = 36/184 (20%)
 Frame = +2

Query  26   TVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHES  205
             +F NKLHAFVEYETIE AE A+ ELND  +WR GL+VR L K   K    +  K GHE 
Sbjct  317  VLFYNKLHAFVEYETIEDAENAVTELNDERNWRTGLRVRILSKCMTKHGPGQGRKIGHEG  376

Query  206  EATFKED---------------------DMFGH--KHQIssehsesqsselvgeeegeke  316
            +A   ED                     D+  H  +   + +   ++ S+  G     + 
Sbjct  377  DANGDEDEIATTNQPTEKQVEDPSQSFEDLMEHVGEENFNDKDGMARRSKGRGRGGKGRG  436

Query  317  gVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVS----GRQASVPRMPDGTRGFSM  484
                 HN  R  G A+G P         P    +  V      +Q   PRMPDGTRGF+M
Sbjct  437  RGQYHHNDNRNGGHAIGTP---------PSSHLIHAVQQPAVSKQPPGPRMPDGTRGFTM  487

Query  485  GRGK  496
            GRGK
Sbjct  488  GRGK  491



>ref|XP_010069204.1| PREDICTED: la-related protein 6B [Eucalyptus grandis]
 gb|KCW57478.1| hypothetical protein EUGRSUZ_H00248 [Eucalyptus grandis]
Length=298

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 98/195 (50%), Gaps = 49/195 (25%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+ K+D   ++NKLHAFVEYE+I++AEKA+ ELN+  +WR+GL+VR + +R +K S  R 
Sbjct  115  RSGKADGMHYTNKLHAFVEYESIDVAEKAVEELNEEGNWRSGLRVRLMHRRGSKPSQARG  174

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGR-GKGQA  361
             K GH+ E  ++E+D    + Q   +  ES                  AH +G  G+  A
Sbjct  175  -KKGHDGEEPWEEEDASVSEQQPEKQLEESFEQSD-------------AHFQGNMGEENA  220

Query  362  VGRPQFGV------------------NNQRG------PMCEQLQMVSGRQASV------P  451
              R +FG                    N RG      P+     + S   A+V      P
Sbjct  221  TDR-EFGQRKGRGRGRGRGRGRGQYHQNNRGNHLGAPPLN---NVTSNETATVAKQPPGP  276

Query  452  RMPDGTRGFSMGRGK  496
            RMPDGTRGF+MGRGK
Sbjct  277  RMPDGTRGFAMGRGK  291



>gb|KCW57477.1| hypothetical protein EUGRSUZ_H00248 [Eucalyptus grandis]
Length=299

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 98/195 (50%), Gaps = 49/195 (25%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+ K+D   ++NKLHAFVEYE+I++AEKA+ ELN+  +WR+GL+VR + +R +K S  R 
Sbjct  116  RSGKADGMHYTNKLHAFVEYESIDVAEKAVEELNEEGNWRSGLRVRLMHRRGSKPSQARG  175

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGR-GKGQA  361
             K GH+ E  ++E+D    + Q   +  ES                  AH +G  G+  A
Sbjct  176  -KKGHDGEEPWEEEDASVSEQQPEKQLEESFEQSD-------------AHFQGNMGEENA  221

Query  362  VGRPQFGV------------------NNQRG------PMCEQLQMVSGRQASV------P  451
              R +FG                    N RG      P+     + S   A+V      P
Sbjct  222  TDR-EFGQRKGRGRGRGRGRGRGQYHQNNRGNHLGAPPLN---NVTSNETATVAKQPPGP  277

Query  452  RMPDGTRGFSMGRGK  496
            RMPDGTRGF+MGRGK
Sbjct  278  RMPDGTRGFAMGRGK  292



>ref|XP_009393796.1| PREDICTED: la-related protein 6B-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=455

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 93/177 (53%), Gaps = 25/177 (14%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            +F N+LHAFVEYET+E AEKA+AELND  +WR+GL+VR   K   K    R  K G E++
Sbjct  275  LFGNRLHAFVEYETVEDAEKAVAELNDEKNWRSGLRVRLFPKFLTKHGQGRGRK-GSETD  333

Query  209  ATFKED-------------DMF-----GHKHQIssehse---sqsselvgeeegekegVW  325
             T +ED             D++      H+H+    +S+   +          G   G  
Sbjct  334  FTGEEDVSTSNQSNEKQVEDVYHLSEVSHEHESGESYSDKDGALRRGRGRGRGGRGRGRG  393

Query  326  RAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            + H+  RG G A G P     N   P  +Q  +V+ +Q   PRMPDGTRGF+MGRGK
Sbjct  394  QHHSNNRGGGLAFGTPPSTHLNH--PERDQ-SVVATKQPPGPRMPDGTRGFTMGRGK  447



>ref|XP_009393795.1| PREDICTED: la-related protein 6B-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=461

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 93/183 (51%), Gaps = 31/183 (17%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            +F N+LHAFVEYET+E AEKA+AELND  +WR+GL+VR   K   K    R  K G E++
Sbjct  275  LFGNRLHAFVEYETVEDAEKAVAELNDEKNWRSGLRVRLFPKFLTKHGQGRGRK-GSETD  333

Query  209  ATFKED-------------DMF-----GHKHQIssehsesqsselv---------geeeg  307
             T +ED             D++      H+H++ S     +S                 G
Sbjct  334  FTGEEDVSTSNQSNEKQVEDVYHLSEVSHEHEMCSLEQSGESYSDKDGALRRGRGRGRGG  393

Query  308  ekegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMG  487
               G  + H+  RG G A G P     N   P  +Q  +V+ +Q   PRMPDGTRGF+MG
Sbjct  394  RGRGRGQHHSNNRGGGLAFGTPPSTHLNH--PERDQ-SVVATKQPPGPRMPDGTRGFTMG  450

Query  488  RGK  496
            RGK
Sbjct  451  RGK  453



>ref|XP_009404917.1| PREDICTED: la-related protein 6B-like [Musa acuminata subsp. 
malaccensis]
Length=459

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 90/179 (50%), Gaps = 29/179 (16%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            +F N+LHAFV YET+E AEKA+AELND  +WR GLK+R   K   K    R  + GHE++
Sbjct  279  LFGNRLHAFVVYETLEDAEKAVAELNDEKNWRTGLKLRLFPKFVTKHGQARG-RRGHEAD  337

Query  209  ATFKED-------------DMFG-----HKHQIssehse---sqsselvgeeegekegVW  325
               +ED             D +      H+H+     ++   +          G   G  
Sbjct  338  INGEEDVCTSTHSNEKQVEDTYHPSEVLHEHESEESFNDRDGAPRRGRGRGRGGRGRGRG  397

Query  326  RAHNRGRGKGQAVGRP--QFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            + +N  RG G AVG P   + ++  R     +   V+ +Q   PRMPDGTRGF+MGRGK
Sbjct  398  QPYNNSRGGGHAVGTPPSSYVIHPDR-----EQPAVAHKQPPGPRMPDGTRGFTMGRGK  451



>ref|XP_010912744.1| PREDICTED: la-related protein 6B-like [Elaeis guineensis]
Length=454

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 86/177 (49%), Gaps = 28/177 (16%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            +F N+LHAFVEYET+E AEKA++ELND  +WR+GL+VR LLK   K    R  K GHE +
Sbjct  277  LFGNRLHAFVEYETVEDAEKAVSELNDERNWRSGLRVRLLLKCMTKHGPGRGRK-GHEGD  335

Query  209  ATFKEDDM-------------------FGHKH--QIssehsesqsselvgeeegekegVW  325
                EDD+                     H+H  +      +       G   G +    
Sbjct  336  ID-GEDDVSTSNMPNEKQVEDPSQISEASHEHVGEALLNEKDGGLRRGRGRGWGGRGRGR  394

Query  326  RAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
              +N  R     VG P         P+  +  +++ +Q   PRMPDGTRGF+MGRGK
Sbjct  395  GQYNSNRNGSHMVGTPP-----SSHPIHTEQPVMANKQPPGPRMPDGTRGFTMGRGK  446



>ref|XP_004292453.1| PREDICTED: uncharacterized protein LOC101311941 [Fragaria vesca 
subsp. vesca]
Length=401

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 84/164 (51%), Gaps = 14/164 (9%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNKLHA VEYE+ E+AEKA+ +L+D  +WR GL+VR LL+R     TP+++    +SE
Sbjct  236  IISNKLHALVEYESTEIAEKAVDKLSDERNWRKGLRVRTLLRR-----TPKSVLKNRKSE  290

Query  209  ATFKEDDMFGH------KHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGR  370
                EDD   H        Q  S       S    E     +  W A  RG+ +G+   +
Sbjct  291  FDILEDDDTPHYESAEDSSQPISHIDIVIDSMNAEENSMASKKGW-AWGRGKARGRCASQ  349

Query  371  PQFGV--NNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
               G+   + +     Q +  +      PRMPDGTRGF+MGRGK
Sbjct  350  SGRGLIAPSPQSSCAIQCEASAKPNTKGPRMPDGTRGFTMGRGK  393



>ref|XP_011005266.1| PREDICTED: la-related protein 6B-like [Populus euphratica]
Length=509

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            K+D   FSNKLHAFVEYETIE+AEKA+AELND  +WR+GL+VR +LKR +KS+  R  K 
Sbjct  324  KADGMHFSNKLHAFVEYETIEIAEKAVAELNDEGNWRSGLRVRLMLKRGSKSTQARG-KK  382

Query  194  GHESEATFKEDDM  232
            GH+ +   +ED++
Sbjct  383  GHDGQGHSEEDEI  395



>ref|XP_006380251.1| hypothetical protein POPTR_0007s00450g [Populus trichocarpa]
 gb|ERP58048.1| hypothetical protein POPTR_0007s00450g [Populus trichocarpa]
Length=515

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            K+D   FSNKLHAFVEYETIE+AEKA+AELND  +WR+GL+VR +LKR +KS+  R  K 
Sbjct  329  KADGMHFSNKLHAFVEYETIEIAEKAVAELNDEGNWRSGLRVRLMLKRGSKSTQARG-KK  387

Query  194  GHESEATFKEDDM  232
            GH+ +   +ED++
Sbjct  388  GHDGQGHSEEDEI  400



>ref|XP_006380252.1| hypothetical protein POPTR_0007s00450g [Populus trichocarpa]
 gb|ERP58049.1| hypothetical protein POPTR_0007s00450g [Populus trichocarpa]
Length=461

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            K+D   FSNKLHAFVEYETIE+AEKA+AELND  +WR+GL+VR +LKR +KS+  R  K 
Sbjct  329  KADGMHFSNKLHAFVEYETIEIAEKAVAELNDEGNWRSGLRVRLMLKRGSKSTQARG-KK  387

Query  194  GHESEATFKEDDM  232
            GH+ +   +ED++
Sbjct  388  GHDGQGHSEEDEI  400



>ref|XP_002878301.1| hypothetical protein ARALYDRAFT_907506 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54560.1| hypothetical protein ARALYDRAFT_907506 [Arabidopsis lyrata subsp. 
lyrata]
Length=403

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 84/164 (51%), Gaps = 42/164 (26%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK+D   FSNK+HAFVEYE +ELAEKA+AELN+  +W +GL++R +L+   K      
Sbjct  266  RSAKTD---FSNKVHAFVEYERVELAEKAVAELNEERNW-SGLRIRLMLQHETKEPKHVL  321

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAV  364
             + G +     +EDD                              V R   +GRG+    
Sbjct  322  QERGRK-----EEDD------------------------------VMRTIEQGRGQNH-Y  345

Query  365  GRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            GR    V+N   PM  +   VS  +   PRMPDGTRGFS+GRGK
Sbjct  346  GRGNHHVSN--NPMNNKTDQVSMGKQQGPRMPDGTRGFSLGRGK  387



>ref|XP_009366258.1| PREDICTED: la-related protein 6B-like [Pyrus x bretschneideri]
Length=491

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 91/183 (50%), Gaps = 25/183 (14%)
 Frame = +2

Query  20   DSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGH  199
            D  +FSNKLHAFVEYE+ E+AE A+AELND  +WR+GL+VR +L R +K +  R  K G 
Sbjct  303  DGMLFSNKLHAFVEYESPEIAENAVAELNDEANWRSGLRVRLMLGRASKPAQVRG-KKGL  361

Query  200  ESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRA-HNRGRGKGQAVGRP-  373
            + E   +E+D    + Q + + S   S +        +E      +    G  + VG+  
Sbjct  362  DGEVQLEEEDASTPEQQANEKQSVDSSQQSDIHPHEHEERTNSLKYGEEHGNDKEVGQRK  421

Query  374  -------------QFGVNNQRGPMC---EQLQMVSGRQASV------PRMPDGTRGFSMG  487
                         Q+  NN RG          + S   A V      PRMPDGTRGF+MG
Sbjct  422  GRNKGRGKGRGRGQYHHNNNRGNHAGHPPNSSVGSMEHAGVTKKPPGPRMPDGTRGFAMG  481

Query  488  RGK  496
            RGK
Sbjct  482  RGK  484



>ref|XP_006296119.1| hypothetical protein CARUB_v10025271mg [Capsella rubella]
 gb|EOA29017.1| hypothetical protein CARUB_v10025271mg [Capsella rubella]
Length=540

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 57/79 (72%), Gaps = 6/79 (8%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AKSD T+FSNK+HAFVEYE +ELAEKA+AELN+  +WR+GLKVR +LK   K   P+ 
Sbjct  331  RSAKSDGTLFSNKVHAFVEYEMVELAEKAVAELNEAGNWRSGLKVRLMLKHQIKE--PKQ  388

Query  185  LKA----GHESEATFKEDD  229
             +     GH+ E   +EDD
Sbjct  389  GQGRGRKGHDPEVEHEEDD  407



>gb|EPS58875.1| hypothetical protein M569_15937, partial [Genlisea aurea]
Length=275

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 85/162 (52%), Gaps = 25/162 (15%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALK  190
            +K D+ V SNKLHA VEYE+ E A+KA  +LND  +WR G++VR +L R +  S  +  K
Sbjct  138  SKGDAVVMSNKLHALVEYESPESAKKAAEKLNDERNWRKGMRVRVMLLRRSPKSVLKNKK  197

Query  191  AGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGR  370
            +  E EA  +++ +  H+       ++  ++    E +   +  W A NR + K Q  G 
Sbjct  198  S--EFEACLEDEGLLLHEDH----PTKPNNNTSETEGDENSKKTW-AKNRAKTKPQLHGL  250

Query  371  PQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            P     + RG                PRMPDGTRGF+MGRGK
Sbjct  251  PDSS--STRG----------------PRMPDGTRGFTMGRGK  274



>gb|EYU36643.1| hypothetical protein MIMGU_mgv1a013239mg [Erythranthe guttata]
Length=226

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 90/185 (49%), Gaps = 26/185 (14%)
 Frame = +2

Query  20   DSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGH  199
            D   F  K HAFVE++++E AEKA+AEL D  +WR  LKVR LL    K S  +  K GH
Sbjct  35   DGLHFIGKFHAFVEFQSVEAAEKAVAELKDEGNWRRSLKVRLLLTSALKPSNAQTKKVGH  94

Query  200  ESEATFKEDDMFGHKHQ-IssehsesqsselvgeeegekegVWR---AHNRGRGKG----  355
            E + + K+D+    + Q     H E    +   +    +   +R   AH +GR  G    
Sbjct  95   EGQLSGKKDETAVAEMQGFEENHLEDSLKQCDAQNHEIQLENYRKGNAHRKGRNTGGSSK  154

Query  356  ---------QAVGRPQFGVN--NQRGPMCEQLQM-------VSGRQASVPRMPDGTRGFS  481
                        GR Q  VN  N  G    ++         ++ + +SVPRMPDGT+GFS
Sbjct  155  AKGKGHGHGHGRGRHQHSVNGGNILGSAQSEVSFNTAEKLNLANKASSVPRMPDGTKGFS  214

Query  482  MGRGK  496
            +GRGK
Sbjct  215  LGRGK  219



>ref|XP_010930389.1| PREDICTED: la-related protein 6C [Elaeis guineensis]
Length=412

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 93/172 (54%), Gaps = 17/172 (10%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            +++K+D  + SNKLHA VEYET+E AEKA+ +LND  +WR GL+VR + +R+ +S   R 
Sbjct  229  KSSKTD-VLISNKLHALVEYETVEQAEKAVEKLNDERNWRKGLRVRTMSRRSPRSVI-RT  286

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAV  364
             ++ ++      ED+       + S H E      + + +   +  W     GRG+ +  
Sbjct  287  RRSDYDHFDIVSEDEQSPSSQTVGSLHIEQLLEHNIEDNQNTTKKGW-----GRGRAKLH  341

Query  365  GRPQFGVNNQRG-------PMCE-QLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            G  Q   +N RG       P C  Q +  S +    PRMPDGTRGF+MGRGK
Sbjct  342  GMVQN--HNGRGLLSQTPQPGCLGQSEASSKQMLQGPRMPDGTRGFTMGRGK  391



>ref|XP_009398953.1| PREDICTED: la-related protein 6C [Musa acuminata subsp. malaccensis]
Length=418

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 88/174 (51%), Gaps = 23/174 (13%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+ KSD  + SNKLHA VEYET E AEKA+ +LND  +WR GL+VR +L+      +P++
Sbjct  237  RSTKSD-LLISNKLHALVEYETTEQAEKAVEKLNDERNWRKGLRVRTMLR-----CSPKS  290

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAV  364
            +  G+  E  + EDD       + S   E        + +      W    RGR K   +
Sbjct  291  VIRGNHFE-LYSEDDQSPSSQTLGSPRIEQLLDHNNEDNQSGPRKAW---GRGRVKPHGL  346

Query  365  GRPQFGVNNQRGPMCEQLQM---------VSGRQASV-PRMPDGTRGFSMGRGK  496
              P     + RG + +  Q+          S +Q    PRMPDGTRGF+MGRGK
Sbjct  347  LAPNL---SGRGLLTQAPQIGGALGHGGEASSKQTPQGPRMPDGTRGFTMGRGK  397



>gb|EEC75591.1| hypothetical protein OsI_12289 [Oryza sativa Indica Group]
Length=429

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 92/171 (54%), Gaps = 19/171 (11%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R++KSD+ + SNKLHA +EYET + A++A+ +LND  +WR GL+VRP+L+R+ KS+    
Sbjct  246  RSSKSDALI-SNKLHALIEYETSQQADRAVDKLNDERNWRKGLRVRPVLRRSPKSAM--R  302

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAV  364
            LK          +DD    + Q SS+   +       +E+   +  W     GRG+G   
Sbjct  303  LKRPDFDHLMISDDD-HSPQSQASSDSPMADHLPDHHQEDQHGKKSW-----GRGRG---  353

Query  365  GRPQFGVNNQRGPM------CEQLQMVSGRQASV-PRMPDGTRGFSMGRGK  496
             RP                  + L M+S R A   PRMPDGTRGF+MGRG+
Sbjct  354  SRPHAAAGGAPQAAAAAAGHLDSLMMMSPRHAPQGPRMPDGTRGFTMGRGR  404



>ref|NP_001050504.1| Os03g0566500 [Oryza sativa Japonica Group]
 gb|ABF97161.1| RNA-binding protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12418.1| Os03g0566500 [Oryza sativa Japonica Group]
 dbj|BAG92039.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59367.1| hypothetical protein OsJ_11468 [Oryza sativa Japonica Group]
Length=429

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 92/171 (54%), Gaps = 19/171 (11%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R++KSD+ + SNKLHA +EYET + A++A+ +LND  +WR GL+VRP+L+R+ KS+    
Sbjct  246  RSSKSDALI-SNKLHALIEYETSQQADRAVDKLNDERNWRKGLRVRPVLRRSPKSAM--R  302

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAV  364
            LK          +DD    + Q SS+   +       +E+   +  W     GRG+G   
Sbjct  303  LKRPDFDHLMISDDD-HSPQSQASSDSPMADHLPDHHQEDQHGKKSW-----GRGRG---  353

Query  365  GRPQFGVNNQRGPM------CEQLQMVSGRQASV-PRMPDGTRGFSMGRGK  496
             RP                  + L M+S R A   PRMPDGTRGF+MGRG+
Sbjct  354  SRPHAAAGGAPQAAAAAAGHLDSLMMMSPRHAPQGPRMPDGTRGFTMGRGR  404



