BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22246_g2_i1 len=437 path=[5571:0-229 3412:230-275 5844:276-303
4688:304-341 5909:342-436]

Length=437
                                                                      Score     E

ref|XP_010316153.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  67.8    3e-10   
ref|XP_006354167.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  67.8    3e-10   
ref|XP_004228597.2|  PREDICTED: DNA (cytosine-5)-methyltransferas...  67.8    3e-10   
ref|XP_007208072.1|  hypothetical protein PRUPE_ppa001672mg           66.6    8e-10   
ref|XP_008226363.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  66.6    9e-10   
ref|NP_001289523.1|  DNA (cytosine-5)-methyltransferase CMT3-like     66.2    1e-09   
emb|CDN40870.1|  chromomethylase                                      66.2    1e-09   
gb|AGH70220.1|  chromomethylase 3                                     66.2    1e-09   
ref|XP_009590684.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  66.2    1e-09   
ref|XP_010651344.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  65.5    2e-09   
ref|XP_009625628.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  65.1    3e-09   
ref|XP_009625627.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  65.1    3e-09   
emb|CBI16477.3|  unnamed protein product                              65.1    3e-09   
emb|CAS84142.1|  chromomethylase                                      63.9    4e-09   Nicotiana tomentosiformis
ref|XP_004288717.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  64.3    5e-09   
emb|CAQ18903.1|  chromomethylase                                      63.2    9e-09   Nicotiana sylvestris
emb|CDP13153.1|  unnamed protein product                              63.5    9e-09   
gb|AIO05713.1|  CMT-type DNA-methyltransferase                        63.2    9e-09   
ref|XP_009781267.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.2    1e-08   
ref|XP_009781266.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.2    1e-08   
ref|XP_009781265.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.2    1e-08   
ref|XP_009781264.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.2    1e-08   
gb|AFK80345.1|  chromomethylase 3                                     63.2    1e-08   
ref|XP_006662134.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.2    1e-08   
ref|XP_009390335.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.2    1e-08   
ref|XP_009390334.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.2    1e-08   
ref|XP_009390332.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.2    1e-08   
ref|XP_004983483.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.2    1e-08   
ref|XP_010936992.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.2    1e-08   
gb|ABW96889.1|  CMT-type DNA-methyltransferase                        63.2    1e-08   Elaeis guineensis
ref|XP_008797880.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.2    1e-08   
ref|XP_002530367.1|  protein with unknown function                    62.8    1e-08   Ricinus communis
gb|AGT16212.1|  methyltransferase                                     62.4    2e-08   
emb|CAQ18901.1|  chromomethylase                                      60.8    2e-08   Nicotiana sylvestris
ref|XP_003636958.1|  DNA (cytosine-5)-methyltransferase               62.0    2e-08   
gb|KEH27061.1|  DNA (cytosine-5)-methyltransferase CMT3-like protein  62.0    2e-08   
ref|XP_004252840.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  62.0    3e-08   
gb|KEH27609.1|  DNA (cytosine-5)-methyltransferase CMT3-like protein  62.0    3e-08   
ref|XP_003612312.1|  DNA (cytosine-5)-methyltransferase               62.0    3e-08   
ref|XP_009364101.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  62.0    3e-08   
gb|AFV99137.1|  CMT-type cytosine DNA-methyltransferase 3c            62.0    3e-08   
ref|XP_009364100.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  62.0    3e-08   
ref|XP_010236739.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  61.6    3e-08   
gb|KHN41840.1|  DNA (cytosine-5)-methyltransferase 1                  61.6    4e-08   
ref|XP_006590741.1|  PREDICTED: putative DNA (cytosine-5)-methylt...  61.6    4e-08   
ref|XP_007157973.1|  hypothetical protein PHAVU_002G113900g           61.6    4e-08   
emb|CAJ01708.1|  chromomethylase 1                                    61.2    4e-08   Hordeum vulgare [barley]
ref|XP_010673524.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  61.6    4e-08   
ref|XP_010091206.1|  DNA (cytosine-5)-methyltransferase 1             61.2    4e-08   
ref|XP_010533849.1|  PREDICTED: putative DNA (cytosine-5)-methylt...  61.2    4e-08   
ref|XP_004170052.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  61.2    4e-08   
gb|EMS51591.1|  DNA (cytosine-5)-methyltransferase 1                  61.2    5e-08   
ref|XP_006573534.1|  PREDICTED: putative DNA (cytosine-5)-methylt...  61.2    5e-08   
ref|XP_004512254.1|  PREDICTED: putative DNA (cytosine-5)-methylt...  61.2    5e-08   
ref|XP_004149031.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  61.2    5e-08   
ref|XP_008451103.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  61.2    5e-08   
gb|EMT24338.1|  DNA (cytosine-5)-methyltransferase 1                  60.8    7e-08   
gb|AAL75761.1|  Putative DNA cytosine methyltransferase MET2a         60.8    7e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454088.1|  hypothetical protein SORBIDRAFT_04g024430        60.8    7e-08   Sorghum bicolor [broomcorn]
pdb|4FT2|A  Chain A, Crystal Structure Of Zea Mays Zmet2 In Compl...  60.8    7e-08   
gb|KEH25929.1|  DNA (cytosine-5)-methyltransferase CMT1               60.8    7e-08   
tpg|DAA36033.1|  TPA: hypothetical protein ZEAMMB73_314017            60.8    7e-08   
gb|EEE50451.1|  hypothetical protein OsJ_30466                        60.8    8e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70797.1|  hypothetical protein OsI_02246                        60.8    8e-08   Oryza sativa Indica Group [Indian rice]
dbj|BAH37019.1|  chromomethylase OsMET2a                              60.8    8e-08   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001104978.1|  DNA (cytosine-5)-methyltransferase 1             60.8    8e-08   Zea mays [maize]
ref|XP_002448525.1|  hypothetical protein SORBIDRAFT_06g028430        60.8    8e-08   Sorghum bicolor [broomcorn]
gb|KDO62937.1|  hypothetical protein CISIN_1g047980mg                 60.5    8e-08   
ref|NP_001105167.1|  DNA (cytosine-5)-methyltransferase 3             60.8    8e-08   Zea mays [maize]
gb|AFW59438.1|  DNA (cytosine-5)-methyltransferase 1                  60.8    8e-08   
sp|Q8LPU5.1|CMT3_MAIZE  RecName: Full=DNA (cytosine-5)-methyltran...  60.8    8e-08   Zea mays [maize]
ref|XP_006445885.1|  hypothetical protein CICLE_v10014232mg           60.5    8e-08   
ref|NP_001275877.1|  DNA (cytosine-5)-methyltransferase CMT3-like     60.5    8e-08   
emb|CBI29991.3|  unnamed protein product                              60.5    9e-08   
ref|XP_002275932.1|  PREDICTED: putative DNA (cytosine-5)-methylt...  60.5    9e-08   Vitis vinifera
ref|XP_006849583.1|  hypothetical protein AMTR_s00024p00193220        60.1    1e-07   
ref|XP_009376742.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  60.1    1e-07   
ref|XP_008390169.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  60.1    1e-07   
ref|NP_001280801.1|  DNA (cytosine-5)-methyltransferase CMT3          60.1    1e-07   
gb|AIU80190.1|  chromomethylase                                       60.1    1e-07   
gb|KDP34481.1|  hypothetical protein JCGZ_12764                       60.1    1e-07   
gb|EYU39242.1|  hypothetical protein MIMGU_mgv1a001319mg              59.7    1e-07   
dbj|BAC53936.1|  chromomethylase-like protein                         59.7    1e-07   Nicotiana tabacum [American tobacco]
ref|XP_010234610.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  59.7    2e-07   
ref|XP_010230204.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  59.7    2e-07   
dbj|BAH37020.1|  chromomethylase OsMET2b                              59.3    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011037979.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  59.3    2e-07   
ref|XP_011037978.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  59.3    2e-07   
ref|XP_002299134.2|  hypothetical protein POPTR_0001s04700g           59.3    2e-07   Populus trichocarpa [western balsam poplar]
gb|EEE58631.1|  hypothetical protein OsJ_09996                        59.3    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KCW85898.1|  hypothetical protein EUGRSUZ_B02615                   58.9    3e-07   
gb|EEC74798.1|  hypothetical protein OsI_10599                        59.3    3e-07   Oryza sativa Indica Group [Indian rice]
gb|AAN60988.1|  Putative DNA cytosine methyltransferase MET2a         59.3    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010243384.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  58.9    3e-07   
ref|XP_010243382.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  58.9    3e-07   
ref|XP_010043881.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  58.9    3e-07   
ref|XP_010541913.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  58.5    3e-07   
gb|KHN40382.1|  DNA (cytosine-5)-methyltransferase 1                  58.5    4e-07   
ref|XP_006572936.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  58.5    4e-07   
ref|XP_007014767.1|  Chromomethylase 3, putative isoform 2            58.2    4e-07   
ref|XP_007014771.1|  Chromomethylase 1, putative isoform 6            58.2    5e-07   
ref|XP_007014770.1|  Chromomethylase 1, putative isoform 5            58.2    5e-07   
ref|XP_007014769.1|  Chromomethylase 1, putative isoform 4            58.2    5e-07   
ref|XP_007014766.1|  Chromomethylase 1, putative isoform 1            58.2    5e-07   
ref|XP_007014768.1|  Chromomethylase 1, putative isoform 3            58.2    5e-07   
gb|EPS58007.1|  chromomethylase                                       57.4    7e-07   
ref|XP_004513047.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  57.8    7e-07   
ref|XP_004513046.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  57.8    7e-07   
ref|XP_010666617.1|  PREDICTED: putative DNA (cytosine-5)-methylt...  57.4    8e-07   
gb|EMT27177.1|  DNA (cytosine-5)-methyltransferase 1                  57.4    8e-07   
ref|XP_002990857.1|  hypothetical protein SELMODRAFT_132507           57.4    8e-07   
ref|XP_011089105.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  57.4    8e-07   
gb|ABB46585.2|  DNA cytosine methyltransferase MET2a, putative, e...  56.6    9e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KDP44326.1|  hypothetical protein JCGZ_19193                       57.4    9e-07   
gb|KEH28933.1|  DNA (cytosine-5)-methyltransferase CMT1               57.4    1e-06   
ref|XP_007152976.1|  hypothetical protein PHAVU_004G176100g           57.0    1e-06   
ref|NP_001064023.1|  Os10g0104900                                     56.6    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002974335.1|  hypothetical protein SELMODRAFT_30570            57.0    1e-06   
ref|XP_007152975.1|  hypothetical protein PHAVU_004G176100g           57.0    1e-06   
ref|XP_006854149.1|  hypothetical protein AMTR_s00048p00181490        57.0    1e-06   
ref|XP_004293200.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  56.6    1e-06   
gb|KEH27204.1|  DNA (cytosine-5)-methyltransferase CMT3-like protein  56.6    1e-06   
ref|XP_004987095.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...  56.6    2e-06   
ref|XP_010243148.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  56.6    2e-06   
gb|EMT16647.1|  DNA (cytosine-5)-methyltransferase 2                  56.2    2e-06   
ref|NP_001049442.2|  Os03g0226800                                     53.1    2e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AAB95486.1|  chromomethylase                                       55.8    2e-06   Arabidopsis arenosa
ref|XP_008238301.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  55.8    3e-06   
ref|XP_006417360.1|  hypothetical protein EUTSA_v10006850mg           55.8    3e-06   
ref|XP_007210636.1|  hypothetical protein PRUPE_ppa019831mg           55.8    3e-06   
ref|XP_006390678.1|  hypothetical protein EUTSA_v10018159mg           55.8    3e-06   
ref|XP_006599217.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  55.5    3e-06   
gb|KHN10109.1|  DNA (cytosine-5)-methyltransferase CMT2               55.5    4e-06   
ref|XP_006599216.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  55.5    4e-06   
ref|XP_006599215.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  55.5    4e-06   
ref|NP_001266791.1|  uncharacterized protein LOC101027213             54.7    4e-06   
gb|AEC12443.1|  chromomethylase 3                                     55.5    4e-06   
ref|XP_010908353.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  55.5    4e-06   
gb|AAC02665.1|  chromomethylase                                       55.1    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAC02667.1|  chromomethylase                                       55.1    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010110416.1|  DNA (cytosine-5)-methyltransferase CMT2          55.5    4e-06   
ref|XP_008790945.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  55.5    4e-06   
gb|AAA98912.1|  theoretical protein with similarity to Swiss-Prot...  55.1    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28331.1|  chromomethylase                                       55.1    4e-06   
gb|AAC02662.1|  chromomethylase                                       55.1    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAC02670.1|  chromomethylase                                       55.1    4e-06   Arabidopsis suecica
ref|NP_565245.1|  chromomethylase 1                                   55.1    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAB95485.1|  chromomethylase                                       55.1    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAC02663.1|  chromomethylase                                       55.1    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006470820.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  55.1    4e-06   
ref|XP_006431407.1|  hypothetical protein CICLE_v10000251mg           55.1    4e-06   
ref|XP_010662142.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  55.1    5e-06   
ref|XP_010662140.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  55.1    5e-06   
ref|XP_001769709.1|  predicted protein                                55.1    5e-06   
emb|CBI26560.3|  unnamed protein product                              55.1    5e-06   
ref|XP_002889276.1|  hypothetical protein ARALYDRAFT_895912           55.1    5e-06   
ref|XP_010662139.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  55.1    5e-06   
ref|XP_009148471.1|  PREDICTED: putative DNA (cytosine-5)-methylt...  55.1    5e-06   
emb|CDX97957.1|  BnaA06g07080D                                        55.1    5e-06   
emb|CDY19364.1|  BnaC05g08730D                                        55.1    5e-06   
emb|CBI37413.3|  unnamed protein product                              54.7    5e-06   
gb|ACX83573.1|  DNA chromomethylase                                   54.7    5e-06   Hieracium piloselloides
ref|XP_011075808.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  54.7    6e-06   
ref|XP_011075807.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  54.7    6e-06   
ref|XP_010665041.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  54.7    6e-06   
ref|XP_004509555.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  54.7    6e-06   
ref|XP_010665035.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  54.7    6e-06   
ref|XP_010665031.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  54.7    6e-06   
gb|KFK30827.1|  hypothetical protein AALP_AA6G031000                  54.7    7e-06   
gb|KEH20304.1|  DNA (cytosine-5)-methyltransferase                    54.7    7e-06   
ref|XP_010429915.1|  PREDICTED: putative DNA (cytosine-5)-methylt...  53.9    1e-05   
ref|XP_010429914.1|  PREDICTED: putative DNA (cytosine-5)-methylt...  53.9    1e-05   
ref|XP_010677408.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.9    1e-05   
ref|XP_010677407.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.9    1e-05   
ref|XP_006300613.1|  hypothetical protein CARUB_v10019805mg           53.9    1e-05   
ref|XP_009392768.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.9    1e-05   
ref|XP_009392766.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.9    1e-05   
ref|XP_010677406.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.9    1e-05   
ref|XP_010054090.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.9    1e-05   
ref|XP_011092593.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.9    1e-05   
gb|KDO42579.1|  hypothetical protein CISIN_1g0039741mg                53.1    1e-05   
ref|XP_004960650.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.9    1e-05   
ref|XP_004960649.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.9    1e-05   
ref|XP_007041239.1|  Chromomethylase 1, putative                      53.5    1e-05   
ref|XP_010054093.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.9    1e-05   
ref|XP_008346523.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.5    1e-05   
ref|XP_008373678.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.5    1e-05   
ref|XP_009373520.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.5    2e-05   
ref|XP_009785637.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.1    2e-05   
ref|XP_009625195.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.1    2e-05   
ref|XP_008448611.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.1    2e-05   
dbj|BAH37021.1|  chromomethylase OsMET2c                              53.1    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004301642.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.1    2e-05   
gb|KGN55702.1|  hypothetical protein Csa_3G006640                     53.1    2e-05   
ref|XP_004146191.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.1    2e-05   
ref|XP_008448610.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.1    2e-05   
ref|XP_010324482.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.1    2e-05   
ref|XP_006361281.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.1    2e-05   
gb|EEE62800.1|  hypothetical protein OsJ_17603                        53.1    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78738.1|  hypothetical protein OsI_18945                        53.1    2e-05   Oryza sativa Indica Group [Indian rice]
gb|AEP33250.1|  CMT-type DNA-methyltransferase                        52.8    3e-05   
ref|XP_002888734.1|  chromomethylase CMT3                             52.8    3e-05   
ref|XP_007040779.1|  DNA-methyltransferase CMT2                       52.4    3e-05   
ref|XP_003615342.1|  DNA (cytosine-5)-methyltransferase               52.4    4e-05   
ref|XP_007156278.1|  hypothetical protein PHAVU_003G273100g           52.4    4e-05   
gb|AHB20162.1|  DNA methyltransferase                                 52.0    4e-05   
gb|AHB20163.1|  DNA methyltransferase                                 52.0    4e-05   
ref|XP_002519960.1|  protein with unknown function                    52.0    4e-05   Ricinus communis
ref|XP_006385690.1|  hypothetical protein POPTR_0003s09920g           52.0    4e-05   
ref|XP_011028082.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.0    4e-05   
ref|XP_011028081.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.0    4e-05   
ref|XP_011028080.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.0    4e-05   
emb|CDP11756.1|  unnamed protein product                              52.0    5e-05   
emb|CAA16759.1|  putative protein                                     52.0    5e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAK69757.1|AF383171_1  chromomethylase CMT2                        52.0    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870005.1|  chromomethylase 2                                52.0    5e-05   
ref|XP_006282433.1|  hypothetical protein CARUB_v10003999mg           52.0    5e-05   
ref|NP_193637.2|  chromomethylase 2                                   52.0    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449422.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.0    5e-05   
ref|XP_002886525.1|  predicted protein                                51.6    6e-05   
gb|EPS64010.1|  cytosine-specific methyltransferase                   51.2    6e-05   
gb|AAL28119.1|AF433678_1  putative chromomethylase MTH1               48.5    6e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006432634.1|  hypothetical protein CICLE_v100004871mg          51.2    7e-05   
gb|KHG22889.1|  DNA (cytosine-5)-methyltransferase 1                  50.8    7e-05   
gb|KFK28574.1|  chromomethylase 2                                     51.2    8e-05   
gb|EYU22416.1|  hypothetical protein MIMGU_mgv1a001955mg              51.2    8e-05   
ref|XP_006414021.1|  hypothetical protein EUTSA_v10024250mg           51.2    8e-05   
ref|XP_002439474.1|  hypothetical protein SORBIDRAFT_09g007390        51.2    8e-05   Sorghum bicolor [broomcorn]
ref|XP_006471441.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  51.2    9e-05   
ref|XP_006655109.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  50.8    1e-04   
ref|XP_009150572.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  50.8    1e-04   
emb|CDY08836.1|  BnaA06g23880D                                        50.8    1e-04   
dbj|BAF34637.1|  chromomethylase                                      50.8    1e-04   Brassica rapa
emb|CDY14524.1|  BnaC03g49350D                                        50.8    1e-04   
ref|XP_009378155.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  50.4    1e-04   
ref|XP_010671153.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  50.4    1e-04   
ref|XP_010470978.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  50.1    2e-04   
ref|XP_010470977.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  50.1    2e-04   
ref|XP_010415637.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  50.1    2e-04   
ref|XP_010415636.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  50.1    2e-04   
ref|XP_006300392.1|  hypothetical protein CARUB_v10019778mg           50.1    2e-04   
ref|NP_177135.1|  DNA (cytosine-5)-methyltransferase CMT3             50.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01425.1|  putative chromomethylase                             50.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAK71870.1|  chromomethylase 3                                     50.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAK69756.1|AF383170_1  chromomethylase CMT3                        50.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
pdb|4FSX|A  Chain A, Crystal Structure Of Se-Substituted Zea Mays...  49.7    2e-04   
emb|CDX78915.1|  BnaA01g09820D                                        49.7    2e-04   
ref|XP_009132479.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  49.7    2e-04   
ref|XP_009132470.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  49.7    2e-04   
emb|CDX99400.1|  BnaC01g11520D                                        49.7    2e-04   
gb|AFU50364.1|  CMT3                                                  48.1    3e-04   
ref|XP_010518849.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  49.3    3e-04   
ref|XP_010518848.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  49.3    3e-04   
ref|XP_010518846.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  49.3    3e-04   
gb|EMT31695.1|  DNA (cytosine-5)-methyltransferase 1                  48.5    4e-04   



