BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22244_g1_i1 len=2506 path=[1:0-1322 12322:1323-1354 9672:1355-1970
1954:1971-2001 1985:2002-2505]

Length=2506
                                                                      Score     E

ref|XP_009601900.1|  PREDICTED: U-box domain-containing protein 3...    826   0.0      
ref|XP_009798003.1|  PREDICTED: U-box domain-containing protein 3...    825   0.0      
ref|XP_009591658.1|  PREDICTED: U-box domain-containing protein 3...    821   0.0      
ref|XP_009591659.1|  PREDICTED: U-box domain-containing protein 3...    818   0.0      
ref|XP_009780371.1|  PREDICTED: U-box domain-containing protein 3...    808   0.0      
ref|XP_006350355.1|  PREDICTED: U-box domain-containing protein 3...    791   0.0      
ref|XP_010322089.1|  PREDICTED: U-box domain-containing protein 5...    777   0.0      
ref|XP_006342500.1|  PREDICTED: U-box domain-containing protein 3...    771   0.0      
ref|XP_006342499.1|  PREDICTED: U-box domain-containing protein 3...    770   0.0      
ref|XP_009591661.1|  PREDICTED: U-box domain-containing protein 3...    767   0.0      
ref|XP_009591660.1|  PREDICTED: U-box domain-containing protein 3...    767   0.0      
ref|XP_009798004.1|  PREDICTED: U-box domain-containing protein 3...    765   0.0      
ref|XP_004253092.1|  PREDICTED: U-box domain-containing protein 3...    765   0.0      
ref|XP_010648363.1|  PREDICTED: U-box domain-containing protein 5...    767   0.0      
ref|XP_009601901.1|  PREDICTED: U-box domain-containing protein 3...    763   0.0      
emb|CDP08293.1|  unnamed protein product                                749   0.0      
ref|XP_006474435.1|  PREDICTED: U-box domain-containing protein 5...    740   0.0      
ref|XP_006474436.1|  PREDICTED: U-box domain-containing protein 5...    739   0.0      
ref|XP_006474434.1|  PREDICTED: U-box domain-containing protein 5...    739   0.0      
ref|XP_006453060.1|  hypothetical protein CICLE_v10010543mg             734   0.0      
ref|XP_007012336.1|  Kinase protein with adenine nucleotide alpha...    731   0.0      
ref|XP_006342501.1|  PREDICTED: U-box domain-containing protein 3...    726   0.0      
ref|XP_010094961.1|  U-box domain-containing protein 35                 729   0.0      
gb|AID16038.1|  putative universal stress protein                       723   0.0      
ref|XP_010314823.1|  PREDICTED: U-box domain-containing protein 3...    719   0.0      
ref|XP_011070514.1|  PREDICTED: U-box domain-containing protein 5...    720   0.0      
gb|EYU46472.1|  hypothetical protein MIMGU_mgv1a002470mg                717   0.0      
ref|XP_004305624.1|  PREDICTED: U-box domain-containing protein 5...    717   0.0      
ref|XP_009412924.1|  PREDICTED: U-box domain-containing protein 3...    718   0.0      
ref|XP_010648364.1|  PREDICTED: U-box domain-containing protein 5...    714   0.0      
ref|XP_008445509.1|  PREDICTED: U-box domain-containing protein 5...    712   0.0      
ref|XP_010669367.1|  PREDICTED: U-box domain-containing protein 5...    709   0.0      
ref|XP_010491956.1|  PREDICTED: U-box domain-containing protein 5...    704   0.0      
ref|XP_002533173.1|  kinase, putative                                   705   0.0      Ricinus communis
gb|KGN47604.1|  hypothetical protein Csa_6G363600                       704   0.0      
ref|XP_010419784.1|  PREDICTED: U-box domain-containing protein 5...    701   0.0      
ref|XP_010453263.1|  PREDICTED: U-box domain-containing protein 5...    701   0.0      
ref|XP_004167209.1|  PREDICTED: U-box domain-containing protein 5...    702   0.0      
ref|XP_008808214.1|  PREDICTED: U-box domain-containing protein 52      702   0.0      
ref|XP_008220512.1|  PREDICTED: U-box domain-containing protein 3...    700   0.0      
ref|XP_007226500.1|  hypothetical protein PRUPE_ppa026359mg             699   0.0      
ref|XP_008220511.1|  PREDICTED: U-box domain-containing protein 5...    699   0.0      
ref|XP_010925037.1|  PREDICTED: U-box domain-containing protein 52      701   0.0      
ref|XP_008365052.1|  PREDICTED: U-box domain-containing protein 5...    697   0.0      
ref|XP_009334725.1|  PREDICTED: U-box domain-containing protein 3...    697   0.0      
ref|XP_002873544.1|  kinase                                             695   0.0      
ref|XP_004144270.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    695   0.0      
gb|KFK25461.1|  hypothetical protein AALP_AA8G117900                    691   0.0      
emb|CAB87673.1|  putative receptor-like kinase                          691   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011009941.1|  PREDICTED: U-box domain-containing protein 3...    692   0.0      
ref|NP_196761.2|  Protein kinase protein with adenine nucleotide ...    690   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289405.1|  hypothetical protein CARUB_v10002905mg             688   0.0      
ref|XP_006399719.1|  hypothetical protein EUTSA_v10012830mg             686   0.0      
ref|XP_002324143.2|  kinase family protein                              685   0.0      Populus trichocarpa [western balsam poplar]
gb|KCW79251.1|  hypothetical protein EUGRSUZ_C00670                     681   0.0      
ref|XP_010519836.1|  PREDICTED: U-box domain-containing protein 5...    682   0.0      
ref|XP_009365576.1|  PREDICTED: U-box domain-containing protein 5...    681   0.0      
emb|CDX97160.1|  BnaC09g44650D                                          679   0.0      
ref|XP_011019410.1|  PREDICTED: U-box domain-containing protein 35      678   0.0      
ref|XP_009121891.1|  PREDICTED: U-box domain-containing protein 5...    675   0.0      
ref|XP_010262238.1|  PREDICTED: U-box domain-containing protein 52      672   0.0      
ref|XP_010050404.1|  PREDICTED: U-box domain-containing protein 5...    676   0.0      
ref|XP_011094049.1|  PREDICTED: U-box domain-containing protein 3...    673   0.0      
ref|XP_009388676.1|  PREDICTED: U-box domain-containing protein 5...    672   0.0      
dbj|BAK03904.1|  predicted protein                                      672   0.0      
ref|XP_010491957.1|  PREDICTED: U-box domain-containing protein 5...    667   0.0      
emb|CCM07282.1|  putative Serine threonine kinase 1-l                   669   0.0      
ref|XP_009618440.1|  PREDICTED: U-box domain-containing protein 35      670   0.0      
ref|XP_010915203.1|  PREDICTED: U-box domain-containing protein 5...    669   0.0      
ref|XP_010419785.1|  PREDICTED: U-box domain-containing protein 5...    664   0.0      
ref|XP_010453264.1|  PREDICTED: U-box domain-containing protein 5...    662   0.0      
ref|XP_010252202.1|  PREDICTED: U-box domain-containing protein 3...    665   0.0      
ref|XP_008445511.1|  PREDICTED: U-box domain-containing protein 5...    660   0.0      
ref|XP_004969416.1|  PREDICTED: U-box domain-containing protein 3...    660   0.0      
ref|XP_002308542.2|  hypothetical protein POPTR_0006s24180g             660   0.0      Populus trichocarpa [western balsam poplar]
emb|CAN69465.1|  hypothetical protein VITISV_023046                     660   0.0      Vitis vinifera
ref|XP_010252203.1|  PREDICTED: U-box domain-containing protein 3...    659   0.0      
ref|XP_010928974.1|  PREDICTED: U-box domain-containing protein 3...    657   0.0      
gb|KDP34071.1|  hypothetical protein JCGZ_07642                         655   0.0      
ref|XP_008782816.1|  PREDICTED: U-box domain-containing protein 3...    656   0.0      
gb|AFO66517.1|  putative kinase                                         672   0.0      
ref|XP_007137133.1|  hypothetical protein PHAVU_009G102500g             653   0.0      
ref|XP_003569258.2|  PREDICTED: U-box domain-containing protein 3...    652   0.0      
emb|CDM83211.1|  unnamed protein product                                651   0.0      
gb|KFK25460.1|  hypothetical protein AALP_AA8G117900                    646   0.0      
ref|XP_008368671.1|  PREDICTED: U-box domain-containing protein 3...    650   0.0      
dbj|BAK03771.1|  predicted protein                                      647   0.0      
ref|NP_001046304.1|  Os02g0218400                                       647   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007137134.1|  hypothetical protein PHAVU_009G102500g             649   0.0      
ref|XP_008654459.1|  PREDICTED: uncharacterized protein LOC100216...    646   0.0      
ref|XP_004951440.1|  PREDICTED: U-box domain-containing protein 5...    641   0.0      
ref|XP_006647075.1|  PREDICTED: U-box domain-containing protein 5...    641   0.0      
ref|XP_008654456.1|  PREDICTED: uncharacterized protein LOC100216...    642   0.0      
ref|XP_002453538.1|  hypothetical protein SORBIDRAFT_04g007620          641   0.0      Sorghum bicolor [broomcorn]
ref|XP_008654458.1|  PREDICTED: uncharacterized protein LOC100216...    641   0.0      
ref|XP_008654457.1|  PREDICTED: uncharacterized protein LOC100216...    641   0.0      
gb|KCW80744.1|  hypothetical protein EUGRSUZ_C02137                     639   0.0      
ref|XP_010519837.1|  PREDICTED: U-box domain-containing protein 5...    637   0.0      
ref|XP_010424341.1|  PREDICTED: U-box domain-containing protein 5...    638   0.0      
ref|XP_003571113.1|  PREDICTED: U-box domain-containing protein 3...    638   0.0      
ref|XP_002874302.1|  predicted protein                                  637   0.0      
ref|XP_007216833.1|  hypothetical protein PRUPE_ppa022664mg             638   0.0      
gb|KHN18232.1|  U-box domain-containing protein 52                      638   0.0      
ref|XP_009121892.1|  PREDICTED: U-box domain-containing protein 5...    633   0.0      
emb|CDX91180.1|  BnaC02g04170D                                          642   0.0      
ref|XP_007216961.1|  hypothetical protein PRUPE_ppa015558mg             637   0.0      
ref|XP_008679842.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    635   0.0      
ref|XP_009375498.1|  PREDICTED: U-box domain-containing protein 5...    636   0.0      
ref|XP_006582487.1|  PREDICTED: U-box domain-containing protein 5...    636   0.0      
ref|XP_010493873.1|  PREDICTED: U-box domain-containing protein 5...    632   0.0      
gb|KHN16327.1|  U-box domain-containing protein 52                      632   0.0      
gb|ACE75946.1|  calcium-dependent protein kinase                        632   0.0      Camellia sinensis [black tea]
ref|XP_004501455.1|  PREDICTED: U-box domain-containing protein 3...    631   0.0      
ref|XP_006394859.1|  hypothetical protein EUTSA_v10005575mg             629   0.0      
gb|AID16034.1|  putative universal stress protein                       632   0.0      
ref|NP_197987.1|  protein kinase                                        629   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125843.1|  PREDICTED: U-box domain-containing protein 51      643   0.0      
ref|XP_006466153.1|  PREDICTED: U-box domain-containing protein 5...    630   0.0      
ref|XP_006850971.1|  hypothetical protein AMTR_s00025p00206220          631   0.0      
ref|XP_003545424.1|  PREDICTED: U-box domain-containing protein 5...    633   0.0      
ref|XP_004501454.1|  PREDICTED: U-box domain-containing protein 3...    627   0.0      
ref|XP_008228381.1|  PREDICTED: U-box domain-containing protein 35      630   0.0      
ref|XP_006289371.1|  hypothetical protein CARUB_v10002865mg             624   0.0      
gb|KDO65137.1|  hypothetical protein CISIN_1g005343mg                   625   0.0      
gb|EYU22082.1|  hypothetical protein MIMGU_mgv1a001807mg                625   0.0      
gb|EYU39810.1|  hypothetical protein MIMGU_mgv1a024838mg                624   0.0      
ref|XP_004501223.1|  PREDICTED: U-box domain-containing protein 3...    624   0.0      
ref|XP_007161131.1|  hypothetical protein PHAVU_001G045100g             617   0.0      
gb|ACN33899.1|  unknown                                                 613   0.0      Zea mays [maize]
ref|XP_010247378.1|  PREDICTED: U-box domain-containing protein 3...    607   0.0      
ref|XP_008462338.1|  PREDICTED: U-box domain-containing protein 3...    612   0.0      
gb|EMS62362.1|  U-box domain-containing protein 52                      610   0.0      
gb|KDO73524.1|  hypothetical protein CISIN_1g008365mg                   606   0.0      
ref|XP_009801055.1|  PREDICTED: U-box domain-containing protein 5...    613   0.0      
ref|XP_008462336.1|  PREDICTED: U-box domain-containing protein 3...    610   0.0      
gb|KDP25035.1|  hypothetical protein JCGZ_22570                         616   0.0      
ref|XP_004954165.1|  PREDICTED: U-box domain-containing protein 3...    607   0.0      
gb|KCW70920.1|  hypothetical protein EUGRSUZ_F04036                     603   0.0      
ref|XP_006285266.1|  hypothetical protein CARUB_v10006638mg             616   0.0      
ref|XP_009616384.1|  PREDICTED: U-box domain-containing protein 5...    605   0.0      
ref|XP_004141807.1|  PREDICTED: U-box domain-containing protein 5...    603   0.0      
ref|XP_006355246.1|  PREDICTED: U-box domain-containing protein 3...    604   0.0      
ref|XP_004245436.1|  PREDICTED: U-box domain-containing protein 5...    603   0.0      
ref|XP_010234042.1|  PREDICTED: U-box domain-containing protein 3...    600   0.0      
gb|AAD40140.1|AF149413_21  contains similarity to protein kinase ...    600   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009418576.1|  PREDICTED: U-box domain-containing protein 3...    602   0.0      
ref|XP_010669507.1|  PREDICTED: U-box domain-containing protein 52      603   0.0      
ref|XP_009801054.1|  PREDICTED: U-box domain-containing protein 5...    603   0.0      
ref|XP_009590270.1|  PREDICTED: U-box domain-containing protein 5...    601   0.0      
gb|KGN45512.1|  hypothetical protein Csa_7G450690                       602   0.0      
gb|AES73422.2|  adenine nucleotide alpha hydrolase-like domain ki...    598   0.0      
ref|XP_004501456.1|  PREDICTED: U-box domain-containing protein 3...    594   0.0      
ref|XP_009590275.1|  PREDICTED: U-box domain-containing protein 5...    596   0.0      
ref|XP_003603171.1|  U-box domain-containing protein                    593   0.0      
ref|XP_009616383.1|  PREDICTED: U-box domain-containing protein 5...    592   0.0      
ref|XP_011081656.1|  PREDICTED: U-box domain-containing protein 51      586   0.0      
ref|XP_007161130.1|  hypothetical protein PHAVU_001G045100g             583   0.0      
gb|AES59157.2|  adenine nucleotide alpha hydrolase-like domain ki...    585   0.0      
ref|XP_003588906.1|  U-box domain-containing protein                    585   0.0      
emb|CDY67812.1|  BnaAnng25230D                                          578   0.0      
ref|XP_007024548.1|  Kinase protein with adenine nucleotide alpha...    585   0.0      
ref|XP_004305505.1|  PREDICTED: U-box domain-containing protein 3...    595   0.0      
tpg|DAA58697.1|  TPA: putative protein kinase superfamily protein       571   0.0      
ref|XP_007217395.1|  hypothetical protein PRUPE_ppa025268mg             583   0.0      
ref|XP_007024547.1|  Kinase protein with adenine nucleotide alpha...    583   0.0      
ref|XP_006843202.1|  hypothetical protein AMTR_s00146p00101680          580   0.0      
ref|XP_006374811.1|  hypothetical protein POPTR_0014s01190g             578   0.0      
ref|NP_001136486.1|  uncharacterized protein LOC100216601               575   0.0      Zea mays [maize]
ref|XP_006374752.1|  kinase family protein                              577   0.0      
ref|XP_011019963.1|  PREDICTED: U-box domain-containing protein 3...    575   0.0      
ref|XP_010656707.1|  PREDICTED: U-box domain-containing protein 5...    579   0.0      
ref|XP_002309024.1|  kinase family protein                              575   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010656706.1|  PREDICTED: U-box domain-containing protein 5...    579   0.0      
ref|XP_010656705.1|  PREDICTED: U-box domain-containing protein 5...    579   0.0      
ref|NP_198388.1|  protein kinase protein with adenine nucleotide ...    576   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009779108.1|  PREDICTED: U-box domain-containing protein 3...    576   0.0      
ref|XP_002521369.1|  kinase, putative                                   576   0.0      Ricinus communis
ref|XP_008672352.1|  PREDICTED: uncharacterized LOC100272561 isof...    573   0.0      
ref|NP_001140500.1|  uncharacterized LOC100272561                       573   0.0      Zea mays [maize]
gb|KCW69804.1|  hypothetical protein EUGRSUZ_F03165                     573   0.0      
ref|XP_002455839.1|  hypothetical protein SORBIDRAFT_03g026030          572   0.0      Sorghum bicolor [broomcorn]
ref|XP_010913853.1|  PREDICTED: U-box domain-containing protein 3...    572   0.0      
ref|XP_008381640.1|  PREDICTED: U-box domain-containing protein 5...    573   0.0      
gb|EMS65140.1|  U-box domain-containing protein 34                      572   0.0      
ref|XP_007011461.1|  Kinase protein with adenine nucleotide alpha...    570   0.0      
ref|XP_010325202.1|  PREDICTED: U-box domain-containing protein 5...    567   0.0      
ref|XP_009354312.1|  PREDICTED: U-box domain-containing protein 3...    569   0.0      
gb|KDP33410.1|  hypothetical protein JCGZ_06981                         569   0.0      
ref|XP_010263442.1|  PREDICTED: U-box domain-containing protein 3...    570   0.0      
ref|XP_009353332.1|  PREDICTED: U-box domain-containing protein 3...    567   0.0      
ref|XP_006483740.1|  PREDICTED: U-box domain-containing protein 5...    568   0.0      
ref|XP_006360651.1|  PREDICTED: U-box domain-containing protein 3...    567   0.0      
ref|XP_008219968.1|  PREDICTED: U-box domain-containing protein 52      566   0.0      
ref|XP_009353318.1|  PREDICTED: U-box domain-containing protein 3...    566   0.0      
ref|XP_008357473.1|  PREDICTED: U-box domain-containing protein 3...    566   0.0      
gb|EYU25756.1|  hypothetical protein MIMGU_mgv1a001768mg                566   0.0      
ref|XP_008378145.1|  PREDICTED: U-box domain-containing protein 35      566   0.0      
ref|XP_010321639.1|  PREDICTED: U-box domain-containing protein 3...    567   0.0      
ref|XP_008466286.1|  PREDICTED: U-box domain-containing protein 5...    562   0.0      
ref|XP_008361051.1|  PREDICTED: U-box domain-containing protein 3...    564   0.0      
ref|XP_008228017.1|  PREDICTED: U-box domain-containing protein 3...    564   0.0      
ref|XP_007225224.1|  hypothetical protein PRUPE_ppa001920mg             561   0.0      
gb|KEH39700.1|  adenine nucleotide alpha hydrolase-like domain ki...    563   0.0      
gb|KHM99859.1|  U-box domain-containing protein 35                      562   0.0      
ref|XP_006580498.1|  PREDICTED: U-box domain-containing protein 3...    562   0.0      
ref|XP_008466285.1|  PREDICTED: U-box domain-containing protein 5...    561   0.0      
gb|KGN60182.1|  hypothetical protein Csa_3G882930                       561   0.0      
gb|EAZ12456.1|  hypothetical protein OsJ_02353                          560   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_011002967.1|  PREDICTED: U-box domain-containing protein 3...    560   0.0      
ref|XP_002518240.1|  ATP binding protein, putative                      561   0.0      Ricinus communis
ref|XP_006371832.1|  hypothetical protein POPTR_0018s04050g             558   0.0      
emb|CDP12490.1|  unnamed protein product                                560   0.0      
ref|XP_006580497.1|  PREDICTED: U-box domain-containing protein 3...    561   0.0      
ref|NP_001043411.1|  Os01g0581400                                       559   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010106940.1|  U-box domain-containing protein 35                 559   0.0      
ref|XP_008228827.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    558   0.0      
ref|XP_010648456.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    560   0.0      
ref|XP_008781718.1|  PREDICTED: U-box domain-containing protein 3...    557   0.0      
ref|XP_010927278.1|  PREDICTED: U-box domain-containing protein 5...    558   0.0      
ref|XP_011006664.1|  PREDICTED: U-box domain-containing protein 3...    556   0.0      
ref|XP_011006665.1|  PREDICTED: U-box domain-containing protein 3...    555   0.0      
ref|XP_011082098.1|  PREDICTED: U-box domain-containing protein 3...    552   0.0      
ref|XP_008781717.1|  PREDICTED: U-box domain-containing protein 3...    556   0.0      
ref|XP_011006666.1|  PREDICTED: U-box domain-containing protein 3...    555   0.0      
ref|XP_009590276.1|  PREDICTED: U-box domain-containing protein 5...    553   0.0      
ref|XP_007014562.1|  Kinase protein with adenine nucleotide alpha...    548   0.0      
ref|XP_010527112.1|  PREDICTED: U-box domain-containing protein 5...    556   0.0      
ref|XP_006584790.1|  PREDICTED: U-box domain-containing protein 3...    556   0.0      
gb|KHN16699.1|  U-box domain-containing protein 35                      556   0.0      
ref|XP_009396581.1|  PREDICTED: U-box domain-containing protein 3...    554   0.0      
ref|XP_006382208.1|  hypothetical protein POPTR_0006s29380g             555   0.0      
gb|EMT25251.1|  Lycopene epsilon cyclase, chloroplastic                 568   0.0      
ref|XP_011082097.1|  PREDICTED: U-box domain-containing protein 3...    552   0.0      
ref|XP_009362073.1|  PREDICTED: U-box domain-containing protein 35      552   0.0      
ref|XP_009396685.1|  PREDICTED: U-box domain-containing protein 5...    553   0.0      
ref|XP_010669606.1|  PREDICTED: U-box domain-containing protein 3...    555   0.0      
ref|XP_008391475.1|  PREDICTED: U-box domain-containing protein 3...    553   0.0      
ref|XP_010669604.1|  PREDICTED: U-box domain-containing protein 3...    555   0.0      
ref|XP_008798198.1|  PREDICTED: U-box domain-containing protein 52      553   0.0      
ref|XP_006404968.1|  hypothetical protein EUTSA_v10000051mg             553   0.0      
ref|XP_010112125.1|  U-box domain-containing protein 35                 552   0.0      
ref|XP_011082095.1|  PREDICTED: U-box domain-containing protein 3...    551   0.0      
gb|EPS65707.1|  hypothetical protein M569_09070                         549   1e-180   
ref|XP_002880578.1|  kinase                                             551   1e-180   
ref|XP_010548525.1|  PREDICTED: U-box domain-containing protein 3...    551   1e-180   
ref|XP_010654499.1|  PREDICTED: U-box domain-containing protein 5...    547   2e-180   