>gb|EYU42655.1| hypothetical protein MIMGU_mgv1a007130mg [Erythranthe guttata]
Length=418

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 87/166 (52%), Gaps = 12/166 (7%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R++K D  V SNKLHA VEYE  E AE+A  +LND  +WR G++VR +LKR     +P+
Sbjct  255  SRSSKGD-IVVSNKLHALVEYENHETAERAAEKLNDERNWRKGMRVRLMLKR-----SPK  308

Query  182  ALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQA  361
            ++    +SE      ++        +    S+ S    E +     + R+ +R RGK   
Sbjct  309  SVLKNRKSEF-----EVCLDDDHHHAHEDGSRLSSSENEGDDNPSALKRSWSRNRGKATK  363

Query  362  VGRPQF-GVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
              RPQ  G  +   P        +G+    PRMPDGTRGF+MGRGK
Sbjct  364  TQRPQLQGTRSLPTPSSHAGSSFAGQPVKGPRMPDGTRGFTMGRGK  409



>ref|XP_008447187.1| PREDICTED: la-related protein 6B isoform X4 [Cucumis melo]
Length=403

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +++AK+D   +SNKLHAFVEYE++ELAEKA+AELND  +WRN L++R +L  ++KS+  R
Sbjct  303  SKSAKADGMHYSNKLHAFVEYESVELAEKAVAELNDEGNWRNALRLRLMLSCSSKSAPVR  362

Query  182  ALKAGHESEATFKEDD  229
              K GH  E  +K+ D
Sbjct  363  G-KKGHNGEMNYKDVD  377



>ref|XP_003521844.1| PREDICTED: la-related protein 6-like isoformX1 [Glycine max]
 gb|KHN16371.1| La-related protein 7 [Glycine soja]
Length=475

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 90/186 (48%), Gaps = 33/186 (18%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK-----  166
            +R  K D    SNKLHAFVEY ++ELAE+A+AELND  +WR+GL++R +L+R +K     
Sbjct  295  SRLGKVDGMPLSNKLHAFVEYGSVELAERAVAELNDEGNWRSGLRIRLMLRRMSKPAQGR  354

Query  167  ---------------SSTPRALKAGHESE-ATFKEDDMFGHKHQIssehsesqsselvge  298
                           +S P    +  + E A+F +  +  H  +      ES   +    
Sbjct  355  GKKGLDVEVGCDEDYTSVPEPQASEKQLEDASFPDTLLLEHAGEEHGYDKESGQRKGRSR  414

Query  299  eegekegVWRAHNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGF  478
              G+  G    H   R     VG P    NN      +Q   V  +Q   PRMPDGTRGF
Sbjct  415  GRGKGRGRVHCHQNNR-----VGTPP--SNNTI--FTDQ---VIAKQPPGPRMPDGTRGF  462

Query  479  SMGRGK  496
            SMGRGK
Sbjct  463  SMGRGK  468



>ref|XP_002281817.1| PREDICTED: la-related protein 6C isoform X1 [Vitis vinifera]
 emb|CBI32464.3| unnamed protein product [Vitis vinifera]
Length=412

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 87/163 (53%), Gaps = 15/163 (9%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESEA  211
             SNKLHA VEYE++E+AEKA+  LND  +WR GL+VR LL+R+     P+++     SE 
Sbjct  244  ISNKLHALVEYESVEIAEKAVEMLNDERNWRKGLRVRMLLRRS-----PKSVLKNRRSEF  298

Query  212  TFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGVNN  391
                D+  G   + S + S   ++ELV E   E+          RG+G+  GR Q  + +
Sbjct  299  DGIMDEEEGPHPEFSEDSSHPNNTELVIESNAEENSSGSKKGWARGRGKPRGRTQ--ITS  356

Query  392  QRGPMCEQLQMVSGRQASV--------PRMPDGTRGFSMGRGK  496
             RG +    Q     Q           PRMPDGTRGF+MGRGK
Sbjct  357  GRGLLAPSPQSSGSNQFEASAKQITKGPRMPDGTRGFTMGRGK  399



>ref|XP_008447186.1| PREDICTED: la-related protein 6B isoform X3 [Cucumis melo]
Length=428

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +++AK+D   +SNKLHAFVEYE++ELAEKA+AELND  +WRN L++R +L  ++KS+  R
Sbjct  303  SKSAKADGMHYSNKLHAFVEYESVELAEKAVAELNDEGNWRNALRLRLMLSCSSKSAPVR  362

Query  182  ALKAGHESEATFKEDD  229
              K GH  E  +K+ D
Sbjct  363  G-KKGHNGEMNYKDVD  377



>ref|XP_008447185.1| PREDICTED: la-related protein 6B isoform X2 [Cucumis melo]
Length=444

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +++AK+D   +SNKLHAFVEYE++ELAEKA+AELND  +WRN L++R +L  ++KS+  R
Sbjct  303  SKSAKADGMHYSNKLHAFVEYESVELAEKAVAELNDEGNWRNALRLRLMLSCSSKSAPVR  362

Query  182  ALKAGHESEATFKEDD  229
              K GH  E  +K+ D
Sbjct  363  G-KKGHNGEMNYKDVD  377



>ref|XP_010469262.1| PREDICTED: la-related protein 6B-like [Camelina sativa]
Length=371

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 91/182 (50%), Gaps = 35/182 (19%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALK  190
            A+S +T FSNK+HAFVEYE +ELAEKA+AELN   +WR+GL+VR +L+   K      L+
Sbjct  196  ARSANTDFSNKVHAFVEYERVELAEKAVAELNGERNWRSGLRVRLMLQGQTKEPK-HVLQ  254

Query  191  AGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGR  370
             G   E    EDD   ++          +  E  G ++       R HNRG   GQ  GR
Sbjct  255  EGGRKE----EDDDKKYEDCGGERDGHGEEEEEQGGKKR------RGHNRG---GQGRGR  301

Query  371  PQ--------FGVNNQRG-----PMCEQLQMVSGRQASV--------PRMPDGTRGFSMG  487
             Q           N Q+G     P   Q+   +  Q S+        PRMPD TRGFS+G
Sbjct  302  SQQNQNENSKHNQNYQKGRGNHHPSNSQMNNNTDHQVSMGKQQPPPGPRMPDSTRGFSLG  361

Query  488  RG  493
            RG
Sbjct  362  RG  363



>ref|XP_010506300.1| PREDICTED: la-related protein 6B [Camelina sativa]
Length=534

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 6/79 (8%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AKSD T+FSNK+HAFVEYE +ELAEKA+A+LN+  +WR+GL+VR +LK   K   P+ 
Sbjct  328  RSAKSDGTLFSNKVHAFVEYEMVELAEKAVADLNEAGNWRSGLRVRLMLKHQTKE--PKQ  385

Query  185  LKA----GHESEATFKEDD  229
             +     GH++E   +EDD
Sbjct  386  GQGRGRKGHDAEVEHEEDD  404



>ref|XP_011088295.1| PREDICTED: la-related protein 6C [Sesamum indicum]
Length=365

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 90/167 (54%), Gaps = 21/167 (13%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
             R++K D  V SNKLHA VEYE  E AEKA  +LND  +WR G++VR +LKR     +P+
Sbjct  212  CRSSKGD-LVISNKLHALVEYENSEAAEKAAEKLNDERNWRKGMRVRVMLKR-----SPK  265

Query  182  ALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQ-  358
            ++    +S+     DD  G  H+     +   +S    E      G+ R+ +R RGK + 
Sbjct  266  SVLRSRKSDFDMYSDDDQGPSHE----DASRANSLKPAEAGENPVGLKRSWSRNRGKPRH  321

Query  359  AVGRPQFGVNNQRGPMCEQLQMVSGR-QASVPRMPDGTRGFSMGRGK  496
            +V  P    +N     C      +G+  A  PRMPDGTRGFSMGRGK
Sbjct  322  SVAIPCAVSSN-----CP----AAGKPTAKGPRMPDGTRGFSMGRGK  359



>ref|XP_010647782.1| PREDICTED: la-related protein 6C isoform X2 [Vitis vinifera]
Length=406

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 83/164 (51%), Gaps = 23/164 (14%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHE-SE  208
             SNKLHA VEYE++E+AEKA+  LND  +WR GL+VR LL+R+ + S    +    E   
Sbjct  244  ISNKLHALVEYESVEIAEKAVEMLNDERNWRKGLRVRMLLRRSNRRSEFDGIMDEEEGPH  303

Query  209  ATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGVN  388
              F ED    +  ++  E +  ++S    +        W      RG+G+  GR Q  + 
Sbjct  304  PEFSEDSSHPNNTELVIESNAEENSSGSKKG-------W-----ARGRGKPRGRTQ--IT  349

Query  389  NQRGPMCEQLQMVSGRQASV--------PRMPDGTRGFSMGRGK  496
            + RG +    Q     Q           PRMPDGTRGF+MGRGK
Sbjct  350  SGRGLLAPSPQSSGSNQFEASAKQITKGPRMPDGTRGFTMGRGK  393



>ref|XP_010508353.1| PREDICTED: la-related protein 6B-like [Camelina sativa]
Length=535

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 6/79 (8%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AKSD T+FSNK+HAFVEYE +ELAEKA+A+LN+  +WR+GL+VR +LK   K   P+ 
Sbjct  329  RSAKSDGTLFSNKVHAFVEYEMVELAEKAVADLNEAGNWRSGLRVRLMLKHQTKE--PKQ  386

Query  185  LKA----GHESEATFKEDD  229
             +     GH++E   +EDD
Sbjct  387  GQGRGRKGHDAEVEHEEDD  405



>emb|CAN81423.1| hypothetical protein VITISV_035943 [Vitis vinifera]
Length=941

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 108/210 (51%), Gaps = 27/210 (13%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESEA  211
             SNKLHA VEYE++E+AEKA+  LND  +WR GL+VR LL+R+     P+++     SE 
Sbjct  228  ISNKLHALVEYESVEIAEKAVEMLNDERNWRKGLRVRMLLRRS-----PKSVLKNRRSEF  282

Query  212  TFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGVNN  391
                D+  G   + S + S   ++ELV E   E+          RG+G+  GR Q  + +
Sbjct  283  DGIMDEEEGPHPEFSEDSSHPNNTELVIESNAEENSSGSKKGWARGRGKPRGRTQ--ITS  340

Query  392  QRGPMCEQLQMVSGRQASV--------PRMPDGTRGFSMGRGKaiaiksv*lsvilllHQ  547
             RG +    Q     Q           PRMPDGTRGF+MGRGK I+  ++   +      
Sbjct  341  GRGLLAPSPQSSGSNQFEASAKQITKGPRMPDGTRGFTMGRGKPISTPALASPL------  394

Query  548  CLGSFLWWWLYV*LYIQSNPNL-IAVLRKV  634
             LG FL +      Y +S P+L + V+R V
Sbjct  395  -LGQFLDYK----FYDRSCPDLPMMVMRNV  419



>ref|XP_010251418.1| PREDICTED: la-related protein 6B isoform X1 [Nelumbo nucifera]
Length=481

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 60/83 (72%), Gaps = 10/83 (12%)
 Frame = +2

Query  14   KSDSTVFSNK----------LHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTA  163
            K D+ +FSNK          LHAFVEYET+ELAEKAI ELND  +WR+GL+VR LL+RT 
Sbjct  277  KLDNMLFSNKAIMATGHCQKLHAFVEYETVELAEKAITELNDERNWRSGLRVRLLLRRTP  336

Query  164  KSSTPRALKAGHESEATFKEDDM  232
            KS+ PR  KAGHE E  ++EDD+
Sbjct  337  KSAQPRGRKAGHEGEGNYEEDDV  359



>ref|XP_006651554.1| PREDICTED: uncharacterized protein LOC102719286 [Oryza brachyantha]
Length=396

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 89/166 (54%), Gaps = 10/166 (6%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
             R++KSD+ V SNKLHA +EYET + A++A+ +LND  +WR GL+VRP+L+R+ KS    
Sbjct  214  ARSSKSDALV-SNKLHALIEYETSQQADRAVDKLNDERNWRKGLRVRPVLRRSPKSVV--  270

Query  182  ALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQA  361
             LK      A    DD      Q+SS+   +  S    +E+   +  W A  RG     A
Sbjct  271  RLKRPDFDHAMI-SDDEHSPLSQVSSDSPMADHSPDHHQEDHHGKKSW-ARGRGGRTPHA  328

Query  362  VGRPQFGVNNQRGPMCEQLQMVSGRQASV-PRMPDGTRGFSMGRGK  496
             G P    +           M S R A   PRMPDGTRGF+MGRG+
Sbjct  329  TGAPHPAASAGHF----DALMRSPRYAPQGPRMPDGTRGFTMGRGR  370



>ref|XP_010248222.1| PREDICTED: la-related protein 6C-like [Nelumbo nucifera]
Length=410

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 83/166 (50%), Gaps = 13/166 (8%)
 Frame = +2

Query  26   TVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHES  205
             + SNKLHA VEYET++ AEKA+ +LND  +WR GL+VR L +RT +S           S
Sbjct  232  VLISNKLHALVEYETVDQAEKAVEKLNDERNWRKGLRVRLLHRRTPRSIIKSRKPDYDHS  291

Query  206  EATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGV  385
            +   +ED+    +    S    S    +    E    G  +   RGRGK +  GR Q   
Sbjct  292  DRNSEEDEAPPSESLEDSSQPNSIEHPMESNAEDSSSGSKKGWARGRGKSR--GRCQ--S  347

Query  386  NNQRGPMCEQLQMVSGRQASV---------PRMPDGTRGFSMGRGK  496
            +N RG +    Q  S   +           PRMPDGTRGF+MGRGK
Sbjct  348  HNGRGLLAPSPQSTSSVLSEATTIKQTPRGPRMPDGTRGFTMGRGK  393



>ref|XP_010517979.1| PREDICTED: la-related protein 6B-like isoform X2 [Camelina sativa]
Length=543

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 58/79 (73%), Gaps = 6/79 (8%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AKSD T+FSNK+HAFVEYE +ELAEKA+A+L++  +WR+GL+VR +LK   K   P+ 
Sbjct  337  RSAKSDGTLFSNKVHAFVEYEMVELAEKAVADLHEAGNWRSGLRVRLMLKHQTKE--PKQ  394

Query  185  LKA----GHESEATFKEDD  229
             +     GH++E   +EDD
Sbjct  395  GQGRGRKGHDAEVEHEEDD  413



>ref|XP_010524198.1| PREDICTED: la-related protein 6B-like [Tarenaya hassleriana]
Length=522

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 57/80 (71%), Gaps = 5/80 (6%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            RTAKSD  +F+NK+HAFVEYET+ELAEKA+AELN+  +WR+GL+V  +LK     +  + 
Sbjct  331  RTAKSDGALFTNKVHAFVEYETVELAEKAVAELNEEGNWRSGLRVHLMLKHHHHQTKDQK  390

Query  185  L-----KAGHESEATFKEDD  229
                  + GH++EA  +E+D
Sbjct  391  HVQGRGRKGHDAEAQHEEED  410



>gb|KFK37220.1| hypothetical protein AALP_AA4G229300 [Arabis alpina]
Length=515

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 58/80 (73%), Gaps = 7/80 (9%)
 Frame = +2

Query  5    RTAKSDSTVFS-NKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            R+AKSD ++FS NK+HAFVEYE +ELAEKA+AELN+  +WR+GLKVR +LKR  K   P+
Sbjct  304  RSAKSDGSLFSINKVHAFVEYEIVELAEKAVAELNEAGNWRSGLKVRLMLKRQTKE--PK  361

Query  182  ALKA----GHESEATFKEDD  229
              +     GH+ E   +EDD
Sbjct  362  QGQGRGRKGHDVEVEHEEDD  381



>ref|XP_006845325.1| hypothetical protein AMTR_s00141p00064150 [Amborella trichopoda]
 gb|ERN07000.1| hypothetical protein AMTR_s00141p00064150 [Amborella trichopoda]
Length=450

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 88/170 (52%), Gaps = 28/170 (16%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK-SSTPRALKAGHE-  202
            + S+KLHA VEYET+E AEKA+A LND  +WR+G++V+ LLKR     + PR+ K     
Sbjct  291  MISSKLHALVEYETVEAAEKAVAVLNDERNWRSGMRVQLLLKRMGMYGAAPRSRKGLVAE  350

Query  203  -----------SEATFKEDDMFGHKHQIsse-hsesqsselvgeeegekegVWRAHNRGR  346
                        EA +K  ++   K  +  E HS S+   L G   G  +G  + HN G 
Sbjct  351  SSNSASNSDIGDEANYKTHELHTEKSDMEVERHSPSEREGLRGRRRGRGKGHGQHHNDGH  410

Query  347  GKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            G G        G++    PM         +Q   PRMPDGTRGF+MGRG+
Sbjct  411  GAGLVC-----GISGSEAPM---------KQPPGPRMPDGTRGFTMGRGR  446



>emb|CDY17896.1| BnaC04g03230D [Brassica napus]
Length=453

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK  166
            R+AKSD T+FSNK+HAFVEYET+ELAEKA+AELN+  +WR+ LKVR +LK   K
Sbjct  247  RSAKSDGTLFSNKVHAFVEYETVELAEKAVAELNEAGNWRSSLKVRLMLKPQTK  300



>ref|XP_010107985.1| La-related protein 7 [Morus notabilis]
 gb|EXC17385.1| La-related protein 7 [Morus notabilis]
Length=397

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 86/170 (51%), Gaps = 27/170 (16%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKS------STPRALK  190
            + SNKLHA VEY+T E+AE A+ +LND  +WR GL+VR LL+ + KS      S    + 
Sbjct  237  LVSNKLHALVEYDTTEMAETAVEKLNDERNWRKGLRVRLLLRCSPKSVLKNRRSEFDGIL  296

Query  191  AGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGR  370
               ++  T   +D F H  Q      ES +     E    ++  W     GR +G+A GR
Sbjct  297  DADDAPLTESAEDAF-HSSQ-----RESITETNGEESSTGQKKGW-----GRVRGKAQGR  345

Query  371  PQFGVNNQRGPMCEQLQMVSGRQASV--------PRMPDGTRGFSMGRGK  496
                +   RG +    Q  +G Q  V        PRMPDGTRGF+MGRGK
Sbjct  346  ASNHIG--RGLLAPSPQSSNGNQGEVSPKQSPKGPRMPDGTRGFTMGRGK  393



>dbj|BAK04171.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=453

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 90/187 (48%), Gaps = 29/187 (16%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R +KSD T+ SNK+HA VEYET + AEKA+ +LND  +WR GL+VR +L+R+ KS   R 
Sbjct  252  RASKSD-TLVSNKMHALVEYETSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKSVM-RL  309

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAV  364
             +   +  A    DD   H    S   +           E  + G  +   RGRGK   V
Sbjct  310  KRPDFDHYAG--SDDESPHSQVSSDSPTSEAIHSPEAHPEDHQSGAKKGWARGRGKLHVV  367

Query  365  G--RPQ---------FGVNNQRGPMCEQLQMVSGRQASV------------PRMPDGTRG  475
                PQ         F  ++ R     Q   +S RQ S             PRMPDGTRG
Sbjct  368  APHSPQSAPAGAVGHFDPSSPR--QASQKCPLSPRQVSQKCPFSPRQPPQGPRMPDGTRG  425

Query  476  FSMGRGK  496
            F+MGRGK
Sbjct  426  FTMGRGK  432



>ref|XP_011011378.1| PREDICTED: la-related protein 6B-like isoform X2 [Populus euphratica]
Length=405

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 6/73 (8%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            K+D   FSNKLHAFVEYET+E+AEKA+AELND  +WR+GLKVR +LKR A+       K 
Sbjct  308  KADGMHFSNKLHAFVEYETVEIAEKAVAELNDEGNWRSGLKVRLMLKRGAQG------KK  361

Query  194  GHESEATFKEDDM  232
            GH+ +   ++D++
Sbjct  362  GHDGQGNSEDDEV  374



>ref|XP_011001840.1| PREDICTED: la-related protein 6B-like isoform X2 [Populus euphratica]
Length=405

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 6/73 (8%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            K+D   FSNKLHAFVEYET+E+AEKA+AELND  +WR+GLKVR +LKR A+       K 
Sbjct  308  KADGMHFSNKLHAFVEYETVEIAEKAVAELNDEGNWRSGLKVRLMLKRGAQG------KK  361

Query  194  GHESEATFKEDDM  232
            GH+ +   ++D++
Sbjct  362  GHDGQGNSEDDEV  374