>ref|XP_010316153.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1 isoform X2 [Solanum 
lycopersicum]
Length=744

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQAR+GMMVAGAYG PQFRMRVFMW
Sbjct  435  VGMNYQARMGMMVAGAYGLPQFRMRVFMW  463



>ref|XP_006354167.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Solanum 
tuberosum]
Length=854

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQAR+GMMVAGAYG PQFRMRVFMW
Sbjct  544  VGMNYQARMGMMVAGAYGLPQFRMRVFMW  572



>ref|XP_004228597.2| PREDICTED: DNA (cytosine-5)-methyltransferase 1 isoform X1 [Solanum 
lycopersicum]
Length=855

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQAR+GMMVAGAYG PQFRMRVFMW
Sbjct  546  VGMNYQARMGMMVAGAYGLPQFRMRVFMW  574



>ref|XP_007208072.1| hypothetical protein PRUPE_ppa001672mg [Prunus persica]
 gb|EMJ09271.1| hypothetical protein PRUPE_ppa001672mg [Prunus persica]
Length=782

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            VGMNYQAR+GMM AGAYG PQFRMR+FMW    T R
Sbjct  465  VGMNYQARMGMMAAGAYGLPQFRMRMFMWGARPTER  500



>ref|XP_008226363.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Prunus mume]
Length=869

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            VGMNYQAR+GMM AGAYG PQFRMR+FMW    T R
Sbjct  552  VGMNYQARMGMMAAGAYGLPQFRMRMFMWGARPTER  587



>ref|NP_001289523.1| DNA (cytosine-5)-methyltransferase CMT3-like [Nicotiana sylvestris]
 emb|CDN40871.1| chromomethylase [Nicotiana sylvestris]
Length=901

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQAR+GMM AGAYG PQFRMRVFMW
Sbjct  597  VGMNYQARMGMMAAGAYGLPQFRMRVFMW  625



>emb|CDN40870.1| chromomethylase [Nicotiana sylvestris]
Length=901

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQAR+GMM AGAYG PQFRMRVFMW
Sbjct  597  VGMNYQARMGMMAAGAYGLPQFRMRVFMW  625



>gb|AGH70220.1| chromomethylase 3, partial [Nicotiana benthamiana]
Length=901

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQAR+GMM AGAYG PQFRMRVFMW
Sbjct  597  VGMNYQARMGMMAAGAYGLPQFRMRVFMW  625



>ref|XP_009590684.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Nicotiana 
tomentosiformis]
Length=903

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQAR+GMM AGAYG PQFRMRVFMW
Sbjct  599  VGMNYQARMGMMAAGAYGLPQFRMRVFMW  627



>ref|XP_010651344.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Vitis vinifera]
Length=965

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEF  338
            +GMNYQ R+GMM AGAYG PQFRMRVFMW   F
Sbjct  646  IGMNYQTRMGMMAAGAYGLPQFRMRVFMWGARF  678



>ref|XP_009625628.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=820

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQAR+GMMVAGAYG PQFR RVFMW
Sbjct  513  VGMNYQARMGMMVAGAYGLPQFRRRVFMW  541



>ref|XP_009625627.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=856

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQAR+GMMVAGAYG PQFR RVFMW
Sbjct  549  VGMNYQARMGMMVAGAYGLPQFRRRVFMW  577