ref|XP_010419304.1|  PREDICTED: U-box domain-containing protein 5...    542   2e-180   
ref|XP_009385916.1|  PREDICTED: U-box domain-containing protein 5...    549   2e-180   
emb|CDY24991.1|  BnaC02g40170D                                          548   2e-180   
ref|XP_010542113.1|  PREDICTED: U-box domain-containing protein 52      553   2e-180   
ref|XP_010548527.1|  PREDICTED: U-box domain-containing protein 3...    550   2e-180   
ref|XP_009130043.1|  PREDICTED: U-box domain-containing protein 51      548   2e-180   
ref|XP_010548526.1|  PREDICTED: U-box domain-containing protein 3...    550   3e-180   
emb|CDY05538.1|  BnaA02g31530D                                          548   3e-180   
ref|XP_010654498.1|  PREDICTED: U-box domain-containing protein 5...    548   4e-180   
ref|XP_009340706.1|  PREDICTED: U-box domain-containing protein 5...    550   5e-180   
ref|XP_007014561.1|  Kinase protein with adenine nucleotide alpha...    550   5e-180   
ref|XP_006450083.1|  hypothetical protein CICLE_v10010213mg             561   6e-180   
ref|XP_003588643.1|  Protein kinase catalytic domain-containing p...    539   6e-180   
ref|XP_002870429.1|  kinase family protein                              548   8e-180   
gb|AFX60112.1|  phytophthora resistance protein RpsWD15-2               543   1e-179   
gb|KHN29704.1|  U-box domain-containing protein 35                      536   1e-179   
ref|NP_180014.2|  adenine nucleotide alpha hydrolase domain-conta...    549   1e-179   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32639.1|  hypothetical protein AALP_AA6G269400                    549   1e-179   
gb|EAZ24876.1|  hypothetical protein OsJ_08656                          548   1e-179   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006579059.1|  PREDICTED: U-box domain-containing protein 5...    548   1e-179   
gb|AAD18110.1|  putative protein kinase                                 550   2e-179   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009140543.1|  PREDICTED: U-box domain-containing protein 52      547   2e-179   
ref|XP_009372417.1|  PREDICTED: U-box domain-containing protein 5...    547   3e-179   
ref|XP_006296408.1|  hypothetical protein CARUB_v10025585mg             548   3e-179   
ref|XP_007160217.1|  hypothetical protein PHAVU_002G302700g             546   6e-179   
ref|XP_008374014.1|  PREDICTED: U-box domain-containing protein 3...    547   9e-179   
emb|CDY20308.1|  BnaC04g36480D                                          547   9e-179   
gb|EYU29341.1|  hypothetical protein MIMGU_mgv1a002420mg                543   9e-179   
ref|XP_008372808.1|  PREDICTED: U-box domain-containing protein 5...    546   2e-178   
ref|XP_006597079.1|  PREDICTED: U-box domain-containing protein 3...    546   2e-178   
ref|XP_010417189.1|  PREDICTED: U-box domain-containing protein 5...    546   3e-178   
ref|XP_009762627.1|  PREDICTED: U-box domain-containing protein 3...    532   3e-178   
gb|KDO62030.1|  hypothetical protein CISIN_1g035604mg                   545   3e-178   
gb|AES73812.2|  adenine nucleotide alpha hydrolase-like domain ki...    545   3e-178   
ref|XP_006453185.1|  hypothetical protein CICLE_v10010281mg             543   4e-178   
ref|XP_009380166.1|  PREDICTED: U-box domain-containing protein 5...    543   5e-178   
ref|XP_003603561.1|  U-box domain-containing protein                    546   6e-178   
ref|XP_007214779.1|  hypothetical protein PRUPE_ppa023720mg             542   6e-178   
ref|XP_010447602.1|  PREDICTED: U-box domain-containing protein 3...    543   1e-177   
dbj|BAB11488.1|  receptor-like protein kinase                           540   1e-177   
ref|XP_010447603.1|  PREDICTED: U-box domain-containing protein 3...    543   1e-177   
emb|CDY46145.1|  BnaA04g14330D                                          542   2e-177   
gb|EEC74143.1|  hypothetical protein OsI_09217                          541   5e-177   
emb|CDY34775.1|  BnaA09g41420D                                          542   5e-177   
ref|NP_001048340.1|  Os02g0787200                                       541   5e-177   
ref|XP_009117133.1|  PREDICTED: U-box domain-containing protein 5...    542   5e-177   
ref|XP_008337010.1|  PREDICTED: U-box domain-containing protein 3...    534   6e-177   
gb|AFW64200.1|  putative protein kinase superfamily protein             534   6e-177   
ref|XP_006601602.1|  PREDICTED: U-box domain-containing protein 5...    542   6e-177   
gb|EYU39578.1|  hypothetical protein MIMGU_mgv1a004000mg                533   6e-177   
ref|XP_002867309.1|  kinase family protein                              541   8e-177   
emb|CDY55241.1|  BnaC02g44910D                                          540   8e-177   
ref|XP_008228685.1|  PREDICTED: U-box domain-containing protein 5...    542   9e-177   
gb|KHN22379.1|  U-box domain-containing protein 35                      543   1e-176   
emb|CDY33692.1|  BnaC04g29590D                                          539   1e-176   
ref|XP_006649113.1|  PREDICTED: U-box domain-containing protein 5...    540   1e-176   
gb|KGN61212.1|  hypothetical protein Csa_2G070290                       533   2e-176   
gb|KGN62856.1|  hypothetical protein Csa_2G377920                       541   2e-176   
ref|XP_003630605.1|  U-box domain-containing protein                    541   2e-176   
ref|XP_010472443.1|  PREDICTED: U-box domain-containing protein 5...    541   2e-176   
ref|XP_003523647.1|  PREDICTED: U-box domain-containing protein 3...    538   3e-176   
ref|XP_009417309.1|  PREDICTED: U-box domain-containing protein 5...    538   4e-176   
ref|XP_007161331.1|  hypothetical protein PHAVU_001G060600g             539   5e-176   
ref|XP_006595204.1|  PREDICTED: U-box domain-containing protein 3...    539   5e-176   
emb|CDP18079.1|  unnamed protein product                                540   6e-176   
ref|XP_003630607.1|  U-box domain-containing protein                    540   6e-176   
gb|AET05083.2|  adenine nucleotide alpha hydrolase-like domain ki...    538   7e-176   
ref|XP_010438066.1|  PREDICTED: U-box domain-containing protein 3...    538   8e-176   
ref|XP_010438068.1|  PREDICTED: U-box domain-containing protein 3...    538   9e-176   
ref|XP_010438067.1|  PREDICTED: U-box domain-containing protein 3...    538   1e-175   
ref|XP_010432890.1|  PREDICTED: U-box domain-containing protein 3...    537   2e-175   
ref|XP_010432888.1|  PREDICTED: U-box domain-containing protein 3...    537   3e-175   
gb|KHN24375.1|  U-box domain-containing protein 35                      537   3e-175   
gb|EPS61916.1|  hypothetical protein M569_12876                         537   4e-175   
ref|XP_004305504.1|  PREDICTED: U-box domain-containing protein 3...    537   4e-175   
gb|ACN25241.1|  unknown                                                 522   5e-175   
ref|XP_006403083.1|  hypothetical protein EUTSA_v10003492mg             535   7e-175   
gb|KEH27279.1|  adenine nucleotide alpha hydrolase-like domain ki...    537   8e-175   
emb|CDY64004.1|  BnaCnng42950D                                          534   9e-175   
ref|XP_008231955.1|  PREDICTED: U-box domain-containing protein 5...    536   9e-175   
ref|XP_007136848.1|  hypothetical protein PHAVU_009G0793001g            528   9e-175   
ref|NP_194851.2|  Protein kinase protein with adenine nucleotide ...    535   1e-174   
ref|XP_003564167.1|  PREDICTED: U-box domain-containing protein 5...    536   1e-174   
emb|CDY60522.1|  BnaAnng16890D                                          534   1e-174   
ref|XP_009124445.1|  PREDICTED: U-box domain-containing protein 3...    534   2e-174   
gb|AFW64201.1|  putative protein kinase superfamily protein             534   2e-174   
ref|XP_002452944.1|  hypothetical protein SORBIDRAFT_04g035360          535   3e-174   
emb|CBI20673.3|  unnamed protein product                                531   3e-174   
ref|XP_008448004.1|  PREDICTED: U-box domain-containing protein 3...    535   3e-174   
ref|XP_006572917.1|  PREDICTED: U-box domain-containing protein 5...    535   4e-174   
ref|XP_002513301.1|  ATP binding protein, putative                      533   1e-173   
emb|CDY59782.1|  BnaCnng35580D                                          531   1e-173   
ref|XP_006468244.1|  PREDICTED: U-box domain-containing protein 3...    533   1e-173   
ref|XP_004152889.1|  PREDICTED: U-box domain-containing protein 3...    535   1e-173   
ref|XP_004305476.1|  PREDICTED: U-box domain-containing protein 3...    533   1e-173   
gb|ACR38284.1|  unknown                                                 523   2e-173   
ref|XP_009108027.1|  PREDICTED: U-box domain-containing protein 35      531   2e-173   
ref|XP_006450025.1|  hypothetical protein CICLE_v10013950mg             531   2e-173   
gb|EAY99981.1|  hypothetical protein OsI_21985                          531   4e-173   
ref|XP_009417522.1|  PREDICTED: U-box domain-containing protein 52      526   4e-173   
ref|XP_006474648.1|  PREDICTED: U-box domain-containing protein 3...    543   6e-173   
ref|XP_004163060.1|  PREDICTED: U-box domain-containing protein 3...    535   7e-173   
ref|XP_004513116.1|  PREDICTED: U-box domain-containing protein 5...    532   7e-173   
gb|KDO48984.1|  hypothetical protein CISIN_1g040785mg                   531   7e-173   
ref|XP_004513115.1|  PREDICTED: U-box domain-containing protein 5...    532   8e-173   
emb|CBI35918.3|  unnamed protein product                                528   9e-173   
ref|XP_010046884.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    530   1e-172   
ref|XP_010065061.1|  PREDICTED: U-box domain-containing protein 5...    529   2e-172   
ref|XP_002520858.1|  ATP binding protein, putative                      529   4e-172   
ref|XP_006412615.1|  hypothetical protein EUTSA_v10026931mg             540   4e-172   
gb|KDP21660.1|  hypothetical protein JCGZ_03331                         528   6e-172   
ref|XP_004172287.1|  PREDICTED: U-box domain-containing protein 5...    528   8e-172   
ref|XP_008460102.1|  PREDICTED: U-box domain-containing protein 3...    530   9e-172   
gb|KHN20156.1|  U-box domain-containing protein 52                      516   1e-171   
gb|KEH39701.1|  adenine nucleotide alpha hydrolase-like domain ki...    525   1e-171   
ref|XP_004964592.1|  PREDICTED: U-box domain-containing protein 3...    528   1e-171   
ref|XP_002437997.1|  hypothetical protein SORBIDRAFT_10g006130          528   1e-171   
ref|XP_006601678.1|  PREDICTED: U-box domain-containing protein 5...    518   1e-171   
ref|XP_006303100.1|  hypothetical protein CARUB_v100212851mg            523   1e-171   
ref|XP_004305796.1|  PREDICTED: U-box domain-containing protein 3...    527   1e-171   
ref|XP_008358252.1|  PREDICTED: U-box domain-containing protein 3...    524   1e-171   
gb|KGN43210.1|  hypothetical protein Csa_7G009060                       528   2e-171   
ref|XP_004488971.1|  PREDICTED: U-box domain-containing protein 3...    527   2e-171   
ref|NP_178015.2|  adenine nucleotide alpha hydrolases-domain cont...    523   4e-171   
dbj|BAC42581.1|  unknown protein                                        523   4e-171   
ref|XP_007216419.1|  hypothetical protein PRUPE_ppa022892mg             525   8e-171   
ref|XP_010429760.1|  PREDICTED: U-box domain-containing protein 5...    525   1e-170   
gb|EEE65245.1|  hypothetical protein OsJ_20418                          526   1e-170   
ref|XP_010472730.1|  PREDICTED: U-box domain-containing protein 5...    524   1e-170   
gb|AAV64214.1|  stk                                                     525   2e-170   
ref|XP_002310353.2|  hypothetical protein POPTR_0007s15230g             524   2e-170   
gb|AAK73111.2|AF391808_21  serine threonine kinase 1                    525   2e-170   
ref|XP_003572885.1|  PREDICTED: U-box domain-containing protein 3...    524   3e-170   
ref|NP_001183778.1|  serine threonine kinase1                           525   3e-170   
ref|XP_008658989.1|  PREDICTED: serine threonine kinase1 isoform X1     525   3e-170   
ref|XP_004305731.1|  PREDICTED: U-box domain-containing protein 5...    523   3e-170   
ref|XP_010417508.1|  PREDICTED: U-box domain-containing protein 5...    522   4e-170   
ref|XP_010050906.1|  PREDICTED: U-box domain-containing protein 52      525   6e-170   
ref|XP_009793817.1|  PREDICTED: U-box domain-containing protein 5...    524   6e-170   
ref|XP_008228731.1|  PREDICTED: U-box domain-containing protein 3...    523   7e-170   
ref|XP_004144908.1|  PREDICTED: U-box domain-containing protein 3...    527   8e-170   
gb|AAC17071.1|  Similar to protein serine/threonine kinase NPK15 ...    523   8e-170   
ref|XP_006304388.1|  hypothetical protein CARUB_v10010903mg             522   8e-170   
ref|XP_009793815.1|  PREDICTED: U-box domain-containing protein 5...    524   9e-170   
ref|XP_009793818.1|  PREDICTED: U-box domain-containing protein 5...    523   9e-170   
ref|XP_009793816.1|  PREDICTED: U-box domain-containing protein 5...    524   1e-169   
ref|NP_001185432.1|  adenine nucleotide alpha hydrolases-domain c...    522   1e-169   
ref|XP_010112459.1|  U-box domain-containing protein 35                 523   2e-169   
emb|CDY13420.1|  BnaA03g51380D                                          521   3e-169   
ref|XP_009149113.1|  PREDICTED: U-box domain-containing protein 3...    521   3e-169   
ref|XP_009137999.1|  PREDICTED: U-box domain-containing protein 35      521   3e-169   
gb|KFK42273.1|  hypothetical protein AALP_AA2G234500                    521   4e-169   
ref|XP_002889221.1|  predicted protein                                  520   4e-169   
ref|XP_004305494.1|  PREDICTED: U-box domain-containing protein 5...    519   5e-169   
ref|XP_009610856.1|  PREDICTED: U-box domain-containing protein 5...    521   7e-169   
ref|XP_009610864.1|  PREDICTED: U-box domain-containing protein 5...    521   7e-169   
ref|XP_006389938.1|  hypothetical protein EUTSA_v10018168mg             520   7e-169   
ref|XP_009610849.1|  PREDICTED: U-box domain-containing protein 5...    521   9e-169   
gb|EYU21347.1|  hypothetical protein MIMGU_mgv1a001411mg                522   1e-168   
ref|XP_006416783.1|  hypothetical protein EUTSA_v10009494mg             518   1e-168   
gb|EAY74665.1|  hypothetical protein OsI_02560                          517   1e-168   
ref|XP_009334996.1|  PREDICTED: U-box domain-containing protein 52      520   1e-168   
ref|XP_011077010.1|  PREDICTED: U-box domain-containing protein 5...    520   1e-168   
ref|XP_010459224.1|  PREDICTED: U-box domain-containing protein 3...    519   2e-168   
ref|XP_010476794.1|  PREDICTED: U-box domain-containing protein 3...    518   3e-168   
ref|XP_011031475.1|  PREDICTED: U-box domain-containing protein 35      520   4e-168   
ref|XP_010429418.1|  PREDICTED: U-box domain-containing protein 3...    503   6e-168   
dbj|BAK06108.1|  predicted protein                                      519   7e-168   
emb|CDY50990.1|  BnaA09g56190D                                          517   1e-167   
ref|XP_002890187.1|  kinase family protein                              517   1e-167   
emb|CDY40035.1|  BnaC05g12800D                                          517   1e-167   
emb|CDO97882.1|  unnamed protein product                                520   1e-167   
ref|XP_010319966.1|  PREDICTED: U-box domain-containing protein 5...    517   2e-167   
ref|XP_007226770.1|  hypothetical protein PRUPE_ppa018572mg             516   2e-167   
ref|XP_009400106.1|  PREDICTED: U-box domain-containing protein 5...    534   4e-167   
ref|XP_009775324.1|  PREDICTED: U-box domain-containing protein 3...    504   6e-167   
emb|CDX81778.1|  BnaC08g38230D                                          514   6e-167   
ref|XP_009379211.1|  PREDICTED: U-box domain-containing protein 52      516   6e-167   
ref|NP_173120.1|  protein kinase protein with adenine nucleotide ...    515   7e-167   
ref|NP_178719.2|  adenine nucleotide alpha hydrolases-domain cont...    512   2e-166   
ref|XP_009118123.1|  PREDICTED: U-box domain-containing protein 5...    513   2e-166   
gb|AAG09082.1|AC026237_3  Similar to protein kinases                    514   2e-166   
ref|XP_010498006.1|  PREDICTED: U-box domain-containing protein 3...    514   2e-166   
ref|XP_009128323.1|  PREDICTED: U-box domain-containing protein 5...    513   2e-166   
ref|XP_006340592.1|  PREDICTED: U-box domain-containing protein 5...    513   4e-166   
ref|XP_009128322.1|  PREDICTED: U-box domain-containing protein 5...    513   1e-165   
ref|XP_009106610.1|  PREDICTED: U-box domain-containing protein 35      511   2e-165   
ref|XP_009624934.1|  PREDICTED: U-box domain-containing protein 5...    513   6e-165   
ref|XP_010537753.1|  PREDICTED: U-box domain-containing protein 3...    510   9e-165   
ref|XP_008223966.1|  PREDICTED: U-box domain-containing protein 35      516   2e-164   
ref|XP_008380441.1|  PREDICTED: U-box domain-containing protein 3...    510   2e-164   
gb|EYU45873.1|  hypothetical protein MIMGU_mgv1a001438mg                510   2e-164   
ref|XP_009110442.1|  PREDICTED: U-box domain-containing protein 3...    508   3e-164   
ref|XP_008347301.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    493   3e-164   
emb|CDX96806.1|  BnaA08g23490D                                          508   3e-164   
ref|XP_006369271.1|  hypothetical protein POPTR_0001s20560g             506   4e-164   
ref|XP_002885825.1|  kinase family protein                              506   5e-164   
ref|XP_010655259.1|  PREDICTED: U-box domain-containing protein 3...    508   6e-164   
ref|XP_011079919.1|  PREDICTED: U-box domain-containing protein 3...    510   7e-164   
gb|KHN32924.1|  U-box domain-containing protein 34                      506   7e-164   
ref|XP_010655258.1|  PREDICTED: U-box domain-containing protein 3...    508   8e-164   
ref|XP_009341594.1|  PREDICTED: U-box domain-containing protein 5...    506   9e-164   
ref|XP_007023630.1|  Kinase protein with adenine nucleotide alpha...    507   2e-163   
ref|XP_010064877.1|  PREDICTED: U-box domain-containing protein 5...    504   8e-163   
gb|EPS69919.1|  hypothetical protein M569_04840                         503   1e-162   
ref|XP_009398619.1|  PREDICTED: U-box domain-containing protein 5...    503   1e-162   
ref|XP_009398618.1|  PREDICTED: U-box domain-containing protein 5...    503   1e-162   
emb|CDX72299.1|  BnaC07g43210D                                          503   5e-162   
ref|XP_011014927.1|  PREDICTED: U-box domain-containing protein 3...    503   6e-162   
gb|EPS61860.1|  hypothetical protein M569_12933                         495   1e-161   
ref|XP_007023631.1|  Kinase protein with adenine nucleotide alpha...    502   1e-161   
ref|XP_008354863.1|  PREDICTED: U-box domain-containing protein 3...    501   3e-161   
emb|CDP04352.1|  unnamed protein product                                498   8e-161   
ref|XP_007152997.1|  hypothetical protein PHAVU_004G177800g             500   1e-160   
ref|XP_002533177.1|  kinase, putative                                   492   1e-160   
emb|CDY25396.1|  BnaA05g18880D                                          499   4e-160   
ref|XP_009145663.1|  PREDICTED: U-box domain-containing protein 35      498   5e-160   
ref|XP_006299724.1|  hypothetical protein CARUB_v10015917mg             496   6e-160   
ref|XP_006286064.1|  hypothetical protein CARUB_v10007597mg             494   8e-160   
emb|CDY29801.1|  BnaC05g31890D                                          497   1e-159   
ref|XP_006396094.1|  hypothetical protein EUTSA_v10003057mg             493   9e-159   
gb|KDP40738.1|  hypothetical protein JCGZ_24737                         482   9e-159   
ref|XP_010545488.1|  PREDICTED: U-box domain-containing protein 3...    494   1e-158   
ref|XP_010545486.1|  PREDICTED: U-box domain-containing protein 3...    494   2e-158   
ref|XP_010467135.1|  PREDICTED: U-box domain-containing protein 3...    492   2e-158   
ref|XP_010087704.1|  U-box domain-containing protein 51                 489   4e-158   
ref|XP_010655257.1|  PREDICTED: U-box domain-containing protein 3...    494   4e-158   
ref|XP_010655256.1|  PREDICTED: U-box domain-containing protein 3...    494   4e-158   
ref|XP_008445579.1|  PREDICTED: U-box domain-containing protein 51      495   5e-158   
ref|XP_010490182.1|  PREDICTED: U-box domain-containing protein 3...    491   6e-158   
gb|EPS59004.1|  hypothetical protein M569_15807                         490   6e-158   
gb|AES58877.2|  adenine nucleotide alpha hydrolase-like domain ki...    492   7e-158   
gb|KHN30795.1|  U-box domain-containing protein 35                      491   8e-158   
emb|CDX87421.1|  BnaA07g34520D                                          508   1e-157   
ref|XP_003588626.1|  U-box domain-containing protein                    492   1e-157   
emb|CDX88492.1|  BnaC06g39360D                                          508   1e-157   
gb|KFK39345.1|  hypothetical protein AALP_AA3G232100                    491   5e-157   
ref|XP_006843910.1|  hypothetical protein AMTR_s00007p00268730          488   1e-156   
ref|XP_010424666.1|  PREDICTED: U-box domain-containing protein 3...    488   1e-156   
emb|CDY70022.1|  BnaCnng66370D                                          475   2e-156   
emb|CDX83940.1|  BnaC08g17050D                                          506   3e-156   
gb|KCW70921.1|  hypothetical protein EUGRSUZ_F04037                     481   3e-156   
ref|XP_007136849.1|  hypothetical protein PHAVU_009G0793001g            479   4e-156   
gb|AAC13610.1|  similar to eukaryotic protein kinase domains (Pfa...    475   9e-156   
ref|XP_007135498.1|  hypothetical protein PHAVU_010G134200g             484   2e-155   
ref|XP_006406411.1|  hypothetical protein EUTSA_v10020098mg             486   2e-155   
ref|XP_006357469.1|  PREDICTED: U-box domain-containing protein 3...    487   3e-155   
ref|XP_010450373.1|  PREDICTED: U-box domain-containing protein 3...    484   4e-155   
ref|XP_010487989.1|  PREDICTED: U-box domain-containing protein 3...    486   4e-155   
ref|XP_010508621.1|  PREDICTED: U-box domain-containing protein 3...    485   6e-155   
ref|XP_010508613.1|  PREDICTED: U-box domain-containing protein 3...    485   6e-155   
ref|XP_010696198.1|  PREDICTED: U-box domain-containing protein 35      487   1e-154   
gb|KHN40317.1|  U-box domain-containing protein 34                      484   1e-154   
ref|XP_010440711.1|  PREDICTED: U-box domain-containing protein 3...    481   3e-154   