>ref|XP_009389160.1| PREDICTED: la-related protein 6B-like [Musa acuminata subsp. 
malaccensis]
Length=446

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 86/174 (49%), Gaps = 23/174 (13%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESEA  211
            F N+LHAFVEYET+E AEKA+AELN+  +WR+GL+VR   K   K    R  K  HE E 
Sbjct  269  FGNRLHAFVEYETVEDAEKAVAELNNEKNWRSGLRVRVFPKLLTKHGQGRGRKV-HEVEF  327

Query  212  TFKED----------DMFG-----HKHQIssehsesqsselvgeeegekegVWRAH---N  337
            T +ED          D +      H+H+     ++   +   G                +
Sbjct  328  TGEEDVSTLNEKQVEDAYHTSEVLHEHESVDSFNDKDGTVRRGRGRSRGGRGRGRGQHLS  387

Query  338  RGRGKGQAVGRPQFGVNNQRGPMCEQLQMV-SGRQASVPRMPDGTRGFSMGRGK  496
              R  G AVG P    ++      E+ Q V + +Q   PRMPDGTRGF+MGRGK
Sbjct  388  NNRVGGHAVGTPP---SSHHLIHSEREQPVGANKQPPGPRMPDGTRGFTMGRGK  438



>ref|XP_010526876.1| PREDICTED: la-related protein 6B [Tarenaya hassleriana]
Length=522

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTP-  178
            +R+ KSD  +++NK+HA+VEYET+ELAEKA+AELN+  +WR+GL+VR +LK   K     
Sbjct  329  SRSGKSDGALYTNKVHAYVEYETVELAEKAVAELNEEGNWRSGLRVRLMLKHQTKEQKQG  388

Query  179  --RALKAGHESEATFKED  226
              R  K GHE EA  +ED
Sbjct  389  QGRGRK-GHEVEAQHEED  405



>ref|XP_006397570.1| hypothetical protein EUTSA_v10001395mg [Eutrema salsugineum]
 gb|ESQ39023.1| hypothetical protein EUTSA_v10001395mg [Eutrema salsugineum]
Length=532

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 57/79 (72%), Gaps = 6/79 (8%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AKSD T+FSNK+HAFVEYE +ELAEKA+AEL++  +WR+GLKVR +LK   K   P+ 
Sbjct  325  RSAKSDGTLFSNKVHAFVEYELVELAEKAVAELSEAGNWRSGLKVRLMLKHQTKE--PKQ  382

Query  185  LKA----GHESEATFKEDD  229
             +     G++ E   +EDD
Sbjct  383  GQGRGRKGNDVEVEHEEDD  401



>gb|EMS67153.1| La-related protein 7 [Triticum urartu]
Length=458

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 91/187 (49%), Gaps = 29/187 (16%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R +KSD T+ SNK+HA VEYET + AEKA+ +LND  +WR GL+VR +L+R+ KS   R 
Sbjct  257  RASKSD-TLVSNKMHALVEYETSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKSVM-RL  314

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAV  364
             +   +  A    DD   H    S   +          +E  + G  +   RGRGK   V
Sbjct  315  KRPDFDHYAG--SDDESPHSQVSSDSPTSEAIHSPEAHQEDHQSGAKKGWARGRGKLHIV  372

Query  365  G--RPQ---------FGVNNQRGPMCEQLQMVSGRQASV------------PRMPDGTRG  475
                PQ         F  ++ R     Q   +S RQ S             PRMPDGTRG
Sbjct  373  APHSPQSAPAGAVGHFDPSSPR--QASQKCPLSPRQVSQKCPFSPRQPPQGPRMPDGTRG  430

Query  476  FSMGRGK  496
            F+MGRGK
Sbjct  431  FTMGRGK  437



>gb|KDO51615.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=451

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            KS+  +FSNKLHAFVEYE++ELAEKAIAELND  +WR+GL+VR +L+R +K +  +  K 
Sbjct  338  KSEGMLFSNKLHAFVEYESVELAEKAIAELNDEGNWRSGLRVRLMLRRGSKPAQVKG-KK  396

Query  194  GHESEATFKEDD  229
            G E E   +E+D
Sbjct  397  GPEGEWQCEEED  408



>ref|XP_002881943.1| hypothetical protein ARALYDRAFT_322062 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58202.1| hypothetical protein ARALYDRAFT_322062 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 6/76 (8%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            KSD T+ SNK+HAFVEYE +ELAEKA+AELN+  +WR+GLKVR +LK   K   P+  + 
Sbjct  329  KSDGTLLSNKVHAFVEYEMVELAEKAVAELNEAGNWRSGLKVRLMLKHQIKE--PKQGQG  386

Query  194  ----GHESEATFKEDD  229
                GH++E   +EDD
Sbjct  387  RGRKGHDAEVEHEEDD  402



>ref|XP_004293535.1| PREDICTED: la-related protein 6-like [Fragaria vesca subsp. vesca]
Length=371

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 93/162 (57%), Gaps = 12/162 (7%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK---SSTPRALKAGHE  202
             SNKLHA +EY+T+E  EKA+A LN+  DWRNG++V+ LLK+ +K   S+  R  + G +
Sbjct  208  ISNKLHALIEYDTVEATEKAVAILNNEEDWRNGMRVK-LLKQMSKYGQSAQRRQSRRGFD  266

Query  203  SEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAH--NRGRGKGQAVGRPQ  376
            SE   K   +   +  I   H+ S+      +EE   +   +    +RGR +GQ+ GRP+
Sbjct  267  SE---KSSSIRTSEAGIEETHNASEHHNGTPDEEDGGDQFPKEKTGHRGRSRGQS-GRPK  322

Query  377  F-GVNN-QRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            + G+N    G       + S +    PRMPDGTRGF+MGRG+
Sbjct  323  YRGLNGFGHGTSSSAHLIESSKPPPGPRMPDGTRGFTMGRGR  364



>ref|XP_008790044.1| PREDICTED: la-related protein 6A [Phoenix dactylifera]
Length=400

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 80/170 (47%), Gaps = 14/170 (8%)
 Frame = +2

Query  8    TAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRAL  187
            TA+      S+K+HA VEYET+E AE+A+A LND  +WR G++V  LLKR  K      +
Sbjct  229  TARKAEIAISSKVHALVEYETVEAAERAVATLNDEKNWRTGMRVELLLKRMEKYGL---V  285

Query  188  KAGHESEATFKEDDM-------FGHKHQIssehsesqsselvgeeegekegVWRAHNRGR  346
            + GH    + K +D+        G K +    H E            +     R  NRG+
Sbjct  286  QQGHRGTFSEKNNDIQTAEMAGNGKKMKSVDYHDEMAEKVEEQSAIVKGGRRSRYKNRGK  345

Query  347  GKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
               Q         +   G  CE +     +    PRMPDGTRGF+MGRGK
Sbjct  346  DHSQRNDDGHGPGSVAAGSGCEYM----SKPVPGPRMPDGTRGFTMGRGK  391



>ref|XP_010228482.1| PREDICTED: la-related protein 6C [Brachypodium distachyon]
Length=443

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 88/185 (48%), Gaps = 25/185 (14%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R +KSD T+ SNK+HA VEYET + AEKA+ +LND  +WR GL+VR +L+R+ KS   R 
Sbjct  242  RASKSD-TLVSNKMHALVEYETSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKSVM-RL  299

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAV  364
             +   +  A    DD   H    S   +           E  + G  +   RGRGK    
Sbjct  300  KRPDFDHFAG--SDDDSPHSQMSSDSPTSEAVHSPEAHPEDHQSGAKKGWARGRGKLHVT  357

Query  365  G--RPQ---FGVNNQRGP----MCEQLQMVSGRQASV------------PRMPDGTRGFS  481
                PQ    G+     P       Q   +S RQ S             PRMPDGTRGF+
Sbjct  358  APHSPQSAPAGIVGHFDPSSPRQASQKSPLSPRQVSQKCPFSPRQPPQGPRMPDGTRGFT  417

Query  482  MGRGK  496
            MGRGK
Sbjct  418  MGRGK  422



>gb|AAL06505.1|AF412052_1 At2g43970/F6E13.10 [Arabidopsis thaliana]
Length=329

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 6/84 (7%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALK  190
            AKSD T+FSNK+HAFVEYE +ELAE+A+ EL++  +WR+GLKVR +LK   K   P+  +
Sbjct  118  AKSDGTLFSNKVHAFVEYEIVELAERAVTELSEAGNWRSGLKVRLMLKHQTKE--PKQGQ  175

Query  191  A----GHESEATFKEDDMFGHKHQ  250
                 GH+++   +EDD    + Q
Sbjct  176  GRGRKGHDADVEHEEDDATTSEQQ  199



>ref|XP_010512276.1| PREDICTED: la-related protein 6B-like [Camelina sativa]
Length=402

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 90/173 (52%), Gaps = 25/173 (14%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALK  190
            A+S +T FSNK+HAFVEYET+ELAE+A+AELN+  +WR+GL+VR +L+   K        
Sbjct  237  ARSANTDFSNKVHAFVEYETVELAERAVAELNEERNWRSGLRVRLMLQDQTK--------  288

Query  191  AGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGR  370
               E +   +E                    +  GEEE + +   R HNRG   GQ  GR
Sbjct  289  ---EPKHVLQEGGRKEEDDDDKKFEDCGGERDGHGEEEEQGDKKRRGHNRG---GQGRGR  342

Query  371  PQF-GVNNQRGPMCEQLQMVSGRQASV----------PRMPDGTRGFSMGRGK  496
             Q    N+++    +     +  Q S+          PRMPDGT+GFS+GRGK
Sbjct  343  SQNQNENSKQNLNYQMNNNNTDHQVSMGKQQQQPPPGPRMPDGTKGFSLGRGK  395



>ref|XP_011001196.1| PREDICTED: la-related protein 6C [Populus euphratica]
Length=428

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 86/165 (52%), Gaps = 6/165 (4%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALK  190
            AK+D  V +NKLHA VE ET  +AEKA+ +LND  +WR GL+VR LL+ + KS   R  K
Sbjct  254  AKNDFFV-TNKLHALVELETRVIAEKAVEKLNDERNWRKGLRVRLLLRCSPKSVLTRGRK  312

Query  191  AGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGR  370
            +  E +   +E+D    +    +    +  S +    E       +A  +GRGKG+  G+
Sbjct  313  S--EFDNILEEEDSSLDESTEDTFQPNNSESAIESCAEDNPGASKKARAKGRGKGKDRGQ  370

Query  371  PQFGVNNQRGPMC---EQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
                      P C      +    +  + PRMPDGT+GF++GRGK
Sbjct  371  IICARGMLAPPKCGSTPHCEASPKKTCNGPRMPDGTKGFTVGRGK  415



>emb|CDX79791.1| BnaA05g03650D [Brassica napus]
Length=500

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK  166
            R+AKSD  +FSNK+HAFVEYET+ELAEKA+AELN+  +WR+ LKVR +LK   K
Sbjct  288  RSAKSDGNLFSNKVHAFVEYETVELAEKAVAELNEAGNWRSSLKVRLMLKPQTK  341



>ref|XP_009360880.1| PREDICTED: la-related protein 6A [Pyrus x bretschneideri]
Length=381

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 84/160 (53%), Gaps = 7/160 (4%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNKLHA VEY+T+E A+KA+  LN+  DWRNG++V+ LLK+  K    +    G +SE
Sbjct  218  LISNKLHALVEYDTVEAADKAVTTLNNEGDWRNGMRVK-LLKQVGKYGQRKQPWRGFDSE  276

Query  209  ATF--KEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQF-  379
             +   + +D  G +   +     + +     E+          H RGR +GQ  GR ++ 
Sbjct  277  KSSGNRSNDQTGDEENHTVSEKHNDARTTDEEDGERVPKEKTGH-RGRNRGQP-GRQKYR  334

Query  380  GVNN-QRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            G N    G       +   +    PRMPDGTRGF+MGRG+
Sbjct  335  GTNGFGHGTTSANHGIEPSKPPPGPRMPDGTRGFTMGRGR  374



>ref|XP_006351072.1| PREDICTED: la-related protein 6-like isoform X2 [Solanum tuberosum]
Length=360

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKS  169
            RTAKSDST+ SNKLH FVEYET ELAE+A+ ELND N WRN LKVR LL+ + +S
Sbjct  263  RTAKSDSTLHSNKLHTFVEYETAELAERAVVELNDDN-WRNALKVRLLLRSSKQS  316



>ref|XP_009142983.1| PREDICTED: la-related protein 6B [Brassica rapa]
Length=495

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK  166
            R+AKSD  +FSNK+HAFVEYET+ELAEKA+AELN+  +WR+ LKVR +LK   K
Sbjct  285  RSAKSDGNLFSNKVHAFVEYETVELAEKAVAELNEAGNWRSSLKVRLMLKPQTK  338



>ref|XP_010999935.1| PREDICTED: la-related protein 6C-like [Populus euphratica]
Length=414

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 89/172 (52%), Gaps = 18/172 (10%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +  AK+D  V +NKLHA VE ET ++AEKA+ +LND  +WR GL+VR LL+ + KS  PR
Sbjct  241  SSVAKNDFIV-TNKLHALVELETQKIAEKAVEKLNDERNWRKGLRVRLLLRCSPKSVLPR  299

Query  182  ALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQA  361
                G  SE    E++   H          + S     +  G  +  W A   G+GKG+ 
Sbjct  300  ----GRRSEFDIWEEEDSPHYESTVDTFKPNNSESHAEDSSGASKKAWAAKGHGKGKGRG  355

Query  362  VGRPQFGVNNQRGPMCE-QLQMVSGRQASV------PRMPDGTRGFSMGRGK  496
                   +N  RG +   +      R+AS       PRMPDGT+GF++GRGK
Sbjct  356  ------QINCSRGLLAPVKCASTPQREASAKHASKGPRMPDGTKGFTVGRGK  401



>gb|EMT10567.1| 26S proteasome non-ATPase regulatory subunit 11 [Aegilops tauschii]
Length=793

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 90/187 (48%), Gaps = 29/187 (16%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R +KSD T+ SNK+HA VEYET + AEKA+ +LND  +WR GL+VR +L+R+ KS   R 
Sbjct  592  RASKSD-TLVSNKMHALVEYETSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKSVM-RL  649

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAV  364
             +   +  A    DD   H    S   +           E  + G  +   RGRGK   V
Sbjct  650  KRPDFDHYA--GSDDESPHSQVSSDSPTSEAIHSPEAHPEDHQSGAKKGWARGRGKLHIV  707

Query  365  G--RPQ---------FGVNNQRGPMCEQLQMVSGRQASV------------PRMPDGTRG  475
                PQ         F  ++ R     Q   +S RQ S             PRMPDGTRG
Sbjct  708  APHSPQSAPAGAVGHFDTSSPR--QASQKCPLSPRQVSQKCPFSPRQPPQGPRMPDGTRG  765

Query  476  FSMGRGK  496
            F+MGRGK
Sbjct  766  FTMGRGK  772



>dbj|BAH57224.1| AT2G43970 [Arabidopsis thaliana]
Length=494

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALK  190
            AKSD T+FSNK+HAFVEYE +ELAE+A+ EL++  +WR+GLKVR +LK   K   P+  +
Sbjct  283  AKSDGTLFSNKVHAFVEYEIVELAERAVTELSEAGNWRSGLKVRLMLKHQTKE--PKQGQ  340

Query  191  A----GHESEATFKEDD  229
                 GH+++   +EDD
Sbjct  341  GRGRKGHDADVEHEEDD  357



>gb|KDO51616.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=405

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA  193
            KS+  +FSNKLHAFVEYE++ELAEKAIAELND  +WR+GL+VR +L+R +K +  +  K 
Sbjct  338  KSEGMLFSNKLHAFVEYESVELAEKAIAELNDEGNWRSGLRVRLMLRRGSKPAQVKG-KK  396

Query  194  GHESE  208
            G E E
Sbjct  397  GPEGE  401



>ref|XP_010691018.1| PREDICTED: la-related protein 6C [Beta vulgaris subsp. vulgaris]
Length=484

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 85/175 (49%), Gaps = 23/175 (13%)
 Frame = +2

Query  20   DSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGH  199
            +  + SNKLHA VEYE +E AE+A  +LND  +WR G++VR +L+R+ KS     LK   
Sbjct  304  NDVIISNKLHALVEYENVETAERAAEKLNDERNWRKGMRVRVMLRRSPKS----VLKTRK  359

Query  200  ESEATFKEDD--MFGHKHQIssehsesqsselvgeeegekegVWRAHNR---GRGKGQAV  364
                   +DD   +G   + +S                + E       R   GR + +  
Sbjct  360  SDFDMLTDDDEPSYGDSPKETSSQLNGAEFVTENNVAQQAEETSGGLKRLGSGRMRVKTK  419

Query  365  GRPQFGVNNQRGPM-----------CEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            GR Q   +N RG +           C+ L +++ +    PRMPDGTRGF+MGRGK
Sbjct  420  GRAQ--CHNDRGLLSSPTHSIGAVQCDTL-LLTKQITKGPRMPDGTRGFTMGRGK  471



>ref|NP_566004.1| RNA-binding protein [Arabidopsis thaliana]
 sp|O80567.2|LRP6B_ARATH RecName: Full=La-related protein 6B; Short=AtLARP6b; AltName: 
Full=VirF-interacting protein FIP1 [Arabidopsis thaliana]
 gb|AAK52994.1|AF375410_1 At2g43970/F6E13.10 [Arabidopsis thaliana]
 gb|AAK56266.1|AF367277_1 At2g43970/F6E13.10 [Arabidopsis thaliana]
 gb|AAK06847.1| VirF-interacting protein FIP1 [Arabidopsis thaliana]
 gb|AAL07087.1| unknown protein [Arabidopsis thaliana]
 gb|AAC23405.2| expressed protein [Arabidopsis thaliana]
 gb|AAM91060.1| At2g43970/F6E13.10 [Arabidopsis thaliana]
 gb|AEC10356.1| RNA-binding protein [Arabidopsis thaliana]
Length=545

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALK  190
            AKSD T+FSNK+HAFVEYE +ELAE+A+ EL++  +WR+GLKVR +LK   K   P+  +
Sbjct  334  AKSDGTLFSNKVHAFVEYEIVELAERAVTELSEAGNWRSGLKVRLMLKHQTKE--PKQGQ  391

Query  191  A----GHESEATFKEDD  229
                 GH+++   +EDD
Sbjct  392  GRGRKGHDADVEHEEDD  408



>ref|XP_004969999.1| PREDICTED: la-related protein 7-like isoform X1 [Setaria italica]
Length=416

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 92/182 (51%), Gaps = 28/182 (15%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            + TAK  + + S+K+HA VEYE +E AEKA+  L+D ++WR G+KVR + K +AK S   
Sbjct  234  SSTAKKPAFILSSKVHALVEYEAVEAAEKAVTTLSDESNWRTGMKVRLISKGSAKHS---  290

Query  182  ALKAGHESEATF-KEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHN-------  337
              K+  E++ T  K+++   H  +     SE  S     E   +KE +  A         
Sbjct  291  --KSSKENQDTVSKKNNQNQHSKEDQQTSSEKNSIADSMESTKDKENLNSAFTTETEHQH  348

Query  338  ---------RGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGR  490
                     +GR KGQ  G+ Q   + Q     E L     R    PRMPDGTRGF+MGR
Sbjct  349  QKQNPKGARKGRYKGQ--GQIQQNTDKQGSSGSESL----NRPIPGPRMPDGTRGFTMGR  402

Query  491  GK  496
            G+
Sbjct  403  GR  404



>ref|XP_010665825.1| PREDICTED: la-related protein 6A [Beta vulgaris subsp. vulgaris]
Length=339

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 87/166 (52%), Gaps = 31/166 (19%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTA-----KSSTPRALKA  193
            + S+K++A VEYE++E AEKA+A LND+ DWRNGL V+PL K+ A     K+     LKA
Sbjct  188  LVSSKMYALVEYESVEAAEKAVAMLNDKTDWRNGLWVQPLQKQRAYGLGRKAGRGSDLKA  247

Query  194  GH-ESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGR  370
             H     + KE++      Q                ++ ++E   +  N  +G+ Q+ GR
Sbjct  248  SHARVPVSAKEEEKNPPSQQ---------------HDDEDREHTSKERNGRKGRNQSKGR  292