>emb|CBI16477.3| unnamed protein product [Vitis vinifera]
Length=821

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEF  338
            +GMNYQ R+GMM AGAYG PQFRMRVFMW   F
Sbjct  502  IGMNYQTRMGMMAAGAYGLPQFRMRVFMWGARF  534



>emb|CAS84142.1| chromomethylase [Nicotiana tomentosiformis]
Length=500

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQAR+GMMVAGAYG PQFR RVFMW
Sbjct  245  VGMNYQARMGMMVAGAYGLPQFRRRVFMW  273



>ref|XP_004288717.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Fragaria 
vesca subsp. vesca]
Length=965

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 38/63 (60%), Gaps = 10/63 (16%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRS--NYSVNLHH-------PIRWSS  284
            V MNYQAR+GMM AGAYG PQFRMRVF+W G   + S   + +  H        PI+W  
Sbjct  648  VKMNYQARMGMMCAGAYGLPQFRMRVFLW-GALPTESLPQFPLPTHDVVFKGQIPIKWEQ  706

Query  283  ICL  275
             C+
Sbjct  707  SCV  709



>emb|CAQ18903.1| chromomethylase [Nicotiana sylvestris]
 emb|CAQ18904.1| chromomethylase [Nicotiana sylvestris]
 emb|CAQ18905.1| chromomethylase [Nicotiana sylvestris]
 emb|CAQ18906.1| chromomethylase [Nicotiana sylvestris]
Length=741

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQ R+GMMVAGAYG PQFR RVFMW
Sbjct  434  VGMNYQTRMGMMVAGAYGLPQFRRRVFMW  462



>emb|CDP13153.1| unnamed protein product [Coffea canephora]
Length=887

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            + MNYQARLGMM AGAYG PQFRMRVFMW
Sbjct  572  LAMNYQARLGMMAAGAYGLPQFRMRVFMW  600



>gb|AIO05713.1| CMT-type DNA-methyltransferase, partial [Cocos nucifera]
Length=579

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMMVAG YG PQFRMRVF+W
Sbjct  519  VAMNYQARLGMMVAGCYGLPQFRMRVFLW  547



>ref|XP_009781267.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X4 [Nicotiana sylvestris]
Length=859

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQ R+GMMVAGAYG PQFR RVFMW
Sbjct  606  VGMNYQTRMGMMVAGAYGLPQFRRRVFMW  634



>ref|XP_009781266.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X3 [Nicotiana sylvestris]
Length=871

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQ R+GMMVAGAYG PQFR RVFMW
Sbjct  564  VGMNYQTRMGMMVAGAYGLPQFRRRVFMW  592



>ref|XP_009781265.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Nicotiana sylvestris]
Length=907

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQ R+GMMVAGAYG PQFR RVFMW
Sbjct  600  VGMNYQTRMGMMVAGAYGLPQFRRRVFMW  628



>ref|XP_009781264.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Nicotiana sylvestris]
Length=913

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQ R+GMMVAGAYG PQFR RVFMW
Sbjct  606  VGMNYQTRMGMMVAGAYGLPQFRRRVFMW  634



>gb|AFK80345.1| chromomethylase 3 [Nicotiana benthamiana]
Length=740

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGM+YQAR+GMMVAGAYG PQFR RVFMW
Sbjct  433  VGMDYQARMGMMVAGAYGLPQFRRRVFMW  461



>ref|XP_006662134.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Oryza brachyantha]
Length=827

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMMVAG YG PQFRMRVF+W
Sbjct  497  VAMNYQARLGMMVAGCYGLPQFRMRVFLW  525



>ref|XP_009390335.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=873

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMMVAG YG PQFRMRVF+W
Sbjct  564  VAMNYQARLGMMVAGCYGLPQFRMRVFLW  592



>ref|XP_009390334.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=875

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMMVAG YG PQFRMRVF+W
Sbjct  564  VAMNYQARLGMMVAGCYGLPQFRMRVFLW  592



>ref|XP_009390332.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=885

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMMVAG YG PQFRMRVF+W
Sbjct  564  VAMNYQARLGMMVAGCYGLPQFRMRVFLW  592



>ref|XP_004983483.1| PREDICTED: DNA (cytosine-5)-methyltransferase 3-like [Setaria 
italica]
Length=915

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMMVAG YG PQFRMRVF+W
Sbjct  586  VAMNYQARLGMMVAGCYGLPQFRMRVFLW  614



>ref|XP_010936992.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Elaeis 
guineensis]
Length=925

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMMVAG YG PQFRMRVF+W
Sbjct  602  VAMNYQARLGMMVAGCYGLPQFRMRVFLW  630



>gb|ABW96889.1| CMT-type DNA-methyltransferase [Elaeis guineensis]
Length=925

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMMVAG YG PQFRMRVF+W
Sbjct  602  VAMNYQARLGMMVAGCYGLPQFRMRVFLW  630



>ref|XP_008797880.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Phoenix 
dactylifera]
Length=928

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMMVAG YG PQFRMRVF+W
Sbjct  605  VAMNYQARLGMMVAGCYGLPQFRMRVFLW  633



>ref|XP_002530367.1| protein with unknown function [Ricinus communis]
 gb|EEF32028.1| protein with unknown function [Ricinus communis]
Length=845

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            + MNYQARLGMM AG+YG PQFRMRVFMW
Sbjct  534  ISMNYQARLGMMAAGSYGLPQFRMRVFMW  562



>gb|AGT16212.1| methyltransferase [Saccharum hybrid cultivar R570]
Length=811

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMMVAG YG PQFRMRVF+W
Sbjct  515  VAMNYQARLGMMVAGCYGLPQFRMRVFLW  543



>emb|CAQ18901.1| chromomethylase [Nicotiana sylvestris]
Length=308

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 33/46 (72%), Gaps = 3/46 (7%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR--SNYSVNLH  305
            VGMNYQAR+GMM AGAYG PQFRMRVFMW G  +S     Y +  H
Sbjct  4    VGMNYQARMGMMAAGAYGLPQFRMRVFMW-GALSSEKLPQYPLPTH  48



>ref|XP_003636958.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|KEH21528.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=827

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 35/63 (56%), Gaps = 18/63 (29%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRSNYSVNLHHPIRWSSICLLDGY*L  257
            V MNYQAR+GMM AG+YG PQFRMRVF+W G  T+                   L  Y L
Sbjct  508  VAMNYQARMGMMAAGSYGLPQFRMRVFLW-GALTTEK-----------------LPSYPL  549

Query  256  PTH  248
            PTH
Sbjct  550  PTH  552



>gb|KEH27061.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=835

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR-SNYSVNLHHPIRWSSI  281
            V MNYQAR+GMM AG+YG PQFRMRVF+W    T +  +Y +  H  +  S I
Sbjct  516  VAMNYQARMGMMAAGSYGLPQFRMRVFLWGALATEKLPSYPLPTHEVVSRSVI  568



>ref|XP_004252840.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Solanum lycopersicum]
Length=933

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQAR+GMM AGAYG PQFRMRVFM+
Sbjct  627  VGMNYQARMGMMAAGAYGLPQFRMRVFMF  655



>gb|KEH27609.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=830

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR-SNYSVNLHHPIRWSSI  281
            V MNYQAR+GMM AG+YG PQFRMRVF+W    T +  +Y +  H  +  S I
Sbjct  512  VAMNYQARMGMMAAGSYGLPQFRMRVFLWGALATEKLPSYPLPTHKVVSRSVI  564



>ref|XP_003612312.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|AES95270.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=835

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR-SNYSVNLHHPIRWSSI  281
            V MNYQAR+GMM AG+YG PQFRMRVF+W    T +  +Y +  H  +  S I
Sbjct  517  VAMNYQARMGMMAAGSYGLPQFRMRVFLWGALATEKLPSYPLPTHKVVSRSVI  569



>ref|XP_009364101.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Pyrus x bretschneideri]
Length=945

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQAR+GMM AGAYG PQFRMRVF+W
Sbjct  628  VDMNYQARMGMMAAGAYGLPQFRMRVFLW  656



>gb|AFV99137.1| CMT-type cytosine DNA-methyltransferase 3c [Malus domestica]
Length=974

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQAR+GMM AGAYG PQFRMRVF+W
Sbjct  677  VDMNYQARMGMMAAGAYGLPQFRMRVFLW  705



>ref|XP_009364100.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Pyrus x bretschneideri]
Length=1023

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQAR+GMM AGAYG PQFRMRVF+W
Sbjct  706  VDMNYQARMGMMAAGAYGLPQFRMRVFLW  734



>ref|XP_010236739.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Brachypodium 
distachyon]
Length=897

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V +NYQARLGMMVAG YG PQFRMRVF+W
Sbjct  567  VALNYQARLGMMVAGCYGLPQFRMRVFLW  595



>gb|KHN41840.1| DNA (cytosine-5)-methyltransferase 1 [Glycine soja]
Length=823

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQAR+GMM AG+YG PQFRMRVF+W    T +
Sbjct  501  VAMNYQARMGMMAAGSYGLPQFRMRVFLWGARPTEK  536



>ref|XP_006590741.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1-like 
[Glycine max]
Length=832

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQAR+GMM AG+YG PQFRMRVF+W    T +
Sbjct  510  VAMNYQARMGMMAAGSYGLPQFRMRVFLWGARPTEK  545



>ref|XP_007157973.1| hypothetical protein PHAVU_002G113900g [Phaseolus vulgaris]
 gb|ESW29967.1| hypothetical protein PHAVU_002G113900g [Phaseolus vulgaris]
Length=838

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQAR+GMM AG+YG PQFRMRVF+W    T +
Sbjct  515  VAMNYQARMGMMAAGSYGLPQFRMRVFLWGARPTEK  550



>emb|CAJ01708.1| chromomethylase 1 [Hordeum vulgare subsp. vulgare]
Length=735

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V +NYQARLGMMVAG YG PQFRMRVF+W
Sbjct  404  VSLNYQARLGMMVAGCYGLPQFRMRVFLW  432



>ref|XP_010673524.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Beta vulgaris 
subsp. vulgaris]
Length=868

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQAR+GMM AGAYG PQFRMRVF+W
Sbjct  550  VDMNYQARMGMMAAGAYGLPQFRMRVFIW  578



>ref|XP_010091206.1| DNA (cytosine-5)-methyltransferase 1 [Morus notabilis]
 gb|EXB43461.1| DNA (cytosine-5)-methyltransferase 1 [Morus notabilis]
Length=851

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 35/63 (56%), Gaps = 18/63 (29%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRSNYSVNLHHPIRWSSICLLDGY*L  257
            V MNYQAR+GMM AGAYG PQFRMRVF+W               HP+       L  Y L
Sbjct  530  VSMNYQARIGMMPAGAYGVPQFRMRVFLWGA-------------HPLE-----RLPQYPL  571

Query  256  PTH  248
            PTH
Sbjct  572  PTH  574



>ref|XP_010533849.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Tarenaya 
hassleriana]
Length=799

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQ RLGMM AG+YG PQFRMRVF+W  + T +
Sbjct  481  VSMNYQTRLGMMAAGSYGLPQFRMRVFLWGAQPTEK  516



>ref|XP_004170052.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like, partial 
[Cucumis sativus]
Length=753

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + MNYQ R+GMM AGAYG PQFRMR+FMW  + T +
Sbjct  434  ISMNYQVRMGMMAAGAYGLPQFRMRMFMWGAQPTEK  469



>gb|EMS51591.1| DNA (cytosine-5)-methyltransferase 1 [Triticum urartu]
Length=758

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V +NYQARLGMMVAG YG PQFRMRVF+W
Sbjct  404  VSLNYQARLGMMVAGCYGLPQFRMRVFLW  432



>ref|XP_006573534.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1-like 
[Glycine max]
 gb|KHN35974.1| DNA (cytosine-5)-methyltransferase 3 [Glycine soja]
Length=833

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQAR+GMM AG+YG PQFRMRVF+W
Sbjct  512  VAMNYQARMGMMAAGSYGLPQFRMRVFLW  540



>ref|XP_004512254.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1-like 
[Cicer arietinum]
Length=882