>ref|XP_009601900.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Nicotiana tomentosiformis]
Length=695

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/694 (67%), Positives = 557/694 (80%), Gaps = 14/694 (2%)
 Frame = -3

Query  2369  SSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNG---GP  2199
             S DG +  PI VVAVDKDKNSASAVKW VDNLL SNP ++L+HVR K SPN   G    P
Sbjct  4     SDDGGSHRPI-VVAVDKDKNSASAVKWAVDNLLASNPNLVLVHVRIKKSPNPVGGNEAAP  62

Query  2198  DAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
             DA+GG S+     VFTPFRAYSAR+ I++KE  +ED EV+K ++ YIN H V+N+VLGAS
Sbjct  63    DANGGSSNEGTQNVFTPFRAYSARKRIVVKEIVLEDNEVSKGLLDYINGHCVTNIVLGAS  122

Query  2018  SRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLP------THIW  1857
             SRSA+ RK+WT DVPTI+NK AP+FC+VYV+SKG+QQS+RPAA+PLT+        +  W
Sbjct  123   SRSALGRKYWTPDVPTIINKAAPEFCTVYVVSKGRQQSVRPAAKPLTSSAPARQHFSSAW  182

Query  1856  shhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSC  1677
             +    S+  S   S  + + A    I +  +R E               G    P NS  
Sbjct  183   TPSRLSNSESEDISRLSFARAEPKIIESEKTRPEKGPSNVVMDHLHAPSGG---PMNSCS  239

Query  1676  RNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQ  1497
             R SL++ ++LFA I+    + +A  NLDFT+++   +  +  +S  LE+EMKRLKLEL+Q
Sbjct  240   RTSLSDGSELFARINHRSVDISA-DNLDFTQVAIKETTRNGSSSYSLEAEMKRLKLELRQ  298

Query  1496  TMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaamea  1317
             T+DMYN ACKEA+ A ++A+EL + K+EE++RFEQAR AE+AAL + E EKAKC+AA+EA
Sbjct  299   TLDMYNAACKEAVLANQAAEELNKWKMEEARRFEQARLAEDAALAIAETEKAKCRAAIEA  358

Query  1316  aekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSK  1137
             A+KAQK+ E+EAQR KYAE+KAK+E  +KNRA++VLS++D RYRKY+I+EIE AT+ FS 
Sbjct  359   AKKAQKMVEIEAQRRKYAELKAKQEGEKKNRAMNVLSQNDLRYRKYTIEEIEAATKNFSS  418

Query  1136  SMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGAC  957
             S+K+GEGGYGPV++GKLDHTPVAIKVL  DAAQG+KQFQQEVEVLSL+RHPN+VLLLGAC
Sbjct  419   SLKVGEGGYGPVFKGKLDHTPVAIKVLSADAAQGKKQFQQEVEVLSLIRHPNLVLLLGAC  478

Query  956   PEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRD  777
             PEYGCLVYE+M NGSLEDRL RKGNTP+IPWEIRFKI+AEIAT LLFLHQ+KPEPLVHRD
Sbjct  479   PEYGCLVYEFMNNGSLEDRLFRKGNTPSIPWEIRFKIAAEIATGLLFLHQAKPEPLVHRD  538

Query  776   LKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGT  597
             LKPANILLDRN+V KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGKLGT
Sbjct  539   LKPANILLDRNYVCKISDVGLARLVPPSVADTVTQYHMTSAAGTFCYIDPEYQQTGKLGT  598

Query  596   KSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSL  417
             KSDIYSLGVMLLQIITA+PPMGLTHHVERAIEKGTFADLLDPT+  WPVEEAL FAKLSL
Sbjct  599   KSDIYSLGVMLLQIITARPPMGLTHHVERAIEKGTFADLLDPTVQHWPVEEALKFAKLSL  658

Query  416   QCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
             +CAELR KDRPDLGSVI+PELN+LKE+ + S+ S
Sbjct  659   KCAELRMKDRPDLGSVIVPELNKLKEVGINSMPS  692



>ref|XP_009798003.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Nicotiana sylvestris]
Length=696

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/694 (67%), Positives = 558/694 (80%), Gaps = 13/694 (2%)
 Frame = -3

Query  2369  SSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNG---GP  2199
             S DG +     VVAVDKDKNSASAVKW VDNLL +NP ++LLHVR K SPN   G    P
Sbjct  4     SDDGGSHHRPIVVAVDKDKNSASAVKWAVDNLLTTNPNLVLLHVRIKKSPNPGGGNEAAP  63

Query  2198  DAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
             DA+GG SD D   VFTPFRAYSAR+ I++KE  +EDTEV+K +V YIN H V+N+VLGAS
Sbjct  64    DANGGSSDEDTQNVFTPFRAYSARKRIVVKEIVLEDTEVSKGLVDYINGHCVTNIVLGAS  123

Query  2018  SRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL------PTHIW  1857
             SRSA+ RK+WT DVPTI+NK AP+FC+VYV+SKG+QQS+RPAA+PLT+        +  W
Sbjct  124   SRSALGRKYWTPDVPTIINKAAPEFCTVYVVSKGRQQSVRPAAKPLTSSVSARQHSSSAW  183

Query  1856  shhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSC  1677
             +    S+  S   S  + + A    I +  +R E               G    P NS  
Sbjct  184   TPSRLSNSESEDISRLSFARAEPKIIESEKTRPEKGPSNVVIDHLHAPSGG---PMNSCS  240

Query  1676  RNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQ  1497
             R S ++ N+LFA I+    + +A  NLDFT+++   +  +  +S  LE+EMKRLKLEL+Q
Sbjct  241   RTSQSDGNELFARINHRSVDISA-DNLDFTQVAIKETPRNGSSSYTLEAEMKRLKLELRQ  299

Query  1496  TMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaamea  1317
             T+DMYN ACKEA+ A ++A+EL + K+EE++RFEQAR AEEAAL + E EKAKC+AA+EA
Sbjct  300   TLDMYNAACKEAVLANQAAEELNKWKMEEARRFEQARLAEEAALAIAETEKAKCRAAIEA  359

Query  1316  aekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSK  1137
             A+KAQK+AE+EAQR KYAE+KAK+E  +KNRA++VLS++D RYRKY+I+EIE AT+ FS 
Sbjct  360   AKKAQKMAEIEAQRRKYAELKAKREGEKKNRAMNVLSQNDLRYRKYTIEEIEAATKNFSS  419

Query  1136  SMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGAC  957
             S+K+GEGGYGPV++GKLDHTPVAIKVL  DAAQG+KQFQQEVEVLSL+RHPN+VLLLGAC
Sbjct  420   SLKVGEGGYGPVFKGKLDHTPVAIKVLSADAAQGKKQFQQEVEVLSLIRHPNLVLLLGAC  479

Query  956   PEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRD  777
             PEYGCLVYE+M NGSLEDRL RKGNTP+IPWEIRFKI+AEIAT LLFLHQ+KPEPLVHRD
Sbjct  480   PEYGCLVYEFMNNGSLEDRLFRKGNTPSIPWEIRFKIAAEIATGLLFLHQAKPEPLVHRD  539

Query  776   LKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGT  597
             LKPANILLDRN+V KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGKLGT
Sbjct  540   LKPANILLDRNYVCKISDVGLARLVPPSVADTVTQYHMTSAAGTFCYIDPEYQQTGKLGT  599

Query  596   KSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSL  417
             KSD+YSLG+MLLQIITA+PPMGLTHHVERAIEKGTFADLLDPT+ +WPVEEAL FAKLSL
Sbjct  600   KSDVYSLGIMLLQIITARPPMGLTHHVERAIEKGTFADLLDPTVQNWPVEEALKFAKLSL  659

Query  416   QCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
             +CAELR KDRPDLGSVI+PEL++LKE+ + S+ S
Sbjct  660   KCAELRMKDRPDLGSVIVPELSKLKEVGINSMPS  693



>ref|XP_009591658.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Nicotiana tomentosiformis]
Length=691

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/678 (68%), Positives = 549/678 (81%), Gaps = 12/678 (2%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
             T+VAVDKDK+SASAVKW VD+L+ISNP ++L+HVR K S N       ++ G+SD D H 
Sbjct  14    TIVAVDKDKHSASAVKWAVDHLVISNPTLVLVHVRIKNSTNQNGVVQGSNRGLSDQDTHK  73

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             VFTPFRAYSAR+GI +KE  IED EV+K ++ YIN HR++N+VLGASSRSA+SRKFW+HD
Sbjct  74    VFTPFRAYSARKGIAVKEVVIEDIEVSKGLLDYINNHRITNIVLGASSRSALSRKFWSHD  133

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN-----LPT-HIWshhgsssrassrg  1818
             VPTI+NK+APDFC+VYVISKGKQQS+RPAA+P  +     LP+   WS    S+ + S  
Sbjct  134   VPTIINKSAPDFCTVYVISKGKQQSVRPAAKPFASSLSATLPSSQAWSAARLSNYSESSD  193

Query  1817  ssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAP  1638
              S +  +  +  I          G P   S D + D   R P NS  R+S ++D  LFAP
Sbjct  194   VSRSVYTRPEQNIVGSEMMKLKIG-PSNASMD-NLDVHTRDPRNSYSRSSPSDDRGLFAP  251

Query  1637  ISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAI  1458
             +S G  +  A QNLDFT++S   + +SS      E+EM RLKLEL+QT++MYN ACKEA+
Sbjct  252   LSHGSVDITA-QNLDFTQVSVKENCSSSS---SWEAEMNRLKLELRQTLNMYNTACKEAV  307

Query  1457  TAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQ  1278
             +A ++AKEL Q K+EE+ RF+QAR +EEAAL + EMEKAK +AA+EAA+KAQK+AE+EA+
Sbjct  308   SANQTAKELHQWKMEEASRFKQARISEEAALAIAEMEKAKGRAAIEAAQKAQKLAEIEAK  367

Query  1277  RTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVY  1098
             R KYAE+KAK+ T EKN AL+ LS+SD  YRKY+I+EIE AT+ FS S KIGEGGYGPVY
Sbjct  368   RRKYAELKAKRVTEEKNLALNDLSRSDLCYRKYTIEEIEAATKNFSNSEKIGEGGYGPVY  427

Query  1097  RGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMEN  918
             +GKLDHTPVAIKVLR DAAQG KQF+QEV+VL LMRHPNMVLLLGACPEYGCLVYE+M N
Sbjct  428   KGKLDHTPVAIKVLRSDAAQGMKQFKQEVQVLGLMRHPNMVLLLGACPEYGCLVYEFMNN  487

Query  917   GSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFV  738
             GSLEDRL RKGNTP IPWEIRFKI+AEIAT LLFLHQ+KPEPLVHRDLKPANILLD N+ 
Sbjct  488   GSLEDRLFRKGNTPPIPWEIRFKIAAEIATGLLFLHQAKPEPLVHRDLKPANILLDSNYS  547

Query  737   SKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQ  558
              KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQ
Sbjct  548   CKISDVGLARLVPPSVADCVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQ  607

Query  557   IITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDL  378
             IITA+PPMGLTHHVERAIE GTFAD+LDPT+ +WP+EE L++AKLSL+CAELRKKDRPDL
Sbjct  608   IITARPPMGLTHHVERAIENGTFADILDPTVPNWPMEETLNYAKLSLKCAELRKKDRPDL  667

Query  377   GSVILPELNRLKELALQS  324
             GSVILPELN+LKEL + S
Sbjct  668   GSVILPELNKLKELGMNS  685



>ref|XP_009591659.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Nicotiana tomentosiformis]
Length=685

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/678 (69%), Positives = 548/678 (81%), Gaps = 18/678 (3%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
             T+VAVDKDK+SASAVKW VD+L+ISNP ++L+HVR K S N  N G      +SD D H 
Sbjct  14    TIVAVDKDKHSASAVKWAVDHLVISNPTLVLVHVRIKNSTNRSNRG------LSDQDTHK  67

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             VFTPFRAYSAR+GI +KE  IED EV+K ++ YIN HR++N+VLGASSRSA+SRKFW+HD
Sbjct  68    VFTPFRAYSARKGIAVKEVVIEDIEVSKGLLDYINNHRITNIVLGASSRSALSRKFWSHD  127

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN-----LPT-HIWshhgsssrassrg  1818
             VPTI+NK+APDFC+VYVISKGKQQS+RPAA+P  +     LP+   WS    S+ + S  
Sbjct  128   VPTIINKSAPDFCTVYVISKGKQQSVRPAAKPFASSLSATLPSSQAWSAARLSNYSESSD  187

Query  1817  ssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAP  1638
              S +  +  +  I          G P   S D + D   R P NS  R+S ++D  LFAP
Sbjct  188   VSRSVYTRPEQNIVGSEMMKLKIG-PSNASMD-NLDVHTRDPRNSYSRSSPSDDRGLFAP  245

Query  1637  ISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAI  1458
             +S G  +  A QNLDFT++S   + +SS      E+EM RLKLEL+QT++MYN ACKEA+
Sbjct  246   LSHGSVDITA-QNLDFTQVSVKENCSSSS---SWEAEMNRLKLELRQTLNMYNTACKEAV  301

Query  1457  TAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQ  1278
             +A ++AKEL Q K+EE+ RF+QAR +EEAAL + EMEKAK +AA+EAA+KAQK+AE+EA+
Sbjct  302   SANQTAKELHQWKMEEASRFKQARISEEAALAIAEMEKAKGRAAIEAAQKAQKLAEIEAK  361

Query  1277  RTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVY  1098
             R KYAE+KAK+ T EKN AL+ LS+SD  YRKY+I+EIE AT+ FS S KIGEGGYGPVY
Sbjct  362   RRKYAELKAKRVTEEKNLALNDLSRSDLCYRKYTIEEIEAATKNFSNSEKIGEGGYGPVY  421

Query  1097  RGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMEN  918
             +GKLDHTPVAIKVLR DAAQG KQF+QEV+VL LMRHPNMVLLLGACPEYGCLVYE+M N
Sbjct  422   KGKLDHTPVAIKVLRSDAAQGMKQFKQEVQVLGLMRHPNMVLLLGACPEYGCLVYEFMNN  481

Query  917   GSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFV  738
             GSLEDRL RKGNTP IPWEIRFKI+AEIAT LLFLHQ+KPEPLVHRDLKPANILLD N+ 
Sbjct  482   GSLEDRLFRKGNTPPIPWEIRFKIAAEIATGLLFLHQAKPEPLVHRDLKPANILLDSNYS  541

Query  737   SKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQ  558
              KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQ
Sbjct  542   CKISDVGLARLVPPSVADCVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQ  601

Query  557   IITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDL  378
             IITA+PPMGLTHHVERAIE GTFAD+LDPT+ +WP+EE L++AKLSL+CAELRKKDRPDL
Sbjct  602   IITARPPMGLTHHVERAIENGTFADILDPTVPNWPMEETLNYAKLSLKCAELRKKDRPDL  661

Query  377   GSVILPELNRLKELALQS  324
             GSVILPELN+LKEL + S
Sbjct  662   GSVILPELNKLKELGMNS  679



>ref|XP_009780371.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
Length=691

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/678 (68%), Positives = 544/678 (80%), Gaps = 12/678 (2%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
             T+VA+DKDK+SASAVKW VD+L++SNP ++L+HVR K S N       ++ G+SD D   
Sbjct  14    TIVAIDKDKHSASAVKWAVDHLVMSNPTLVLVHVRIKNSTNQNGVVQGSNRGLSDQDTPK  73