Query  371  PQFGVNNQRG----PMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
               G NN  G     M E  +   G     PRMPDGTRGF++GRG+
Sbjct  293  KYRG-NNGMGHGNPSMAEPFKPPPG-----PRMPDGTRGFTIGRGR  332



>gb|KEH24675.1| LA-related protein 6 LA RNA-binding domain protein, putative 
[Medicago truncatula]
Length=440

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            +R+ K D     NKLHAFVEYE++ELAE+A+ ELND  +WR+GL+VR +L+RT+K  TP 
Sbjct  251  SRSGKVDGIPLHNKLHAFVEYESVELAERAVTELNDEGNWRSGLRVRLMLRRTSK-PTPG  309

Query  182  ALKAGHESEATFKED  226
              + G + E + +ED
Sbjct  310  RGRKGLDVEVSCEED  324



>ref|XP_006290446.1| hypothetical protein CARUB_v10019416mg [Capsella rubella]
 gb|EOA23344.1| hypothetical protein CARUB_v10019416mg [Capsella rubella]
Length=453

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 89/181 (49%), Gaps = 20/181 (11%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALK  190
            AKS  T FSNK+HAFVEYE +ELAEKA+AELN+   WR+GL+VR +L+   K +    L+
Sbjct  267  AKSGKTDFSNKVHAFVEYERVELAEKAVAELNEERSWRSGLRVRLMLQDQTKEAN-HVLQ  325

Query  191  AG---HESEATFKED-----------DMFGHKHQIssehsesqsselvgeeegekegVWR  328
             G    E +A  + D           D    +  +  E    +        +G   G  R
Sbjct  326  GGGRKEEDDAMMRSDDKQFEDCGGERDGHVQEQTVGEEEQGHKKRRGHNRVQGGGGGGGR  385

Query  329  AHNRGRGKGQA---VGRPQFGVNNQRGPMCEQLQM--VSGRQASVPRMPDGTRGFSMGRG  493
            + N+     Q     GR     +N +    +++ M     +    PRMPDGTRGFS+GRG
Sbjct  386  SENQNENAKQNQNHSGRGNHHPSNSQRNKTDEVSMGNQQQQPPPGPRMPDGTRGFSLGRG  445

Query  494  K  496
            K
Sbjct  446  K  446



>ref|XP_007211445.1| hypothetical protein PRUPE_ppa007255mg [Prunus persica]
 gb|EMJ12644.1| hypothetical protein PRUPE_ppa007255mg [Prunus persica]
Length=376

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 84/160 (53%), Gaps = 7/160 (4%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNKLHA VEY+T+E A+KA+  LN+  DWRNG++V+  LK+  K    +    G +SE
Sbjct  211  LISNKLHALVEYDTVEAADKAVTTLNNEEDWRNGMRVK-HLKQMGKYGQRKQAWRGFDSE  269

Query  209  ATF--KEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFG  382
             +   +  D  G +   ++    + +     E+          H RGR +GQ+ GR ++ 
Sbjct  270  KSSGNRTSDQTGGEENHNASEHHNDTRTPDDEDGERVPKEKNGH-RGRNRGQS-GRQKYR  327

Query  383  VNN--QRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            V N    G       +   +    PRMPDGTRGF+MGRG+
Sbjct  328  VTNGFGHGTSSANHGIEPSKPPPGPRMPDGTRGFTMGRGR  367



>gb|KDO51617.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=387

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKR  157
            KS+  +FSNKLHAFVEYE++ELAEKAIAELND  +WR+GL+VR +L+R
Sbjct  338  KSEGMLFSNKLHAFVEYESVELAEKAIAELNDEGNWRSGLRVRLMLRR  385



>ref|XP_010517978.1| PREDICTED: la-related protein 6B-like isoform X1 [Camelina sativa]
Length=547

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 58/83 (70%), Gaps = 10/83 (12%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKA----IAELNDRNDWRNGLKVRPLLKRTAKSS  172
            R+AKSD T+FSNK+HAFVEYE +ELAEKA    +A+L++  +WR+GL+VR +LK   K  
Sbjct  337  RSAKSDGTLFSNKVHAFVEYEMVELAEKAECVQVADLHEAGNWRSGLRVRLMLKHQTKE-  395

Query  173  TPRALKA----GHESEATFKEDD  229
             P+  +     GH++E   +EDD
Sbjct  396  -PKQGQGRGRKGHDAEVEHEEDD  417



>ref|XP_008383487.1| PREDICTED: la-related protein 6A-like [Malus domestica]
 ref|XP_008349174.1| PREDICTED: la-related protein 6A-like [Malus domestica]
Length=390

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 84/160 (53%), Gaps = 7/160 (4%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNKLHA VEY+T+E A+KA+  L +  DWRNG++V+ LLK+  K    +    G +SE
Sbjct  227  LISNKLHALVEYDTVEAADKAVTTLXNEGDWRNGMRVK-LLKQVGKYGQRKQPWRGFDSE  285

Query  209  --ATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQF-  379
              +  + +D  G +   +     + +     E+          H RGR +GQ+ GR ++ 
Sbjct  286  KXSGNRSNDQTGDEENHTVSEKHNDARTTDEEDGERVPKEKTGH-RGRNRGQS-GRQKYR  343

Query  380  GVNN-QRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            G N    G       +   +    PRMPDGTRGF+MGRG+
Sbjct  344  GTNGFGHGTTSANHGIEPSKPPPGPRMPDGTRGFTMGRGR  383



>ref|XP_004162617.1| PREDICTED: la protein homolog [Cucumis sativus]
Length=291

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 89/179 (50%), Gaps = 17/179 (9%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLL--------KRT  160
            +++K D  + SNKLHA VEYET+E +EKA+A LND  DWRNG++V+PL         K+ 
Sbjct  107  KSSKGD-VLISNKLHALVEYETLEASEKAVATLNDEQDWRNGMRVKPLKLMSKHGQRKQH  165

Query  161  AKSSTPRALKAGHESEATFKEDDMFGH------KHQIssehsesqsselvgeeegekegV  322
             +   P    +G  ++    + ++ G         +I +  +E        EE   +   
Sbjct  166  WRGPEPDKTSSGRIADQNGPDKNIPGRVTDQNGNEEIPNVVNEHHDDVPDEEEGDHQHKD  225

Query  323  WRAHNRGRGKGQAVGRPQFGVNNQ-RGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
               H RG+ +G+   +   GVN    G       +   +    P+MPDGTRGF+MGRG+
Sbjct  226  KHGH-RGQNQGRTRRQKYKGVNGMGHGTTTSTHHIELSKPPPGPKMPDGTRGFTMGRGR  283



>ref|XP_003542932.1| PREDICTED: stress response protein NST1-like isoform X1 [Glycine 
max]
Length=400

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 86/157 (55%), Gaps = 5/157 (3%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNKLHA VEYET+E AEKA+A LN+  DWRNG++V+ LLK   K    +    GH SE
Sbjct  241  LISNKLHALVEYETMEAAEKAVAMLNNEQDWRNGMRVK-LLKGMGKYGHKKQAWKGHHSE  299

Query  209  ATFKEDDMFG-HKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGV  385
                  +  G  ++  S++H E    E  G+   + +G  R  N+GR +     R   G+
Sbjct  300  KNSSRPEQTGDEENHGSNDHHEDTHEEEDGDHLSKDKGGQRYRNQGRSRKHKY-RAGNGM  358

Query  386  NNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
             +   P     +  + +    PRMPDGTRGF++GRG+
Sbjct  359  GHGSAPSTHAAE--ASKSPPGPRMPDGTRGFAVGRGR  393



>gb|KHG28356.1| La-related 7 [Gossypium arboreum]
Length=379

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 79/161 (49%), Gaps = 10/161 (6%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAG---H  199
            + S+KLHA VEYET+E AEKA+A LND  DWRNG+ V+ L +   K +  R    G    
Sbjct  217  LVSSKLHALVEYETVEAAEKAVATLNDERDWRNGMHVKLLKRIMGKHAQRRPAWRGPDPA  276

Query  200  ESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQF  379
            E  +  +  D  G     +S        +  GE   +++   R  NRGR +     +P+ 
Sbjct  277  EKNSNAQASDQTGDDENNASNQHHEGLPDEDGENLSKEKNGHRPRNRGRAR-----KPRT  331

Query  380  GVNN--QRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
             V N    G           +    PRMPDGTRGF+MGRG+
Sbjct  332  RVTNGLGHGTTSSSHATEPSKPPPGPRMPDGTRGFTMGRGQ  372



>ref|XP_004293591.1| PREDICTED: uncharacterized protein LOC101309803 [Fragaria vesca 
subsp. vesca]
Length=284

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 87/161 (54%), Gaps = 10/161 (6%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK---SSTPRALKAGHE  202
             SNKLHA +EY+T+E  EKA+A LN+  DWRNG++V+ LLK+ +K   S+  R  + G +
Sbjct  119  ISNKLHALIEYDTVEATEKAVAILNNEEDWRNGMRVK-LLKQMSKYGQSAQRRQSRGGFD  177

Query  203  SEATFKEDDMFGHKHQIssehsesqsselvgeeegekegV--WRAHNRGRGKGQAVGRPQ  376
            SE   K   +   +  I   H+ S+      +EE     +   +  +RGR +GQ+  +  
Sbjct  178  SE---KSSSIRTSEAGIEETHNASEHHNGTPDEEDGGGQLPKEKTGHRGRNRGQSGRQKY  234

Query  377  FGVNN-QRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
             G+N    G       +   +    PRMPDGTRGF+ GRG+
Sbjct  235  LGLNGFGHGTTSSAHPIEPSKPPPGPRMPDGTRGFTTGRGR  275



>ref|XP_008225473.1| PREDICTED: la-related protein 6A [Prunus mume]
Length=376

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 84/160 (53%), Gaps = 7/160 (4%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNKLHA VEY+T+E A+KA+  LN+  DWRNG++V+  LK+  K    +    G +S+
Sbjct  211  LISNKLHALVEYDTVEAADKAVTTLNNEEDWRNGMRVK-HLKQMGKYGQRKQAWRGFDSD  269

Query  209  ATF--KEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFG  382
             +   +  D  G +   ++    + +     E+          H RGR +GQ+ GR ++ 
Sbjct  270  KSSGNRTSDQAGGEENHNASEHHNDTRTPDDEDGERVPKEKTGH-RGRNRGQS-GRQKYR  327

Query  383  VNN--QRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            V N    G       +   +    PRMPDGTRGF+MGRG+
Sbjct  328  VTNGFGHGTSSANHGIEPSKPPPGPRMPDGTRGFTMGRGR  367



>ref|XP_010257771.1| PREDICTED: la-related protein 6A isoform X2 [Nelumbo nucifera]
Length=370

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 78/168 (46%), Gaps = 26/168 (15%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK-SSTPRALKAG---  196
            + S K++A VEYET+E AEKA+A LND N+WR+G++V+ LLKR  K   + + +KA    
Sbjct  210  LISGKIYALVEYETVEAAEKAVATLNDENNWRSGMRVK-LLKRMGKFGLSKKNVKAAVSE  268

Query  197  -----HESEATFKEDDMFGH---KHQIssehsesqsselvgeeegekegVWRAHNRGRGK  352
                   SEA   E+   GH    H+       S + +               H+   G 
Sbjct  269  KNNNVPASEAAGDENPKTGHLEETHEPEYAGGHSPTEKTGRRGRNRGRFRGHKHHSTNGL  328

Query  353  GQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            G        G+     P              VPRMPDGTRGF+MGRG+
Sbjct  329  GHGTLHSGAGIKCSNPP-------------RVPRMPDGTRGFTMGRGR  363



>ref|XP_004134576.1| PREDICTED: la protein homolog [Cucumis sativus]
 gb|KGN49390.1| hypothetical protein Csa_6G523320 [Cucumis sativus]
Length=388

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 89/179 (50%), Gaps = 17/179 (9%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLL--------KRT  160
            +++K D  + SNKLHA VEYET+E +EKA+A LND  DWRNG++V+PL         K+ 
Sbjct  204  KSSKGD-VLISNKLHALVEYETLEASEKAVATLNDEQDWRNGMRVKPLKLMSKHGQRKQH  262

Query  161  AKSSTPRALKAGHESEATFKEDDMFGH------KHQIssehsesqsselvgeeegekegV  322
             +   P    +G  ++    + ++ G         +I +  +E        EE   +   
Sbjct  263  WRGPEPDKTSSGRIADQNGPDKNIPGRVTDQNGNEEIPNVVNEHHDDVPDEEEGDHQHKD  322

Query  323  WRAHNRGRGKGQAVGRPQFGVNNQ-RGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
               H RG+ +G+   +   GVN    G       +   +    P+MPDGTRGF+MGRG+
Sbjct  323  KHGH-RGQNQGRTRRQKYKGVNGMGHGTTTSTHHIELSKPPPGPKMPDGTRGFTMGRGR  380



>gb|KDP38238.1| hypothetical protein JCGZ_04881 [Jatropha curcas]
Length=457

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 88/175 (50%), Gaps = 18/175 (10%)
 Frame = +2

Query  2    TRTAKSDSTVF-SNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTP  178
            + ++++ S  F SNKLHA VE+E+ E AEKA+ +LND  +WR GL+VR LL+ + KS   
Sbjct  278  SNSSRTKSDFFMSNKLHALVEFESPETAEKAVEKLNDERNWRKGLRVRVLLRCSPKS---  334

Query  179  RALKA-GHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKG  355
              LK    E +    ++++   +    S  + +  S      E     + +   R RGK 
Sbjct  335  -VLKNRKSEFDGLLDDEELPVPESNEDSSPTNNADSVNESNVEENSGALKKGWARTRGKV  393

Query  356  QAVGRPQFGVNNQRGPMCEQLQMVSGRQASV--------PRMPDGTRGFSMGRGK  496
            +  G+   G    RG +    Q V   Q           PRMPDGTRGF+MGRGK
Sbjct  394  RGRGQSHGG----RGLLAPPSQSVCSLQCEASAKHTSRGPRMPDGTRGFTMGRGK  444



>ref|NP_001241310.1| uncharacterized protein LOC100807619 [Glycine max]
 gb|ACU18818.1| unknown [Glycine max]
Length=405

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 86/164 (52%), Gaps = 17/164 (10%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL--------LKRTAKSSTPRA  184
            + SNKLHA VEYETIE AEKA+A LN+  DWRNG++V+ L         K+  K S    
Sbjct  244  LISNKLHALVEYETIEAAEKAVAMLNNEQDWRNGMRVKLLKGMGTYGHKKQAWKGSHSEK  303

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAV  364
              + H SE T  E++   ++H+      E    E  G+   + +G  R  N+GR +    
Sbjct  304  NSSRHVSEQTGDEENHGSNEHR------EDAHEEEDGDHLSKDKGGQRYRNQGRSRKHKY  357

Query  365  GRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
             R   G+ +   P     +  + +    PRMPDGTRGF++GRG+
Sbjct  358  -RAGNGMGHGSTPSTHAAE--ASKPPPGPRMPDGTRGFAIGRGR  398



>ref|XP_008371601.1| PREDICTED: la-related protein 6A-like isoform X1 [Malus domestica]
Length=375

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 85/160 (53%), Gaps = 7/160 (4%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNKLHA V+Y+T+E A+KA+  LN+  DWRNG++V+ LLK+  K    +    G ESE
Sbjct  212  LISNKLHALVKYDTVEAADKAVTTLNNEEDWRNGMRVK-LLKQVGKYGQRKQPWKGFESE  270

Query  209  ATF--KEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQF-  379
             +   + +D  G +   +     + +  +  E+          H RGR +GQ+ GR ++ 
Sbjct  271  KSSGNRSNDQTGDEEYHTVSVKHNDARTIDEEDGERVPKEKTGH-RGRNRGQS-GRQKYR  328

Query  380  GVNN-QRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            G N    G       +   +    PRMPDGTRGF+ GRG+
Sbjct  329  GTNGFGHGTTTANHGIEPWKPPPGPRMPDGTRGFTXGRGR  368



>ref|NP_001176849.1| Os12g0225100 [Oryza sativa Japonica Group]
 dbj|BAH95577.1| Os12g0225100, partial [Oryza sativa Japonica Group]
Length=243

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEYET+E AEKAI ELND  +WRNGL+VR LL         + 
Sbjct  22   RSAKLD-MLFANKLHAFVEYETLEDAEKAILELNDEKNWRNGLRVR-LLNTCMTKGAGKG  79

Query  185  LKAGHESEATFKED  226
             K  HE++   +ED
Sbjct  80   KKGVHEADGNGEED  93



>ref|XP_010257773.1| PREDICTED: la-related protein 6A isoform X4 [Nelumbo nucifera]
Length=282

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 77/169 (46%), Gaps = 27/169 (16%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK-SSTPRALKAGHE-  202
            + S K++A VEYET+E AEKA+A LND N+WR+G++V+ LLKR  K   + + +KA    
Sbjct  121  LISGKIYALVEYETVEAAEKAVATLNDENNWRSGMRVK-LLKRMGKFGLSKKNVKAAVSE  179

Query  203  -------SEATFKEDDMFGHKHQIssehse----sqsselvgeeegekegVWRAHNRGRG  349
                   SEA   E+   GH  +           S + +               H+   G
Sbjct  180  KNNNVPASEAAGDENPKTGHLEETHEPEQYAGGHSPTEKTGRRGRNRGRFRGHKHHSTNG  239

Query  350  KGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
             G        G+     P              VPRMPDGTRGF+MGRG+
Sbjct  240  LGHGTLHSGAGIKCSNPP-------------RVPRMPDGTRGFTMGRGR  275



>ref|XP_004159060.1| PREDICTED: la-related protein 7-like [Cucumis sativus]
Length=356

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLL  151
            +++AK+D   +SNKLHAFVEYE++ELAEKA+AELND  +WRN L++R +L
Sbjct  303  SKSAKADGMHYSNKLHAFVEYESVELAEKAVAELNDEGNWRNALRLRLML  352



>gb|ABG21923.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
Length=274

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEYET+E AEKAI ELND  +WRNGL+VR LL         + 
Sbjct  53   RSAKLD-MLFANKLHAFVEYETLEDAEKAILELNDEKNWRNGLRVR-LLNTCMTKGAGKG  110

Query  185  LKAGHESEATFKED  226
             K  HE++   +ED
Sbjct  111  KKGVHEADGNGEED  124



>ref|XP_007139081.1| hypothetical protein PHAVU_009G2633000g, partial [Phaseolus vulgaris]
 gb|ESW11075.1| hypothetical protein PHAVU_009G2633000g, partial [Phaseolus vulgaris]
Length=332

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKR  157
            +R  K D    SNKLHAFVEYE++ELAE+A+AELND  +WR+GL+VR +L+R
Sbjct  280  SRLGKVDGLPLSNKLHAFVEYESVELAERAVAELNDEGNWRSGLRVRLMLRR  331



>ref|XP_002453408.1| hypothetical protein SORBIDRAFT_04g005500 [Sorghum bicolor]
 gb|EES06384.1| hypothetical protein SORBIDRAFT_04g005500 [Sorghum bicolor]
Length=451

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 87/180 (48%), Gaps = 21/180 (12%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPR  181
            + TAK      S+K+H  VEYE +E AEKA+  L+D ++WR G+KVR L K++   S   
Sbjct  266  SSTAKKPDFNLSSKVHVLVEYEAVEAAEKAVTVLSDESNWRTGMKVRLLSKQSVMGSGKY  325

Query  182  ALKAGHESEATFKEDDMFGHKHQ---IssehsesqsselvgeeegekegVWRAHN-----  337
               +    +A  K+ D   H  +   I+SE   +  +    +++   + V+         
Sbjct  326  NKPSKENQDAVSKKIDQNQHSKEDQRITSEKISNADAVGSAKDKENLKSVFTTETEHHDQ  385

Query  338  -------RGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
                   +GR KGQ  G+ Q   N Q     E L     +    PRMPDGTRGF++GRGK
Sbjct  386  KPNSRGRKGRYKGQ--GQMQQNTNKQGSSGSESL----NKPIPGPRMPDGTRGFTLGRGK  439



>ref|XP_010908488.1| PREDICTED: la-related protein 6B-like [Elaeis guineensis]
Length=471

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            +F NKLHAFVEYET+E AEKA+ EL D  +WR+GL+VR L K   K    R  K GHE +
Sbjct  289  LFYNKLHAFVEYETVEDAEKAVTELIDERNWRSGLRVRILSKCMTKHGPGRGRKIGHEGD  348