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQAR+GMM AG+YG PQFRMRVF+W
Sbjct  498  VAMNYQARMGMMAAGSYGLPQFRMRVFLW  526



>ref|XP_004149031.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Cucumis 
sativus]
 gb|KGN66422.1| hypothetical protein Csa_1G604080 [Cucumis sativus]
Length=855

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + MNYQ R+GMM AGAYG PQFRMR+FMW  + T +
Sbjct  536  ISMNYQVRMGMMAAGAYGLPQFRMRMFMWGAQPTEK  571



>ref|XP_008451103.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Cucumis melo]
Length=859

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + MNYQ R+GMM AGAYG PQFRMR+FMW  + T +
Sbjct  540  ISMNYQVRMGMMAAGAYGLPQFRMRMFMWGAQPTEK  575



>gb|EMT24338.1| DNA (cytosine-5)-methyltransferase 1 [Aegilops tauschii]
Length=826

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V +NYQARLGMMVAG YG PQFRMRVF+W
Sbjct  524  VSLNYQARLGMMVAGCYGLPQFRMRVFLW  552



>gb|AAL75761.1| Putative DNA cytosine methyltransferase MET2a [Oryza sativa Japonica 
Group]
Length=719

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  555  VAMKYQARLGMMVAGCYGLPQFRMRVFLW  583



>ref|XP_002454088.1| hypothetical protein SORBIDRAFT_04g024430 [Sorghum bicolor]
 gb|EES07064.1| hypothetical protein SORBIDRAFT_04g024430 [Sorghum bicolor]
Length=770

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  588  VAMKYQARLGMMVAGCYGLPQFRMRVFLW  616



>pdb|4FT2|A Chain A, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-15)k9me2 
Peptide And Sah
 pdb|4FT2|B Chain B, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-15)k9me2 
Peptide And Sah
 pdb|4FT4|B Chain B, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 
Peptide And Sah
 pdb|4FT4|A Chain A, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 
Peptide And Sah
Length=784

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  453  VAMKYQARLGMMVAGCYGLPQFRMRVFLW  481



>gb|KEH25929.1| DNA (cytosine-5)-methyltransferase CMT1 [Medicago truncatula]
Length=843

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQAR+GMM AG YG PQFRMRVF+W
Sbjct  524  VAMNYQARMGMMAAGCYGLPQFRMRVFLW  552



>tpg|DAA36033.1| TPA: hypothetical protein ZEAMMB73_314017 [Zea mays]
Length=849

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  585  VAMKYQARLGMMVAGCYGLPQFRMRVFLW  613



>gb|EEE50451.1| hypothetical protein OsJ_30466 [Oryza sativa Japonica Group]
Length=907

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  577  VAMKYQARLGMMVAGCYGLPQFRMRVFLW  605



>gb|EEC70797.1| hypothetical protein OsI_02246 [Oryza sativa Indica Group]
Length=907

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  577  VAMKYQARLGMMVAGCYGLPQFRMRVFLW  605



>dbj|BAH37019.1| chromomethylase OsMET2a [Oryza sativa Japonica Group]
Length=907

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  577  VAMKYQARLGMMVAGCYGLPQFRMRVFLW  605



>ref|NP_001104978.1| DNA (cytosine-5)-methyltransferase 1 [Zea mays]
 sp|Q9AXT8.1|CMT1_MAIZE RecName: Full=DNA (cytosine-5)-methyltransferase 1; AltName: 
Full=Chromomethylase 1; AltName: Full=DNA cytosine methyltransferase 
MET2a; AltName: Full=Zea methyltransferase2; Short=Zmet2 
[Zea mays]
 gb|AAK11516.1|AF243043_1 DNA cytosine methyltransferase MET2a [Zea mays]
 gb|ACX48824.1| chromomethylase [Zea mays]
Length=912

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  581  VAMKYQARLGMMVAGCYGLPQFRMRVFLW  609



>ref|XP_002448525.1| hypothetical protein SORBIDRAFT_06g028430 [Sorghum bicolor]
 gb|EES12853.1| hypothetical protein SORBIDRAFT_06g028430 [Sorghum bicolor]
Length=913

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  583  VAMKYQARLGMMVAGCYGLPQFRMRVFLW  611



>gb|KDO62937.1| hypothetical protein CISIN_1g047980mg, partial [Citrus sinensis]
Length=718

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + MNYQ R+GMM AGAYG PQFRMRVF+W  + T +
Sbjct  596  IQMNYQVRMGMMAAGAYGLPQFRMRVFLWGAQPTEK  631



>ref|NP_001105167.1| DNA (cytosine-5)-methyltransferase 3 [Zea mays]
 sp|Q9ARI6.1|CMT2_MAIZE RecName: Full=DNA (cytosine-5)-methyltransferase 2; AltName: 
Full=Chromomethylase 2; AltName: Full=DNA cytosine methyltransferase 
MET5; AltName: Full=Zea methyltransferase5; Short=Zmet5 
[Zea mays]
 gb|AAK15805.1| chromomethylase [Zea mays]
Length=915

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  585  VAMKYQARLGMMVAGCYGLPQFRMRVFLW  613



>gb|AFW59438.1| DNA (cytosine-5)-methyltransferase 1 [Zea mays]
Length=915

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  584  VAMKYQARLGMMVAGCYGLPQFRMRVFLW  612



>sp|Q8LPU5.1|CMT3_MAIZE RecName: Full=DNA (cytosine-5)-methyltransferase 3; AltName: 
Full=Chromomethylase 3; AltName: Full=DNA methyltransferase 
105 [Zea mays]
 gb|AAM28227.1| DNA methyltransferase 105 [Zea mays]
 tpg|DAA36032.1| TPA: DNA (cytosine-5)-methyltransferase 2 [Zea mays]
Length=915

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  585  VAMKYQARLGMMVAGCYGLPQFRMRVFLW  613



>ref|XP_006445885.1| hypothetical protein CICLE_v10014232mg [Citrus clementina]
 gb|ESR59125.1| hypothetical protein CICLE_v10014232mg [Citrus clementina]
Length=869

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + MNYQ R+GMM AGAYG PQFRMRVF+W  + T +
Sbjct  552  IQMNYQVRMGMMAAGAYGLPQFRMRVFLWGAQPTEK  587



>ref|NP_001275877.1| DNA (cytosine-5)-methyltransferase CMT3-like [Citrus sinensis]
 gb|AGU16982.1| CMT-type DNA-methyltransferase [Citrus sinensis]
Length=869

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + MNYQ R+GMM AGAYG PQFRMRVF+W  + T +
Sbjct  552  IQMNYQVRMGMMAAGAYGLPQFRMRVFLWGAQPTEK  587



>emb|CBI29991.3| unnamed protein product [Vitis vinifera]
Length=827

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 35/63 (56%), Gaps = 18/63 (29%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRSNYSVNLHHPIRWSSICLLDGY*L  257
            V MNYQARLGMM AG+YG PQ+RMRVF+W               HP+       L  Y L
Sbjct  507  VSMNYQARLGMMAAGSYGVPQYRMRVFLWGA-------------HPME-----KLPPYPL  548

Query  256  PTH  248
            PTH
Sbjct  549  PTH  551



>ref|XP_002275932.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Vitis 
vinifera]
Length=829

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 35/63 (56%), Gaps = 18/63 (29%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRSNYSVNLHHPIRWSSICLLDGY*L  257
            V MNYQARLGMM AG+YG PQ+RMRVF+W               HP+       L  Y L
Sbjct  509  VSMNYQARLGMMAAGSYGVPQYRMRVFLWGA-------------HPME-----KLPPYPL  550

Query  256  PTH  248
            PTH
Sbjct  551  PTH  553



>ref|XP_006849583.1| hypothetical protein AMTR_s00024p00193220 [Amborella trichopoda]
 gb|ERN11164.1| hypothetical protein AMTR_s00024p00193220 [Amborella trichopoda]
Length=884

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQARLGMM AG YG PQFR+RVF+W  + T +
Sbjct  561  VHMNYQARLGMMAAGCYGLPQFRLRVFLWGAQPTEK  596



>ref|XP_009376742.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Pyrus 
x bretschneideri]
Length=989

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQ R+GMM AGAYG PQFRMRVF+W
Sbjct  672  VDMNYQVRMGMMAAGAYGLPQFRMRVFLW  700



>ref|XP_008390169.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Malus domestica]
Length=1077

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQ R+GMM AGAYG PQFRMRVF+W
Sbjct  630  VDMNYQVRMGMMAAGAYGLPQFRMRVFLW  658



>ref|NP_001280801.1| DNA (cytosine-5)-methyltransferase CMT3 [Malus domestica]
 gb|AFV99136.1| CMT-type cytosine DNA-methyltransferase 3b [Malus domestica]
Length=1096

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQ R+GMM AGAYG PQFRMRVF+W
Sbjct  649  VDMNYQVRMGMMAAGAYGLPQFRMRVFLW  677



>gb|AIU80190.1| chromomethylase [Hevea brasiliensis]
Length=851

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 35/63 (56%), Gaps = 18/63 (29%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRSNYSVNLHHPIRWSSICLLDGY*L  257
            + MNYQARLG+M AG+YG PQFRMRVF+W               HP+       L  Y L
Sbjct  528  ISMNYQARLGIMAAGSYGLPQFRMRVFLWGS-------------HPLE-----SLPQYPL  569

Query  256  PTH  248
            PTH
Sbjct  570  PTH  572



>gb|KDP34481.1| hypothetical protein JCGZ_12764 [Jatropha curcas]
Length=848

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 35/63 (56%), Gaps = 18/63 (29%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRSNYSVNLHHPIRWSSICLLDGY*L  257
            + MNYQARLG+M AG+YG PQFRMRVF+W               HP+       L  Y L
Sbjct  526  INMNYQARLGIMAAGSYGLPQFRMRVFLWGS-------------HPLE-----SLPQYPL  567

Query  256  PTH  248
            PTH
Sbjct  568  PTH  570



>gb|EYU39242.1| hypothetical protein MIMGU_mgv1a001319mg [Erythranthe guttata]
Length=841

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + M+YQAR+GMM AGAYG PQFRMR+FMW    T R
Sbjct  524  LSMDYQARMGMMAAGAYGLPQFRMRMFMWGALPTER  559



>dbj|BAC53936.1| chromomethylase-like protein [Nicotiana tabacum]
Length=741

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQAR+GMMVAGAYG PQFR R  MW
Sbjct  434  VGMNYQARMGMMVAGAYGLPQFRRRASMW  462



>ref|XP_010234610.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Brachypodium 
distachyon]
Length=894

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V +NYQARLG+MVAG YG PQFRMRVF+W
Sbjct  564  VSLNYQARLGIMVAGCYGLPQFRMRVFLW  592



>ref|XP_010230204.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Brachypodium 
distachyon]
Length=956

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGM+VAG YG PQFRMR F+W
Sbjct  628  VAMNYQARLGMIVAGCYGLPQFRMRAFLW  656



>dbj|BAH37020.1| chromomethylase OsMET2b [Oryza sativa Japonica Group]
Length=690

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMM AG YG PQFRMR F+W
Sbjct  418  VAMNYQARLGMMAAGYYGLPQFRMRAFLW  446



>ref|XP_011037979.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 isoform X2 
[Populus euphratica]
Length=951

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGM+ AGAYG PQFRMRVF+W
Sbjct  642  VSMKYQARLGMLAAGAYGLPQFRMRVFLW  670



>ref|XP_011037978.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 isoform X1 
[Populus euphratica]
Length=966

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGM+ AGAYG PQFRMRVF+W
Sbjct  657  VSMKYQARLGMLAAGAYGLPQFRMRVFLW  685



>ref|XP_002299134.2| hypothetical protein POPTR_0001s04700g [Populus trichocarpa]
 gb|EEE83939.2| hypothetical protein POPTR_0001s04700g [Populus trichocarpa]
Length=970