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             VFTPFRAYSAR+GI +KE  IED EV+K ++ YIN+HRV+N+VLGASSRSA+SRKFW+HD
Sbjct  74    VFTPFRAYSARKGIAVKEVVIEDIEVSKGLLDYINSHRVTNIVLGASSRSALSRKFWSHD  133

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHI------Wshhgsssrassrg  1818
             VPTI+NK+APDFC+VYVISKGKQQS+RPAA+P  +  +        WS    S+ + S  
Sbjct  134   VPTIINKSAPDFCTVYVISKGKQQSVRPAAKPFASSLSSTLPSSQPWSAARLSNYSESSD  193

Query  1817  ssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAP  1638
              S +  +  +  I          G P   S D + D   + P NS  R+S ++D  LFAP
Sbjct  194   VSRSVYTRPEQNIVGSEMMKPKIG-PSNASMD-NLDVHTKEPKNSYSRSSPSDDRGLFAP  251

Query  1637  ISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAI  1458
             +S G  +    QNLDFT++S   +  SS      E+EM RLKLEL+QT+DMYN ACKEA+
Sbjct  252   LSHGSVDITT-QNLDFTQVSVKDNCCSSS---SWEAEMNRLKLELRQTLDMYNTACKEAV  307

Query  1457  TAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQ  1278
             +A ++AKEL Q K+EE+ RF+QAR +EEAAL   EMEKAK +AA+EAA+KAQK+AE+EA+
Sbjct  308   SANQTAKELHQWKMEEASRFKQARISEEAALASAEMEKAKGRAAIEAAQKAQKLAEIEAK  367

Query  1277  RTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVY  1098
             R KYAE+KAK+ET EKN AL+ LS+SD  YRKY+I+EIE AT+ FS S KIGEGGYGPVY
Sbjct  368   RRKYAELKAKRETEEKNLALNDLSRSDLCYRKYTIEEIEAATKNFSNSEKIGEGGYGPVY  427

Query  1097  RGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMEN  918
             + KLDHTPVAIKVLR DAAQG KQF+QEV+VL LMRHPNMVLLLGACPEYGCLVYE+M N
Sbjct  428   KAKLDHTPVAIKVLRSDAAQGMKQFKQEVQVLGLMRHPNMVLLLGACPEYGCLVYEFMNN  487

Query  917   GSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFV  738
             GSLEDRL RKGNTP IPWEIRFKI+AEIAT LLFLHQ+KPEPLVHRDLKPANILLD N+ 
Sbjct  488   GSLEDRLFRKGNTPPIPWEIRFKIAAEIATGLLFLHQAKPEPLVHRDLKPANILLDSNYS  547

Query  737   SKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQ  558
              KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQ
Sbjct  548   CKISDVGLARLVPPSVADCVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQ  607

Query  557   IITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDL  378
             IITA+PPMGLTHHVERAIE GTFAD+LDPT+ +WP+EE L++AKLSL+CAELRKKDRPDL
Sbjct  608   IITARPPMGLTHHVERAIENGTFADILDPTVPNWPMEETLNYAKLSLKCAELRKKDRPDL  667

Query  377   GSVILPELNRLKELALQS  324
             GSVILPELN+LKEL + S
Sbjct  668   GSVILPELNKLKELGMNS  685



>ref|XP_006350355.1| PREDICTED: U-box domain-containing protein 35-like [Solanum tuberosum]
Length=687

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/686 (66%), Positives = 546/686 (80%), Gaps = 30/686 (4%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNG---GPDAHGGMSDHDG  2166
             VVA+DKDK+S+SAVKW VD+L+ISNP ++L+HVR K SPN   G   G  ++ G+SD D 
Sbjct  15    VVAIDKDKHSSSAVKWAVDHLVISNPALVLVHVRMKNSPNQVGGNGAGQSSNRGLSDQDS  74

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
             H VF PFRAYSAR+GI +KE  IED  V+K ++ YIN + ++NVV+GASSRSA SRKFWT
Sbjct  75    HKVFIPFRAYSARKGIAVKEVIIEDISVSKGLLDYINNYHITNVVVGASSRSAFSRKFWT  134

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN----LPT-HIWshhgsssrassr  1821
             HDVPTIVNK APD+C+VYVISKGKQQS+RPAA+PL +    LP+   WS    S+ +   
Sbjct  135   HDVPTIVNKAAPDYCTVYVISKGKQQSVRPAAKPLASSSARLPSSQPWSAARLSNYSEP-  193

Query  1820  gssaasssAGDDRISACSSRGEHSGRPFRRSEDRDA-----DGSVRRPWNS-SCRNSLAE  1659
                        + IS  + +         +S   +A     D   R P NS + R+S ++
Sbjct  194   -----------EDISRSAYKNSFGPDMMPKSGTSNASIDSLDFYSRDPKNSYTGRSSPSD  242

Query  1658  DNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYN  1479
             D  LFAP+S G  +    QNLDFT++S   + +SS   +   SEM RLKLELKQTMDMYN
Sbjct  243   DTALFAPLSRGSVDVTT-QNLDFTQVSVNDNSSSSSMWE---SEMSRLKLELKQTMDMYN  298

Query  1478  NACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqk  1299
             +ACK+A++A ++AKEL Q K+EE  RF+Q+R +EEAAL M EMEKAK +AA+EAA+K+Q+
Sbjct  299   SACKDAVSANQTAKELHQWKVEEGSRFKQSRISEEAALAMAEMEKAKGRAAVEAAQKSQR  358

Query  1298  iaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGE  1119
             +AE+EA+R +YAE+KA++ET EKN A++ LS+++  YRKY+I+EIE  T+ FS S KIGE
Sbjct  359   LAEIEAKRRRYAELKARRETEEKNLAINDLSRNEICYRKYTIEEIEITTKSFSNSEKIGE  418

Query  1118  GGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCL  939
             GGYGPVY+G+LDHTPVAIKVLR DAAQG +QF+QEV+VL LMRHPNMVLLLGACPEYGCL
Sbjct  419   GGYGPVYKGRLDHTPVAIKVLRSDAAQGMQQFKQEVQVLGLMRHPNMVLLLGACPEYGCL  478

Query  938   VYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANI  759
             VYE+M NGSLEDRL RKGNTP IPWEIRFKI+AEIAT LLFLHQ+KPEPLVHRDLKP NI
Sbjct  479   VYEFMNNGSLEDRLFRKGNTPPIPWEIRFKIAAEIATGLLFLHQAKPEPLVHRDLKPGNI  538

Query  758   LLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYS  579
             LLD N+  KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYS
Sbjct  539   LLDSNYACKISDVGLARLVPPSVADCVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYS  598

Query  578   LGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELR  399
             LGVMLLQIITA+PPMGLTHHVERAIE GTF+D+LDPT+ +WP+EEAL++AKLSL+CAELR
Sbjct  599   LGVMLLQIITARPPMGLTHHVERAIENGTFSDILDPTVPNWPLEEALNYAKLSLKCAELR  658

Query  398   KKDRPDLGSVILPELNRLKELALQSL  321
             KKDRPDLGSVILPEL+RLKEL + SL
Sbjct  659   KKDRPDLGSVILPELSRLKELGMSSL  684



>ref|XP_010322089.1| PREDICTED: U-box domain-containing protein 52-like [Solanum lycopersicum]
Length=674

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/692 (65%), Positives = 539/692 (78%), Gaps = 55/692 (8%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             VVA+DKDK+S+SAVKW VD+L+ISNP ++L+HVR K SPN       ++ G+SD DGH V
Sbjct  15    VVAIDKDKHSSSAVKWAVDHLVISNPALVLVHVRMKNSPNRS-----SNRGLSDQDGHKV  69

Query  2156  FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDV  1977
             F PFRAYSAR+G+I     +ED  V+K ++ YIN + ++NVV+GASSRSA SRKFWTHDV
Sbjct  70    FIPFRAYSARKGVI-----VEDISVSKGLLDYINNYHITNVVVGASSRSAFSRKFWTHDV  124

Query  1976  PTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN----LPT-HIWshhgsssrassrgss  1812
             PTIVNK APD+C+VYVISKGKQQS+RPAA+PL +    LP+   WS              
Sbjct  125   PTIVNKAAPDYCTVYVISKGKQQSVRPAAKPLASSSARLPSSQPWSAA------------  172

Query  1811  aasssAGDDRISACSSRGEHSGRPFRRSEDRD--------------ADGSVRRPWNS-SC  1677
                      R+S  S   + S   ++ S   D              AD   R P NS + 
Sbjct  173   ---------RLSNYSEPEDVSRSAYKNSFGPDMMPKSGTSNASIDSADFYSRDPKNSYTG  223

Query  1676  RNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQ  1497
             R+S  +D   FAP S G  +    +NLDFT+IS   + +SS   +   SEM RLKLELKQ
Sbjct  224   RSSPFDDTGPFAPFSRGSVDVTT-ENLDFTQISVNDNSSSSSMWE---SEMSRLKLELKQ  279

Query  1496  TMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaamea  1317
             TMDMYN+ACK+A++A ++AKEL Q K+EE  RF+Q+R +EEAAL M EMEKAK +AA+EA
Sbjct  280   TMDMYNSACKDAVSANQTAKELNQWKVEEGSRFKQSRISEEAALAMAEMEKAKGRAAVEA  339

Query  1316  aekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSK  1137
             A+K+Q++AE+EA+R KYAE+KA++ET EKN A++ LS+++  YRKY+I+EIE  T+ FS 
Sbjct  340   AQKSQRLAEIEAKRRKYAELKARRETEEKNLAINDLSRNEICYRKYTIEEIEKTTKSFSN  399

Query  1136  SMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGAC  957
             S KIGEGGYGPVY+GKLDHTPVAIKVLR DAAQG +QF+QEV+VL LMRHPNMVLLLGAC
Sbjct  400   SEKIGEGGYGPVYKGKLDHTPVAIKVLRSDAAQGMQQFKQEVQVLGLMRHPNMVLLLGAC  459

Query  956   PEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRD  777
             PEYGCLVYE+M NGSLEDRL RKGNTP IPWEIRFKI+AEIAT LLFLHQ+KPEPLVHRD
Sbjct  460   PEYGCLVYEFMNNGSLEDRLFRKGNTPPIPWEIRFKIAAEIATGLLFLHQAKPEPLVHRD  519

Query  776   LKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGT  597
             LKP NILLD N+  KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGKLGT
Sbjct  520   LKPGNILLDSNYACKISDVGLARLVPPSVADCVTQYHMTSAAGTFCYIDPEYQQTGKLGT  579

Query  596   KSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSL  417
             KSDIYSLGVMLLQIITA+PPMGLTHHVERAIE GTFAD+LDPT+ +WP+EEAL++AKLSL
Sbjct  580   KSDIYSLGVMLLQIITARPPMGLTHHVERAIENGTFADILDPTVPNWPLEEALNYAKLSL  639

Query  416   QCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             +CAELRKKDRPDLGSVILPEL+RLKE+ + SL
Sbjct  640   KCAELRKKDRPDLGSVILPELSRLKEIGMSSL  671



>ref|XP_006342500.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Solanum tuberosum]
Length=684

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/678 (65%), Positives = 539/678 (79%), Gaps = 15/678 (2%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             VVAVDKDK+S+SAVKW +DNLL +N  ++L+HVR K SP       D++GG+SD     V
Sbjct  12    VVAVDKDKSSSSAVKWAIDNLLGNNQSLVLVHVRVKNSPKPT---LDSNGGLSDEGTQNV  68

Query  2156  FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDV  1977
             F PF+AYSAR+ I++KE  IE+TE +K ++ YIN+H VSN+VLGASSRS + RK+WTHDV
Sbjct  69    FIPFKAYSARKRIVVKEIVIENTEASKGLLEYINSHSVSNIVLGASSRSTLGRKYWTHDV  128

Query  1976  PTIVNKTAPDFCSVYVISKGKQQSIRPAARPL-TNLP-----THIWshhgsssrassrgs  1815
             PT+VNK AP+FCSVYV+SKGKQQS+RPAA+ L +++P     +  WS   SS+  S   +
Sbjct  129   PTLVNKAAPEFCSVYVVSKGKQQSVRPAAKSLPSSVPARQPSSSAWSAPRSSNSGSEDST  188

Query  1814  saasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPI  1635
               +   +    + +  +RGE    P     D      +  P+  +   S  + N  +A I
Sbjct  189   RFSYMRSEQKIVESEKTRGEKG--PSIVPIDNLHSPEMTNPYKHA---SQPDGNMRYARI  243

Query  1634  SDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAIT  1455
             S    +  + +NLDFT+++   +  +  +S  +++EMKRLKLEL+QTMDMYN ACKEA+ 
Sbjct  244   SPRSVDMTS-ENLDFTQVAIRETPMNGSSSYSVDAEMKRLKLELRQTMDMYNAACKEAVM  302

Query  1454  AKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQR  1275
             A ++A EL + KIEE+++FEQAR AEEAAL + E EKAKC+AA+EAA+KAQK+AE+EAQR
Sbjct  303   ANQAADELNKWKIEEARKFEQARFAEEAALAIAETEKAKCRAAIEAAKKAQKMAEIEAQR  362

Query  1274  TkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYR  1095
              KYAE+KAK+ET +K +A++V S++D RYRKY+I+EIE AT+KFS + KIGEGGYGPV++
Sbjct  363   RKYAELKAKRETEKKKQAMNVRSQNDIRYRKYTIEEIEAATKKFSNAQKIGEGGYGPVFK  422

Query  1094  GKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENG  915
             GKLDHTPVAIKVL PDAAQG+KQFQQEVEVLSL+RHPN+VLLLGACPEYGCLVYE M NG
Sbjct  423   GKLDHTPVAIKVLSPDAAQGKKQFQQEVEVLSLIRHPNLVLLLGACPEYGCLVYELMNNG  482

Query  914   SLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVS  735
             SLEDRL RKGNTP+IPWEIRFKI+AEIAT LLFLHQSKPEPLVHRDLKP NILLD+N+V 
Sbjct  483   SLEDRLFRKGNTPSIPWEIRFKIAAEIATGLLFLHQSKPEPLVHRDLKPGNILLDKNYVC  542

Query  734   KISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQI  555
             KISDVGLARLVP SVAD VTQYHMTSAAGTFCYIDPEYQQTG+L TKSDIYSLGVMLLQI
Sbjct  543   KISDVGLARLVPSSVADCVTQYHMTSAAGTFCYIDPEYQQTGRLETKSDIYSLGVMLLQI  602

Query  554   ITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLG  375
             ITA+PPMGLTHHVERAIEKG FAD LDPT+ +WPVEEAL FAKLSL+CAELRKKDRPDLG
Sbjct  603   ITARPPMGLTHHVERAIEKGKFADFLDPTVPNWPVEEALKFAKLSLKCAELRKKDRPDLG  662

Query  374   SVILPELNRLKELALQSL  321
             SV++PEL RL E  + S+
Sbjct  663   SVVVPELTRLSEFGMSSM  680



>ref|XP_006342499.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Solanum tuberosum]
Length=685

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/679 (65%), Positives = 541/679 (80%), Gaps = 16/679 (2%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             VVAVDKDK+S+SAVKW +DNLL +N  ++L+HVR K SP       D++GG+SD     V
Sbjct  12    VVAVDKDKSSSSAVKWAIDNLLGNNQSLVLVHVRVKNSPKPT---LDSNGGLSDEGTQNV  68

Query  2156  FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDV  1977
             F PF+AYSAR+ I++KE  IE+TE +K ++ YIN+H VSN+VLGASSRS + RK+WTHDV
Sbjct  69    FIPFKAYSARKRIVVKEIVIENTEASKGLLEYINSHSVSNIVLGASSRSTLGRKYWTHDV  128

Query  1976  PTIVNKTAPDFCSVYVISKGKQQSIRPAARPL-TNLP-----THIWshhgsssrassrgs  1815
             PT+VNK AP+FCSVYV+SKGKQQS+RPAA+ L +++P     +  WS   SS+  S   +
Sbjct  129   PTLVNKAAPEFCSVYVVSKGKQQSVRPAAKSLPSSVPARQPSSSAWSAPRSSNSGSEDST  188

Query  1814  saasssAGDDRI-SACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAP  1638
             S  S    + +I  +  +RGE    P     D      +  P+  +   S  + N  +A 
Sbjct  189   SRFSYMRSEQKIVESEKTRGEKG--PSIVPIDNLHSPEMTNPYKHA---SQPDGNMRYAR  243

Query  1637  ISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAI  1458
             IS    +  + +NLDFT+++   +  +  +S  +++EMKRLKLEL+QTMDMYN ACKEA+
Sbjct  244   ISPRSVDMTS-ENLDFTQVAIRETPMNGSSSYSVDAEMKRLKLELRQTMDMYNAACKEAV  302

Query  1457  TAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQ  1278
              A ++A EL + KIEE+++FEQAR AEEAAL + E EKAKC+AA+EAA+KAQK+AE+EAQ
Sbjct  303   MANQAADELNKWKIEEARKFEQARFAEEAALAIAETEKAKCRAAIEAAKKAQKMAEIEAQ  362

Query  1277  RTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVY  1098
             R KYAE+KAK+ET +K +A++V S++D RYRKY+I+EIE AT+KFS + KIGEGGYGPV+
Sbjct  363   RRKYAELKAKRETEKKKQAMNVRSQNDIRYRKYTIEEIEAATKKFSNAQKIGEGGYGPVF  422

Query  1097  RGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMEN  918
             +GKLDHTPVAIKVL PDAAQG+KQFQQEVEVLSL+RHPN+VLLLGACPEYGCLVYE M N
Sbjct  423   KGKLDHTPVAIKVLSPDAAQGKKQFQQEVEVLSLIRHPNLVLLLGACPEYGCLVYELMNN  482

Query  917   GSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFV  738
             GSLEDRL RKGNTP+IPWEIRFKI+AEIAT LLFLHQSKPEPLVHRDLKP NILLD+N+V
Sbjct  483   GSLEDRLFRKGNTPSIPWEIRFKIAAEIATGLLFLHQSKPEPLVHRDLKPGNILLDKNYV  542

Query  737   SKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQ  558
              KISDVGLARLVP SVAD VTQYHMTSAAGTFCYIDPEYQQTG+L TKSDIYSLGVMLLQ
Sbjct  543   CKISDVGLARLVPSSVADCVTQYHMTSAAGTFCYIDPEYQQTGRLETKSDIYSLGVMLLQ  602

Query  557   IITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDL  378
             IITA+PPMGLTHHVERAIEKG FAD LDPT+ +WPVEEAL FAKLSL+CAELRKKDRPDL
Sbjct  603   IITARPPMGLTHHVERAIEKGKFADFLDPTVPNWPVEEALKFAKLSLKCAELRKKDRPDL  662

Query  377   GSVILPELNRLKELALQSL  321
             GSV++PEL RL E  + S+
Sbjct  663   GSVVVPELTRLSEFGMSSM  681



>ref|XP_009591661.1| PREDICTED: U-box domain-containing protein 35-like isoform X4 
[Nicotiana tomentosiformis]
Length=641

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/627 (69%), Positives = 511/627 (81%), Gaps = 12/627 (2%)
 Frame = -3

Query  2186  GMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSA  2007
             G+SD D H VFTPFRAYSAR+GI +KE  IED EV+K ++ YIN HR++N+VLGASSRSA
Sbjct  15    GLSDQDTHKVFTPFRAYSARKGIAVKEVVIEDIEVSKGLLDYINNHRITNIVLGASSRSA  74

Query  2006  ISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN-----LPT-HIWshhg  1845
             +SRKFW+HDVPTI+NK+APDFC+VYVISKGKQQS+RPAA+P  +     LP+   WS   
Sbjct  75    LSRKFWSHDVPTIINKSAPDFCTVYVISKGKQQSVRPAAKPFASSLSATLPSSQAWSAAR  134

Query  1844  sssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSL  1665
              S+ + S   S +  +  +  I          G P   S D + D   R P NS  R+S 
Sbjct  135   LSNYSESSDVSRSVYTRPEQNIVGSEMMKLKIG-PSNASMD-NLDVHTRDPRNSYSRSSP  192

Query  1664  AEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDM  1485
             ++D  LFAP+S G  +  A QNLDFT++S   + +SS      E+EM RLKLEL+QT++M
Sbjct  193   SDDRGLFAPLSHGSVDITA-QNLDFTQVSVKENCSSSS---SWEAEMNRLKLELRQTLNM  248

Query  1484  YNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaeka  1305
             YN ACKEA++A ++AKEL Q K+EE+ RF+QAR +EEAAL + EMEKAK +AA+EAA+KA
Sbjct  249   YNTACKEAVSANQTAKELHQWKMEEASRFKQARISEEAALAIAEMEKAKGRAAIEAAQKA  308