Query  209  ATFKEDDM  232
             T  ED++
Sbjct  349  GTGDEDEI  356



>ref|XP_004494976.1| PREDICTED: uncharacterized protein LOC101512171 [Cicer arietinum]
Length=641

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLL-KRTAKSSTP  178
            +R  K D    SNKLHAFVEYE++ELAE A+AELND  +WR+GL+VR +L K T K +  
Sbjct  459  SRLGKVDGIPLSNKLHAFVEYESVELAENAVAELNDEGNWRSGLRVRLMLNKHTPKPTQG  518

Query  179  RALKAGHESEATFKED  226
            R  K G + E + +ED
Sbjct  519  RGRK-GLDVEVSCEED  533



>gb|KHN33140.1| La-related protein 7 [Glycine soja]
Length=792

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 17/164 (10%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL--------LKRTAKSSTPRA  184
            + SNKLHA VEYETIE AEKA+A LN+  DWRNG++V+ L         K+  K S    
Sbjct  631  LISNKLHALVEYETIEAAEKAVAMLNNEQDWRNGMRVKLLKGMGTYGHKKQAWKGSHSEK  690

Query  185  LKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAV  364
              + H SE T  E++   ++H+  +   E        +         R  N+GR +    
Sbjct  691  NSSRHVSEQTGDEENHGSNEHREDAHEEEDGDHLSKDKGGQ------RYRNQGRSRKHKY  744

Query  365  GRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
             R   G+ +   P     +  + +    PRMPDGTRGF++GRG+
Sbjct  745  -RAGNGMGHGSTPSTHAAE--ASKPPPGPRMPDGTRGFAIGRGR  785



>ref|XP_010257770.1| PREDICTED: la-related protein 6A isoform X1 [Nelumbo nucifera]
Length=371

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 77/169 (46%), Gaps = 27/169 (16%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK-SSTPRALKAG---  196
            + S K++A VEYET+E AEKA+A LND N+WR+G++V+ LLKR  K   + + +KA    
Sbjct  210  LISGKIYALVEYETVEAAEKAVATLNDENNWRSGMRVK-LLKRMGKFGLSKKNVKAAVSE  268

Query  197  -----HESEATFKEDDMFGHKHQIssehse----sqsselvgeeegekegVWRAHNRGRG  349
                   SEA   E+   GH  +           S + +               H+   G
Sbjct  269  KNNNVPASEAAGDENPKTGHLEETHEPEQYAGGHSPTEKTGRRGRNRGRFRGHKHHSTNG  328

Query  350  KGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
             G        G+     P              VPRMPDGTRGF+MGRG+
Sbjct  329  LGHGTLHSGAGIKCSNPP-------------RVPRMPDGTRGFTMGRGR  364



>ref|XP_010257772.1| PREDICTED: la-related protein 6A isoform X3 [Nelumbo nucifera]
Length=359

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 77/169 (46%), Gaps = 27/169 (16%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK-SSTPRALKAG---  196
            + S K++A VEYET+E AEKA+A LND N+WR+G++V+ LLKR  K   + + +KA    
Sbjct  198  LISGKIYALVEYETVEAAEKAVATLNDENNWRSGMRVK-LLKRMGKFGLSKKNVKAAVSE  256

Query  197  -----HESEATFKEDDMFGHKHQIssehse----sqsselvgeeegekegVWRAHNRGRG  349
                   SEA   E+   GH  +           S + +               H+   G
Sbjct  257  KNNNVPASEAAGDENPKTGHLEETHEPEQYAGGHSPTEKTGRRGRNRGRFRGHKHHSTNG  316

Query  350  KGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
             G        G+     P              VPRMPDGTRGF+MGRG+
Sbjct  317  LGHGTLHSGAGIKCSNPP-------------RVPRMPDGTRGFTMGRGR  352



>ref|XP_006577368.1| PREDICTED: la-related protein 6-like isoform X2 [Glycine max]
Length=366

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK  166
            +R  K D    SNKLHAFVEY ++ELAE+A+AELND  +WR+GL++R +L+R +K
Sbjct  295  SRLGKVDGMPLSNKLHAFVEYGSVELAERAVAELNDEGNWRSGLRIRLMLRRMSK  349



>emb|CDO97143.1| unnamed protein product [Coffea canephora]
Length=432

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 81/169 (48%), Gaps = 17/169 (10%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + S KLHA VE+E  E AE+A+ +LND+ +WR GL+VR LL+R+ KS     LK+     
Sbjct  253  IISTKLHALVEFENSESAERAVEKLNDQKNWRKGLRVRCLLRRSPKS----VLKSKKSEF  308

Query  209  ATFKEDDMFGHKHQIssehse-----sqsselvgeeegekegVWRAHNRGRGK------G  355
                +DD       I S         S S       E       +A N+GRGK       
Sbjct  309  DGLLDDDETPPGSSIVSPELSPRPIISDSPPENNGYESSGASKTKAWNKGRGKPRHRLTS  368

Query  356  QAVGRPQFGVNNQ--RGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
               GR    ++ Q   G        ++ + A  P+MPDGTRGF+MGRGK
Sbjct  369  SHSGRGLLSLSPQSNNGIFILGEAPLTRQNAKGPKMPDGTRGFTMGRGK  417



>ref|XP_009772752.1| PREDICTED: la-related protein 6C-like [Nicotiana sylvestris]
Length=431

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 87/163 (53%), Gaps = 17/163 (10%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESEA  211
             S+KLHA +E+E  E AEKA+ +LND  +WR GL+V+ LL+R+ KS     LK+    ++
Sbjct  265  ISSKLHALIEFEHPEAAEKAVEKLNDERNWRKGLQVKLLLRRSPKS----VLKS---RKS  317

Query  212  TFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGVNN  391
             F  D  F  +  ++SE ++  +     E          A  +  GKG+   R +  + N
Sbjct  318  AF--DGCFDDEDWLASELTDDSNHTNQSEIADSNVEETLATRKTWGKGRVRARQRNQMFN  375

Query  392  QRGPMCEQLQMVSG-------RQASV-PRMPDGTRGFSMGRGK  496
             RG +    Q  +        +QA+  PRMPDGT+GF+MGRGK
Sbjct  376  GRGLLASSPQSSNSGPFEAPIKQATKGPRMPDGTKGFTMGRGK  418



>ref|XP_004986415.1| PREDICTED: la-related protein 6-like [Setaria italica]
Length=421

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 80/170 (47%), Gaps = 15/170 (9%)
 Frame = +2

Query  5    RTAKSDST--VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSST-  175
            R++KSD+   + SNKLHA +EYET + AE+A+  LND  +WR GL+VR +L+R+ KS T 
Sbjct  246  RSSKSDANALLVSNKLHALIEYETSQQAERAVYRLNDGRNWRKGLRVRAVLRRSPKSVTR  305

Query  176  PRALKAGH--ESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRG  349
             + L   H   S+     D      H                +     +  W    RGR 
Sbjct  306  LKRLDLDHLAASDEERSPDSPTAAAH--------LPDHSQEDQHAAGSKKPW-GSGRGRQ  356

Query  350  KGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASV-PRMPDGTRGFSMGRGK  496
               A   PQ   +             S R A   PRMPDGTRGF+MGRG+
Sbjct  357  HAGANAAPQTTHSTAGAAWHLDSFAASPRHAPQGPRMPDGTRGFNMGRGR  406



>ref|XP_009402690.1| PREDICTED: la-related protein 6A [Musa acuminata subsp. malaccensis]
Length=412

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 87/163 (53%), Gaps = 8/163 (5%)
 Frame = +2

Query  14   KSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSS-TPRALK  190
            KS +T+ S+K+HA VEYET++ A  A++ LND  +WR+G++V  LLKR  K    P+  K
Sbjct  242  KSGATI-SSKVHALVEYETVDAAASAVSSLNDEKNWRSGMRVELLLKRMGKYGLVPKGRK  300

Query  191  AGH-ESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVG  367
            A   E   + + D+    + +      ++       EE  + +GV R   + RG+GQ V 
Sbjct  301  ATSVEKSNSAQVDEPTADREK---SSLDNHEELPTTEEGEQGKGVRRNRYKSRGRGQ-VR  356

Query  368  RPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            +   G  + R P    +     +    PRMPDGTRGFS GRGK
Sbjct  357  QSDNGHGHGRNPPASAVDF-PHKPVQGPRMPDGTRGFSFGRGK  398



>gb|KEH24676.1| LA-related protein 6 LA RNA-binding domain protein, putative 
[Medicago truncatula]
Length=363

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTA  163
            +R+ K D     NKLHAFVEYE++ELAE+A+ ELND  +WR+GL+VR +L+RT 
Sbjct  251  SRSGKVDGIPLHNKLHAFVEYESVELAERAVTELNDEGNWRSGLRVRLMLRRTV  304



>gb|EAY82629.1| hypothetical protein OsI_37849 [Oryza sativa Indica Group]
Length=478

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEYET+E AEKAI ELND  +WRNGL+VR LL         + 
Sbjct  257  RSAKLD-MLFANKLHAFVEYETLEDAEKAILELNDEKNWRNGLRVR-LLNTCMTKGAGKG  314

Query  185  LKAGHESEATFKED  226
             K  HE++   +ED
Sbjct  315  KKGVHEADGNGEED  328



>gb|ABA96797.2| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
Length=478

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEYET+E AEKAI ELND  +WRNGL+VR LL         + 
Sbjct  257  RSAKLD-MLFANKLHAFVEYETLEDAEKAILELNDEKNWRNGLRVR-LLNTCMTKGAGKG  314

Query  185  LKAGHESEATFKED  226
             K  HE++   +ED
Sbjct  315  KKGVHEADGNGEED  328



>gb|EAZ20013.1| hypothetical protein OsJ_35608 [Oryza sativa Japonica Group]
Length=481

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEYET+E AEKAI ELND  +WRNGL+VR LL         + 
Sbjct  260  RSAKLD-MLFANKLHAFVEYETLEDAEKAILELNDEKNWRNGLRVR-LLNTCMTKGAGKG  317

Query  185  LKAGHESEATFKED  226
             K  HE++   +ED
Sbjct  318  KKGVHEADGNGEED  331



>ref|XP_008666613.1| PREDICTED: la-related protein 6C-like [Zea mays]
Length=435

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 82/186 (44%), Gaps = 50/186 (27%)
 Frame = +2

Query  23   STVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK------------  166
            +T  SNKLHA +EYET   A++A+ +LND  +WR GL+VRP+L+R+ K            
Sbjct  256  NTPASNKLHALIEYETSHQADRAVDKLNDERNWRKGLRVRPVLRRSPKTVARMKRPDLDH  315

Query  167  ------------SSTPRALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeege  310
                        S +P A  A H  + T ++               E +  +    + G 
Sbjct  316  HVAASDEERVSTSDSPTATAAAHPPDNTQQQ--------------QEEEEEDQHQHQHGG  361

Query  311  kegVWRAHNRGR----GKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGF  478
             +  W +  RGR        + G P   V++        L       A  PRMPDGTRGF
Sbjct  362  AKKPWGSRGRGRPPPHSSAHSAGAPGHSVDS--------LAASPRHAAQGPRMPDGTRGF  413

Query  479  SMGRGK  496
            +MGRG+
Sbjct  414  TMGRGR  419



>ref|XP_002521842.1| lupus la ribonucleoprotein, putative [Ricinus communis]
 gb|EEF40478.1| lupus la ribonucleoprotein, putative [Ricinus communis]
Length=440

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 86/178 (48%), Gaps = 24/178 (13%)
 Frame = +2

Query  2    TRTAKSDSTVF-SNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTP  178
            + ++++ S  F SNKLHA VE+E  E AEKA+  LND  +WR GL+VR LL R +  S  
Sbjct  261  SNSSRTKSDFFMSNKLHALVEFEGSEAAEKAVENLNDERNWRKGLRVRVLL-RCSPKSVL  319

Query  179  RALKAGHESEATFKEDDMF---GHKHQIssehsesqsselvgeeegekegVWRAHNRGR-  346
            R  K+  E E    ++D+     ++      + ES +     E  G  +  W        
Sbjct  320  RNRKS--EFEGLLDDEDLALPESNEDSSQVNNVESVTESNTEENSGSSKKGWAKGRGKGR  377

Query  347  -------GKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASV-PRMPDGTRGFSMGRGK  496
                   G+G     PQ    +   P CE     S +  S  PRMPDGTRGF+MGRGK
Sbjct  378  GRGQSHGGRGLLAPSPQ----SVSSPQCE----ASAKHTSKGPRMPDGTRGFTMGRGK  427



>ref|XP_006664435.1| PREDICTED: la-related protein 7-like [Oryza brachyantha]
Length=402

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEYETIE AEKAI ELND  +WRNGL+VR LL         + 
Sbjct  182  RSAKLD-MLFANKLHAFVEYETIEDAEKAILELNDEKNWRNGLRVR-LLNTCTTKGAGKG  239

Query  185  LKAGHESEATFKED  226
             K  +E++   +ED
Sbjct  240  KKGIYEADGNGEED  253



>ref|XP_006423072.1| hypothetical protein CICLE_v10028506mg [Citrus clementina]
 gb|ESR36312.1| hypothetical protein CICLE_v10028506mg [Citrus clementina]
Length=424

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 83/167 (50%), Gaps = 12/167 (7%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALK  190
            AKSD  V SNKLHA VEYE+ ++AEKA+ +LND  +WR GL+VR LL R +  S  +  K
Sbjct  254  AKSDFFV-SNKLHALVEYESTDIAEKAVEKLNDERNWRKGLRVRVLL-RCSPKSVLKTKK  311

Query  191  AGHE-----SEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKG  355
            +  E      EA   ED    +  +  +E++  + +    ++   +              
Sbjct  312  SEFEGILDDEEADASEDSSHPNNQESVAENNNVEENSGGSKKGWARGRGKGRGRAQSHNS  371

Query  356  QAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            +++  P    +N         Q   G     PRMPDGTRGF+MGRGK
Sbjct  372  RSLLTPPPQSSNATQNEASAKQTFKG-----PRMPDGTRGFTMGRGK  413



>ref|XP_006398322.1| hypothetical protein EUTSA_v10000879mg [Eutrema salsugineum]
 gb|ESQ39775.1| hypothetical protein EUTSA_v10000879mg [Eutrema salsugineum]
Length=463

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 84/172 (49%), Gaps = 19/172 (11%)
 Frame = +2

Query  26   TVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSST--PRALKAGH  199
            T    +LHAFVEYET+E AEKA A LN+  DWRNGL+V+ LL++  K +   P   +   
Sbjct  284  TFIRTRLHAFVEYETVEAAEKAAATLNNEQDWRNGLRVK-LLEQAGKFAQRRPARREVDT  342

Query  200  ESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQF  379
            E ++T +  D  G +      +          +   + EG  +  N+ RG+G+ V RP  
Sbjct  343  EKDSTGRVHDKTGGEEN-KKSNEHQHHRHHHSDTPADDEGGHKNGNKSRGRGR-VRRPNH  400

Query  380  GVNNQRGPMCEQLQM-------------VSGRQASVPRMPDGTRGFSMGRGK  496
              +N  G                     VS R    PRMPDGTRGF+MGRGK
Sbjct  401  VGSNATGHGTSPSSSSSFHQNYNHHPVEVSKRPPG-PRMPDGTRGFTMGRGK  451



>ref|XP_008392294.1| PREDICTED: la-related protein 6C [Malus domestica]
Length=404

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 76/162 (47%), Gaps = 11/162 (7%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNKLHA +EYET+E+AE+A+ +L+D  +WR GL+VR L++ + KS     LK+     
Sbjct  240  IVSNKLHALLEYETMEIAERAVDKLSDERNWRKGLRVRMLIRCSPKS----VLKSRKSDF  295

Query  209  ATFKEDDMFGH------KHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGR  370
                ED+   +       H  S E      +        +K   W             GR
Sbjct  296  DGILEDEEPPYDCAVETSHPSSPELVIDSPNVEENSALSKKGLAWGRGKGRGRGQSQSGR  355

Query  371  PQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
                ++        Q +  +   +  PRMPDGTRGF+MGRGK
Sbjct  356  GLIALSPLSSSTI-QCEASAKLNSKGPRMPDGTRGFTMGRGK  396



>ref|XP_010919805.1| PREDICTED: la-related protein 6A [Elaeis guineensis]
Length=401

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 87/165 (53%), Gaps = 4/165 (2%)
 Frame = +2

Query  8    TAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRAL  187
            T +      S+K++A VEYE +E AE+A+A LND  +WR G++V  LLKR  K    +  
Sbjct  226  TTRKAEIAISSKVYALVEYEKVEAAERAVATLNDEKNWRTGMRVELLLKRMEKYGLVQKG  285

Query  188  KAGHESEAT--FKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQA  361
              G  SE +   +  +M G   ++ S +  ++ +E V E+     G  R+  + RGKG +
Sbjct  286  YKGTFSEKSNDIQTTEMTGDGKKMKSVNYHNEMAEKVEEQSAIVRGGRRSRYKNRGKGHS  345

Query  362  VGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
              R   G  +         + +S +    PRMPDGTRGF+MGRG+
Sbjct  346  -QRNDNGHGHGSIASGSSSEYMS-KPVPGPRMPDGTRGFTMGRGR  388



>gb|ABA96798.2| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
Length=310

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL  148
            R+AK D  +F+NKLHAFVEYET+E AEKAI ELND  +WRNGL+VR L
Sbjct  257  RSAKLD-MLFANKLHAFVEYETLEDAEKAILELNDEKNWRNGLRVRLL  303



>gb|EPS74002.1| hypothetical protein M569_00755 [Genlisea aurea]
Length=379

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 82/168 (49%), Gaps = 33/168 (20%)
 Frame = +2

Query  8    TAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTP--R  181
            T+KSD+ V S KL   VEYE  E AEKA  +LND   WR G++VR +LKR+AK+ T   R
Sbjct  233  TSKSDA-VASYKLRVMVEYENAENAEKAAEKLNDERHWRKGMRVRVMLKRSAKAMTKGRR  291

Query  182  ALK-AGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQ  358
            +L     E+EAT    D+F                      +   +  W   NRG+   +
Sbjct  292  SLDGVVDEAEAT---ADLF------------------EVVVDETSQKGWLP-NRGKPPKR  329

Query  359  AVGRPQFGVNNQRGPMCEQLQMVSGRQASV--PRMPDGTRGFSMGRGK  496
                P    +       E    VS +Q +   PRMPDGTRGF++GRGK
Sbjct  330  TTSLPP-ATSASAASTGE----VSSKQTTARGPRMPDGTRGFTLGRGK  372



>ref|XP_006279625.1| hypothetical protein CARUB_v10026475mg [Capsella rubella]
 gb|EOA12523.1| hypothetical protein CARUB_v10026475mg [Capsella rubella]
Length=420

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 82/171 (48%), Gaps = 26/171 (15%)
 Frame = +2

Query  41   KLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSST--PRALKAGHESEAT  214
            +LHAFVEYET+E AE A A LN+  DWRNGL+V+ LL++  K +   P   +   E + T
Sbjct  243  RLHAFVEYETVEAAENAAATLNNEQDWRNGLRVK-LLEQAGKFAQRKPARREVDKEKDTT  301

Query  215  FKEDDMFG------------HKHQIssehsesq-----sselvgeeegekegVWRAHNRG  343
             +  D  G            H+H  S   ++ +       +   +  G  +G  + H  G
Sbjct  302  GRVHDQIGEEKNKKTREHQYHRHHHSDNPADDECGNHHKDKNGNKGRGGGQGRRQNHQGG  361

Query  344  RGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
             G G     P    +    P+      VS R    PRMPDGTRGF+MGRGK
Sbjct  362  NGFGYGTTPPASSSHYNHHPI-----EVSKRPPG-PRMPDGTRGFTMGRGK  406



>ref|XP_008371602.1| PREDICTED: la-related protein 6A-like isoform X2 [Malus domestica]
Length=373

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 83/160 (52%), Gaps = 9/160 (6%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNKLHA V+Y+T+E A+KA+  LN+  DWRNG++V+ L +   +   P     G ESE
Sbjct  212  LISNKLHALVKYDTVEAADKAVTTLNNEEDWRNGMRVKLLKQVYGQRKQPW---KGFESE  268