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGM+ AGAYG PQFRMRVF+W
Sbjct  664  VSMKYQARLGMLAAGAYGLPQFRMRVFLW  692



>gb|EEE58631.1| hypothetical protein OsJ_09996 [Oryza sativa Japonica Group]
Length=1033

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMM AG YG PQFRMR F+W
Sbjct  700  VAMNYQARLGMMAAGYYGLPQFRMRAFLW  728



>gb|KCW85898.1| hypothetical protein EUGRSUZ_B02615 [Eucalyptus grandis]
Length=655

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQ RLGMM AGAYG PQFRMR F+W
Sbjct  337  VQMNYQTRLGMMAAGAYGLPQFRMRCFLW  365



>gb|EEC74798.1| hypothetical protein OsI_10599 [Oryza sativa Indica Group]
Length=1760

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMM AG YG PQFRMR F+W
Sbjct  700  VAMNYQARLGMMAAGYYGLPQFRMRAFLW  728



>gb|AAN60988.1| Putative DNA cytosine methyltransferase MET2a [Oryza sativa Japonica 
Group]
 gb|ABF94750.1| C-5 cytosine-specific DNA methylase family protein, expressed 
[Oryza sativa Japonica Group]
Length=1761

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMM AG YG PQFRMR F+W
Sbjct  700  VAMNYQARLGMMAAGYYGLPQFRMRAFLW  728



>ref|XP_010243384.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Nelumbo nucifera]
Length=838

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQARLG++ AG YG PQFRMRVF+W    T +
Sbjct  517  VAMNYQARLGLLAAGCYGLPQFRMRVFLWGARPTEK  552



>ref|XP_010243382.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X1 [Nelumbo nucifera]
Length=839

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQARLG++ AG YG PQFRMRVF+W    T +
Sbjct  518  VAMNYQARLGLLAAGCYGLPQFRMRVFLWGARPTEK  553



>ref|XP_010043881.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Eucalyptus 
grandis]
Length=874

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQ RLGMM AGAYG PQFRMR F+W
Sbjct  556  VQMNYQTRLGMMAAGAYGLPQFRMRCFLW  584



>ref|XP_010541913.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Tarenaya 
hassleriana]
Length=874

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQ R+GMM AGAYG PQFRMR F+W  +   R
Sbjct  555  VQMNYQTRMGMMAAGAYGLPQFRMRFFLWGAQPNER  590



>gb|KHN40382.1| DNA (cytosine-5)-methyltransferase 1 [Glycine soja]
Length=705

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  430  MNYQARLGMMVAGAYGFPQFRMRVFMW  350
            MNYQARLG+M AGAYG PQFR+RVF+W
Sbjct  387  MNYQARLGIMAAGAYGLPQFRLRVFLW  413



>ref|XP_006572936.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Glycine 
max]
Length=875

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  430  MNYQARLGMMVAGAYGFPQFRMRVFMW  350
            MNYQARLG+M AGAYG PQFR+RVF+W
Sbjct  557  MNYQARLGIMAAGAYGLPQFRLRVFLW  583



>ref|XP_007014767.1| Chromomethylase 3, putative isoform 2 [Theobroma cacao]
 gb|EOY32386.1| Chromomethylase 3, putative isoform 2 [Theobroma cacao]
Length=708

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + +NYQ R+GMM AGAYG PQFRMRVF+W    T +
Sbjct  390  IHLNYQVRMGMMAAGAYGLPQFRMRVFLWGARPTEK  425



>ref|XP_007014771.1| Chromomethylase 1, putative isoform 6, partial [Theobroma cacao]
 gb|EOY32390.1| Chromomethylase 1, putative isoform 6, partial [Theobroma cacao]
Length=770

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + +NYQ R+GMM AGAYG PQFRMRVF+W    T +
Sbjct  570  IHLNYQVRMGMMAAGAYGLPQFRMRVFLWGARPTEK  605



>ref|XP_007014770.1| Chromomethylase 1, putative isoform 5, partial [Theobroma cacao]
 gb|EOY32389.1| Chromomethylase 1, putative isoform 5, partial [Theobroma cacao]
Length=774

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + +NYQ R+GMM AGAYG PQFRMRVF+W    T +
Sbjct  570  IHLNYQVRMGMMAAGAYGLPQFRMRVFLWGARPTEK  605



>ref|XP_007014769.1| Chromomethylase 1, putative isoform 4 [Theobroma cacao]
 gb|EOY32388.1| Chromomethylase 1, putative isoform 4 [Theobroma cacao]
Length=804

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + +NYQ R+GMM AGAYG PQFRMRVF+W    T +
Sbjct  613  IHLNYQVRMGMMAAGAYGLPQFRMRVFLWGARPTEK  648



>ref|XP_007014766.1| Chromomethylase 1, putative isoform 1 [Theobroma cacao]
 gb|EOY32385.1| Chromomethylase 1, putative isoform 1 [Theobroma cacao]
Length=930

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + +NYQ R+GMM AGAYG PQFRMRVF+W    T +
Sbjct  612  IHLNYQVRMGMMAAGAYGLPQFRMRVFLWGARPTEK  647



>ref|XP_007014768.1| Chromomethylase 1, putative isoform 3 [Theobroma cacao]
 gb|EOY32387.1| Chromomethylase 1, putative isoform 3 [Theobroma cacao]
Length=931

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            + +NYQ R+GMM AGAYG PQFRMRVF+W    T +
Sbjct  613  IHLNYQVRMGMMAAGAYGLPQFRMRVFLWGARPTEK  648



>gb|EPS58007.1| chromomethylase, partial [Genlisea aurea]
Length=515

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 34/64 (53%), Gaps = 18/64 (28%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRSNYSVNLHHPIRWSSICLLDGY*L  257
            V + YQ+R+G+M AGAYG PQFRMR+FMW    + R                  L  Y L
Sbjct  205  VSLGYQSRMGLMAAGAYGLPQFRMRMFMWGALASQR------------------LPQYPL  246

Query  256  PTHG  245
            PTHG
Sbjct  247  PTHG  250



>ref|XP_004513047.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Cicer arietinum]
Length=863

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQ+RLG+M AGAYG PQFR+RVF+W
Sbjct  545  VQMNYQSRLGIMAAGAYGLPQFRLRVFIW  573



>ref|XP_004513046.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Cicer arietinum]
Length=864

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQ+RLG+M AGAYG PQFR+RVF+W
Sbjct  546  VQMNYQSRLGIMAAGAYGLPQFRLRVFIW  574



>ref|XP_010666617.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Beta 
vulgaris subsp. vulgaris]
Length=832

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            VGMN+Q R+G+M AG+YG PQFR+RVF+W    + +
Sbjct  520  VGMNFQTRMGIMAAGSYGLPQFRLRVFLWGAHISKK  555



>gb|EMT27177.1| DNA (cytosine-5)-methyltransferase 1 [Aegilops tauschii]
Length=616

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTS  332
            V MNYQ+RLG+M+AG YG PQFRMR F+W G  T+
Sbjct  374  VAMNYQSRLGIMLAGCYGLPQFRMRTFLW-GALTT  407



>ref|XP_002990857.1| hypothetical protein SELMODRAFT_132507 [Selaginella moellendorffii]
 gb|EFJ08130.1| hypothetical protein SELMODRAFT_132507 [Selaginella moellendorffii]
Length=933

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQA+LGMM AG+YG PQFRMRVF+W
Sbjct  626  VDMRYQAKLGMMAAGSYGLPQFRMRVFLW  654



>ref|XP_011089105.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Sesamum indicum]
Length=859

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V   YQAR+GMM AGAYG PQFRMR+FMW    T R
Sbjct  542  VANGYQARMGMMAAGAYGLPQFRMRMFMWGALPTER  577



>gb|ABB46585.2| DNA cytosine methyltransferase MET2a, putative, expressed [Oryza 
sativa Japonica Group]
Length=371

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  41   VAMKYQARLGMMVAGCYGLPQFRMRVFLW  69



>gb|KDP44326.1| hypothetical protein JCGZ_19193 [Jatropha curcas]
Length=752

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            + MNYQ R+GMM AGAYG PQFRMR F+W
Sbjct  434  IEMNYQTRIGMMAAGAYGLPQFRMRCFLW  462



>gb|KEH28933.1| DNA (cytosine-5)-methyltransferase CMT1 [Medicago truncatula]
Length=843

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M+YQAR+GMM AG+YG PQFRMR F+W
Sbjct  524  VAMHYQARMGMMAAGSYGLPQFRMRFFLW  552



>ref|XP_007152976.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
 gb|ESW24970.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
Length=658

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  430  MNYQARLGMMVAGAYGFPQFRMRVFMW  350
            MNYQARLG+M AGAYG PQFR+R+F+W
Sbjct  334  MNYQARLGIMAAGAYGLPQFRLRMFLW  360



>ref|NP_001064023.1| Os10g0104900 [Oryza sativa Japonica Group]
 dbj|BAF25937.1| Os10g0104900, partial [Oryza sativa Japonica Group]
Length=406

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  76   VAMKYQARLGMMVAGCYGLPQFRMRVFLW  104



>ref|XP_002974335.1| hypothetical protein SELMODRAFT_30570, partial [Selaginella moellendorffii]
 gb|EFJ24557.1| hypothetical protein SELMODRAFT_30570, partial [Selaginella moellendorffii]
Length=773

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQA+LGMM AG+YG PQFRMRVF+W
Sbjct  473  VDMRYQAKLGMMAAGSYGLPQFRMRVFLW  501



>ref|XP_007152975.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
 gb|ESW24969.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
Length=877

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  430  MNYQARLGMMVAGAYGFPQFRMRVFMW  350
            MNYQARLG+M AGAYG PQFR+R+F+W
Sbjct  553  MNYQARLGIMAAGAYGLPQFRLRMFLW  579



>ref|XP_006854149.1| hypothetical protein AMTR_s00048p00181490 [Amborella trichopoda]
 gb|ERN15616.1| hypothetical protein AMTR_s00048p00181490 [Amborella trichopoda]
Length=1183

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            + MNYQARLG+M AG YG PQFR+RVF+W
Sbjct  863  INMNYQARLGIMAAGCYGLPQFRLRVFLW  891



>ref|XP_004293200.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Fragaria 
vesca subsp. vesca]
Length=758

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQ R G+M AGAYG PQFR+RVF+W    T R
Sbjct  457  VHMNYQTRTGIMAAGAYGLPQFRLRVFIWGARPTER  492



>gb|KEH27204.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=935

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQ+RLG++ AGAYG PQFR+RVF+W
Sbjct  615  VKMNYQSRLGILAAGAYGLPQFRLRVFLW  643



>ref|XP_004987095.1| PREDICTED: LOW QUALITY PROTEIN: DNA (cytosine-5)-methyltransferase 
1-like [Setaria italica]
Length=1608

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MN+QARLG+MVAG YG PQFRMRVF+W
Sbjct  659  VAMNFQARLGLMVAGCYGLPQFRMRVFIW  687



>ref|XP_010243148.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Nelumbo 
nucifera]
Length=1126

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG M AG YG PQFR+RVF+W
Sbjct  839  VHMNYQARLGTMAAGCYGLPQFRLRVFLW  867



>gb|EMT16647.1| DNA (cytosine-5)-methyltransferase 2 [Aegilops tauschii]
Length=660

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V +NYQ+R+G+MVAG YG PQFRMR+F+W
Sbjct  347  VALNYQSRMGLMVAGCYGLPQFRMRMFLW  375



>ref|NP_001049442.2| Os03g0226800 [Oryza sativa Japonica Group]
 dbj|BAF11356.2| Os03g0226800, partial [Oryza sativa Japonica Group]
Length=130

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMM AG YG PQFRMR F+W
Sbjct  79   VAMNYQARLGMMAAGYYGLPQFRMRAFLW  107



>gb|AAB95486.1| chromomethylase [Arabidopsis arenosa]
 gb|AAC02671.1| chromomethylase [Arabidopsis arenosa]
Length=744