Query  1304  qkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKI  1125
             QK+AE+EA+R KYAE+KAK+ T EKN AL+ LS+SD  YRKY+I+EIE AT+ FS S KI
Sbjct  309   QKLAEIEAKRRKYAELKAKRVTEEKNLALNDLSRSDLCYRKYTIEEIEAATKNFSNSEKI  368

Query  1124  GEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYG  945
             GEGGYGPVY+GKLDHTPVAIKVLR DAAQG KQF+QEV+VL LMRHPNMVLLLGACPEYG
Sbjct  369   GEGGYGPVYKGKLDHTPVAIKVLRSDAAQGMKQFKQEVQVLGLMRHPNMVLLLGACPEYG  428

Query  944   CLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPA  765
             CLVYE+M NGSLEDRL RKGNTP IPWEIRFKI+AEIAT LLFLHQ+KPEPLVHRDLKPA
Sbjct  429   CLVYEFMNNGSLEDRLFRKGNTPPIPWEIRFKIAAEIATGLLFLHQAKPEPLVHRDLKPA  488

Query  764   NILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDI  585
             NILLD N+  KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDI
Sbjct  489   NILLDSNYSCKISDVGLARLVPPSVADCVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDI  548

Query  584   YSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAE  405
             YSLGVMLLQIITA+PPMGLTHHVERAIE GTFAD+LDPT+ +WP+EE L++AKLSL+CAE
Sbjct  549   YSLGVMLLQIITARPPMGLTHHVERAIENGTFADILDPTVPNWPMEETLNYAKLSLKCAE  608

Query  404   LRKKDRPDLGSVILPELNRLKELALQS  324
             LRKKDRPDLGSVILPELN+LKEL + S
Sbjct  609   LRKKDRPDLGSVILPELNKLKELGMNS  635



>ref|XP_009591660.1| PREDICTED: U-box domain-containing protein 35-like isoform X3 
[Nicotiana tomentosiformis]
Length=647

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/627 (69%), Positives = 511/627 (81%), Gaps = 12/627 (2%)
 Frame = -3

Query  2186  GMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSA  2007
             G+SD D H VFTPFRAYSAR+GI +KE  IED EV+K ++ YIN HR++N+VLGASSRSA
Sbjct  21    GLSDQDTHKVFTPFRAYSARKGIAVKEVVIEDIEVSKGLLDYINNHRITNIVLGASSRSA  80

Query  2006  ISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN-----LPT-HIWshhg  1845
             +SRKFW+HDVPTI+NK+APDFC+VYVISKGKQQS+RPAA+P  +     LP+   WS   
Sbjct  81    LSRKFWSHDVPTIINKSAPDFCTVYVISKGKQQSVRPAAKPFASSLSATLPSSQAWSAAR  140

Query  1844  sssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSL  1665
              S+ + S   S +  +  +  I          G P   S D + D   R P NS  R+S 
Sbjct  141   LSNYSESSDVSRSVYTRPEQNIVGSEMMKLKIG-PSNASMD-NLDVHTRDPRNSYSRSSP  198

Query  1664  AEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDM  1485
             ++D  LFAP+S G  +  A QNLDFT++S   + +SS      E+EM RLKLEL+QT++M
Sbjct  199   SDDRGLFAPLSHGSVDITA-QNLDFTQVSVKENCSSSS---SWEAEMNRLKLELRQTLNM  254

Query  1484  YNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaeka  1305
             YN ACKEA++A ++AKEL Q K+EE+ RF+QAR +EEAAL + EMEKAK +AA+EAA+KA
Sbjct  255   YNTACKEAVSANQTAKELHQWKMEEASRFKQARISEEAALAIAEMEKAKGRAAIEAAQKA  314

Query  1304  qkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKI  1125
             QK+AE+EA+R KYAE+KAK+ T EKN AL+ LS+SD  YRKY+I+EIE AT+ FS S KI
Sbjct  315   QKLAEIEAKRRKYAELKAKRVTEEKNLALNDLSRSDLCYRKYTIEEIEAATKNFSNSEKI  374

Query  1124  GEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYG  945
             GEGGYGPVY+GKLDHTPVAIKVLR DAAQG KQF+QEV+VL LMRHPNMVLLLGACPEYG
Sbjct  375   GEGGYGPVYKGKLDHTPVAIKVLRSDAAQGMKQFKQEVQVLGLMRHPNMVLLLGACPEYG  434

Query  944   CLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPA  765
             CLVYE+M NGSLEDRL RKGNTP IPWEIRFKI+AEIAT LLFLHQ+KPEPLVHRDLKPA
Sbjct  435   CLVYEFMNNGSLEDRLFRKGNTPPIPWEIRFKIAAEIATGLLFLHQAKPEPLVHRDLKPA  494

Query  764   NILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDI  585
             NILLD N+  KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDI
Sbjct  495   NILLDSNYSCKISDVGLARLVPPSVADCVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDI  554

Query  584   YSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAE  405
             YSLGVMLLQIITA+PPMGLTHHVERAIE GTFAD+LDPT+ +WP+EE L++AKLSL+CAE
Sbjct  555   YSLGVMLLQIITARPPMGLTHHVERAIENGTFADILDPTVPNWPMEETLNYAKLSLKCAE  614

Query  404   LRKKDRPDLGSVILPELNRLKELALQS  324
             LRKKDRPDLGSVILPELN+LKEL + S
Sbjct  615   LRKKDRPDLGSVILPELNKLKELGMNS  641



>ref|XP_009798004.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Nicotiana sylvestris]
Length=652

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/637 (67%), Positives = 518/637 (81%), Gaps = 10/637 (2%)
 Frame = -3

Query  2207  GGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVL  2028
               PDA+GG SD D   VFTPFRAYSAR+ I++KE  +EDTEV+K +V YIN H V+N+VL
Sbjct  17    AAPDANGGSSDEDTQNVFTPFRAYSARKRIVVKEIVLEDTEVSKGLVDYINGHCVTNIVL  76

Query  2027  GASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL------PT  1866
             GASSRSA+ RK+WT DVPTI+NK AP+FC+VYV+SKG+QQS+RPAA+PLT+        +
Sbjct  77    GASSRSALGRKYWTPDVPTIINKAAPEFCTVYVVSKGRQQSVRPAAKPLTSSVSARQHSS  136

Query  1865  HIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWN  1686
               W+    S+  S   S  + + A    I +  +R E               G    P N
Sbjct  137   SAWTPSRLSNSESEDISRLSFARAEPKIIESEKTRPEKGPSNVVIDHLHAPSGG---PMN  193

Query  1685  SSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLE  1506
             S  R S ++ N+LFA I+    + +A  NLDFT+++   +  +  +S  LE+EMKRLKLE
Sbjct  194   SCSRTSQSDGNELFARINHRSVDISA-DNLDFTQVAIKETPRNGSSSYTLEAEMKRLKLE  252

Query  1505  LKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaa  1326
             L+QT+DMYN ACKEA+ A ++A+EL + K+EE++RFEQAR AEEAAL + E EKAKC+AA
Sbjct  253   LRQTLDMYNAACKEAVLANQAAEELNKWKMEEARRFEQARLAEEAALAIAETEKAKCRAA  312

Query  1325  meaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEK  1146
             +EAA+KAQK+AE+EAQR KYAE+KAK+E  +KNRA++VLS++D RYRKY+I+EIE AT+ 
Sbjct  313   IEAAKKAQKMAEIEAQRRKYAELKAKREGEKKNRAMNVLSQNDLRYRKYTIEEIEAATKN  372

Query  1145  FSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLL  966
             FS S+K+GEGGYGPV++GKLDHTPVAIKVL  DAAQG+KQFQQEVEVLSL+RHPN+VLLL
Sbjct  373   FSSSLKVGEGGYGPVFKGKLDHTPVAIKVLSADAAQGKKQFQQEVEVLSLIRHPNLVLLL  432

Query  965   GACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLV  786
             GACPEYGCLVYE+M NGSLEDRL RKGNTP+IPWEIRFKI+AEIAT LLFLHQ+KPEPLV
Sbjct  433   GACPEYGCLVYEFMNNGSLEDRLFRKGNTPSIPWEIRFKIAAEIATGLLFLHQAKPEPLV  492

Query  785   HRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGK  606
             HRDLKPANILLDRN+V KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGK
Sbjct  493   HRDLKPANILLDRNYVCKISDVGLARLVPPSVADTVTQYHMTSAAGTFCYIDPEYQQTGK  552

Query  605   LGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAK  426
             LGTKSD+YSLG+MLLQIITA+PPMGLTHHVERAIEKGTFADLLDPT+ +WPVEEAL FAK
Sbjct  553   LGTKSDVYSLGIMLLQIITARPPMGLTHHVERAIEKGTFADLLDPTVQNWPVEEALKFAK  612

Query  425   LSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
             LSL+CAELR KDRPDLGSVI+PEL++LKE+ + S+ S
Sbjct  613   LSLKCAELRMKDRPDLGSVIVPELSKLKEVGINSMPS  649



>ref|XP_004253092.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Solanum lycopersicum]
Length=683

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/690 (64%), Positives = 540/690 (78%), Gaps = 40/690 (6%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             VVAVDKDKNS+SAVKW +DNLL +N  ++L+HVR K SP       D++GG+SD     V
Sbjct  12    VVAVDKDKNSSSAVKWAIDNLLGNNQILVLIHVRVKNSPKPTL---DSNGGLSDEATQNV  68

Query  2156  FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDV  1977
             FTPF+AYSAR+ I++KE  IE+TE +K ++ YIN++ V+N+VLGASSRSA+ RK+WTHDV
Sbjct  69    FTPFKAYSARKRIVVKEIVIENTEASKGLLEYINSNSVTNIVLGASSRSALGRKYWTHDV  128

Query  1976  PTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaasss  1797
             PT+VNK AP+FCSVYV+SKGKQQS+RPAA+   +LP+ + +   SSS  S+         
Sbjct  129   PTLVNKAAPEFCSVYVVSKGKQQSVRPAAK---SLPSCVPARQPSSSAWSAPR-------  178

Query  1796  AGDDRISACSSRGEHSGR-PFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFD  1620
                    + +S  E S R  + RS+ +  +    RP      + +  DN  F  +++ + 
Sbjct  179   -------SSNSGSEDSIRFSYTRSDQKIVESEKMRPEKGP--SIVPIDNPHFPEMTNPYK  229

Query  1619  NAA-----------------AAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTM  1491
             + +                  ++NLDFT+++   +  +   S  +++EMKRLKLEL+QTM
Sbjct  230   HTSQPDGMRYARISPRSVDMTSENLDFTQVAIRETPMNGNTSYSVDAEMKRLKLELRQTM  289

Query  1490  DMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaae  1311
             DMYN ACKEA+ A ++A EL + KIEE+++FEQAR AEEAAL + E EKAKC+AA+EAA+
Sbjct  290   DMYNAACKEAVVANQAADELNKWKIEEARKFEQARFAEEAALAIAETEKAKCRAAIEAAK  349

Query  1310  kaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSM  1131
             KAQK+AE+EAQR KYAE+KAK+E  +K +A++V S++D RYRKY+I+EIE AT+KFS + 
Sbjct  350   KAQKMAEIEAQRRKYAELKAKREAEKKKQAINVRSQNDIRYRKYTIEEIEAATKKFSNAQ  409

Query  1130  KIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPE  951
             KIGEGGYGPV++GKLDHTPVAIKVL PDAAQG+KQFQQEVEVLSL+RHPN+VLLLGACPE
Sbjct  410   KIGEGGYGPVFKGKLDHTPVAIKVLSPDAAQGKKQFQQEVEVLSLIRHPNLVLLLGACPE  469

Query  950   YGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLK  771
             YGCLVYE M NGSLEDRL RKGNTP+IPWEIRFKI+AEIAT LLFLHQSKPEPLVHRDLK
Sbjct  470   YGCLVYELMNNGSLEDRLFRKGNTPSIPWEIRFKIAAEIATGLLFLHQSKPEPLVHRDLK  529

Query  770   PANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKS  591
             P NILLD+N+V KISDVGLARLVP SVAD VTQYHMTSAAGTFCYIDPEYQQTG+L TKS
Sbjct  530   PGNILLDKNYVCKISDVGLARLVPSSVADCVTQYHMTSAAGTFCYIDPEYQQTGRLETKS  589

Query  590   DIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQC  411
             DIYSLGVMLLQIITA+PPMGLTHHVERAIEKG FAD LDPT+ +WPVEEAL FAKLSL+C
Sbjct  590   DIYSLGVMLLQIITARPPMGLTHHVERAIEKGKFADFLDPTVPNWPVEEALKFAKLSLKC  649

Query  410   AELRKKDRPDLGSVILPELNRLKELALQSL  321
             AELRKKDRPDLGSV++PEL RL E  + S+
Sbjct  650   AELRKKDRPDLGSVVVPELTRLCEFGMSSM  679



>ref|XP_010648363.1| PREDICTED: U-box domain-containing protein 52 isoform X1 [Vitis 
vinifera]
Length=732

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/710 (61%), Positives = 534/710 (75%), Gaps = 29/710 (4%)
 Frame = -3

Query  2363  DGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGG  2184
             DG      TVVA+DKDKNS  AV+WT+D+LLI+NP +IL+HVRHK    HQ       GG
Sbjct  9     DGIAPINSTVVAIDKDKNSHYAVRWTIDHLLINNPQIILIHVRHKYL-QHQGYNAGEGGG  67

Query  2183  MSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAI  2004
              S+ D   +F  +R Y AR+ I +KE  ++D +V++AI+ YI  +R+ N+V+GAS+++A+
Sbjct  68    ESETDAQQLFIAYRGYCARKAIQLKEIVLDDVDVSRAIIDYITRNRIKNIVVGASTKNAL  127

Query  2003  SRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN------------LPTHI  1860
             +RKF  +DV T + K+APDFCSVYVISKGK  S+R A RP+ N            LP   
Sbjct  128   TRKFRNYDVSTSITKSAPDFCSVYVISKGKVVSVRSAQRPVVNTAVPPKLPSPRGLPPQA  187

Query  1859  WshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDA-------DGSV  1701
                +      +   S     + G +R++      E +    R    R A       +  +
Sbjct  188   LPDNPELEDVARIQSLKGWRNVGSERVTF-----ERTNNNMRVPRARSAPTNLSIDNIDL  242

Query  1700  RRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFT-RisdagsdassiaSKDLESEM  1524
             +RP  S+ R+S+++D D   PI     + ++ Q++DF+          +  ++K+L +EM
Sbjct  243   QRP--STSRDSVSDDLDFSTPIRFASVDLSS-QDMDFSITSDSGRDSLTPTSAKELAAEM  299

Query  1523  KRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemek  1344
             KRLKLELKQTMDMY+ ACKEAITAK+ AKEL Q ++EE++RF++AR +EEAAL M EMEK
Sbjct  300   KRLKLELKQTMDMYSTACKEAITAKQKAKELHQWRMEEARRFKEARLSEEAALAMAEMEK  359

Query  1343  akckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEI  1164
             A+CKAA+EAAE AQK+AE EAQR +YAE+KA +E  EK RAL+ L+ +D RYRKY+I+EI
Sbjct  360   ARCKAAIEAAEVAQKLAEKEAQRRRYAELKASREAEEKARALTALAHNDVRYRKYAIEEI  419

Query  1163  EFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHP  984
             E ATEKFS++MKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQG +QFQQE+EVLS MRHP
Sbjct  420   EVATEKFSQAMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGMRQFQQEIEVLSCMRHP  479

Query  983   NMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQS  804
             NMVLLLGACPEYGCLVYEYM NGSLEDRLLR+G+TP+IPW +RFKI+AEIATALLFLHQ+
Sbjct  480   NMVLLLGACPEYGCLVYEYMSNGSLEDRLLRRGDTPSIPWRMRFKIAAEIATALLFLHQA  539

Query  803   KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPE  624
             KPEP VHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPE
Sbjct  540   KPEPFVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYHMTSAAGTFCYIDPE  599

Query  623   YQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEE  444
             YQQTG LGTKSD+YS+G+MLLQIITAKPPMGLTHHV RAIEKGTFAD+LD T+ DWPVEE
Sbjct  600   YQQTGMLGTKSDVYSMGIMLLQIITAKPPMGLTHHVRRAIEKGTFADMLDQTVPDWPVEE  659

Query  443   ALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQTF  294
             AL FA L+L+C+ELRKKDRPDLGSV+LPELNRL    + S    N +  F
Sbjct  660   ALAFANLALKCSELRKKDRPDLGSVVLPELNRLSGFGMDSSGPDNSSNMF  709



>ref|XP_009601901.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Nicotiana tomentosiformis]
Length=652

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/637 (67%), Positives = 515/637 (81%), Gaps = 10/637 (2%)
 Frame = -3

Query  2207  GGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVL  2028
               PDA+GG S+     VFTPFRAYSAR+ I++KE  +ED EV+K ++ YIN H V+N+VL
Sbjct  17    AAPDANGGSSNEGTQNVFTPFRAYSARKRIVVKEIVLEDNEVSKGLLDYINGHCVTNIVL  76

Query  2027  GASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLP------T  1866
             GASSRSA+ RK+WT DVPTI+NK AP+FC+VYV+SKG+QQS+RPAA+PLT+        +
Sbjct  77    GASSRSALGRKYWTPDVPTIINKAAPEFCTVYVVSKGRQQSVRPAAKPLTSSAPARQHFS  136

Query  1865  HIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWN  1686
               W+    S+  S   S  + + A    I +  +R E               G    P N
Sbjct  137   SAWTPSRLSNSESEDISRLSFARAEPKIIESEKTRPEKGPSNVVMDHLHAPSGG---PMN  193

Query  1685  SSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLE  1506
             S  R SL++ ++LFA I+    + +A  NLDFT+++   +  +  +S  LE+EMKRLKLE
Sbjct  194   SCSRTSLSDGSELFARINHRSVDISA-DNLDFTQVAIKETTRNGSSSYSLEAEMKRLKLE  252

Query  1505  LKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaa  1326
             L+QT+DMYN ACKEA+ A ++A+EL + K+EE++RFEQAR AE+AAL + E EKAKC+AA
Sbjct  253   LRQTLDMYNAACKEAVLANQAAEELNKWKMEEARRFEQARLAEDAALAIAETEKAKCRAA  312

Query  1325  meaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEK  1146
             +EAA+KAQK+ E+EAQR KYAE+KAK+E  +KNRA++VLS++D RYRKY+I+EIE AT+ 
Sbjct  313   IEAAKKAQKMVEIEAQRRKYAELKAKQEGEKKNRAMNVLSQNDLRYRKYTIEEIEAATKN  372

Query  1145  FSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLL  966
             FS S+K+GEGGYGPV++GKLDHTPVAIKVL  DAAQG+KQFQQEVEVLSL+RHPN+VLLL
Sbjct  373   FSSSLKVGEGGYGPVFKGKLDHTPVAIKVLSADAAQGKKQFQQEVEVLSLIRHPNLVLLL  432

Query  965   GACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLV  786
             GACPEYGCLVYE+M NGSLEDRL RKGNTP+IPWEIRFKI+AEIAT LLFLHQ+KPEPLV
Sbjct  433   GACPEYGCLVYEFMNNGSLEDRLFRKGNTPSIPWEIRFKIAAEIATGLLFLHQAKPEPLV  492

Query  785   HRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGK  606
             HRDLKPANILLDRN+V KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGK
Sbjct  493   HRDLKPANILLDRNYVCKISDVGLARLVPPSVADTVTQYHMTSAAGTFCYIDPEYQQTGK  552

Query  605   LGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAK  426
             LGTKSDIYSLGVMLLQIITA+PPMGLTHHVERAIEKGTFADLLDPT+  WPVEEAL FAK
Sbjct  553   LGTKSDIYSLGVMLLQIITARPPMGLTHHVERAIEKGTFADLLDPTVQHWPVEEALKFAK  612

Query  425   LSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
             LSL+CAELR KDRPDLGSVI+PELN+LKE+ + S+ S
Sbjct  613   LSLKCAELRMKDRPDLGSVIVPELNKLKEVGINSMPS  649



>emb|CDP08293.1| unnamed protein product [Coffea canephora]
Length=708

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/704 (63%), Positives = 531/704 (75%), Gaps = 26/704 (4%)
 Frame = -3

Query  2381  HPTISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGG  2202
             H   SSD +TT  +T VA+D+DKNSASAVKW VD+LL+++  +IL+HV+ + +P  Q+ G
Sbjct  10    HSGTSSDESTTNNLTAVAIDRDKNSASAVKWAVDHLLLTDHSIILIHVKIR-NPQPQSLG  68

Query  2201  PD-----AHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSN  2037
              D     A+      D   +F P R Y AR+GI +KE  +E  +V+KAI+ YI+ + + N
Sbjct  69    ADGEVANAYNASGITDEQQLFKPSRLYCARKGIKVKEVLLEGVDVSKAILDYISDNHIKN  128