Query  209  ATF--KEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQF-  379
             +   + +D  G +   +     + +  +  E+          H RGR +GQ+ GR ++ 
Sbjct  269  KSSGNRSNDQTGDEEYHTVSVKHNDARTIDEEDGERVPKEKTGH-RGRNRGQS-GRQKYR  326

Query  380  GVNN-QRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            G N    G       +   +    PRMPDGTRGF+ GRG+
Sbjct  327  GTNGFGHGTTTANHGIEPWKPPPGPRMPDGTRGFTXGRGR  366



>ref|XP_002443059.1| hypothetical protein SORBIDRAFT_08g007220 [Sorghum bicolor]
 gb|EES16897.1| hypothetical protein SORBIDRAFT_08g007220 [Sorghum bicolor]
Length=489

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEYET E AEKAI ELND  +WRNGL+VR LL         + 
Sbjct  273  RSAKLD-MLFANKLHAFVEYETPEDAEKAILELNDEKNWRNGLRVR-LLNTCTVKGAGKG  330

Query  185  LKAGHESEATFKED  226
             K  HE++   +ED
Sbjct  331  KKGVHETDGNGEED  344



>ref|XP_006662857.1| PREDICTED: la-related protein 6-like [Oryza brachyantha]
Length=341

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL  148
            R+AK D  +F+NKLHAFVEY+T+E AEKAI ELND  +WRNGL+VR L
Sbjct  115  RSAKLD-MLFANKLHAFVEYDTVEDAEKAIVELNDERNWRNGLRVRLL  161



>ref|XP_006449682.1| hypothetical protein CICLE_v10015602mg [Citrus clementina]
 gb|ESR62922.1| hypothetical protein CICLE_v10015602mg [Citrus clementina]
Length=381

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKR  157
            +++K D  V SNKLHAFVEYET+E AEKA+A LND  DWRNG++V+ LLKR
Sbjct  210  KSSKCDYLV-SNKLHAFVEYETVEAAEKAVATLNDEQDWRNGMRVK-LLKR  258



>gb|ABG22428.1| La domain-containing protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=324

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL  148
            R+AK D  +F+NKLHAFVEY+T+E AEKAI ELND  +WRNGL+VR L
Sbjct  115  RSAKLD-MLFANKLHAFVEYDTVEDAEKAIVELNDERNWRNGLRVRLL  161



>gb|AAX95155.1| At2g43970/F6E13.10 [Oryza sativa Japonica Group]
 gb|ABA92362.1| La domain-containing protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=341

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL  148
            R+AK D  +F+NKLHAFVEY+T+E AEKAI ELND  +WRNGL+VR L
Sbjct  115  RSAKLD-MLFANKLHAFVEYDTVEDAEKAIVELNDERNWRNGLRVRLL  161



>ref|XP_008459218.1| PREDICTED: la-related protein 6C [Cucumis melo]
Length=424

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 5/66 (8%)
 Frame = +2

Query  35   SNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA-GHESEA  211
            SNKLHA VE+ET++LAE+AI +LND  +WR GL+VRPL++R+ KS     LK    E ++
Sbjct  253  SNKLHALVEFETVDLAERAIEQLNDERNWRKGLRVRPLVRRSPKS----VLKNRKSEFDS  308

Query  212  TFKEDD  229
               EDD
Sbjct  309  VLDEDD  314



>gb|EMT23549.1| La-related protein 7 [Aegilops tauschii]
Length=296

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 78/162 (48%), Gaps = 17/162 (10%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            +F+NKLHAFVEY T+E AEKA+AE +   +WR+G +VR LL    K    +  K G E  
Sbjct  135  LFANKLHAFVEYGTVEDAEKAVAEFSGGRNWRDGPRVRSLLG-CLKHGIGQGRKGGDEEA  193

Query  209  ATFKEDDMFGHKHQIsse------hsesqsselvgeeegekegVWRAHNRGRGKGQAVGR  370
            A   EDD   ++ + +++                    G   G  + H + R  G  +G 
Sbjct  194  A--DEDDPEEYEAEDAAQGEDGFYDKAGMRQGRGRGRGGRGRGRGQYHGQSRDGGHPIGT  251

Query  371  PQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            P    + +          V  +    PRMPDGT+GF+MGRGK
Sbjct  252  PPSNHSAE--------HPVVSKPPPGPRMPDGTKGFAMGRGK  285



>ref|XP_006467479.1| PREDICTED: la-related protein 6-like [Citrus sinensis]
Length=381

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKR  157
            + SNKLHAFVEYET+E AEKA+A LND  DWRNGL+V+ LLKR
Sbjct  217  LVSNKLHAFVEYETVEAAEKAVATLNDEQDWRNGLRVK-LLKR  258



>gb|EEE51926.1| hypothetical protein OsJ_33536 [Oryza sativa Japonica Group]
Length=470

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL  148
            R+AK D  +F+NKLHAFVEY+T+E AEKAI ELND  +WRNGL+VR L
Sbjct  244  RSAKLD-MLFANKLHAFVEYDTVEDAEKAIVELNDERNWRNGLRVRLL  290



>ref|NP_001067617.1| Os11g0248200 [Oryza sativa Japonica Group]
 dbj|BAF27980.1| Os11g0248200, partial [Oryza sativa Japonica Group]
Length=354

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL  148
            R+AK D  +F+NKLHAFVEY+T+E AEKAI ELND  +WRNGL+VR L
Sbjct  128  RSAKLD-MLFANKLHAFVEYDTVEDAEKAIVELNDERNWRNGLRVRLL  174



>gb|EEC67957.1| hypothetical protein OsI_35696 [Oryza sativa Indica Group]
Length=489

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL  148
            R+AK D  +F+NKLHAFVEY+T+E AEKAI ELND  +WRNGL+VR L
Sbjct  265  RSAKLD-MLFANKLHAFVEYDTVEDAEKAIVELNDERNWRNGLRVRLL  311



>gb|AAX96755.1| At2g43970/F6E13.10 [Oryza sativa Japonica Group]
Length=505

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL  148
            R+AK D  +F+NKLHAFVEY+T+E AEKAI ELND  +WRNGL+VR L
Sbjct  279  RSAKLD-MLFANKLHAFVEYDTVEDAEKAIVELNDERNWRNGLRVRLL  325



>ref|XP_010232344.1| PREDICTED: la-related protein 6A [Brachypodium distachyon]
Length=513

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 86/175 (49%), Gaps = 25/175 (14%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNK+HA VEYE +E+AEKA   LND  +WR G++V  L KR+   S  R +++  E+ 
Sbjct  333  MLSNKVHAVVEYEAVEVAEKAATTLNDERNWRTGMRVILLAKRSVTGSA-RHIQSSKENH  391

Query  209  ATFK----EDDMFGHKHQIssehsesqsselvgeeegekegV----WRAHNRGRGKGQAV  364
             T      ED     +  +S ++  + S E+  ++E     V     R H +   KG   
Sbjct  392  GTVSKKNNEDQSLKEQGSVSEQNGGADSGEVALDKENMNSDVNHEEVRRHQKTIAKGGQK  451

Query  365  GRPQ-----FGVNNQRG------PMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            GR +         N  G      P     + +SG     PRMPDGTRGF+MGRG+
Sbjct  452  GRYRSQGKGLIQQNTSGHGHGSFPSDSMNKPISG-----PRMPDGTRGFTMGRGR  501



>ref|XP_004486031.1| PREDICTED: la-related protein 7-like [Cicer arietinum]
Length=426

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 82/163 (50%), Gaps = 17/163 (10%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL--------LKRTAKSSTPRAL  187
             S KLHA VEYETIE AEKA+A LN+  DWRNG++V+ L         K+  K S     
Sbjct  266  ISTKLHALVEYETIEAAEKAVAMLNNEQDWRNGMRVKFLNRMGKNGHKKQAWKGSNTEKN  325

Query  188  KAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVG  367
             + H +E T  E++   H+H       E    E  GE   + +G  R + +GR +     
Sbjct  326  SSSHVAEQTRDEENHGSHEHH------EDTPKEEDGEHLPKDKGGQRYNKQGRSRKHKY-  378

Query  368  RPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            R   G+ +  G         + +    PRMPDGTRGF++GRG+
Sbjct  379  RAINGMGH--GGTSSIHTAEASKPPPGPRMPDGTRGFAIGRGR  419



>ref|XP_006848537.1| hypothetical protein AMTR_s00169p00025570 [Amborella trichopoda]
 gb|ERN10118.1| hypothetical protein AMTR_s00169p00025570 [Amborella trichopoda]
Length=394

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRAL  187
            + SNKLHA VE+ET+E AEKA+AELN+  +WR+GL+VR LL+R+ KS   R L
Sbjct  228  LVSNKLHALVEFETVEQAEKAVAELNNEKNWRSGLRVRHLLRRSPKSVRCRKL  280



>ref|XP_002313090.2| hypothetical protein POPTR_0009s10970g [Populus trichocarpa]
 gb|EEE87045.2| hypothetical protein POPTR_0009s10970g [Populus trichocarpa]
Length=419

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 94/173 (54%), Gaps = 22/173 (13%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALK  190
            AK+D  V +NKLHA VE ET ++AEKA  +LND  +WR GL+VR LL+ + KS  PR   
Sbjct  245  AKNDFFV-TNKLHALVELETRKIAEKAAEKLNDERNWRKGLRVRLLLRCSPKSVLPR---  300

Query  191  AGHESE-ATFKEDDMFGHKHQIss---ehsesqsselvgeeegekegVWRAHNRGRGKGQ  358
             G  SE   + E+D   ++  + +    +SES +     +  G  +  W A   G+GKG+
Sbjct  301  -GRRSEFDIWDEEDSPHYESTVDTFKPNNSESVTESHAEDSSGASKKAWAAKGHGKGKGR  359

Query  359  AVGRPQFGVNNQRGPMCE-QLQMVSGRQASV------PRMPDGTRGFSMGRGK  496
                    +N  RG +   +      R+AS       PRMPDGT+GF++GRGK
Sbjct  360  G------QINCSRGLLAPVKCASTPQREASAKHASKSPRMPDGTKGFNVGRGK  406



>ref|XP_011010419.1| PREDICTED: la-related protein 6A [Populus euphratica]
Length=363

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 90/167 (54%), Gaps = 13/167 (8%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALK  190
            +K+D  + S+K+HAFVEY+T+E AEKA A LN+  DWRNG++VR LL + AK    R + 
Sbjct  194  SKTD-ILISSKVHAFVEYDTVEAAEKAAATLNNEQDWRNGMRVR-LLNQMAKHGQRRQVW  251

Query  191  AGHESEATFK--EDDMFG--HKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQ  358
               +SE   K    ++ G   KH  S  H ++   E       EK G  +  NRGR +  
Sbjct  252  REPDSEKNRKGRGTNLAGDVEKHDSSEHHDDTPVEEDGEHISKEKNG-QQGGNRGRSR--  308

Query  359  AVGRPQFGVNNQRGPMCEQLQMVS-GRQASVPRMPDGTRGFSMGRGK  496
               + +F V N  G        V   +    P+MPDGTRGF++GRG+
Sbjct  309  ---KNKFRVTNGMGHGTTSYNAVELSKVPPGPKMPDGTRGFTVGRGR  352



>gb|EMS51819.1| La-related protein 7 [Triticum urartu]
Length=350

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 78/162 (48%), Gaps = 17/162 (10%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            +F+NKLHAFVEY T+E AEKA+AE +   +WR+G +VR LL    K    +  K G E  
Sbjct  189  LFANKLHAFVEYGTVEDAEKAVAEFSGGRNWRDGPRVRSLLG-CLKHGIGQGRKGGDEEA  247

Query  209  ATFKEDDMFGHKHQIsse------hsesqsselvgeeegekegVWRAHNRGRGKGQAVGR  370
            A   EDD   ++ + +S+                    G   G  + H + R  G  +G 
Sbjct  248  A--DEDDPEEYEAEDASQGEDGFYDKAGMRQGRGRGRGGRGRGRGQYHGQSRDGGHPIGT  305

Query  371  PQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            P    + +          V  +    PRMPDGT+GF+MGRGK
Sbjct  306  PPSNHSAE--------HPVVSKPPPGPRMPDGTKGFAMGRGK  339



>ref|XP_004153773.1| PREDICTED: uncharacterized protein LOC101217948, partial [Cucumis 
sativus]
Length=393

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 5/66 (8%)
 Frame = +2

Query  35   SNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA-GHESEA  211
            SNKLHA VE+ET ELAE+AI +LND  +WR GL+VRPL++R+ KS     LK    E ++
Sbjct  223  SNKLHALVEFETAELAERAIEQLNDERNWRKGLRVRPLVRRSPKS----VLKNRKSEFDS  278

Query  212  TFKEDD  229
               EDD
Sbjct  279  VLDEDD  284



>ref|XP_008439642.1| PREDICTED: la-related protein 6A [Cucumis melo]
Length=394

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL  148
            ++ KSD  + SNKLHA VEYET+E +EKA+A LND  DWRNG++V+PL
Sbjct  210  KSNKSD-VLISNKLHALVEYETLEASEKAVATLNDEQDWRNGMRVKPL  256



>dbj|BAB11080.1| unnamed protein product [Arabidopsis thaliana]
Length=411

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 84/168 (50%), Gaps = 21/168 (13%)
 Frame = +2

Query  41   KLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSST--PRALKAGHESEAT  214
            +LHAFVEYET+E AEKA A LN+  DWRNGL+V+ L +   K +   P   +   E + T
Sbjct  235  RLHAFVEYETVEAAEKAAATLNNEQDWRNGLRVKLLEQAAGKFAQRRPARREVDKEKDTT  294

Query  215  FK-EDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGVNN  391
             +  D   G K++ + EH   +        + +     +  N  +G+    GR Q   N+
Sbjct  295  GRVHDQTGGEKNKKTREHQNHRLHHSDNPADDDGGNHQKDKNGNKGRVVGQGRRQ---NH  351

Query  392  QRG-------------PMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            Q G             P    +++   ++   PRMPDGTRGF+MGRGK
Sbjct  352  QGGNGIGHGTASSSSHPNYHPVEV--SKRPPGPRMPDGTRGFTMGRGK  397



>ref|XP_004145408.1| PREDICTED: uncharacterized protein LOC101207999 [Cucumis sativus]
Length=423

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 5/66 (8%)
 Frame = +2

Query  35   SNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA-GHESEA  211
            SNKLHA VE+ET ELAE+AI +LND  +WR GL+VRPL++R+ KS     LK    E ++
Sbjct  253  SNKLHALVEFETAELAERAIEQLNDERNWRKGLRVRPLVRRSPKS----VLKNRKSEFDS  308

Query  212  TFKEDD  229
               EDD
Sbjct  309  VLDEDD  314



>gb|KGN61738.1| hypothetical protein Csa_2G235610 [Cucumis sativus]
Length=446

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 5/66 (8%)
 Frame = +2

Query  35   SNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA-GHESEA  211
            SNKLHA VE+ET ELAE+AI +LND  +WR GL+VRPL++R+ KS     LK    E ++
Sbjct  276  SNKLHALVEFETAELAERAIEQLNDERNWRKGLRVRPLVRRSPKS----VLKNRKSEFDS  331

Query  212  TFKEDD  229
               EDD
Sbjct  332  VLDEDD  337



>ref|NP_851141.1| RNA-binding protein [Arabidopsis thaliana]
 sp|Q94A38.1|LRP6A_ARATH RecName: Full=La-related protein 6A; Short=AtLARP6a [Arabidopsis 
thaliana]
 gb|AAK91419.1| AT5g46250/MPL12_3 [Arabidopsis thaliana]
 gb|AAN18157.1| At5g46250/MPL12_3 [Arabidopsis thaliana]
 gb|AED95357.1| RNA-binding protein [Arabidopsis thaliana]
Length=422

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 84/168 (50%), Gaps = 21/168 (13%)
 Frame = +2

Query  41   KLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSST--PRALKAGHESEAT  214
            +LHAFVEYET+E AEKA A LN+  DWRNGL+V+ L +   K +   P   +   E + T
Sbjct  246  RLHAFVEYETVEAAEKAAATLNNEQDWRNGLRVKLLEQAAGKFAQRRPARREVDKEKDTT  305

Query  215  FK-EDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGVNN  391
             +  D   G K++ + EH   +        + +     +  N  +G+    GR Q   N+
Sbjct  306  GRVHDQTGGEKNKKTREHQNHRLHHSDNPADDDGGNHQKDKNGNKGRVVGQGRRQ---NH  362

Query  392  QRG-------------PMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            Q G             P    +++   ++   PRMPDGTRGF+MGRGK
Sbjct  363  QGGNGIGHGTASSSSHPNYHPVEV--SKRPPGPRMPDGTRGFTMGRGK  408



>ref|XP_009609348.1| PREDICTED: la-related protein 6C-like [Nicotiana tomentosiformis]
Length=428

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 86/163 (53%), Gaps = 17/163 (10%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESEA  211
             S+KLHA +E+E  E AEKA  +LND  +WR GL+V+ LL+R+ KS     LK+    ++
Sbjct  262  ISSKLHALIEFEHPEAAEKAAEKLNDERNWRKGLRVKLLLRRSPKS----VLKS---RKS  314

Query  212  TFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGVNN  391
             F  D  F  +  ++SE ++  +     E          A  +  GKG+   R +  + N
Sbjct  315  AF--DGCFDDEDWLASELTDDSNHTNHSEIVDNNVEETLATKKTWGKGRVRARQRNQMFN  372

Query  392  QRGPMCEQLQMVSG-------RQASV-PRMPDGTRGFSMGRGK  496
             RG +    Q  S        +QA+  PRMPDGT+GF+MGRGK
Sbjct  373  GRGLLVSSPQSSSSSPFEAPLKQATKGPRMPDGTKGFTMGRGK  415



>ref|XP_004171643.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101217948 
[Cucumis sativus]
Length=429

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 5/66 (8%)
 Frame = +2

Query  35   SNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA-GHESEA  211
            SNKLHA VE+ET ELAE+AI +LND  +WR GL+VRPL++R+ KS     LK    E ++
Sbjct  259  SNKLHALVEFETAELAERAIEQLNDERNWRKGLRVRPLVRRSPKS----VLKNRKSEFDS  314

Query  212  TFKEDD  229
               EDD
Sbjct  315  VLDEDD  320



>ref|XP_008651912.1| PREDICTED: la-related protein 6C-like [Zea mays]
 tpg|DAA59328.1| TPA: hypothetical protein ZEAMMB73_430508 [Zea mays]
Length=505

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSST  175
            R +KSD T+ SNK+HA VEYET + AEKA+ +LND  +WR GL+VR +L+R+ KS T
Sbjct  279  RASKSD-TLVSNKMHALVEYETSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKSVT  334



>gb|EMS62383.1| La-related protein 7 [Triticum urartu]
Length=266

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 51/74 (69%), Gaps = 3/74 (4%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEYETIE AEKAI  LND  +WR+GL+VR  L  +  +   + 
Sbjct  166  RSAKLD-MLFANKLHAFVEYETIEDAEKAIVVLNDERNWRSGLRVR--LLNSCMAKGGKG  222

Query  185  LKAGHESEATFKED  226
             K GHE++   +ED
Sbjct  223  KKGGHETDVHGEED  236



>gb|AAK50577.1|AC084404_2 putative RNA-binding protein [Oryza sativa Japonica Group]
Length=343

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSS  172
            R++KSD+ + SNKLHA +EYET + A++A+ +LND  +WR GL+VRP+L+R+ KS+
Sbjct  246  RSSKSDALI-SNKLHALIEYETSQQADRAVDKLNDERNWRKGLRVRPVLRRSPKSA  300



>emb|CDY68074.1| BnaCnng57490D [Brassica napus]
Length=390

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 86/169 (51%), Gaps = 24/169 (14%)
 Frame = +2

Query  41   KLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSST--PRALKAGHESEAT  214
            +LHAFVEYET+E AEKA A LN+  DWRNGL+V+ LL++  K +   P   +   E + T
Sbjct  214  RLHAFVEYETVEAAEKAAATLNNEQDWRNGLRVK-LLEQAVKYAQRRPARKEVDPEKDNT  272

Query  215  FKEDDMFG---HKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQ---------  358
             +  D  G   +++    +H     S+   + +G  +   +A  RGRG+ Q         
Sbjct  273  GRVHDQTGGEENRNSNEHQHHRHHHSDTPTDNDGGDKNGNKARTRGRGRRQNHQGSNVHG  332