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQ RLGMM AG+YG PQ R RVF+W  + T +
Sbjct  465  VAMNYQTRLGMMTAGSYGLPQVRNRVFLWAAQPTEK  500



>ref|XP_008238301.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 [Prunus mume]
Length=752

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG++ AG YG PQFR+RVF+W
Sbjct  431  VHMNYQARLGILAAGCYGLPQFRLRVFLW  459



>ref|XP_006417360.1| hypothetical protein EUTSA_v10006850mg [Eutrema salsugineum]
 gb|ESQ35713.1| hypothetical protein EUTSA_v10006850mg [Eutrema salsugineum]
Length=784

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLGMM AG+YG PQ R RVF+W
Sbjct  469  VAMNYQARLGMMTAGSYGVPQIRNRVFLW  497



>ref|XP_007210636.1| hypothetical protein PRUPE_ppa019831mg, partial [Prunus persica]
 gb|EMJ11835.1| hypothetical protein PRUPE_ppa019831mg, partial [Prunus persica]
Length=998

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG++ AG YG PQFR+RVF+W
Sbjct  691  VHMNYQARLGILAAGCYGLPQFRLRVFLW  719



>ref|XP_006390678.1| hypothetical protein EUTSA_v10018159mg [Eutrema salsugineum]
 gb|ESQ27964.1| hypothetical protein EUTSA_v10018159mg [Eutrema salsugineum]
Length=774

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQ RLGMM AG+YG PQ R RVF+W  + T +
Sbjct  434  VAMNYQTRLGMMAAGSYGLPQIRNRVFLWGAQPTEK  469



>ref|XP_006599217.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X3 [Glycine max]
Length=777

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG++ AG YG PQFR+RVF+W
Sbjct  414  VHMNYQARLGIIAAGCYGLPQFRLRVFLW  442



>gb|KHN10109.1| DNA (cytosine-5)-methyltransferase CMT2 [Glycine soja]
Length=1031

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG++ AG YG PQFR+RVF+W
Sbjct  668  VHMNYQARLGIIAAGCYGLPQFRLRVFLW  696



>ref|XP_006599216.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Glycine max]
Length=1042

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG++ AG YG PQFR+RVF+W
Sbjct  679  VHMNYQARLGIIAAGCYGLPQFRLRVFLW  707



>ref|XP_006599215.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Glycine max]
Length=1118

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG++ AG YG PQFR+RVF+W
Sbjct  755  VHMNYQARLGIIAAGCYGLPQFRLRVFLW  783



>ref|NP_001266791.1| uncharacterized protein LOC101027213 [Zea mays]
 gb|ACN35047.1| unknown [Zea mays]
Length=329

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -2

Query  430  MNYQARLGMMVAGAYGFPQFRMRVFMW  350
            M YQARLGMMVAG YG PQFRMRVF+W
Sbjct  1    MKYQARLGMMVAGCYGLPQFRMRVFLW  27



>gb|AEC12443.1| chromomethylase 3 [Gossypium hirsutum]
Length=824

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            + +NYQ R+GMM AGAYG PQFRMR F W
Sbjct  504  IHLNYQVRMGMMAAGAYGLPQFRMRAFFW  532



>ref|XP_010908353.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Elaeis 
guineensis]
Length=1011

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG+M AG YG PQFR+R F+W
Sbjct  688  VCMNYQARLGIMAAGCYGLPQFRLRAFLW  716



>gb|AAC02665.1| chromomethylase [Arabidopsis thaliana]
 gb|AAC02668.1| chromomethylase [Arabidopsis thaliana]
Length=560

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGE  341
            V MNYQ RLGMM AG+YG PQ R RVF+W  +
Sbjct  481  VAMNYQTRLGMMAAGSYGLPQLRNRVFLWAAQ  512



>gb|AAC02667.1| chromomethylase [Arabidopsis thaliana]
Length=560

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGE  341
            V MNYQ RLGMM AG+YG PQ R RVF+W  +
Sbjct  481  VAMNYQTRLGMMAAGSYGLPQLRNRVFLWAAQ  512



>ref|XP_010110416.1| DNA (cytosine-5)-methyltransferase CMT2 [Morus notabilis]
 gb|EXC26248.1| DNA (cytosine-5)-methyltransferase CMT2 [Morus notabilis]
Length=1399

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436   VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
             V MNYQARLG++ AG YG PQFR+RVF+W
Sbjct  1100  VHMNYQARLGIIAAGCYGLPQFRLRVFLW  1128



>ref|XP_008790945.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Phoenix 
dactylifera]
Length=994

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG+M AG YG PQFR+R F+W
Sbjct  674  VCMNYQARLGIMAAGCYGLPQFRLRAFLW  702



>gb|AAA98912.1| theoretical protein with similarity to Swiss-Prot Accession Number 
P34881 DNA (cytosine-5-) methyltransferase [Arabidopsis 
thaliana]
Length=620

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGE  341
            V MNYQ RLGMM AG+YG PQ R RVF+W  +
Sbjct  399  VAMNYQTRLGMMAAGSYGLPQLRNRVFLWAAQ  430



>gb|KFK28331.1| chromomethylase [Arabis alpina]
Length=781

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQ RLGMM+AG+YG PQ R RVFMW
Sbjct  463  VSMNYQTRLGMMMAGSYGVPQTRCRVFMW  491



>gb|AAC02662.1| chromomethylase [Arabidopsis thaliana]
Length=754

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGE  341
            V MNYQ RLGMM AG+YG PQ R RVF+W  +
Sbjct  481  VAMNYQTRLGMMAAGSYGLPQLRNRVFLWAAQ  512



>gb|AAC02670.1| chromomethylase [Arabidopsis suecica]
Length=754

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGE  341
            V MNYQ RLGMM AG+YG PQ R RVF+W  +
Sbjct  481  VAMNYQTRLGMMAAGSYGLPQLRNRVFLWAAQ  512



>ref|NP_565245.1| chromomethylase 1 [Arabidopsis thaliana]
 sp|O49139.2|CMT1_ARATH RecName: Full=Putative DNA (cytosine-5)-methyltransferase CMT1; 
AltName: Full=Chromomethylase 1; AltName: Full=Protein CHROMOMETHYLASE 
1 [Arabidopsis thaliana]
 gb|AAF14662.1|AC011713_10 Identical to gb|AF039367 ecotype Col-0 chromomethylase (CMT1) 
gene from Arabidopsis thaliana [Arabidopsis thaliana]
 gb|AAC02660.1| chromomethylase [Arabidopsis thaliana]
 gb|AEE36442.1| chromomethylase 1 [Arabidopsis thaliana]
Length=791

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGE  341
            V MNYQ RLGMM AG+YG PQ R RVF+W  +
Sbjct  481  VAMNYQTRLGMMAAGSYGLPQLRNRVFLWAAQ  512



>gb|AAB95485.1| chromomethylase [Arabidopsis thaliana]
 gb|AAC02659.1| chromomethylase [Arabidopsis thaliana]
Length=791

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGE  341
            V MNYQ RLGMM AG+YG PQ R RVF+W  +
Sbjct  481  VAMNYQTRLGMMAAGSYGLPQLRNRVFLWAAQ  512



>gb|AAC02663.1| chromomethylase [Arabidopsis thaliana]
Length=791

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGE  341
            V MNYQ RLGMM AG+YG PQ R RVF+W  +
Sbjct  481  VAMNYQTRLGMMAAGSYGLPQLRNRVFLWAAQ  512



>ref|XP_006470820.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Citrus 
sinensis]
Length=845

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M+YQ RLG+M AG+YG PQFR+RVF+W
Sbjct  524  VSMDYQTRLGIMAAGSYGLPQFRLRVFLW  552



>ref|XP_006431407.1| hypothetical protein CICLE_v10000251mg [Citrus clementina]
 gb|ESR44647.1| hypothetical protein CICLE_v10000251mg [Citrus clementina]
Length=859

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M+YQ RLG+M AG+YG PQFR+RVF+W
Sbjct  538  VSMDYQTRLGIMAAGSYGLPQFRLRVFLW  566



>ref|XP_010662142.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X3 [Vitis vinifera]
Length=731

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG+M AG YG PQ+R+RVF W
Sbjct  573  VRMNYQARLGIMAAGCYGLPQYRLRVFFW  601



>ref|XP_010662140.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Vitis vinifera]
 ref|XP_010662141.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Vitis vinifera]
Length=763

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG+M AG YG PQ+R+RVF W
Sbjct  573  VRMNYQARLGIMAAGCYGLPQYRLRVFFW  601



>ref|XP_001769709.1| predicted protein [Physcomitrella patens]
 gb|EDQ65510.1| predicted protein [Physcomitrella patens]
Length=700

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            VGMNYQ+++G+MVAG YG PQFR R F+W
Sbjct  391  VGMNYQSKVGIMVAGCYGMPQFRARCFLW  419



>emb|CBI26560.3| unnamed protein product [Vitis vinifera]
Length=847

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG+M AG YG PQ+R+RVF W
Sbjct  528  VRMNYQARLGIMAAGCYGLPQYRLRVFFW  556



>ref|XP_002889276.1| hypothetical protein ARALYDRAFT_895912 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65535.1| hypothetical protein ARALYDRAFT_895912 [Arabidopsis lyrata subsp. 
lyrata]
Length=876

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFT  335
            V MNYQ RLGMM AG+YG PQ R RVF+W  + T
Sbjct  433  VAMNYQTRLGMMTAGSYGLPQVRNRVFLWAAQPT  466



>ref|XP_010662139.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Vitis vinifera]
Length=892

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG+M AG YG PQ+R+RVF W
Sbjct  573  VRMNYQARLGIMAAGCYGLPQYRLRVFFW  601



>ref|XP_009148471.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Brassica 
rapa]
Length=786

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQ RLGMM AG+YG PQ R RVF+W  + T +
Sbjct  470  VAMNYQTRLGMMTAGSYGVPQVRNRVFLWGAQPTEK  505



>emb|CDX97957.1| BnaA06g07080D [Brassica napus]
Length=788

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQ RLGMM AG+YG PQ R RVF+W  + T +
Sbjct  462  VAMNYQTRLGMMTAGSYGVPQVRNRVFLWGAQPTEK  497



>emb|CDY19364.1| BnaC05g08730D [Brassica napus]
Length=796

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQ RLGMM AG+YG PQ R RVF+W  + T +
Sbjct  471  VAMNYQTRLGMMTAGSYGVPQVRNRVFLWGAQPTEK  506



>emb|CBI37413.3| unnamed protein product [Vitis vinifera]
Length=729

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLGM+ AG YG PQFR+RVF+W
Sbjct  420  VHMKYQARLGMIAAGCYGLPQFRLRVFLW  448



>gb|ACX83573.1| DNA chromomethylase [Hieracium piloselloides]
Length=607

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNY AR+G+MVAG+YG PQFR R+FMW
Sbjct  288  VSMNYIARVGLMVAGSYGLPQFRRRMFMW  316



>ref|XP_011075808.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Sesamum indicum]
Length=907

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG+M AG YG PQFR+RVF+W
Sbjct  587  VRMQYQARLGIMAAGCYGLPQFRLRVFLW  615



>ref|XP_011075807.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Sesamum indicum]
Length=911

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG+M AG YG PQFR+RVF+W
Sbjct  591  VRMQYQARLGIMAAGCYGLPQFRLRVFLW  619



>ref|XP_010665041.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X3 [Vitis vinifera]
Length=1349

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436   VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
             V M YQARLGM+ AG YG PQFR+RVF+W
Sbjct  1040  VHMKYQARLGMIAAGCYGLPQFRLRVFLW  1068



>ref|XP_004509555.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cicer 
arietinum]
Length=1093

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG++ AG YG PQFR+RVF+W
Sbjct  658  VHMNYQARLGIVAAGCYGVPQFRLRVFLW  686



>ref|XP_010665035.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Vitis vinifera]
Length=1430

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436   VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
             V M YQARLGM+ AG YG PQFR+RVF+W
Sbjct  1121  VHMKYQARLGMIAAGCYGLPQFRLRVFLW  1149