Query  2036  VVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIW  1857
             +VLGASSR+ I+RKFWTHDVP IVNK APDFCSVYVI+KGK+QS RPA R  +   T   
Sbjct  129   IVLGASSRNPIARKFWTHDVPAIVNKAAPDFCSVYVIAKGKKQSFRPAVRSKSTPVT---  185

Query  1856  shhgsssrassrgssaasssAGDDRISACSSRGEHSG-----------RPFRRSEDRDAD  1710
                  S+R  S      S      R  A S R E  G            PF   E+ D  
Sbjct  186   -PKQESARNQSPIRFNHSEPEDLSRYMALSRREEQKGVGPAKVWPPAALPFGSMENIDIS  244

Query  1709  GSVRRPWNSSCRNSLAEDNDLF-APISDGFDNAAAAQNLDFTRisdagsdassiaSKDLE  1533
                +   N   RNSL+  +    AP   G    A  +N+DF  + DA +  SS +S  LE
Sbjct  245   FVAKS--NVPSRNSLSTSDSDSTAPFHFG-PMEAIIKNVDFANMLDAANSGSSGSSS-LE  300

Query  1532  SEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVe  1353
             +EM RLKLELKQT++MYN ACKEA++AK+ AKEL + K+EE+ + EQAR + E+A  +VE
Sbjct  301   AEMNRLKLELKQTLEMYNTACKEALSAKQKAKELDRWKMEEALKIEQARHSGESAFAIVE  360

Query  1352  mekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSI  1173
             MEKAK +AA+EAAEKAQK+A++EAQR+K+AE KAK+E   K+RAL +LS++DCR RKY+I
Sbjct  361   MEKAKRRAAIEAAEKAQKLADIEAQRSKHAEEKAKREAEGKSRALKILSQNDCRCRKYTI  420

Query  1172  DEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLM  993
             ++IE AT KFS S KIGEGGYGPVY+GKLDHTPVAIK+LRPDAAQGRKQFQQEVEVLS +
Sbjct  421   EDIEIATNKFSSSSKIGEGGYGPVYKGKLDHTPVAIKILRPDAAQGRKQFQQEVEVLSSI  480

Query  992   RHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFL  813
             RHPNMVLLLGACPEYGCLVYEYM  GSLEDRL RKGNTP IPW  RFKI+A+IAT LLFL
Sbjct  481   RHPNMVLLLGACPEYGCLVYEYMNYGSLEDRLFRKGNTPPIPWAFRFKIAADIATGLLFL  540

Query  812   HQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYI  633
             HQ+KPEPLVHRDLKPANILLD+NFV KISDVGLARLVP SVAD VTQYHMTSAAGTFCYI
Sbjct  541   HQTKPEPLVHRDLKPANILLDQNFVCKISDVGLARLVPASVADTVTQYHMTSAAGTFCYI  600

Query  632   DPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWP  453
             DPEYQ TGKLGTKSDIYSLGV+LLQIITA+PPMGLTHHVERAIE+G FADLLDPT+ +WP
Sbjct  601   DPEYQHTGKLGTKSDIYSLGVLLLQIITARPPMGLTHHVERAIEEGRFADLLDPTVPEWP  660

Query  452   VEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             VE+AL FAKL+LQC ELRKKDRPDLGSVI+PEL+RLK+L + S+
Sbjct  661   VEDALSFAKLALQCVELRKKDRPDLGSVIVPELSRLKKLGMNSM  704



>ref|XP_006474435.1| PREDICTED: U-box domain-containing protein 51-like isoform X2 
[Citrus sinensis]
 dbj|BAK61818.1| serine threonine kinase [Citrus unshiu]
Length=763

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/706 (62%), Positives = 532/706 (75%), Gaps = 60/706 (8%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGM--SDHDG  2166
             T VA+DKDKNS  AV+W +D+L+ISNP +ILLH+R K   NHQN    ++GG   SD + 
Sbjct  14    TAVAIDKDKNSPHAVRWAIDHLIISNPLIILLHIRQKY--NHQN----SNGGYVESDSEM  67

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
               +FTPFR Y AR+G+++KE  I+D +V KAI+ YI  + ++N+V+GAS+R+A++RKF  
Sbjct  68    QQLFTPFRGYCARKGVLLKEVVIDDNDVPKAILEYIGRNLLNNIVVGASTRNALARKFKG  127

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIR----PAA-------RPLTNLPTHIWshhgss  1839
              D+ T V K+APDFCSVY+ISKGK  S+R    PAA       +P   +P  I S HG  
Sbjct  128   VDISTTVMKSAPDFCSVYIISKGKILSVRTAQRPAANTATPPRQPSPGIPPQIPSDHGEL  187

Query  1838  srassrgssaasssAGDDRISACSSRG------------EHSGRPFRRS-EDR-------  1719
                             DD       RG            E    P R +  DR       
Sbjct  188   ----------------DDPFRGQGMRGIPRGLATERLSWEKGSTPIRAAAHDRHRSSPST  231

Query  1718  ---DADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisda-gsdassi  1551
                D   S      S+ R+S ++++D   P++ G  + ++ +NLDF+ +  +    ++S 
Sbjct  232   LALDTIESTLPGRRSTGRDSFSDESDYSGPLAMGSLDISS-KNLDFSSVPVSPRVSSASQ  290

Query  1550  aSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeea  1371
             +S+DLE+EM+RLKLEL+QTM+MY+ ACKEA+ AKK AKEL Q KIEE+QRFE+AR AEE 
Sbjct  291   SSRDLEAEMRRLKLELRQTMEMYSTACKEALNAKKKAKELNQWKIEEAQRFEEARMAEET  350

Query  1370  alRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCR  1191
             AL + EMEKAKC+AA+EAAEKAQK+A+ EAQR K AE+KAK+E  EKNRAL+ L+ +D R
Sbjct  351   ALAIAEMEKAKCRAAIEAAEKAQKLADAEAQRRKQAELKAKREAEEKNRALTALAHNDVR  410

Query  1190  YRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEV  1011
             YRKY+I+EIE AT+KFS++MKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQG++QFQQEV
Sbjct  411   YRKYTIEEIEEATDKFSEAMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGKRQFQQEV  470

Query  1010  EVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIA  831
             EVLS +RHPNMVLLLGACP+YGCLVYEYM NGSLEDRLLR+GNTP IPW  RFKI+AEIA
Sbjct  471   EVLSSIRHPNMVLLLGACPDYGCLVYEYMHNGSLEDRLLRRGNTPVIPWRKRFKIAAEIA  530

Query  830   TALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAA  651
             TALLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQYHMTSAA
Sbjct  531   TALLFLHQAKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYHMTSAA  590

Query  650   GTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDP  471
             GTFCYIDPEYQQTG L TKSDIYS G+MLLQIITA+ PMGLTHHV RAIEKGT A++LDP
Sbjct  591   GTFCYIDPEYQQTGMLTTKSDIYSFGIMLLQIITARSPMGLTHHVSRAIEKGTLAEMLDP  650

Query  470   TISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              ++DWP E A  F+KL++QCAELRKKDRPDLG+VI+PELNRLK+L 
Sbjct  651   AVTDWPAEAAESFSKLAIQCAELRKKDRPDLGTVIVPELNRLKDLG  696



>ref|XP_006474436.1| PREDICTED: U-box domain-containing protein 51-like isoform X3 
[Citrus sinensis]
Length=753

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/706 (62%), Positives = 532/706 (75%), Gaps = 60/706 (8%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGM--SDHDG  2166
             T VA+DKDKNS  AV+W +D+L+ISNP +ILLH+R K   NHQN    ++GG   SD + 
Sbjct  14    TAVAIDKDKNSPHAVRWAIDHLIISNPLIILLHIRQKY--NHQN----SNGGYVESDSEM  67

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
               +FTPFR Y AR+G+++KE  I+D +V KAI+ YI  + ++N+V+GAS+R+A++RKF  
Sbjct  68    QQLFTPFRGYCARKGVLLKEVVIDDNDVPKAILEYIGRNLLNNIVVGASTRNALARKFKG  127

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIR----PAA-------RPLTNLPTHIWshhgss  1839
              D+ T V K+APDFCSVY+ISKGK  S+R    PAA       +P   +P  I S HG  
Sbjct  128   VDISTTVMKSAPDFCSVYIISKGKILSVRTAQRPAANTATPPRQPSPGIPPQIPSDHGEL  187

Query  1838  srassrgssaasssAGDDRISACSSRG------------EHSGRPFRRS-EDR-------  1719
                             DD       RG            E    P R +  DR       
Sbjct  188   ----------------DDPFRGQGMRGIPRGLATERLSWEKGSTPIRAAAHDRHRSSPST  231

Query  1718  ---DADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisda-gsdassi  1551
                D   S      S+ R+S ++++D   P++ G  + ++ +NLDF+ +  +    ++S 
Sbjct  232   LALDTIESTLPGRRSTGRDSFSDESDYSGPLAMGSLDISS-KNLDFSSVPVSPRVSSASQ  290

Query  1550  aSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeea  1371
             +S+DLE+EM+RLKLEL+QTM+MY+ ACKEA+ AKK AKEL Q KIEE+QRFE+AR AEE 
Sbjct  291   SSRDLEAEMRRLKLELRQTMEMYSTACKEALNAKKKAKELNQWKIEEAQRFEEARMAEET  350

Query  1370  alRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCR  1191
             AL + EMEKAKC+AA+EAAEKAQK+A+ EAQR K AE+KAK+E  EKNRAL+ L+ +D R
Sbjct  351   ALAIAEMEKAKCRAAIEAAEKAQKLADAEAQRRKQAELKAKREAEEKNRALTALAHNDVR  410

Query  1190  YRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEV  1011
             YRKY+I+EIE AT+KFS++MKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQG++QFQQEV
Sbjct  411   YRKYTIEEIEEATDKFSEAMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGKRQFQQEV  470

Query  1010  EVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIA  831
             EVLS +RHPNMVLLLGACP+YGCLVYEYM NGSLEDRLLR+GNTP IPW  RFKI+AEIA
Sbjct  471   EVLSSIRHPNMVLLLGACPDYGCLVYEYMHNGSLEDRLLRRGNTPVIPWRKRFKIAAEIA  530

Query  830   TALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAA  651
             TALLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQYHMTSAA
Sbjct  531   TALLFLHQAKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYHMTSAA  590

Query  650   GTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDP  471
             GTFCYIDPEYQQTG L TKSDIYS G+MLLQIITA+ PMGLTHHV RAIEKGT A++LDP
Sbjct  591   GTFCYIDPEYQQTGMLTTKSDIYSFGIMLLQIITARSPMGLTHHVSRAIEKGTLAEMLDP  650

Query  470   TISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              ++DWP E A  F+KL++QCAELRKKDRPDLG+VI+PELNRLK+L 
Sbjct  651   AVTDWPAEAAESFSKLAIQCAELRKKDRPDLGTVIVPELNRLKDLG  696



>ref|XP_006474434.1| PREDICTED: U-box domain-containing protein 51-like isoform X1 
[Citrus sinensis]
Length=767

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/706 (62%), Positives = 532/706 (75%), Gaps = 60/706 (8%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGM--SDHDG  2166
             T VA+DKDKNS  AV+W +D+L+ISNP +ILLH+R K   NHQN    ++GG   SD + 
Sbjct  14    TAVAIDKDKNSPHAVRWAIDHLIISNPLIILLHIRQKY--NHQN----SNGGYVESDSEM  67

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
               +FTPFR Y AR+G+++KE  I+D +V KAI+ YI  + ++N+V+GAS+R+A++RKF  
Sbjct  68    QQLFTPFRGYCARKGVLLKEVVIDDNDVPKAILEYIGRNLLNNIVVGASTRNALARKFKG  127

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIR----PAA-------RPLTNLPTHIWshhgss  1839
              D+ T V K+APDFCSVY+ISKGK  S+R    PAA       +P   +P  I S HG  
Sbjct  128   VDISTTVMKSAPDFCSVYIISKGKILSVRTAQRPAANTATPPRQPSPGIPPQIPSDHGEL  187

Query  1838  srassrgssaasssAGDDRISACSSRG------------EHSGRPFRRS-EDR-------  1719
                             DD       RG            E    P R +  DR       
Sbjct  188   ----------------DDPFRGQGMRGIPRGLATERLSWEKGSTPIRAAAHDRHRSSPST  231

Query  1718  ---DADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisda-gsdassi  1551
                D   S      S+ R+S ++++D   P++ G  + ++ +NLDF+ +  +    ++S 
Sbjct  232   LALDTIESTLPGRRSTGRDSFSDESDYSGPLAMGSLDISS-KNLDFSSVPVSPRVSSASQ  290

Query  1550  aSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeea  1371
             +S+DLE+EM+RLKLEL+QTM+MY+ ACKEA+ AKK AKEL Q KIEE+QRFE+AR AEE 
Sbjct  291   SSRDLEAEMRRLKLELRQTMEMYSTACKEALNAKKKAKELNQWKIEEAQRFEEARMAEET  350

Query  1370  alRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCR  1191
             AL + EMEKAKC+AA+EAAEKAQK+A+ EAQR K AE+KAK+E  EKNRAL+ L+ +D R
Sbjct  351   ALAIAEMEKAKCRAAIEAAEKAQKLADAEAQRRKQAELKAKREAEEKNRALTALAHNDVR  410

Query  1190  YRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEV  1011
             YRKY+I+EIE AT+KFS++MKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQG++QFQQEV
Sbjct  411   YRKYTIEEIEEATDKFSEAMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGKRQFQQEV  470

Query  1010  EVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIA  831
             EVLS +RHPNMVLLLGACP+YGCLVYEYM NGSLEDRLLR+GNTP IPW  RFKI+AEIA
Sbjct  471   EVLSSIRHPNMVLLLGACPDYGCLVYEYMHNGSLEDRLLRRGNTPVIPWRKRFKIAAEIA  530

Query  830   TALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAA  651
             TALLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQYHMTSAA
Sbjct  531   TALLFLHQAKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYHMTSAA  590

Query  650   GTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDP  471
             GTFCYIDPEYQQTG L TKSDIYS G+MLLQIITA+ PMGLTHHV RAIEKGT A++LDP
Sbjct  591   GTFCYIDPEYQQTGMLTTKSDIYSFGIMLLQIITARSPMGLTHHVSRAIEKGTLAEMLDP  650

Query  470   TISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              ++DWP E A  F+KL++QCAELRKKDRPDLG+VI+PELNRLK+L 
Sbjct  651   AVTDWPAEAAESFSKLAIQCAELRKKDRPDLGTVIVPELNRLKDLG  696



>ref|XP_006453060.1| hypothetical protein CICLE_v10010543mg, partial [Citrus clementina]
 gb|ESR66300.1| hypothetical protein CICLE_v10010543mg, partial [Citrus clementina]
Length=705

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/706 (61%), Positives = 531/706 (75%), Gaps = 60/706 (8%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGM--SDHDG  2166
             T VA+D+DKNS  AV+W +D+L+ISNP +ILLH+R K   NHQN    ++GG   SD + 
Sbjct  14    TAVAIDRDKNSPHAVRWAIDHLIISNPLIILLHIRQKY--NHQN----SNGGYVESDSEM  67

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
               +FTPFR Y AR+G+++KE  I+D +++KAI+ YI  + +SN+V+GAS+R+A++RKF  
Sbjct  68    QQLFTPFRGYCARKGVLLKEVVIDDNDISKAILEYIGRNLLSNIVVGASTRNALARKFKG  127

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIR----PAA-------RPLTNLPTHIWshhgss  1839
              D+ T V K+APDFCSVY+ISKGK  S+R    PAA       +P   +P  I S HG  
Sbjct  128   VDISTTVMKSAPDFCSVYIISKGKILSVRTAQRPAANTAAPPRQPSPGIPPQIPSDHGEL  187

Query  1838  srassrgssaasssAGDDRISACSSRG------------EHSGRPFRRS-EDR-------  1719
                             DD       RG            E    P R +  DR       
Sbjct  188   ----------------DDPFRGQGMRGIPRGLATERLSWEKGSTPIRAAAHDRHRSSPST  231

Query  1718  ---DADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisda-gsdassi  1551
                D   S      S+ R+S ++++D   P+  G  + ++ +NLDF+ +  +    ++S 
Sbjct  232   LALDTIESTLPGRRSTGRDSFSDESDYSGPLGMGSLDISS-KNLDFSSVPVSPRVSSASQ  290

Query  1550  aSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeea  1371
             +S+DLE+EM+RLKLEL+QTM+MY+ ACKEA+ AKK AKEL Q K+EE+QRFE+AR AEE 
Sbjct  291   SSRDLEAEMRRLKLELRQTMEMYSTACKEALNAKKKAKELNQWKMEEAQRFEEARMAEET  350

Query  1370  alRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCR  1191
             AL + EMEKAKC+AA+EAAEKAQK+A+ EAQR K AE+KAK+E  EKNRAL+ L+ +D R
Sbjct  351   ALAIAEMEKAKCRAAIEAAEKAQKLADAEAQRRKQAELKAKREAEEKNRALTALANNDVR  410

Query  1190  YRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEV  1011
             YRKY+I+EIE AT+KFS++MKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQG++QFQQEV
Sbjct  411   YRKYTIEEIEEATDKFSEAMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGKRQFQQEV  470

Query  1010  EVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIA  831
             EVLS +RHPNMVLLLGACP+YGCLVYEYM NGSLEDRLLR+GNTP IPW  RFKI+AEIA
Sbjct  471   EVLSSIRHPNMVLLLGACPDYGCLVYEYMHNGSLEDRLLRRGNTPVIPWRKRFKIAAEIA  530

Query  830   TALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAA  651
             TALLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQYHMTSAA
Sbjct  531   TALLFLHQAKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYHMTSAA  590

Query  650   GTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDP  471
             GTFCYIDPEYQQTG L TKSDIYS G+MLLQI+TA+ PMGLTHHV RAIEKGT A++LDP
Sbjct  591   GTFCYIDPEYQQTGMLTTKSDIYSFGIMLLQILTARSPMGLTHHVSRAIEKGTLAEMLDP  650

Query  470   TISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              ++DWP E A   AKL++QCAELRKKDRPDLG+VI+P+LNRLK+L 
Sbjct  651   AVTDWPAEAAESCAKLAIQCAELRKKDRPDLGTVIVPDLNRLKDLG  696



>ref|XP_007012336.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative [Theobroma cacao]
 gb|EOY29955.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative [Theobroma cacao]
Length=767

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/702 (62%), Positives = 540/702 (77%), Gaps = 36/702 (5%)
 Frame = -3

Query  2378  PTISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGP  2199
             P  S +       T VA+D+DKNS  AV+W +D+L+I+NP +IL+HVRHK      N G 
Sbjct  3     PHFSDESNVPANTTAVAIDRDKNSPHAVRWAIDHLVITNPLIILVHVRHK------NQGE  56

Query  2198  DAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
                 G SD+D + +F PFR Y AR+GI M+E  +EDT+++KA+V YI+ + ++++VLGA+
Sbjct  57    ----GESDYDINQLFIPFRGYCARKGIQMREVILEDTDISKALVDYISKNLINSMVLGAA  112

Query  2018  SRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN-----------L  1872
             SR+AISRKF  HDVPT + K+AP+FCSVYVISKGK  ++R A RP+ N           +
Sbjct  113   SRNAISRKF-KHDVPTTLIKSAPEFCSVYVISKGKILTVRTAQRPVANTATPPKAPSAGM  171

Query  1871  PTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFR-RSEDRDADGSVR-  1698
             P  I            + +  A  +AG +R+S  +     S  P R R   R +  ++  
Sbjct  172   PPQIPLDQIEDDGIRGQYTRGALRNAGSERLSLDNP----SKVPIRERDRQRSSPANLSL  227

Query  1697  -------RPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKD  1539
                    R  +S+  +S + ++D  A ++ G  + +  Q+LDF+ +S + S++   +++D
Sbjct  228   DSIDIGIRGQSSTSHDSFSNESDFPAKLALGSMDISG-QDLDFSMVSGSPSESLPQSTRD  286

Query  1538  LESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRM  1359
             +E+EM+RLKLELKQTMDMY+ ACKEA+TAK+ A EL Q K+EE+++FE+AR AEEAAL +
Sbjct  287   IEAEMRRLKLELKQTMDMYSTACKEALTAKRKANELHQWKMEEARKFEEARLAEEAALAI  346

Query  1358  VemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKY  1179
              EMEKAKCKAA+EAAE +Q++AEMEA R + AE+KAKKE  EKNRAL+ L+ +D RYRKY
Sbjct  347   AEMEKAKCKAAIEAAEASQRLAEMEAHRRRQAELKAKKEADEKNRALNALAHNDVRYRKY  406

Query  1178  SIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS  999
             +I+EIE ATEKFS+SMKIGEGGYGPVY+GKLDHTPVAIKVLRPDAAQG+KQFQQEVEVL 
Sbjct  407   TIEEIEEATEKFSESMKIGEGGYGPVYKGKLDHTPVAIKVLRPDAAQGKKQFQQEVEVLC  466