Query  359  --AVGRPQFGVN-NQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
                    F  N N   P+      VS R    P+MPDGTRGF+MGRGK
Sbjct  333  TSPSSSSSFHHNYNHHHPV-----EVSKRPPG-PKMPDGTRGFTMGRGK  375



>ref|XP_006646336.1| PREDICTED: la-related protein 7-like [Oryza brachyantha]
Length=398

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 88/183 (48%), Gaps = 29/183 (16%)
 Frame = +2

Query  8    TAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRAL  187
            T K+   + SNK+HA VEYET E AEKA   LND ++WR G+KVR L KR+   S     
Sbjct  213  TIKNHDIMLSNKVHALVEYETTEAAEKAATTLNDESNWRAGMKVR-LAKRSVTGS-----  266

Query  188  KAGHESEATFKEDDMFGH----KHQIss-------------ehsesqsselvgeeegeke  316
              G  ++++ +   + G     +HQ+ S             ++    S     +    ++
Sbjct  267  --GKHNQSSKENQTIQGQPSKVEHQMVSGKKGGTDSIEGVLDNENMSSDITHEDMHQHQK  324

Query  317  gVWRAHNRGRGKGQAVGRPQFGVNNQ---RGPMCEQLQMVSGRQASVPRMPDGTRGFSMG  487
               +   +GR KGQ  G+ Q   + Q     P  +    V+ +    PRMPDGTRGF+ G
Sbjct  325  VNAKGGRKGRYKGQGRGQIQQNTSGQGHGSLPAHDGFDHVN-KPIPGPRMPDGTRGFTAG  383

Query  488  RGK  496
            RGK
Sbjct  384  RGK  386



>gb|EMT07023.1| La-related protein 7 [Aegilops tauschii]
Length=397

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 51/74 (69%), Gaps = 3/74 (4%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEYETIE AEKAI  LND  +WR+GL+VR  L  +  +   + 
Sbjct  166  RSAKLD-MLFANKLHAFVEYETIEDAEKAIVVLNDERNWRSGLRVR--LLNSCMAKGGKG  222

Query  185  LKAGHESEATFKED  226
             K GHE++   +ED
Sbjct  223  KKGGHETDVHGEED  236



>tpg|DAA49246.1| TPA: hypothetical protein ZEAMMB73_519082 [Zea mays]
Length=413

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 79/183 (43%), Gaps = 50/183 (27%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK---------------  166
            F  +LHA +EYET   A++A+ +LND  +WR GL+VRP+L+R+ K               
Sbjct  237  FLTQLHALIEYETSHQADRAVDKLNDERNWRKGLRVRPVLRRSPKTVARMKRPDLDHHVA  296

Query  167  ---------SSTPRALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekeg  319
                     S +P A  A H  + T ++               E +  +    + G  + 
Sbjct  297  ASDEERVSTSDSPTATAAAHPPDNTQQQ--------------QEEEEEDQHQHQHGGAKK  342

Query  320  VWRAHNRGR----GKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMG  487
             W +  RGR        + G P   V++        L       A  PRMPDGTRGF+MG
Sbjct  343  PWGSRGRGRPPPHSSAHSAGAPGHSVDS--------LAASPRHAAQGPRMPDGTRGFTMG  394

Query  488  RGK  496
            RG+
Sbjct  395  RGR  397



>emb|CDY33465.1| BnaA06g36080D [Brassica napus]
Length=391

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 86/173 (50%), Gaps = 28/173 (16%)
 Frame = +2

Query  41   KLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESEATFK  220
            +LHAFVEYET+E AEKA A LN+  DWRNGL+V+ LL++  K +  R  +   +SE    
Sbjct  210  RLHAFVEYETVEAAEKAAATLNNEQDWRNGLRVK-LLEQAGKYAQRRPARKEVDSEKDNT  268

Query  221  ---EDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGVN-  388
                D   G +++ S+EH   +      +   + +G  +  N+ R KG+   +   G N 
Sbjct  269  GRVHDQTGGEENKNSNEHQHHRHHHHHSDTPADNDGGDKNGNKARTKGRGRRQNHQGSNG  328

Query  389  -----------------NQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
                             N   P+      VS R    P+MPDGTRGF+MGRGK
Sbjct  329  IVHGTSPSSSSSFHHNYNHHHPV-----EVSKRPPG-PKMPDGTRGFTMGRGK  375



>ref|XP_003593945.1| La-related protein [Medicago truncatula]
 gb|AES64196.1| LA-related protein 6 LA RNA-binding domain protein, putative 
[Medicago truncatula]
 gb|AFK41252.1| unknown [Medicago truncatula]
Length=406

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 81/165 (49%), Gaps = 20/165 (12%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTA----------KSSTPR  181
              +KLHA VEYETIE AEKA+A LN+  DWRNG++V+  L R A          K S   
Sbjct  245  IGSKLHALVEYETIEGAEKAVAMLNNEEDWRNGMRVK-FLSRMAVKYVQKKQPLKGSNSE  303

Query  182  ALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQA  361
               + H SE T  E++   H+H+      E       GE   + +G  R   +GR + Q 
Sbjct  304  KNGSSHVSEKTGDEENHGSHEHR------EDMPVVEDGEHVSKDKGGQRNSKQGRSRKQK  357

Query  362  VGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
              R   G+ +  G           +    P+MPDGTRGF++GRG+
Sbjct  358  Y-RATNGMGH--GGTSSIRTTEPSKPPPGPKMPDGTRGFAIGRGR  399



>ref|XP_004987293.1| PREDICTED: la-related protein 7-like [Setaria italica]
Length=470

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKS  169
            R +KSD T+ SNK+HA VEYET + AEKA+ +LND  +WR GL+VR +L+R+ KS
Sbjct  259  RASKSD-TLVSNKMHALVEYETSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKS  312



>ref|XP_010255219.1| PREDICTED: la-related protein 6C-like [Nelumbo nucifera]
Length=407

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 86/167 (51%), Gaps = 15/167 (9%)
 Frame = +2

Query  26   TVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHES  205
             + SNKLHA VEYET++ AEKA+  LND  +WR GL+VR LL+R+ +S     +K+ +  
Sbjct  232  VLISNKLHALVEYETVDQAEKAVETLNDERNWRKGLRVRLLLRRSPRS----VVKSRNYD  287

Query  206  EATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGV  385
                  DD     ++   + S+  ++E   E   E           RG+G+  GR Q   
Sbjct  288  HFDRNSDDEETPPYESLEDSSQLNNTENPMENSAEDSTTGPKKGWARGRGKPRGRTQ-SQ  346

Query  386  NNQRGPMCEQLQMVSGR----QASV------PRMPDGTRGFSMGRGK  496
            + + GP     Q  S      +A +      PRMPDGTRGF+MGRGK
Sbjct  347  SGRGGPFAPSPQSTSSSNNQPEAHIRQTPRGPRMPDGTRGFTMGRGK  393



>ref|XP_007042355.1| RNA-binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOX98186.1| RNA-binding protein, putative isoform 2 [Theobroma cacao]
Length=422

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 81/172 (47%), Gaps = 19/172 (11%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKV--------RPLLKRTAK  166
            +KSD  + + KLHA VEYE+ E+AEKA+ +LND  +WR GL+V        + +LK + K
Sbjct  253  SKSDFFMCNKKLHALVEYESTEIAEKAVDKLNDERNWRKGLRVRLLLRLSPKSVLK-SRK  311

Query  167  SSTPRALKAGHESEATFKEDDMFGHKHQ-IssehsesqsselvgeeegekegVWRAHNRG  343
            S     L       A + ED    +  + I +   +  +          +          
Sbjct  312  SEFDGILDEDESPVAEYSEDSSLSNIAEAIENNADQDNAVGSKKGWGKGRGKGRGRVQNH  371

Query  344  RGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASV-PRMPDGTRGFSMGRGK  496
             G+G     PQ G   Q    CE     S +Q S  PRMPDGTRGF+MGRGK
Sbjct  372  SGRGLIAACPQPGSAVQ----CE----ASVKQTSKGPRMPDGTRGFTMGRGK  415



>ref|XP_007042354.1| RNA-binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOX98185.1| RNA-binding protein, putative isoform 1 [Theobroma cacao]
Length=440

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 83/176 (47%), Gaps = 20/176 (11%)
 Frame = +2

Query  2    TRTAKSDSTVF-SNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKV--------RPLLK  154
            + +++S S  F  NKLHA VEYE+ E+AEKA+ +LND  +WR GL+V        + +LK
Sbjct  248  SNSSRSKSDFFMCNKLHALVEYESTEIAEKAVDKLNDERNWRKGLRVRLLLRLSPKSVLK  307

Query  155  RTAKSSTPRALKAGHESEATFKEDDMFGHKHQ-IssehsesqsselvgeeegekegVWRA  331
             + KS     L       A + ED    +  + I +   +  +          +      
Sbjct  308  -SRKSEFDGILDEDESPVAEYSEDSSLSNIAEAIENNADQDNAVGSKKGWGKGRGKGRGR  366

Query  332  HNRGRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASV-PRMPDGTRGFSMGRGK  496
                 G+G     PQ G   Q    CE     S +Q S  PRMPDGTRGF+MGRGK
Sbjct  367  VQNHSGRGLIAACPQPGSAVQ----CE----ASVKQTSKGPRMPDGTRGFTMGRGK  414



>ref|XP_007025100.1| Translation initiation factor eIF-2B subunit delta, putative 
isoform 6 [Theobroma cacao]
 gb|EOY27722.1| Translation initiation factor eIF-2B subunit delta, putative 
isoform 6 [Theobroma cacao]
Length=304

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 10/83 (12%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK---------SSTPR  181
            + S+K+HA VEYET+E AEKA+A LND  DWRNG++V+ LLKR +K          S P 
Sbjct  144  LISSKIHALVEYETVEAAEKAVATLNDEQDWRNGMRVK-LLKRVSKYGQRRQAWRGSDPE  202

Query  182  ALKAGHESEATFKEDDMFGHKHQ  250
                G  S+ T  E++    +H 
Sbjct  203  KNSTGRASDQTGDEENNTSSEHH  225



>dbj|BAJ88869.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=351

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 51/74 (69%), Gaps = 3/74 (4%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEYET+E AEKAI  LND  +WR+GL+VR  L  +  +   + 
Sbjct  130  RSAKLD-MLFANKLHAFVEYETVEDAEKAIVVLNDERNWRSGLRVR--LLNSCMAKGGKG  186

Query  185  LKAGHESEATFKED  226
             K GHE++   +ED
Sbjct  187  KKGGHETDVHGEED  200



>ref|XP_009114366.1| PREDICTED: la-related protein 6A-like isoform X2 [Brassica rapa]
Length=402

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 84/174 (48%), Gaps = 35/174 (20%)
 Frame = +2

Query  41   KLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESEATFK  220
            +LHAFVEYE++E AEKA A LN+  DWRNGL+V+ LL++T K +  R    G +   T K
Sbjct  228  RLHAFVEYESVEAAEKAAATLNNEQDWRNGLRVK-LLEQTGKFAQRR---PGRKEVDTVK  283

Query  221  ED-----DMFG---HKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQ  376
            ++     D  G   +K     +H     S+   + +   +   +  +RGRG+ Q      
Sbjct  284  DNTGQVHDQIGGEENKKSNEHQHHRHHHSDTPADNDSGDKNGNKTKSRGRGRRQ------  337

Query  377  FGVNNQRG--------------PMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
               NNQ G                     +   +    PRMPDGTRGF++GRGK
Sbjct  338  ---NNQGGNGHGSSPSTSSSLHHNYHHHHVEVSKPPPGPRMPDGTRGFTLGRGK  388



>ref|XP_002461300.1| hypothetical protein SORBIDRAFT_02g000420 [Sorghum bicolor]
 gb|EER97821.1| hypothetical protein SORBIDRAFT_02g000420 [Sorghum bicolor]
Length=516

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKS  169
            R +KSD T+ SNK+HA VEYET + AEKA+ +LND  +WR GL+VR +L+R+ KS
Sbjct  269  RASKSD-TLVSNKMHALVEYETSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKS  322



>emb|CDY03229.1| BnaC09g19270D [Brassica napus]
Length=389

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 87/172 (51%), Gaps = 29/172 (17%)
 Frame = +2

Query  41   KLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESEATFK  220
            +LHAFVEYE++E A+KA A LN+  DWRNGL+V+ LL++T K +  R    G +   T K
Sbjct  213  RLHAFVEYESVEAADKAAATLNNEQDWRNGLRVK-LLEQTGKFAQRR---PGRKEVDTVK  268

Query  221  E------DDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFG  382
            +      D + G +++ S+EH   +        +   +   +  N+ R +G+  GR Q  
Sbjct  269  DNTGQVHDQIGGEENKKSNEHQHHRHHHSDTPADNASDSGDKNGNKTRSRGR--GRRQ--  324

Query  383  VNNQRG--------PMCEQLQMVSGRQASV------PRMPDGTRGFSMGRGK  496
             NNQ G                     A V      PRMPDGTRGF++GRGK
Sbjct  325  -NNQGGNGHGSSPSTSSSLHHYYHHHHAEVSKPPPGPRMPDGTRGFTLGRGK  375



>ref|XP_002963146.1| hypothetical protein SELMODRAFT_35606, partial [Selaginella moellendorffii]
 gb|EFJ36609.1| hypothetical protein SELMODRAFT_35606, partial [Selaginella moellendorffii]
Length=270

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKR  157
            V SNKLHA VEYET+E AEKA+AEL D+ +WR+GL VR LL+R
Sbjct  226  VVSNKLHALVEYETLEQAEKAVAELTDQRNWRSGLHVRLLLRR  268



>dbj|BAK05864.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 51/74 (69%), Gaps = 3/74 (4%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEYET+E AEKAI  LND  +WR+GL+VR  L  +  +   + 
Sbjct  262  RSAKLD-MLFANKLHAFVEYETVEDAEKAIVVLNDERNWRSGLRVR--LLNSCMAKGGKG  318

Query  185  LKAGHESEATFKED  226
             K GHE++   +ED
Sbjct  319  KKGGHETDVHGEED  332



>ref|XP_004960758.1| PREDICTED: la-related protein 6-like [Setaria italica]
Length=494

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSS  172
            R+AK D  +FSNKLHAFVEYET E AEKAI  L+D  +WRNGL+VR L   +AK +
Sbjct  273  RSAKLD-MLFSNKLHAFVEYETPEDAEKAIVALSDEENWRNGLRVRLLNTCSAKGA  327



>ref|XP_002980176.1| hypothetical protein SELMODRAFT_35604, partial [Selaginella moellendorffii]
 gb|EFJ18436.1| hypothetical protein SELMODRAFT_35604, partial [Selaginella moellendorffii]
Length=270

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKR  157
            V SNKLHA VEYET+E AEKA+AEL D+ +WR+GL VR LL+R
Sbjct  226  VVSNKLHALVEYETLEQAEKAVAELTDQRNWRSGLHVRLLLRR  268



>ref|XP_006658195.1| PREDICTED: la-related protein 6-like [Oryza brachyantha]
Length=420

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKS  169
            R++KSD T+ SNK+HA VEYE+ + AEKA+ +LND  +WR GL+VR +L+R+ KS
Sbjct  239  RSSKSD-TLVSNKMHALVEYESSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKS  292



>ref|XP_002276730.2| PREDICTED: la-related protein 6A isoform X2 [Vitis vinifera]
 emb|CBI30861.3| unnamed protein product [Vitis vinifera]
Length=342

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 76/172 (44%), Gaps = 33/172 (19%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK--------------  166
            + S KLHA V+YET+E AE+A+A LN+  DWRNG++V+ L K+  K              
Sbjct  181  LISGKLHAIVDYETVEAAERAVATLNNEQDWRNGMRVKLLHKQMGKYGQRRKGWKGSDME  240

Query  167  --SSTPRALKAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNR  340
              SS   A  AG E   + +  D    +       ++ ++          +   +R  N 
Sbjct  241  KNSSVGPAHPAGDEENNSSERHDETPDEED-GEHLTKEKNGPRGRNRGRSRGQKYRCMN-  298

Query  341  GRGKGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
              G+G       +G    + P               P+MPDGTRGF+MGRG+
Sbjct  299  --GQGHGTLSSSYGAEGSKPP-------------PGPKMPDGTRGFTMGRGR  335



>ref|XP_009145827.1| PREDICTED: la-related protein 6C-like [Brassica rapa]
 emb|CDX92302.1| BnaA05g21050D [Brassica napus]
Length=443

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 86/172 (50%), Gaps = 24/172 (14%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNK+HA +EY+   +A+KA+ +LND  +WR GL+VR LL+ + KS     LK     +
Sbjct  273  LMSNKIHALIEYDHTVVADKAVEKLNDERNWRKGLRVRLLLRCSPKS----VLKHRRNFD  328

Query  209  ATFKEDDMFGHKHQIssehsesqsselvgeeegekegVW------------RAHNRGRGK  352
                +D+      + S     ++       +E    G+W            R++  G G+
Sbjct  329  GILIDDESPYESGEDSPRLHLTEHQLDNEGDENTLGGLWGKGRGKGRGRSPRSYVVGGGE  388

Query  353  GQAVGRPQFGVNNQRGPMCEQLQM---VSGRQASV-PRMPDGTRGFSMGRGK  496
             ++ G    G+    GPM   L +    S + A+  PRMPDGTRGF+MGRGK
Sbjct  389  -RSFG---IGMGLSLGPMSPSLGLHGSSSPKTATKGPRMPDGTRGFTMGRGK  436



>emb|CDX99268.1| BnaC05g33830D [Brassica napus]
Length=444

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 86/172 (50%), Gaps = 24/172 (14%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNK+HA +EY+   +A+KA+ +LND  +WR GL+VR LL+ + KS     LK     +
Sbjct  274  LMSNKIHALIEYDHTVVADKAVEKLNDERNWRKGLRVRLLLRCSPKS----VLKHRRNFD  329

Query  209  ATFKEDDMFGHKHQIssehsesqsselvgeeegekegVW------------RAHNRGRGK  352
                +D+      + S     ++       +E    G+W            R++  G G+
Sbjct  330  GILIDDESPYESGEDSPRLHLTEHQLDNEGDENTLGGLWGKGRGKGRGRSPRSYVVGGGE  389

Query  353  GQAVGRPQFGVNNQRGPMCEQLQM---VSGRQASV-PRMPDGTRGFSMGRGK  496
             ++ G    G+    GPM   L +    S + A+  PRMPDGTRGF+MGRGK
Sbjct  390  -RSFG---IGMGLSLGPMSPSLGLHGSSSPKTATKGPRMPDGTRGFTMGRGK  437



>ref|XP_008667400.1| PREDICTED: uncharacterized protein LOC100217316 isoform X1 [Zea 
mays]
 tpg|DAA41896.1| TPA: hypothetical protein ZEAMMB73_789693 [Zea mays]
Length=470

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 3/76 (4%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEY+TIE A +AI ELND  +WR+GL+VR  L  T  +   + 
Sbjct  253  RSAKLD-MLFANKLHAFVEYDTIEDAARAIVELNDERNWRSGLRVR--LLSTCMTKGGKG  309

Query  185  LKAGHESEATFKEDDM  232
             K GHES+    E+++
Sbjct  310  KKGGHESDGYGDEENV  325



>tpg|DAA41895.1| TPA: hypothetical protein ZEAMMB73_789693 [Zea mays]
Length=355

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 3/76 (4%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEY+TIE A +AI ELND  +WR+GL+VR  L  T  +   + 
Sbjct  253  RSAKLD-MLFANKLHAFVEYDTIEDAARAIVELNDERNWRSGLRVR--LLSTCMTKGGKG  309

Query  185  LKAGHESEATFKEDDM  232
             K GHES+    E+++
Sbjct  310  KKGGHESDGYGDEENV  325



>ref|NP_001058684.1| Os07g0102500 [Oryza sativa Japonica Group]
 dbj|BAD31839.1| putative RNA-binding protein homolog [Oryza sativa Japonica Group]
 dbj|BAF20598.1| Os07g0102500 [Oryza sativa Japonica Group]
 dbj|BAG94768.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94554.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81373.1| hypothetical protein OsI_24577 [Oryza sativa Indica Group]
Length=438

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKS  169
            R +KSD T+ SNK+HA VEYE+ + AEKA+ +LND  +WR GL+VR +L+R+ KS
Sbjct  248  RASKSD-TLVSNKMHALVEYESSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKS  301