>ref|XP_010665031.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Vitis vinifera]
Length=1432

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436   VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
             V M YQARLGM+ AG YG PQFR+RVF+W
Sbjct  1123  VHMKYQARLGMIAAGCYGLPQFRLRVFLW  1151



>gb|KFK30827.1| hypothetical protein AALP_AA6G031000 [Arabis alpina]
Length=913

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQ R+GMM AGAYG  QFRMR F+W
Sbjct  593  VQMNYQTRMGMMAAGAYGLAQFRMRFFLW  621



>gb|KEH20304.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
Length=1011

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M+YQARLG++ AG YG PQFR+RVFMW
Sbjct  656  VHMHYQARLGIVAAGCYGLPQFRLRVFMW  684



>ref|XP_010429915.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 isoform 
X2 [Camelina sativa]
Length=795

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQ RLGMMVAG+YG  Q R RVF+W  + T +
Sbjct  480  VAMNYQTRLGMMVAGSYGVAQLRNRVFLWAAQPTEK  515



>ref|XP_010429914.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 isoform 
X1 [Camelina sativa]
Length=796

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQ RLGMMVAG+YG  Q R RVF+W  + T +
Sbjct  481  VAMNYQTRLGMMVAGSYGVAQLRNRVFLWAAQPTEK  516



>ref|XP_010677408.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=773

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQAR+G++ AG+YG PQFR+RVF W
Sbjct  462  VHMNYQARVGIIAAGSYGLPQFRLRVFFW  490



>ref|XP_010677407.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=774

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQAR+G++ AG+YG PQFR+RVF W
Sbjct  463  VHMNYQARVGIIAAGSYGLPQFRLRVFFW  491



>ref|XP_006300613.1| hypothetical protein CARUB_v10019805mg, partial [Capsella rubella]
 gb|EOA33511.1| hypothetical protein CARUB_v10019805mg, partial [Capsella rubella]
Length=824

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQ RLGMM AG+YG PQ R R F+W  + T +
Sbjct  510  VAMNYQTRLGMMTAGSYGVPQLRNRFFLWAAQPTEK  545



>ref|XP_009392768.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=1098

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V +NYQARLG+M AG YG PQFR+R F+W
Sbjct  785  VSINYQARLGIMAAGCYGVPQFRLRAFLW  813



>ref|XP_009392766.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=1098

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V +NYQARLG+M AG YG PQFR+R F+W
Sbjct  785  VSINYQARLGIMAAGCYGVPQFRLRAFLW  813



>ref|XP_010677406.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=1060

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQAR+G++ AG+YG PQFR+RVF W
Sbjct  749  VHMNYQARVGIIAAGSYGLPQFRLRVFFW  777



>ref|XP_010054090.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Eucalyptus grandis]
 ref|XP_010054091.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Eucalyptus grandis]
 gb|KCW78468.1| hypothetical protein EUGRSUZ_D02616 [Eucalyptus grandis]
Length=1233

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG+M AG YG PQFR+RVF+W
Sbjct  902  VHMRYQARLGVMAAGCYGVPQFRLRVFLW  930



>ref|XP_011092593.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 [Sesamum indicum]
Length=1352

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436   VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
             V MNYQARLG + +G YG PQFR+RVF+W
Sbjct  1036  VNMNYQARLGTIASGCYGLPQFRLRVFIW  1064



>gb|KDO42579.1| hypothetical protein CISIN_1g0039741mg, partial [Citrus sinensis]
Length=381

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRG-EFTSRSNYSVNLHH  302
            V M+YQ RLG+M AG+YG PQFR+RVF+W    F     Y +  H 
Sbjct  118  VSMDYQTRLGIMAAGSYGLPQFRLRVFLWGARPFKKLPQYPLPTHE  163



>ref|XP_004960650.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Setaria italica]
Length=1295

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFM  353
            V MNYQA+LG+M AG YG PQFRMRVF+
Sbjct  973  VAMNYQAKLGIMAAGCYGLPQFRMRVFL  1000



>ref|XP_004960649.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Setaria italica]
Length=1296

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFM  353
            V MNYQA+LG+M AG YG PQFRMRVF+
Sbjct  973  VAMNYQAKLGIMAAGCYGLPQFRMRVFL  1000



>ref|XP_007041239.1| Chromomethylase 1, putative [Theobroma cacao]
 gb|EOX97070.1| Chromomethylase 1, putative [Theobroma cacao]
Length=844

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQAR+GMM AG+YG  Q RMRVF+W
Sbjct  524  VSMNYQARMGMMTAGSYGVAQCRMRVFLW  552



>ref|XP_010054093.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Eucalyptus grandis]
Length=1187

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG+M AG YG PQFR+RVF+W
Sbjct  856  VHMRYQARLGVMAAGCYGVPQFRLRVFLW  884



>ref|XP_008346523.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Malus 
domestica]
Length=611

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG++ AG YG PQFR+RVF+W
Sbjct  289  VHMKYQARLGILAAGCYGLPQFRLRVFLW  317



>ref|XP_008373678.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Malus 
domestica]
Length=666

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG++ AG YG PQFR+RVF+W
Sbjct  344  VHMKYQARLGILAAGCYGLPQFRLRVFLW  372



>ref|XP_009373520.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Pyrus 
x bretschneideri]
Length=1384

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436   VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
             V M YQARLG++ AG YG PQFR+RVF+W
Sbjct  1006  VHMKYQARLGILAAGCYGLPQFRLRVFLW  1034



>ref|XP_009785637.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like, partial 
[Nicotiana sylvestris]
Length=764

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG M AG YG PQFR+RVF W
Sbjct  445  VHMRYQARLGTMAAGCYGLPQFRLRVFFW  473



>ref|XP_009625195.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2, partial [Nicotiana 
tomentosiformis]
Length=773

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG M AG YG PQFR+RVF W
Sbjct  454  VHMRYQARLGTMAAGCYGLPQFRLRVFFW  482



>ref|XP_008448611.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Cucumis melo]
Length=1022

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG + AG +G PQFR+RVF+W
Sbjct  704  VHMNYQARLGTIAAGCFGLPQFRLRVFLW  732



>dbj|BAH37021.1| chromomethylase OsMET2c [Oryza sativa Japonica Group]
Length=749

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFM  353
            V M+YQARLG+M AG YG PQFRMRVF+
Sbjct  461  VAMHYQARLGIMAAGCYGLPQFRMRVFL  488



>ref|XP_004301642.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Fragaria 
vesca subsp. vesca]
Length=1112

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG++ AG YG PQFR+RVF+W
Sbjct  801  VQMTYQARLGIIAAGCYGLPQFRLRVFLW  829



>gb|KGN55702.1| hypothetical protein Csa_3G006640 [Cucumis sativus]
Length=1239

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG + AG +G PQFR+RVF+W
Sbjct  921  VHMNYQARLGTIAAGCFGLPQFRLRVFLW  949



>ref|XP_004146191.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cucumis 
sativus]
 ref|XP_004164187.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cucumis 
sativus]
Length=1243

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG + AG +G PQFR+RVF+W
Sbjct  925  VHMNYQARLGTIAAGCFGLPQFRLRVFLW  953



>ref|XP_008448610.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Cucumis melo]
Length=1247

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQARLG + AG +G PQFR+RVF+W
Sbjct  929  VHMNYQARLGTIAAGCFGLPQFRLRVFLW  957



>ref|XP_010324482.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 [Solanum lycopersicum]
Length=1075

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG M AG YG PQFR+RVF W
Sbjct  757  VHMRYQARLGTMAAGCYGLPQFRLRVFFW  785



>ref|XP_006361281.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Solanum 
tuberosum]
Length=1086

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG M AG YG PQFR+RVF W
Sbjct  768  VHMRYQARLGTMAAGCYGLPQFRLRVFFW  796



>gb|EEE62800.1| hypothetical protein OsJ_17603 [Oryza sativa Japonica Group]
Length=1190

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFM  353
            V M+YQARLG+M AG YG PQFRMRVF+
Sbjct  876  VAMHYQARLGIMAAGCYGLPQFRMRVFL  903



>gb|EEC78738.1| hypothetical protein OsI_18945 [Oryza sativa Indica Group]
Length=1325

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  436   VGMNYQARLGMMVAGAYGFPQFRMRVFM  353
             V M+YQARLG+M AG YG PQFRMRVF+
Sbjct  1011  VAMHYQARLGIMAAGCYGLPQFRMRVFL  1038



>gb|AEP33250.1| CMT-type DNA-methyltransferase [Posidonia oceanica]
Length=802

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V  NYQARLG+M AG YG PQFR+R F W
Sbjct  465  VSRNYQARLGIMAAGCYGLPQFRLRAFFW  493



>ref|XP_002888734.1| chromomethylase CMT3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64993.1| chromomethylase CMT3 [Arabidopsis lyrata subsp. lyrata]
Length=838

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            + MNYQ R+GMM AGAYG  QFR+R F+W
Sbjct  524  IQMNYQVRMGMMAAGAYGLAQFRLRFFLW  552



>ref|XP_007040779.1| DNA-methyltransferase CMT2 [Theobroma cacao]
 gb|EOY25280.1| DNA-methyltransferase CMT2 [Theobroma cacao]
Length=1427

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436   VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
             V M YQARLG++ AG YG PQFR+RVF+W
Sbjct  1099  VHMKYQARLGIIAAGCYGLPQFRLRVFVW  1127



>ref|XP_003615342.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|AES98300.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=800

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 7/49 (14%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRSNYSVNLHH-PIR  293
            V MNYQ+RLG++ A AYG  QFR+RVF+W G        S NLH  P+R
Sbjct  479  VQMNYQSRLGILAARAYGLRQFRLRVFLWGG------TPSENLHQFPLR  521



>ref|XP_007156278.1| hypothetical protein PHAVU_003G273100g [Phaseolus vulgaris]
 gb|ESW28272.1| hypothetical protein PHAVU_003G273100g [Phaseolus vulgaris]
Length=1047

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQAR+G++ AG YG PQFR+RVF+W
Sbjct  728  VHMKYQARMGIIAAGCYGLPQFRLRVFLW  756



>gb|AHB20162.1| DNA methyltransferase, partial [Populus x canadensis]
Length=755

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG + AG YG PQFR+RVF+W
Sbjct  435  VHMKYQARLGTVAAGCYGLPQFRLRVFLW  463



>gb|AHB20163.1| DNA methyltransferase, partial [Populus x canadensis]
Length=760

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG + AG YG PQFR+RVF+W
Sbjct  471  VHMKYQARLGTVAAGCYGLPQFRLRVFLW  499



>ref|XP_002519960.1| protein with unknown function [Ricinus communis]
 gb|EEF42564.1| protein with unknown function [Ricinus communis]
Length=734

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG + AG YG PQFR+RVF+W
Sbjct  414  VHMKYQARLGTIAAGCYGLPQFRLRVFLW  442



>ref|XP_006385690.1| hypothetical protein POPTR_0003s09920g, partial [Populus trichocarpa]
 gb|ERP63487.1| hypothetical protein POPTR_0003s09920g, partial [Populus trichocarpa]
Length=972

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG + AG YG PQFR+RVF+W
Sbjct  857  VHMKYQARLGTVAAGCYGLPQFRLRVFLW  885



>ref|XP_011028082.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X3 
[Populus euphratica]
Length=1056

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG + AG YG PQFR+RVF+W
Sbjct  898  VHMKYQARLGTVAAGCYGLPQFRLRVFLW  926



>ref|XP_011028081.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Populus euphratica]
Length=1167

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG + AG YG PQFR+RVF+W
Sbjct  898  VHMKYQARLGTVAAGCYGLPQFRLRVFLW  926



>ref|XP_011028080.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Populus euphratica]
Length=1218

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG + AG YG PQFR+RVF+W
Sbjct  898  VHMKYQARLGTVAAGCYGLPQFRLRVFLW  926