Query  998   LMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALL  819
              +RHPNMVLLLGACPEYGCLVYEYM +GSLEDRL R+GNTP + W  RFKI+AEIATALL
Sbjct  467   CIRHPNMVLLLGACPEYGCLVYEYMIHGSLEDRLFRRGNTPPLSWRKRFKIAAEIATALL  526

Query  818   FLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFC  639
             FLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQYHMTSAAGTFC
Sbjct  527   FLHQAKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYHMTSAAGTFC  586

Query  638   YIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISD  459
             YIDPEYQQTG L TKSDIYSLG+MLLQIITAKPPMGL HHV RAIEKGTFAD+LDP + D
Sbjct  587   YIDPEYQQTGMLTTKSDIYSLGIMLLQIITAKPPMGLAHHVGRAIEKGTFADMLDPAVPD  646

Query  458   WPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             WPVEEAL FA+++L+C ELRK+DRPDLG+VILPELNRL++L 
Sbjct  647   WPVEEALSFAQMALKCVELRKRDRPDLGTVILPELNRLRDLG  688



>ref|XP_006342501.1| PREDICTED: U-box domain-containing protein 35-like isoform X3 
[Solanum tuberosum]
Length=644

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/633 (66%), Positives = 508/633 (80%), Gaps = 13/633 (2%)
 Frame = -3

Query  2198  DAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
             D++GG+SD     VF PF+AYSAR+ I++KE  IE+TE +K ++ YIN+H VSN+VLGAS
Sbjct  14    DSNGGLSDEGTQNVFIPFKAYSARKRIVVKEIVIENTEASKGLLEYINSHSVSNIVLGAS  73

Query  2018  SRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPL-TNLP-----THIW  1857
             SRS + RK+WTHDVPT+VNK AP+FCSVYV+SKGKQQS+RPAA+ L +++P     +  W
Sbjct  74    SRSTLGRKYWTHDVPTLVNKAAPEFCSVYVVSKGKQQSVRPAAKSLPSSVPARQPSSSAW  133

Query  1856  shhgsssrassrgssaasssAGDDRI-SACSSRGEHSGRPFRRSEDRDADGSVRRPWNSS  1680
             S   SS+  S   +S  S    + +I  +  +RGE    P     D      +  P+  +
Sbjct  134   SAPRSSNSGSEDSTSRFSYMRSEQKIVESEKTRGEKG--PSIVPIDNLHSPEMTNPYKHA  191

Query  1679  CRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELK  1500
                S  + N  +A IS    +  + +NLDFT+++   +  +  +S  +++EMKRLKLEL+
Sbjct  192   ---SQPDGNMRYARISPRSVDMTS-ENLDFTQVAIRETPMNGSSSYSVDAEMKRLKLELR  247

Query  1499  QTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaame  1320
             QTMDMYN ACKEA+ A ++A EL + KIEE+++FEQAR AEEAAL + E EKAKC+AA+E
Sbjct  248   QTMDMYNAACKEAVMANQAADELNKWKIEEARKFEQARFAEEAALAIAETEKAKCRAAIE  307

Query  1319  aaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFS  1140
             AA+KAQK+AE+EAQR KYAE+KAK+ET +K +A++V S++D RYRKY+I+EIE AT+KFS
Sbjct  308   AAKKAQKMAEIEAQRRKYAELKAKRETEKKKQAMNVRSQNDIRYRKYTIEEIEAATKKFS  367

Query  1139  KSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGA  960
              + KIGEGGYGPV++GKLDHTPVAIKVL PDAAQG+KQFQQEVEVLSL+RHPN+VLLLGA
Sbjct  368   NAQKIGEGGYGPVFKGKLDHTPVAIKVLSPDAAQGKKQFQQEVEVLSLIRHPNLVLLLGA  427

Query  959   CPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHR  780
             CPEYGCLVYE M NGSLEDRL RKGNTP+IPWEIRFKI+AEIAT LLFLHQSKPEPLVHR
Sbjct  428   CPEYGCLVYELMNNGSLEDRLFRKGNTPSIPWEIRFKIAAEIATGLLFLHQSKPEPLVHR  487

Query  779   DLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLG  600
             DLKP NILLD+N+V KISDVGLARLVP SVAD VTQYHMTSAAGTFCYIDPEYQQTG+L 
Sbjct  488   DLKPGNILLDKNYVCKISDVGLARLVPSSVADCVTQYHMTSAAGTFCYIDPEYQQTGRLE  547

Query  599   TKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLS  420
             TKSDIYSLGVMLLQIITA+PPMGLTHHVERAIEKG FAD LDPT+ +WPVEEAL FAKLS
Sbjct  548   TKSDIYSLGVMLLQIITARPPMGLTHHVERAIEKGKFADFLDPTVPNWPVEEALKFAKLS  607

Query  419   LQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             L+CAELRKKDRPDLGSV++PEL RL E  + S+
Sbjct  608   LKCAELRKKDRPDLGSVVVPELTRLSEFGMSSM  640



>ref|XP_010094961.1| U-box domain-containing protein 35 [Morus notabilis]
 gb|EXB57654.1| U-box domain-containing protein 35 [Morus notabilis]
Length=715

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/695 (61%), Positives = 519/695 (75%), Gaps = 21/695 (3%)
 Frame = -3

Query  2339  TVVAVDKD-KNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQN-GGPDAHGGMSDHDG  2166
             T VA++KD KNS +AV+W V++L+  NPF+IL+HVRHK   NH++     +HG   D D 
Sbjct  17    TAVAIEKDNKNSKAAVRWAVEHLVGGNPFIILIHVRHK---NHRSYAESTSHGDTYDSDV  73

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
             H +F PFR Y AR+ I MKE  ++D +V+KAI+ Y+N + ++NVV GAS++++I+RKF +
Sbjct  74    HSIFAPFRGYCARKAIQMKEVLLDDFDVSKAIMDYVNKNCITNVVAGASTKNSITRKFKS  133

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN------------LPTHIWshhgs  1842
              DVPT + K+APDFCSVYVISKGK  S R A R   N            LP +I      
Sbjct  134   VDVPTSLVKSAPDFCSVYVISKGKLISARNAQRLALNTAAPPKQPSPHGLPPYINPTDHG  193

Query  1841  ssrassrgssaasssAGDDRISACSSRGEHSGRPF-RRSEDRDADGSVRRPWNSSCRNSL  1665
                 +SR          +   S     G    R     S D     S  RP  S CR+S 
Sbjct  194   EVDHASRLQLTRGVIVRNGGGSEKMVPGRERARSVPSLSLDIIDIPSTSRP--SFCRDST  251

Query  1664  AEDNDLFAPISDGFDNAAAAQNLDF-TRisdagsdassiaSKDLESEMKRLKLELKQTMD  1488
             AE++D  A            QNLDF    +   + ++  +++++++EMKRLKLELKQTMD
Sbjct  252   AEESDFVAAFGTFGSIDVTGQNLDFGASTTSPRNSSTRHSAREIDAEMKRLKLELKQTMD  311

Query  1487  MYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaek  1308
             MY++ACKEAI+AK  AKEL Q K+EES++FE+AR AEE AL   EMEKAKCKAA+EAAE 
Sbjct  312   MYSSACKEAISAKNKAKELSQWKLEESRKFEEARLAEETALAAAEMEKAKCKAAIEAAEM  371

Query  1307  aqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMK  1128
             AQ++AE EAQR K+AEM+A++E  EKNR L+ LSK++ RYRKY+I+EIE ATEKFS++MK
Sbjct  372   AQRMAEKEAQRRKHAEMRARREAEEKNRVLTALSKNEFRYRKYTIEEIEAATEKFSEAMK  431

Query  1127  IGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEY  948
             IGEGGYGPVY+GKLDHT VAIKVLRPDAAQGRKQFQQEVEVLS +RHPNMVLLLGACPEY
Sbjct  432   IGEGGYGPVYKGKLDHTAVAIKVLRPDAAQGRKQFQQEVEVLSCIRHPNMVLLLGACPEY  491

Query  947   GCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKP  768
             GCLVYE+M NGSLEDRL R+GNT  IPW  RFKI++E+ATALLFLHQ+KPEPLVHRDLKP
Sbjct  492   GCLVYEHMNNGSLEDRLFRRGNTLPIPWRRRFKIASEVATALLFLHQTKPEPLVHRDLKP  551

Query  767   ANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSD  588
             ANILLDRNFV+KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGKL TKSD
Sbjct  552   ANILLDRNFVTKISDVGLARLVPPSVADQVTQYHMTSAAGTFCYIDPEYQQTGKLTTKSD  611

Query  587   IYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCA  408
             IYS G++LLQIITAKPPMGL HHV+RAIE+G F ++LDP + DWP+EE L FA L+L+CA
Sbjct  612   IYSFGILLLQIITAKPPMGLAHHVKRAIERGRFGEMLDPAVQDWPIEETLTFANLALKCA  671

Query  407   ELRKKDRPDLGSVILPELNRLKELALQSLASKNGT  303
             ELRKKDRP+LGSVI+PEL RLK+        ++G+
Sbjct  672   ELRKKDRPELGSVIVPELKRLKDFGKSHSGGQDGS  706



>gb|AID16038.1| putative universal stress protein [Catharanthus roseus]
Length=694

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/687 (60%), Positives = 516/687 (75%), Gaps = 21/687 (3%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVR----HKASPNHQNGGPDAHGGMSD  2175
             +TVVA+D+DKNSASAVKW +DNL+IS+P ++LLHV+    H  S N        +G  ++
Sbjct  14    VTVVAIDRDKNSASAVKWAIDNLVISHPTLVLLHVKNPQNHSFSANGAGATDSNNGSHNN  73

Query  2174  HDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRK  1995
             +D   +F P R Y AR+GI  +E F+E  +V+KAI+ Y+N + V+N+VLG+S R+ I+RK
Sbjct  74    YDVQQIFKPSRVYCARKGITAQEIFLEHVDVSKAILEYVNENHVANLVLGSSGRNVIARK  133

Query  1994  FWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgs  1815
             FWT+DVPTI+NK  PDFCSVYVI+KGK +SIR AAR  ++  T          ++    S
Sbjct  134   FWTNDVPTILNKAVPDFCSVYVIAKGKIESIRYAARSASSSAT------PQRQKSPRSRS  187

Query  1814  saasssAGDDRIS-ACSSRGEHSGRPFRRSEDR--------DADGSVRRPWNSSCRNSLA  1662
                S   G   +S A   RGE       R   R        D D S     NS+ R+S  
Sbjct  188   PLKSDHHGPHDVSRAKLMRGEKKSIASERVRSRIGSIDGSTDIDISFIASSNSTNRSSPF  247

Query  1661  EDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaS-KDLESEMKRLKLELKQTMDM  1485
             + +D   P   G    A   NL+  ++ ++  +    ++  +LE+EMKRLKLELK+T+D 
Sbjct  248   KASDFSTPFPLG-SVGAPLPNLEIEKLLESVENVCHQSAPSELEAEMKRLKLELKETLDK  306

Query  1484  YNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaeka  1305
             YN AC++AI+AK+ A+ LQQ+K+E+S++ ++ R   EA   + ++EK K KAA EAAEKA
Sbjct  307   YNTACRDAISAKQKAEALQQLKLEDSEKCDRDRVIGEATSAVAQVEKTKYKAAYEAAEKA  366

Query  1304  qkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKI  1125
             Q++AE+E  R KYAE +A+KE  EK+RAL+VLS+SD RYR+Y+I+EIE AT+KFS +MKI
Sbjct  367   QRLAEIEGHRRKYAEEQAEKEAKEKDRALTVLSQSDVRYRRYTIEEIEDATDKFSSAMKI  426

Query  1124  GEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYG  945
             GEGGYGPVY+ KLDHTPVAIKVLR D AQGRKQFQQE+EVL  +RHPN+VLLLGACPE+G
Sbjct  427   GEGGYGPVYKAKLDHTPVAIKVLRSDEAQGRKQFQQEIEVLCSIRHPNLVLLLGACPEFG  486

Query  944   CLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPA  765
             CLVYE+M NGSLEDRL RKGN+P IPW IRFK++A+IATALLFLHQ++PEPLVHRDLKPA
Sbjct  487   CLVYEFMSNGSLEDRLFRKGNSPPIPWRIRFKLAADIATALLFLHQTRPEPLVHRDLKPA  546

Query  764   NILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDI  585
             NILLD  +V KISDVGL+RLVPPSVAD V+ YHMTSAAGTFCYIDPEYQQTG+LGTKSDI
Sbjct  547   NILLDHYYVCKISDVGLSRLVPPSVADSVSNYHMTSAAGTFCYIDPEYQQTGELGTKSDI  606

Query  584   YSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAE  405
             YSLGVMLLQ+ITA+PPMGLTHHVERAI+ G FADLLDPT+ DWPVEEA  FAKL+L+C E
Sbjct  607   YSLGVMLLQVITARPPMGLTHHVERAIKAGNFADLLDPTVQDWPVEEAFSFAKLALKCVE  666

Query  404   LRKKDRPDLGSVILPELNRLKELALQS  324
             LRKKDRPDLGSVI+PEL RLKE+A+ S
Sbjct  667   LRKKDRPDLGSVIVPELCRLKEIAMSS  693



>ref|XP_010314823.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Solanum lycopersicum]
Length=642

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/644 (64%), Positives = 507/644 (79%), Gaps = 37/644 (6%)
 Frame = -3

Query  2198  DAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
             D++GG+SD     VFTPF+AYSAR+ I++KE  IE+TE +K ++ YIN++ V+N+VLGAS
Sbjct  14    DSNGGLSDEATQNVFTPFKAYSARKRIVVKEIVIENTEASKGLLEYINSNSVTNIVLGAS  73

Query  2018  SRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgss  1839
             SRSA+ RK+WTHDVPT+VNK AP+FCSVYV+SKGKQQS+RPAA+   +LP+ + +   SS
Sbjct  74    SRSALGRKYWTHDVPTLVNKAAPEFCSVYVVSKGKQQSVRPAAK---SLPSCVPARQPSS  130

Query  1838  srassrgssaasssAGDDRISACSSRGEHSGR-PFRRSEDRDADGSVRRPWNSSCRNSLA  1662
             S  S+                + +S  E S R  + RS+ +  +    RP      + + 
Sbjct  131   SAWSAPR--------------SSNSGSEDSIRFSYTRSDQKIVESEKMRPEKGP--SIVP  174

Query  1661  EDNDLFAPISDGFDNAA-----------------AAQNLDFTRisdagsdassiaSKDLE  1533
              DN  F  +++ + + +                  ++NLDFT+++   +  +   S  ++
Sbjct  175   IDNPHFPEMTNPYKHTSQPDGMRYARISPRSVDMTSENLDFTQVAIRETPMNGNTSYSVD  234

Query  1532  SEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVe  1353
             +EMKRLKLEL+QTMDMYN ACKEA+ A ++A EL + KIEE+++FEQAR AEEAAL + E
Sbjct  235   AEMKRLKLELRQTMDMYNAACKEAVVANQAADELNKWKIEEARKFEQARFAEEAALAIAE  294

Query  1352  mekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSI  1173
              EKAKC+AA+EAA+KAQK+AE+EAQR KYAE+KAK+E  +K +A++V S++D RYRKY+I
Sbjct  295   TEKAKCRAAIEAAKKAQKMAEIEAQRRKYAELKAKREAEKKKQAINVRSQNDIRYRKYTI  354

Query  1172  DEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLM  993
             +EIE AT+KFS + KIGEGGYGPV++GKLDHTPVAIKVL PDAAQG+KQFQQEVEVLSL+
Sbjct  355   EEIEAATKKFSNAQKIGEGGYGPVFKGKLDHTPVAIKVLSPDAAQGKKQFQQEVEVLSLI  414

Query  992   RHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFL  813
             RHPN+VLLLGACPEYGCLVYE M NGSLEDRL RKGNTP+IPWEIRFKI+AEIAT LLFL
Sbjct  415   RHPNLVLLLGACPEYGCLVYELMNNGSLEDRLFRKGNTPSIPWEIRFKIAAEIATGLLFL  474

Query  812   HQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYI  633
             HQSKPEPLVHRDLKP NILLD+N+V KISDVGLARLVP SVAD VTQYHMTSAAGTFCYI
Sbjct  475   HQSKPEPLVHRDLKPGNILLDKNYVCKISDVGLARLVPSSVADCVTQYHMTSAAGTFCYI  534

Query  632   DPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWP  453
             DPEYQQTG+L TKSDIYSLGVMLLQIITA+PPMGLTHHVERAIEKG FAD LDPT+ +WP
Sbjct  535   DPEYQQTGRLETKSDIYSLGVMLLQIITARPPMGLTHHVERAIEKGKFADFLDPTVPNWP  594

Query  452   VEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             VEEAL FAKLSL+CAELRKKDRPDLGSV++PEL RL E  + S+
Sbjct  595   VEEALKFAKLSLKCAELRKKDRPDLGSVVVPELTRLCEFGMSSM  638



>ref|XP_011070514.1| PREDICTED: U-box domain-containing protein 52-like [Sesamum indicum]
Length=703

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/695 (60%), Positives = 514/695 (74%), Gaps = 32/695 (5%)
 Frame = -3

Query  2348  GPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHD  2169
             G  T VAVD+DK+SA+AV+W +DNLL++N  + LLHV+ +   NH  G P+A    ++  
Sbjct  5     GSATAVAVDRDKHSATAVRWAIDNLLVTNTTLNLLHVKTRNLHNHNGGAPEA----NNES  60

Query  2168  GHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW  1989
                +FT FRAY AR+GIIM+   +E T+V   ++ YI++H +SN+VLGASSRS I+R FW
Sbjct  61    FEDLFTQFRAYGARKGIIMQPVVLEGTDVHSTLIDYISSHHISNIVLGASSRSPITRMFW  120

Query  1988  THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAA---------RPLTNLPTHIWshhgsss  1836
             THDVPT++NK APDFCSVYVIS+GK QS+RPAA         RP + L +       SS 
Sbjct  121   THDVPTMINKAAPDFCSVYVISRGKTQSVRPAAQPAAGSTPPRPQSPLGSPRTPVKCSSE  180

Query  1835  rassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSL---  1665
                   + +  S      IS+  S+ + S  P   S    +   V      S R S+   
Sbjct  181   AIKPERTLSNGSMRHHHEISSSLSK-KPSANPSWWSSRNSSSLEV------SSRGSILHS  233

Query  1664  ----AEDNDLFAP--ISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLEL  1503
                 + DND+  P  IS G    A  Q L   + +   +D    +S    +E+++LKLE+
Sbjct  234   SSWKSRDNDVAEPDEISHGSTGIANGQMLG--KSTGETADHEENSSPPQINELEKLKLEV  291

Query  1502  KQTMDMYNNACKEAITAKKSAKELQQM-KIeesqrfeqarqaeeaalRMVemekakckaa  1326
             +QTM+MYN ACKEA++ K  A EL +M K+++    +QAR AEEAAL ++E+EKAKC+AA
Sbjct  292   RQTMNMYNTACKEAVSLKHQADELHEMNKLDDIHGLQQARTAEEAALALLEVEKAKCRAA  351

Query  1325  meaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEK  1146
             +EAAEKAQ++A+ E QR K AE++AK+E  EK+RAL++LS +D RYR+Y+I+EIE AT K
Sbjct  352   IEAAEKAQELAKRETQRRKQAELRAKREAKEKSRALTILSNNDVRYRRYTIEEIEAATNK  411

Query  1145  FSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLL  966
             FS+S KIGEGGYGPV++GKLDHT VA+KVLRPDA QGRKQFQQEVEVLS MRHPNMVLL+
Sbjct  412   FSRSFKIGEGGYGPVFKGKLDHTRVAVKVLRPDATQGRKQFQQEVEVLSFMRHPNMVLLM  471

Query  965   GACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLV  786
             GACPEYG LVYEYM NGSLEDRL RKGNTP IPW IRFKI+A+IAT LLFLHQ+KPEPLV
Sbjct  472   GACPEYGILVYEYMNNGSLEDRLFRKGNTPPIPWSIRFKIAADIATGLLFLHQAKPEPLV  531

Query  785   HRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGK  606
             HRDLKPANILLDRN+  KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGK
Sbjct  532   HRDLKPANILLDRNYTCKISDVGLARLVPPSVADSVTQYHMTSAAGTFCYIDPEYQQTGK  591

Query  605   LGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAK  426
             LGTKSDIYSLGVMLLQIITA+PPMGLTH VE+AIEKGTF D LDP++ DWP+EE L +A 
Sbjct  592   LGTKSDIYSLGVMLLQIITARPPMGLTHQVEKAIEKGTFVDFLDPSVPDWPIEETLGYAN  651

Query  425   LSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             ++L+CAELRKKDRPDL   ILP+LNRLK+L  + +
Sbjct  652   MALKCAELRKKDRPDLAKDILPQLNRLKKLGTEHV  686