>ref|XP_007025095.1| Translation initiation factor eIF-2B subunit delta, putative 
isoform 1 [Theobroma cacao]
 gb|EOY27717.1| Translation initiation factor eIF-2B subunit delta, putative 
isoform 1 [Theobroma cacao]
Length=387

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 10/83 (12%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK---------SSTPR  181
            + S+K+HA VEYET+E AEKA+A LND  DWRNG++V+ LLKR +K          S P 
Sbjct  227  LISSKIHALVEYETVEAAEKAVATLNDEQDWRNGMRVK-LLKRVSKYGQRRQAWRGSDPE  285

Query  182  ALKAGHESEATFKEDDMFGHKHQ  250
                G  S+ T  E++    +H 
Sbjct  286  KNSTGRASDQTGDEENNTSSEHH  308



>ref|XP_007147895.1| hypothetical protein PHAVU_006G164000g [Phaseolus vulgaris]
 gb|ESW19889.1| hypothetical protein PHAVU_006G164000g [Phaseolus vulgaris]
Length=395

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK  166
            + SNKLHA VEYETIE AEKA+A LN+  DWRNG++V+ LLKR  K
Sbjct  232  LISNKLHALVEYETIEAAEKAVAMLNNEKDWRNGMQVK-LLKRMGK  276



>ref|XP_003577639.1| PREDICTED: la-related protein 6B [Brachypodium distachyon]
Length=488

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 51/74 (69%), Gaps = 3/74 (4%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEY+TI+ AEKAI  LND  +WR+GL+VR  L  T  +   + 
Sbjct  271  RSAKLD-MLFANKLHAFVEYDTIDGAEKAIVVLNDERNWRSGLRVR--LLNTCMAKGGKG  327

Query  185  LKAGHESEATFKED  226
             K GHE++   +ED
Sbjct  328  RKGGHETDGHGEED  341



>ref|XP_007025097.1| Translation initiation factor eIF-2B subunit delta, putative 
isoform 3 [Theobroma cacao]
 gb|EOY27719.1| Translation initiation factor eIF-2B subunit delta, putative 
isoform 3 [Theobroma cacao]
Length=336

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK  166
            + S+K+HA VEYET+E AEKA+A LND  DWRNG++V+ LLKR +K
Sbjct  227  LISSKIHALVEYETVEAAEKAVATLNDEQDWRNGMRVK-LLKRVSK  271



>gb|AFW56663.1| hypothetical protein ZEAMMB73_374856 [Zea mays]
Length=382

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK  166
            R++K D  +F+NKLHAFVEYET E A KAI ELND  +WRNGL+VR L   T K
Sbjct  271  RSSKLD-MLFANKLHAFVEYETPEDAAKAILELNDEKNWRNGLRVRLLNTCTVK  323



>gb|KHG30828.1| La-related 7 [Gossypium arboreum]
Length=368

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK  166
            +T ++D  + S+KLHA VEYETIE AEKA+A LND +DWRNG+ V+ LL+R  K
Sbjct  200  KTGRAD-ILISSKLHALVEYETIEAAEKAVATLNDEHDWRNGMHVK-LLERKGK  251



>gb|ACR36891.1| unknown [Zea mays]
 gb|AFW56662.1| RNA binding protein [Zea mays]
Length=490

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSS  172
            R++K D  +F+NKLHAFVEYET E A KAI ELND  +WRNGL+VR L   T K +
Sbjct  271  RSSKLD-MLFANKLHAFVEYETPEDAAKAILELNDEKNWRNGLRVRLLNTCTVKGA  325



>ref|NP_001148460.1| LOC100282075 [Zea mays]
 gb|ACG31573.1| RNA binding protein [Zea mays]
Length=490

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSS  172
            R++K D  +F+NKLHAFVEYET E A KAI ELND  +WRNGL+VR L   T K +
Sbjct  271  RSSKLD-MLFANKLHAFVEYETPEDAAKAILELNDEKNWRNGLRVRLLNTCTVKGA  325



>gb|KFK43639.1| hypothetical protein AALP_AA1G152700 [Arabis alpina]
Length=399

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 83/169 (49%), Gaps = 23/169 (14%)
 Frame = +2

Query  41   KLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRAL---------KA  193
            +LHAFVEYET+E AEKA + LN+  DWRNGL+V+ LL++T K +  R           K 
Sbjct  222  RLHAFVEYETVEAAEKAASTLNNDQDWRNGLRVK-LLEQTGKFAQKRPAKKEVDVEKDKI  280

Query  194  GHESEATFKEDDMFGHKHQIssehsesqssel--------vgeeegekegVWRAHNRGRG  349
            G   + T  E++   ++HQ   ++  +  ++          G   G   G  + H  G G
Sbjct  281  GRVHDRTGGEENKKANEHQHHRQYHSNTLADEDGGHLNGNKGRGRGRGRGRQQNHQGGNG  340

Query  350  KGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
             G A        +N      E    VS R    P+MPDGTRGF+ GRGK
Sbjct  341  HGTAPAASSSSHHNHNHHPVE----VSKRPPG-PKMPDGTRGFTTGRGK  384



>ref|XP_007025098.1| Translation initiation factor eIF-2B subunit delta, putative 
isoform 4, partial [Theobroma cacao]
 gb|EOY27720.1| Translation initiation factor eIF-2B subunit delta, putative 
isoform 4, partial [Theobroma cacao]
Length=353

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +2

Query  26   TVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK  166
             + S+K+HA VEYET+E AEKA+A LND  DWRNG++V+ LLKR +K
Sbjct  257  ILISSKIHALVEYETVEAAEKAVATLNDEQDWRNGMRVK-LLKRVSK  302



>emb|CDY35155.1| BnaA09g17920D [Brassica napus]
Length=391

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 83/165 (50%), Gaps = 17/165 (10%)
 Frame = +2

Query  41   KLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESEATFK  220
            +LHAFVEYE++E AEKA A LN+  DWRNGL+V+ LL++T K +  R    G +   T K
Sbjct  217  RLHAFVEYESVEAAEKAAATLNNEQDWRNGLRVK-LLEQTGKFAQRR---PGRKEVDTVK  272

Query  221  ED-----DMFG---HKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQ-AVGRP  373
            ++     D  G   +K     +H     S+   + +   +   +  +RGRG+ Q   G  
Sbjct  273  DNTGQVHDQIGGEENKKSNEHQHHRHHHSDTPADNDSGDKNGNKTKSRGRGRRQNNQGGN  332

Query  374  QFGVNNQRGPMCEQLQMVSGRQASVP----RMPDGTRGFSMGRGK  496
              G +                + S P    RMPDGTRGF++GRGK
Sbjct  333  GHGSSPSTSSSLHHNYHHHHVEVSKPPPGPRMPDGTRGFTLGRGK  377



>gb|AGT16157.1| hypothetical protein SHCRBa_167_G07_R_10 [Saccharum hybrid cultivar 
R570]
Length=305

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL  148
            R+AK D  +F+NKLHAFVEY+TIE A +AI ELND  +WR+GL+VR L
Sbjct  251  RSAKLD-MLFANKLHAFVEYDTIEDAARAIVELNDERNWRSGLRVRLL  297



>gb|KFK39252.1| hypothetical protein AALP_AA3G220100 [Arabis alpina]
Length=455

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 81/169 (48%), Gaps = 17/169 (10%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNK+HA +EY+   +A+KA+ +LND  +WR GL+VR LL+ + KS     LK     +
Sbjct  284  LMSNKIHALIEYDNTVIADKAVEKLNDERNWRKGLRVRLLLRCSPKS----VLKNRRNFD  339

Query  209  ATFKEDDMFGHKH-QIssehsesqsselvgeeegekegVWRAHNRG------RGKGQAVG  367
                +D+   ++  + S     ++       ++    G+W            R    A G
Sbjct  340  GLLIDDETPSYESGEDSPRLHLTEQQLDNDVDDNNVGGLWGKGRGKGRGRSPRSYAVAGG  399

Query  368  RPQFGVN-----NQRGPMCEQLQMVSGRQASV-PRMPDGTRGFSMGRGK  496
               FG+          P   Q +  S + A+  PRMPDGT+GF+MGRGK
Sbjct  400  GRSFGIGLGLSLGSMSPSLGQHESSSPKTATKGPRMPDGTKGFTMGRGK  448



>gb|AES90236.2| LA-related protein 6 LA RNA-binding domain protein [Medicago 
truncatula]
Length=404

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 79/169 (47%), Gaps = 25/169 (15%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNKLHA VEYE+ ++A+KA+ +LND  +WR G++VR LL+      +P+++    +SE
Sbjct  238  LISNKLHALVEYESSDVADKAVEKLNDERNWRKGMRVRLLLR-----CSPKSVLKNRKSE  292

Query  209  AT-FKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGV  385
               + +DD   H          + +   V     E          G  KG   GR +   
Sbjct  293  FDGYLDDDENLHSETAEDSSHPNNTELCVESNGDETSV-------GSKKGWTRGRGKGRG  345

Query  386  NNQR-------GPMCEQLQMVSGR-----QASVPRMPDGTRGFSMGRGK  496
              Q         P      +V G       A  PRMPDGTRGF++GRGK
Sbjct  346  RTQNHTGRGLLAPPSPSSSVVLGEVSTKPNAKGPRMPDGTRGFAIGRGK  394



>ref|XP_002449258.1| hypothetical protein SORBIDRAFT_05g006890 [Sorghum bicolor]
 gb|EES08246.1| hypothetical protein SORBIDRAFT_05g006890 [Sorghum bicolor]
Length=481

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 4/75 (5%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRA  184
            R+AK D  +F+NKLHAFVEY++IE A +AI ELND  +WR+GL+VR  L  T  +   + 
Sbjct  254  RSAKLD-MLFANKLHAFVEYDSIEDAARAIVELNDERNWRSGLRVR--LLSTCMTKGGKG  310

Query  185  LKAGHESEATFKEDD  229
             K GHES+  + ED+
Sbjct  311  KKGGHESDG-YGEDE  324



>ref|XP_010481476.1| PREDICTED: la-related protein 6A-like isoform X2 [Camelina sativa]
Length=424

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 79/169 (47%), Gaps = 23/169 (14%)
 Frame = +2

Query  41   KLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESEATFK  220
            +LHAFVEYET+E AE A A LN+  DWRNGL+V+ LL++      P   +   + + T +
Sbjct  247  RLHAFVEYETVEAAEIAAATLNNEQDWRNGLRVK-LLEQAFAQRRPARREVDKDKDTTGR  305

Query  221  EDDMFG------------HKHQIssehses-----qsselvgeeegekegVWRAHNRGRG  349
              D  G            H+H  S   ++      Q  +   +  G  +G  + H  G G
Sbjct  306  VHDQIGEEKNKKTREHQPHRHHHSDNPADDDGGNHQKEKNGNKGRGGGQGRRQNHQGGNG  365

Query  350  KGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
             G          ++      E    VS R    PRMPDGTRGF+MGRGK
Sbjct  366  FGHGTAPSTSSSSHHNHHPIE----VSKRPPG-PRMPDGTRGFTMGRGK  409



>ref|XP_010559250.1| PREDICTED: la-related protein 6A isoform X2 [Tarenaya hassleriana]
Length=396

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + S +LHAFVEYET+E AEKA A LN+  DWRNGL+VR LLK+  K    R ++   E+E
Sbjct  220  MISTRLHAFVEYETVEAAEKAAATLNNEQDWRNGLRVR-LLKQAGKYGQRRQVRRETETE  278

Query  209  A  211
            +
Sbjct  279  S  279



>ref|XP_008667401.1| PREDICTED: uncharacterized protein LOC100217316 isoform X2 [Zea 
mays]
Length=468

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL  148
            R+AK D  +F+NKLHAFVEY+TIE A +AI ELND  +WR+GL+VR L
Sbjct  253  RSAKLD-MLFANKLHAFVEYDTIEDAARAIVELNDERNWRSGLRVRLL  299



>ref|XP_003574867.1| PREDICTED: la-related protein 6B-like [Brachypodium distachyon]
Length=407

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 78/166 (47%), Gaps = 19/166 (11%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            +F+N+LHAFVEYET+E AE+A+AE N   +WR+G +VR LL    K    +  K G E  
Sbjct  241  LFANRLHAFVEYETVEAAERAVAEFNGGRNWRDGPRVRSLLG-VLKHGMGQGKKGGDEEA  299

Query  209  ATFKEDDMFGHKHQIssehsesqss----------elvgeeegekegVWRAHNRGRGKGQ  358
            A   + D  GH  +  +E +                      G   G  + H + R    
Sbjct  300  AEEDDPDTTGHPQEYETEDAAQAEDGFYDKAGMRIGRGRGRGGRGRGRGQYHGQSRDGDH  359

Query  359  AVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
             +G P    +++          V  +    PRMPDGT+GF+MGRGK
Sbjct  360  PIGTPPSNHSSEHS--------VVPKPPPGPRMPDGTKGFTMGRGK  397



>ref|XP_010238604.1| PREDICTED: la-related protein 6B-like [Brachypodium distachyon]
Length=475

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    RTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPL  148
            R+AK D  +F+NKLHAFVEYET E AEKA  ELND  +WRNGL+VR L
Sbjct  257  RSAKLD-MLFANKLHAFVEYETREDAEKASLELNDERNWRNGLRVRLL  303



>gb|ADE76238.1| unknown [Picea sitchensis]
Length=465

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK  166
             S+KLHA VEYET+E AEKA+A+LND  +WR+GL+V+ LLKR  K
Sbjct  292  VSSKLHALVEYETVEQAEKAVADLNDGGNWRSGLQVQLLLKRMGK  336



>ref|XP_006480245.1| PREDICTED: la-related protein 7-like [Citrus sinensis]
Length=424

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKS  169
            AKSD  V SNKLHA VEYE+ ++AEKA+ +LND  +WR GL+VR LL+ + KS
Sbjct  254  AKSDFFV-SNKLHALVEYESTDIAEKAVEKLNDERNWRKGLRVRVLLRCSPKS  305



>ref|NP_001136552.1| uncharacterized protein LOC100216671 [Zea mays]
 gb|ACF82158.1| unknown [Zea mays]
Length=437

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 80/178 (45%), Gaps = 21/178 (12%)
 Frame = +2

Query  8    TAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRAL  187
            TAK      S K H  VEYE +E AEKA+  L+D ++WR G+KVR L K++         
Sbjct  254  TAKKPDFNLSFKAHVLVEYEAVEAAEKAVTALSDESNWRTGMKVRLLSKQSVMGPGKYKK  313

Query  188  KAGHESEATFKEDDMFGHKHQIssehsesqsselvgeeegekegV------------WRA  331
             +    +A  K  D   H  +   +  E  S         +++ +             + 
Sbjct  314  PSKENQDAVSKMIDQNQHSKEDQLKTLEKISGADAVGITKDRDNLKPVFITETEHQDQKP  373

Query  332  HNRGRG---KGQAVGRPQFGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
            + RGR    KGQ  G+ Q   N Q     E L     +  S PRMPDGTRGF++GRG+
Sbjct  374  NARGRKGWYKGQ--GQMQQNANKQGSCGSESL----NKPISGPRMPDGTRGFTLGRGR  425



>gb|ADE76297.1| unknown [Picea sitchensis]
Length=461

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK  166
             S+KLHA VEYET+E AEKA+A+LND  +WR+GL+V+ LLKR  K
Sbjct  288  VSSKLHALVEYETVEQAEKAVADLNDGGNWRSGLQVQLLLKRMGK  332



>ref|XP_009408806.1| PREDICTED: la-related protein 6C-like [Musa acuminata subsp. 
malaccensis]
Length=421

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +2

Query  8    TAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRAL  187
            ++KSD  + +NKLHA VEYE+ E AEKA+ +LND  +WR GL+VR +L+ + KS   R+ 
Sbjct  241  SSKSD-VLINNKLHALVEYESTEQAEKAVEKLNDERNWRKGLRVRTMLRCSPKSVI-RSK  298

Query  188  KAGHESEATFKEDD  229
            K   +    + EDD
Sbjct  299  KLDFDHFDLYAEDD  312



>gb|KDO49150.1| hypothetical protein CISIN_1g046325mg, partial [Citrus sinensis]
Length=442

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKS  169
            AKSD  V SNKLHA VEYE+ ++AEKA+ +LND  +WR GL+VR LL+ + KS
Sbjct  274  AKSDFFV-SNKLHALVEYESTDIAEKAVEKLNDERNWRKGLRVRVLLRCSPKS  325



>gb|KDP37969.1| hypothetical protein JCGZ_04612 [Jatropha curcas]
Length=397

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 2/52 (4%)
 Frame = +2

Query  11   AKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAK  166
            +K+D  + S+KLHA VEY+T+E AEKA+A LN+  DWRNGL+V+ LLKR  K
Sbjct  227  SKAD-VLISSKLHALVEYDTVEAAEKAVATLNNEQDWRNGLRVK-LLKRMGK  276



>ref|XP_008236634.1| PREDICTED: la-related protein 6C isoform X1 [Prunus mume]
Length=401

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 80/160 (50%), Gaps = 8/160 (5%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKAGHESE  208
            + SNKLHA VEYET ++AE+A+A+L+D  +WR GL+VR LL+R+ KS     LK      
Sbjct  238  IISNKLHALVEYETTDIAERAVAKLSDEGNWRKGLRVRLLLRRSPKS----VLKNRKSDF  293

Query  209  ATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQ----  376
                EDD   +     +    +         E       +    GRGK +  G+ Q    
Sbjct  294  DGILEDDEPQYDCAEETSQPSNPELVTDSPNEENLAASKKGWAWGRGKARGRGQGQSGRG  353

Query  377  FGVNNQRGPMCEQLQMVSGRQASVPRMPDGTRGFSMGRGK  496
                + +     Q +  + + A  PRMPDGTRGF+MGRGK
Sbjct  354  LIAPSPQSSNTIQCEAPAKQNAKGPRMPDGTRGFTMGRGK  393



>gb|EPS72682.1| hypothetical protein M569_02071, partial [Genlisea aurea]
Length=320

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    TRTAKSDSTVFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLK  154
            ++T K D    + KLH FVEY++ E AEKA+ ELND  +WRNGLKVR LLK
Sbjct  253  SKTPKGDGLNLNGKLHTFVEYKSAEEAEKAVMELNDDGNWRNGLKVRLLLK  303



>ref|XP_007025101.1| Translation initiation factor eIF-2B subunit delta, putative 
isoform 7 [Theobroma cacao]
 gb|EOY27723.1| Translation initiation factor eIF-2B subunit delta, putative 
isoform 7 [Theobroma cacao]
Length=297

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +2

Query  29   VFSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTA-KSSTPRALKAGHES  205
            + S+K+HA VEYET+E AEKA+A LND  DWRNG++ +   +R A + S P     G  S
Sbjct  144  LISSKIHALVEYETVEAAEKAVATLNDEQDWRNGMRSKYGQRRQAWRGSDPEKNSTGRAS  203

Query  206  EATFKEDDMFGHKHQ  250
            + T  E++    +H 
Sbjct  204  DQTGDEENNTSSEHH  218



>ref|XP_006346524.1| PREDICTED: uncharacterized protein LOC102603710 [Solanum tuberosum]
Length=396

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 83/165 (50%), Gaps = 30/165 (18%)
 Frame = +2

Query  32   FSNKLHAFVEYETIELAEKAIAELNDRNDWRNGLKVRPLLKRTAKSSTPRALKA-GHESE  208
             SNKLHA +E+E  E AE+A+ +LND  +WR GL+VR LL+R+ KS     LK    E E
Sbjct  239  ISNKLHALIEFENPEAAERAVEKLNDERNWRKGLRVRLLLRRSPKS----ILKIRKCEFE  294

Query  209  ATFKEDDMFGHKHQIssehsesqsselvgeeegekegVWRAHNRGRGKGQAVGRPQFGVN  388
              F ++D    +                   E       +A N+GRGK +   RPQ  ++
Sbjct  295  GCFDDEDGLPSEDS------------DSNNVEDGVGSAKKAWNKGRGKLRM--RPQ--IH  338

Query  389  NQRGPMCEQLQMVSG--------RQASV-PRMPDGTRGFSMGRGK  496
              RG +    Q  S         RQ +  PRMPDGTRGF+MGRGK
Sbjct  339  GGRGLLAALPQSSSSSGLGEGPVRQVTKGPRMPDGTRGFTMGRGK  383



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1499838010448