>emb|CDP11756.1| unnamed protein product [Coffea canephora]
Length=792

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG + AG YG PQFR+RVF+W
Sbjct  473  VHMKYQARLGTIAAGCYGLPQFRLRVFIW  501



>emb|CAA16759.1| putative protein [Arabidopsis thaliana]
 emb|CAB78904.1| putative protein [Arabidopsis thaliana]
Length=1171

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG+M AG YG  QFR RVFMW
Sbjct  953  VNMRYQARLGIMTAGCYGLSQFRSRVFMW  981



>gb|AAK69757.1|AF383171_1 chromomethylase CMT2 [Arabidopsis thaliana]
Length=1244

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG+M AG YG  QFR RVFMW
Sbjct  928  VNMRYQARLGIMTAGCYGLSQFRSRVFMW  956



>ref|XP_002870005.1| chromomethylase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46264.1| chromomethylase 2 [Arabidopsis lyrata subsp. lyrata]
Length=1253

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG+M AG YG  QFR RVFMW
Sbjct  937  VNMRYQARLGIMTAGCYGLSQFRSRVFMW  965



>ref|XP_006282433.1| hypothetical protein CARUB_v10003999mg, partial [Capsella rubella]
 gb|EOA15331.1| hypothetical protein CARUB_v10003999mg, partial [Capsella rubella]
Length=1275

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG+M AG YG  QFR RVFMW
Sbjct  959  VNMRYQARLGIMTAGCYGLSQFRSRVFMW  987



>ref|NP_193637.2| chromomethylase 2 [Arabidopsis thaliana]
 sp|Q94F87.3|CMT2_ARATH RecName: Full=DNA (cytosine-5)-methyltransferase CMT2; AltName: 
Full=Chromomethylase 2; AltName: Full=Protein CHROMOMETHYLASE 
2 [Arabidopsis thaliana]
 gb|AEE84126.1| chromomethylase 2 [Arabidopsis thaliana]
Length=1295

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436   VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
             V M YQARLG+M AG YG  QFR RVFMW
Sbjct  979   VNMRYQARLGIMTAGCYGLSQFRSRVFMW  1007



>ref|XP_010449422.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Camelina 
sativa]
Length=1242

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG+M AG YG  QFR RVFMW
Sbjct  926  VNMRYQARLGIMAAGCYGLSQFRSRVFMW  954



>ref|XP_002886525.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62784.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=732

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V  NYQARLG+M AGAYG PQ R RVF+W
Sbjct  429  VNKNYQARLGIMAAGAYGVPQCRYRVFLW  457



>gb|EPS64010.1| cytosine-specific methyltransferase, partial [Genlisea aurea]
Length=396

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRSN  323
            VGM YQ+RLG + +G YG PQFR+RVF+W    T+ + 
Sbjct  76   VGMKYQSRLGTLASGCYGLPQFRLRVFIWGAHPTATTT  113



>gb|AAL28119.1|AF433678_1 putative chromomethylase MTH1 [Triticum aestivum]
Length=107

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 1/36 (3%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V M YQARLG+MVAG YG PQFRMR F+  G   SR
Sbjct  72   VSMRYQARLGLMVAGCYGLPQFRMRAFLG-GALPSR  106



>ref|XP_006432634.1| hypothetical protein CICLE_v100004871mg, partial [Citrus clementina]
 gb|ESR45874.1| hypothetical protein CICLE_v100004871mg, partial [Citrus clementina]
Length=496

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQAR G++ AG YG PQFR+RVF+W
Sbjct  381  VHMKYQARFGIIAAGCYGLPQFRLRVFIW  409



>gb|KHG22889.1| DNA (cytosine-5)-methyltransferase 1 [Gossypium arboreum]
Length=321

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            + +NYQ R+GMM AGAYG PQFRMR F W
Sbjct  101  IHLNYQVRMGMMAAGAYGLPQFRMRAFFW  129



>gb|KFK28574.1| chromomethylase 2 [Arabis alpina]
Length=1039

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG+M AG YG  QFR RVFMW
Sbjct  722  VHMRYQARLGIMTAGCYGLSQFRSRVFMW  750



>gb|EYU22416.1| hypothetical protein MIMGU_mgv1a001955mg [Erythranthe guttata]
Length=734

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V MNYQ RLG+M AGAYG PQ RMR  +W
Sbjct  417  VSMNYQTRLGIMAAGAYGVPQCRMRFLLW  445



>ref|XP_006414021.1| hypothetical protein EUTSA_v10024250mg [Eutrema salsugineum]
 gb|ESQ55474.1| hypothetical protein EUTSA_v10024250mg [Eutrema salsugineum]
Length=1192

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG+M AG YG  QFR RVFMW
Sbjct  875  VHMRYQARLGIMTAGCYGLAQFRSRVFMW  903



>ref|XP_002439474.1| hypothetical protein SORBIDRAFT_09g007390 [Sorghum bicolor]
 gb|EES17904.1| hypothetical protein SORBIDRAFT_09g007390 [Sorghum bicolor]
Length=1441

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  436   VGMNYQARLGMMVAGAYGFPQFRMRVFM  353
             V M+YQA+LG+M AG YG PQFRMRVF+
Sbjct  1124  VSMHYQAKLGVMAAGCYGLPQFRMRVFL  1151



>ref|XP_006471441.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Citrus 
sinensis]
Length=969

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQAR G++ AG YG PQFR+RVF+W
Sbjct  651  VHMKYQARFGIIAAGCYGLPQFRLRVFIW  679



>ref|XP_006655109.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Oryza 
brachyantha]
Length=1221

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFM  353
            V M+YQARLG+M A  YG PQFRMRVF+
Sbjct  907  VAMSYQARLGIMAAACYGLPQFRMRVFL  934



>ref|XP_009150572.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Brassica 
rapa]
Length=805

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 1/37 (3%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRS  326
            V MNYQ R+GMM AG+YG  QFR R F+W G  +S +
Sbjct  495  VQMNYQTRMGMMAAGSYGLAQFRRRFFLW-GAMSSET  530



>emb|CDY08836.1| BnaA06g23880D [Brassica napus]
Length=805

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 1/37 (3%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRS  326
            V MNYQ R+GMM AG+YG  QFR R F+W G  +S +
Sbjct  495  VQMNYQTRMGMMAAGSYGLAQFRRRFFLW-GAMSSET  530



>dbj|BAF34637.1| chromomethylase [Brassica rapa]
Length=805

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 1/37 (3%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSRS  326
            V MNYQ R+GMM AG+YG  QFR R F+W G  +S +
Sbjct  495  VQMNYQTRMGMMAAGSYGLAQFRRRFFLW-GAMSSET  530



>emb|CDY14524.1| BnaC03g49350D [Brassica napus]
Length=802

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMWRGEFTSR  329
            V MNYQ R+GMM AG+YG  QFR R F+W    + R
Sbjct  495  VQMNYQTRMGMMAAGSYGLAQFRRRFFLWGAMSSER  530



>ref|XP_009378155.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Pyrus 
x bretschneideri]
Length=670

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG++ AG+YG PQF +RVF+W
Sbjct  348  VHMKYQARLGILAAGSYGLPQFWLRVFLW  376



>ref|XP_010671153.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Beta 
vulgaris subsp. vulgaris]
Length=841

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            + + YQA LG+M AG YG PQFR+RVF+W
Sbjct  521  IQLKYQASLGIMAAGCYGLPQFRLRVFLW  549



>ref|XP_010470978.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Camelina sativa]
Length=830

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFM  353
            + MNYQ+R+GMM AGAYG  QFRMR F+
Sbjct  522  IQMNYQSRMGMMAAGAYGLAQFRMRFFL  549



>ref|XP_010470977.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Camelina sativa]
Length=831

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFM  353
            + MNYQ+R+GMM AGAYG  QFRMR F+
Sbjct  522  IQMNYQSRMGMMAAGAYGLAQFRMRFFL  549



>ref|XP_010415637.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Camelina sativa]
Length=834

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFM  353
            + MNYQ+R+GMM AGAYG  QFRMR F+
Sbjct  526  IQMNYQSRMGMMAAGAYGLAQFRMRFFL  553



>ref|XP_010415636.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Camelina sativa]
Length=835

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFM  353
            + MNYQ+R+GMM AGAYG  QFRMR F+
Sbjct  526  IQMNYQSRMGMMAAGAYGLAQFRMRFFL  553



>ref|XP_006300392.1| hypothetical protein CARUB_v10019778mg, partial [Capsella rubella]
 gb|EOA33290.1| hypothetical protein CARUB_v10019778mg, partial [Capsella rubella]
Length=865

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFM  353
            + MNYQ+R+GMM AGAYG  QFRMR F+
Sbjct  555  IQMNYQSRMGMMAAGAYGLAQFRMRFFL  582



>ref|NP_177135.1| DNA (cytosine-5)-methyltransferase CMT3 [Arabidopsis thaliana]
 sp|Q94F88.2|CMT3_ARATH RecName: Full=DNA (cytosine-5)-methyltransferase CMT3; AltName: 
Full=Chromomethylase 3; AltName: Full=Protein CHROMOMETHYLASE 
3 [Arabidopsis thaliana]
 gb|AAG52543.1|AC013289_10 putative chromomethylase; 17383-22406 [Arabidopsis thaliana]
 gb|AEE34973.1| DNA (cytosine-5)-methyltransferase CMT3 [Arabidopsis thaliana]
Length=839

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -2

Query  430  MNYQARLGMMVAGAYGFPQFRMRVFMW  350
            MNYQ R GMM AGAYG  QFR+R F+W
Sbjct  526  MNYQVRNGMMAAGAYGLAQFRLRFFLW  552



>dbj|BAF01425.1| putative chromomethylase [Arabidopsis thaliana]
Length=839

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -2

Query  430  MNYQARLGMMVAGAYGFPQFRMRVFMW  350
            MNYQ R GMM AGAYG  QFR+R F+W
Sbjct  526  MNYQVRNGMMAAGAYGLAQFRLRFFLW  552



>gb|AAK71870.1| chromomethylase 3 [Arabidopsis thaliana]
Length=839

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -2

Query  430  MNYQARLGMMVAGAYGFPQFRMRVFMW  350
            MNYQ R GMM AGAYG  QFR+R F+W
Sbjct  526  MNYQVRNGMMAAGAYGLAQFRLRFFLW  552



>gb|AAK69756.1|AF383170_1 chromomethylase CMT3 [Arabidopsis thaliana]
Length=839

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -2

Query  430  MNYQARLGMMVAGAYGFPQFRMRVFMW  350
            MNYQ R GMM AGAYG  QFR+R F+W
Sbjct  526  MNYQVRNGMMAAGAYGLAQFRLRFFLW  552



>pdb|4FSX|A Chain A, Crystal Structure Of Se-Substituted Zea Mays Zmet2 In 
Complex With Sah
 pdb|4FSX|B Chain B, Crystal Structure Of Se-Substituted Zea Mays Zmet2 In 
Complex With Sah
Length=784

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V   YQARLG  VAG YG PQFR RVF+W
Sbjct  453  VAXKYQARLGXXVAGCYGLPQFRXRVFLW  481



>emb|CDX78915.1| BnaA01g09820D [Brassica napus]
Length=1098

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG++ AG YG  QFR RVFMW
Sbjct  781  VDMRYQARLGIITAGCYGLSQFRSRVFMW  809



>ref|XP_009132479.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Brassica rapa]
Length=1119

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG++ AG YG  QFR RVFMW
Sbjct  802  VDMRYQARLGIITAGCYGLSQFRSRVFMW  830



>ref|XP_009132470.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Brassica rapa]
Length=1141

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG++ AG YG  QFR RVFMW
Sbjct  824  VDMRYQARLGIITAGCYGLSQFRSRVFMW  852



>emb|CDX99400.1| BnaC01g11520D [Brassica napus]
Length=1144

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  436  VGMNYQARLGMMVAGAYGFPQFRMRVFMW  350
            V M YQARLG++ AG YG  QFR RVFMW
Sbjct  827  VDMRYQARLGIITAGCYGLSQFRSRVFMW  855



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519632749224