>gb|EYU46472.1| hypothetical protein MIMGU_mgv1a002470mg [Erythranthe guttata]
Length=669

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/682 (62%), Positives = 510/682 (75%), Gaps = 54/682 (8%)
 Frame = -3

Query  2345  PITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGP--DAHGGMSDH  2172
             P   VAVDKD+ S   ++W V+NLL+SN  +IL+HV+ K      NGG   +A+GG  D 
Sbjct  13    PTVAVAVDKDRRSTLTIRWAVENLLVSNKNLILIHVKTKHG---WNGGSHVEANGGNVDD  69

Query  2171  DGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKF  1992
                 +F+ +RAY AR+G I+ E+ ++  EV   I+ YIN   V+N+VLGASSR+ + R F
Sbjct  70    ----IFSRYRAYFARKGTIVHEEVLQGNEVHTTILDYINKKHVTNIVLGASSRNHLLR-F  124

Query  1991  WTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR-----PLT-NLPTHIWshhgsssra  1830
             WTHDVPT+VNK APDFCSVYVI+KGK QSIRPA R     P+   LP+ +          
Sbjct  125   WTHDVPTMVNKAAPDFCSVYVIAKGKAQSIRPAVRQDQASPIPPKLPSPLAHL-------  177

Query  1829  ssrgssaasssAGDDRISACSSRGEHSG-RPFRRSEDRDADGSVRRPWNSSCRNSLAEDN  1653
                             I+   S  E  G +P R   +++ D   +   N S RNSL    
Sbjct  178   ----------------INFSHSEQEEDGSKPPRVKGEKNNDQLHQETQNRSLRNSL----  217

Query  1652  DLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNA  1473
               F   +D +D +   Q++D TR+    +       K  ++E+ RLKLE++QTM+MYN A
Sbjct  218   --FDSPTDHWD-SFDLQSMDITRVETVDN-------KKADNEVVRLKLEVEQTMNMYNTA  267

Query  1472  CKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkia  1293
             CK+A +A++   EL+QMK++E  RFEQAR AEEAAL +VEMEKAKC+AA+EAAEKAQKIA
Sbjct  268   CKDAASAQQRVDELKQMKMDEVNRFEQARLAEEAALALVEMEKAKCRAAIEAAEKAQKIA  327

Query  1292  emeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGG  1113
             E E QR K+AEMKAK+E+ +KNRAL VLS SD RYRKY+I+EI+ AT+  S SMKIGEGG
Sbjct  328   EKETQRRKHAEMKAKRESEDKNRALDVLSNSDVRYRKYTIEEIQIATDNLSNSMKIGEGG  387

Query  1112  YGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVY  933
             YGPV++GKLDHTPVAIK+LR DAAQGRKQFQQEVEVLS +RHPNMVLL+GACPEYGCLVY
Sbjct  388   YGPVFKGKLDHTPVAIKLLRADAAQGRKQFQQEVEVLSCIRHPNMVLLMGACPEYGCLVY  447

Query  932   EYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILL  753
             E+M+NGSLEDRL RKGNTP IPW +RFKI+A+IAT LLFLHQ+KPE LVHRDLKP NILL
Sbjct  448   EFMDNGSLEDRLFRKGNTPPIPWGVRFKIAADIATGLLFLHQTKPESLVHRDLKPGNILL  507

Query  752   DRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLG  573
             D ++  KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYS G
Sbjct  508   DHHYTCKISDVGLARLVPPSVADIVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSFG  567

Query  572   VMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKK  393
             V+LLQIITA+PPMGLTHHVERAIEKG FADLLDPT+ DWPVEEAL FAKL L+CAELRKK
Sbjct  568   VVLLQIITARPPMGLTHHVERAIEKGVFADLLDPTVPDWPVEEALGFAKLGLKCAELRKK  627

Query  392   DRPDLGSVILPELNRLKELALQ  327
             DRPDLG  ILPELNRLKEL ++
Sbjct  628   DRPDLGKEILPELNRLKELGMK  649



>ref|XP_004305624.1| PREDICTED: U-box domain-containing protein 51-like [Fragaria 
vesca subsp. vesca]
Length=734

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/693 (61%), Positives = 527/693 (76%), Gaps = 31/693 (4%)
 Frame = -3

Query  2354  TTGPI--TVVAVDKD-KNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGG  2184
             +T PI  T VAVDKD KNS +AV+W +D+L+ISNP++IL+HVR K++ N  +GG      
Sbjct  8     STPPINATAVAVDKDSKNSNTAVRWAIDHLVISNPYLILIHVRQKSNYNDGDGG------  61

Query  2183  MSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAI  2004
               + + + VF PFR Y AR+GI +KE  +++ +VAKA++ YI+T+ ++N+V+GAS+R+A+
Sbjct  62    --ESENYNVFLPFRGYCARKGIQLKEVVLDEQDVAKALLDYISTNYINNIVVGASTRNAL  119

Query  2003  SRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL-------------PTH  1863
             +R+    DVP+ + K+AP+FCSVYV+ KGK  S+R A RP+ N              P  
Sbjct  120   TRRLKGLDVPSSLTKSAPEFCSVYVVHKGKMLSVRTARRPVVNSVTPPKQPPVQALPPQS  179

Query  1862  IWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDR---DADGSVRRP  1692
               +        +   +   +  +G +++ A   R   +  P   S D     +  S  R 
Sbjct  180   PTTEQNGGENVARTPTRERTLKSGSEKLVATRERTRSA--PMNLSLDNIDIQSHESGSRS  237

Query  1691  WNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLK  1512
               SS RNS A++ +   P+        ++Q+LDF   +    D+S  +SK++E+EMKRLK
Sbjct  238   SVSSARNSTADEYEFAVPVHPFGSMDISSQSLDFC--TSPPKDSSRQSSKEIEAEMKRLK  295

Query  1511  LELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakck  1332
              ELKQTMDMY++ACKEAI+AK  AKEL Q K EE+++FE+AR AEE AL ++EMEKAKCK
Sbjct  296   QELKQTMDMYSSACKEAISAKNKAKELDQWKQEEARKFEEARLAEENALAIIEMEKAKCK  355

Query  1331  aameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFAT  1152
              A+EAAE AQ++AE EA+R   AEMKAKKE  EKNRALS L+ +D RYRKY+I+EIE AT
Sbjct  356   EAIEAAEAAQRMAEKEARRRIQAEMKAKKEAEEKNRALSALAHNDVRYRKYTIEEIEQAT  415

Query  1151  EKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVL  972
             EKF+ SMKIGEGGYGPVY+GKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS +R+PNMVL
Sbjct  416   EKFADSMKIGEGGYGPVYKGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSCIRYPNMVL  475

Query  971   LLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEP  792
             LLGACPEYGCLVYEYM+NGSLEDRLLR+GNTP I W  RFKI+AEI+TALLFLHQ+KPEP
Sbjct  476   LLGACPEYGCLVYEYMDNGSLEDRLLRRGNTPPISWRKRFKIAAEISTALLFLHQAKPEP  535

Query  791   LVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQT  612
             LVHRDLKPANILLDRN+VSKISDVGLARLVP S+AD+VTQYHMTSAAGTFCYIDPEYQQT
Sbjct  536   LVHRDLKPANILLDRNYVSKISDVGLARLVPASIADEVTQYHMTSAAGTFCYIDPEYQQT  595

Query  611   GKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHF  432
             G L TKSD+YSLG++LLQIITA+P M L+HHV  +IE+GTFAD+LDPT+ DWPVEEAL F
Sbjct  596   GMLTTKSDVYSLGIVLLQIITARPAMALSHHVRMSIERGTFADILDPTVLDWPVEEALAF  655

Query  431   AKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             AKL+L+C ELRKKDRPDLG VI+PELNRL++  
Sbjct  656   AKLALKCTELRKKDRPDLGKVIVPELNRLRDFG  688



>ref|XP_009412924.1| PREDICTED: U-box domain-containing protein 35-like [Musa acuminata 
subsp. malaccensis]
Length=779

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/721 (58%), Positives = 514/721 (71%), Gaps = 63/721 (9%)
 Frame = -3

Query  2369  SSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAH  2190
             + DG      T VA+DKDKNS  AVKW +D+LL+ +  VIL+HV+ K   NH+    DA 
Sbjct  6     ADDGGRPPASTAVAIDKDKNSQQAVKWAIDHLLLGSYAVILIHVKTKPPLNHETTS-DAI  64

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
                ++++   +F PFR + AR+G+ M E  +ED +V+KAI+ YINT+ + N+V+GASSR+
Sbjct  65    REQAENEMSQLFLPFRGFCARKGVHMTEVVLEDNDVSKAIIDYINTNYIQNIVVGASSRN  124

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP---LTNLPTHIWshhgss  1839
             A+++KF   DVPT + K AP+FC+VYVISKGK  ++R A  P      LP          
Sbjct  125   ALTKKFRNPDVPTNIGKLAPEFCAVYVISKGKPVTVRTAKSPPPLAGVLPPQ--------  176

Query  1838  srassrgssaasssAGDDRISACSSRGEH-----SGRPFRRSEDRDAD------------  1710
                     ++   +  DD I    +R  +      G P RRS +R+ D            
Sbjct  177   ----PSVLASPQMADPDDSIKTPFTRAGYRGTMAPGTPDRRSFERNMDHIRTPSRERPLL  232

Query  1709  ------GSV---------RRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDF-----  1590
                   G+V         R P  S+ R+ + +D D        F      Q++DF     
Sbjct  233   GGRTPPGNVLLDGIDSSHRPPRPSASRDMIFDDLD--------FQGGTGFQSMDFGSMEI  284

Query  1589  --TRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKI  1416
               T         S  + +DLE+EM+RLKLELKQTM+MY+ ACKEAI+AK+ AKEL Q K+
Sbjct  285   SSTSSDSPKGSLSPTSGRDLEAEMRRLKLELKQTMEMYSTACKEAISAKQKAKELHQWKL  344

Query  1415  eesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketa  1236
             EE++R E+A+ AEE AL + EMEKAKCKAA+E AE AQ+IAE EA++   AEMKAK+E  
Sbjct  345   EEARRVEEAKHAEEMALALAEMEKAKCKAAVEMAEAAQRIAEQEARKRMNAEMKAKREAE  404

Query  1235  eKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVL  1056
             EK +AL  L+ +D RYRKYSI+EIE AT++FS ++KIGEGGYGPVYR  LDHTPVAIKVL
Sbjct  405   EKVKALDALAMTDLRYRKYSIEEIEIATDQFSANLKIGEGGYGPVYRACLDHTPVAIKVL  464

Query  1055  RPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTP  876
             RPDAAQGRKQFQQEVEVLS +RHPNMVLLLGACPEYGCLVYEYM+NGSLEDRL R+GNTP
Sbjct  465   RPDAAQGRKQFQQEVEVLSSIRHPNMVLLLGACPEYGCLVYEYMDNGSLEDRLFRRGNTP  524

Query  875   AIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPP  696
              IPW +RFKI+AEIAT LLFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPP
Sbjct  525   PIPWSVRFKIAAEIATGLLFLHQAKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPP  584

Query  695   SVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHV  516
             SVA+ VTQY MTS AGTFCYIDPEYQQTG LGTKSDIYS G+MLLQIITAKPPMGLTHHV
Sbjct  585   SVANQVTQYRMTSTAGTFCYIDPEYQQTGMLGTKSDIYSFGIMLLQIITAKPPMGLTHHV  644

Query  515   ERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKEL  336
             ERAIE+G+F ++LD T+ DWPVEEAL FA+L+L+CAELR+KDRPDLG+V+LPELNRL+ L
Sbjct  645   ERAIERGSFTEMLDATVKDWPVEEALGFAELALKCAELRRKDRPDLGTVVLPELNRLRNL  704

Query  335   A  333
              
Sbjct  705   G  705



>ref|XP_010648364.1| PREDICTED: U-box domain-containing protein 52 isoform X2 [Vitis 
vinifera]
Length=685

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/652 (62%), Positives = 496/652 (76%), Gaps = 28/652 (4%)
 Frame = -3

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
             GG S+ D   +F  +R Y AR+ I +KE  ++D +V++AI+ YI  +R+ N+V+GAS+++
Sbjct  19    GGESETDAQQLFIAYRGYCARKAIQLKEIVLDDVDVSRAIIDYITRNRIKNIVVGASTKN  78

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN------------LPT  1866
             A++RKF  +DV T + K+APDFCSVYVISKGK  S+R A RP+ N            LP 
Sbjct  79    ALTRKFRNYDVSTSITKSAPDFCSVYVISKGKVVSVRSAQRPVVNTAVPPKLPSPRGLPP  138

Query  1865  HIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDA-------DG  1707
                  +      +   S     + G +R++      E +    R    R A       + 
Sbjct  139   QALPDNPELEDVARIQSLKGWRNVGSERVTF-----ERTNNNMRVPRARSAPTNLSIDNI  193

Query  1706  SVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFT-RisdagsdassiaSKDLES  1530
              ++RP  S+ R+S+++D D   PI     + ++ Q++DF+          +  ++K+L +
Sbjct  194   DLQRP--STSRDSVSDDLDFSTPIRFASVDLSS-QDMDFSITSDSGRDSLTPTSAKELAA  250

Query  1529  EMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVem  1350
             EMKRLKLELKQTMDMY+ ACKEAITAK+ AKEL Q ++EE++RF++AR +EEAAL M EM
Sbjct  251   EMKRLKLELKQTMDMYSTACKEAITAKQKAKELHQWRMEEARRFKEARLSEEAALAMAEM  310

Query  1349  ekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSID  1170
             EKA+CKAA+EAAE AQK+AE EAQR +YAE+KA +E  EK RAL+ L+ +D RYRKY+I+
Sbjct  311   EKARCKAAIEAAEVAQKLAEKEAQRRRYAELKASREAEEKARALTALAHNDVRYRKYAIE  370

Query  1169  EIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMR  990
             EIE ATEKFS++MKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQG +QFQQE+EVLS MR
Sbjct  371   EIEVATEKFSQAMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGMRQFQQEIEVLSCMR  430

Query  989   HPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLH  810
             HPNMVLLLGACPEYGCLVYEYM NGSLEDRLLR+G+TP+IPW +RFKI+AEIATALLFLH
Sbjct  431   HPNMVLLLGACPEYGCLVYEYMSNGSLEDRLLRRGDTPSIPWRMRFKIAAEIATALLFLH  490

Query  809   QSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYID  630
             Q+KPEP VHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQYHMTSAAGTFCYID
Sbjct  491   QAKPEPFVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYHMTSAAGTFCYID  550

Query  629   PEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPV  450
             PEYQQTG LGTKSD+YS+G+MLLQIITAKPPMGLTHHV RAIEKGTFAD+LD T+ DWPV
Sbjct  551   PEYQQTGMLGTKSDVYSMGIMLLQIITAKPPMGLTHHVRRAIEKGTFADMLDQTVPDWPV  610

Query  449   EEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQTF  294
             EEAL FA L+L+C+ELRKKDRPDLGSV+LPELNRL    + S    N +  F
Sbjct  611   EEALAFANLALKCSELRKKDRPDLGSVVLPELNRLSGFGMDSSGPDNSSNMF  662



>ref|XP_008445509.1| PREDICTED: U-box domain-containing protein 51 isoform X1 [Cucumis 
melo]
Length=743

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/695 (61%), Positives = 533/695 (77%), Gaps = 30/695 (4%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
             T VA+DKDKNS  AV+W +D+L+ISNP +IL+HVRHKA+     G  D+  G  + D   
Sbjct  17    TAVAIDKDKNSHHAVRWAIDHLVISNPLIILIHVRHKAN----QGASDSENG--ETDAQQ  70

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F P+R Y AR+G+ +KE  ++D +++KA+V Y++ + +++ V+GAS+RSA++RKF   D
Sbjct  71    LFVPYRGYCARKGVQLKEVVLDDPDISKALVDYVHKNCINSFVVGASTRSALARKFKAPD  130

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL------PTHIWshhgsssrassrg  1818
             VPT + KTAP+FCSVYVISK K  S R A RP+ N       P+ +         +SS  
Sbjct  131   VPTSIIKTAPEFCSVYVISKAKIISARAALRPVANTAMPPRQPSPLGVQSNGQPDSSSEP  190

Query  1817  ssaas--------ssAGDDRISACSSRGEHSGRPFRRSEDRDADGSV---------RRPW  1689
              + A          SAG +R+ A  + G    +   R   + +  ++         R   
Sbjct  191   ENGAKMQVAKEGWKSAGTERMLAERNGGGKPAKALTRERPKTSPTNISLENIEVPNRGSR  250

Query  1688  NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKL  1509
             +S  R+S+++DN + A ++ G  +A A Q+LDF+  S+   D++S ++++LE+EMKRLKL
Sbjct  251   SSFSRDSISDDNMMTAQMAFGSMDATA-QSLDFSASSNLSMDSASQSTRELEAEMKRLKL  309

Query  1508  ELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakcka  1329
             ELKQTMDMY++ACKEAI+AK  A+EL Q K +E+++FE+ R AEEAAL + EMEKAKCKA
Sbjct  310   ELKQTMDMYSSACKEAISAKNKARELSQWKQDEARKFEEVRLAEEAALAIAEMEKAKCKA  369

Query  1328  ameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATE  1149
             A+EAAE AQK+AE EAQR K AEMKA++E  EK RAL+ L+++D RYRKY+I+EIE +TE
Sbjct  370   AIEAAEAAQKLAEREAQRRKQAEMKARREAEEKKRALNALAQNDVRYRKYTIEEIEESTE  429

Query  1148  KFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLL  969
             KFS+ +KIGEGGYGPVY GKLDHT VAIKVLRPDAAQGRKQFQQEVEVL  +RHPNMVLL
Sbjct  430   KFSEKLKIGEGGYGPVYGGKLDHTAVAIKVLRPDAAQGRKQFQQEVEVLCCIRHPNMVLL  489

Query  968   LGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPL  789
             LGACPEYGCLVYEYM NGSLEDRL R+GN+P + W  RFKI+AEIATALLFLHQ+KPEPL
Sbjct  490   LGACPEYGCLVYEYMHNGSLEDRLFRRGNSPPLSWRRRFKIAAEIATALLFLHQAKPEPL  549

Query  788   VHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTG  609
             VHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD VTQYH+TSAAGTFCYIDPEYQQTG
Sbjct  550   VHRDLKPANILLDRNFVSKISDVGLARLVPPSVADQVTQYHLTSAAGTFCYIDPEYQQTG  609

Query  608   KLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFA  429
             KL TKSDIYS G+MLLQIITAKPPMGL HHV+RAIEK  F ++LDPTISD P+EEA +FA
Sbjct  610   KLTTKSDIYSFGIMLLQIITAKPPMGLAHHVQRAIEKDRFDEMLDPTISDCPLEEATNFA  669

Query  428   KLSLQCAELRKKDRPDLGSVILPELNRLKELALQS  324
             KL+L+CAELRK+DRPDLG+VI+PELNRL+++   S
Sbjct  670   KLALKCAELRKRDRPDLGTVIVPELNRLRDIGRSS  704



>ref|XP_010669367.1| PREDICTED: U-box domain-containing protein 51-like [Beta vulgaris 
subsp. vulgaris]
Length=751

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/704 (60%), Positives = 515/704 (73%), Gaps = 39/704 (6%)
 Frame = -3

Query  2366  SDGATTGPI--TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDA  2193
             S+   T PI  T VA+DKDK+S  AVKW +D+LL  N F+IL+HVR +         PD 
Sbjct  4     SEDMGTLPINCTAVAIDKDKHSQYAVKWAIDHLLSGNHFLILVHVRQR--------NPDQ  55

Query  2192  HGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSR  2013
                  + D   +F PFR Y AR+ + +KE  +ED ++ KAI+ Y+N++ ++N+V+GA SR
Sbjct  56    SMAGLEPDPQHIFIPFRGYCARKSVQLKEVVLEDNDIPKAILDYVNSNFITNIVIGACSR  115

Query  2012  SAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssr  1833
             +A+ + F   DVP+ V K AP+FCSVYVI+K K  S+R A RP+ N PT        SS 
Sbjct  116   NALVKTFKKPDVPSYVTKCAPEFCSVYVIAKSKVLSVRSAQRPVANTPT---PPRLPSSL  172

Query  1832  assrgssaasssAGDDRISACSSRGE-HSGRPFRRSEDRDADGSV--RR-----PW----  1689
               +   S   +S  D    A S RG  +S    R S +R++D S   RR      W    
Sbjct  173   GLTHQQSVEHASMDDFNTRASSLRGSMNSNGTERISWERNSDSSRAGRRTLMGSSWKISS  232

Query  1688  ----------NSSCRNSLAED-NDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSK  1542
                        +S R+SL++D N       +  D AA   +  F           +  S 
Sbjct  233   SMDNIDIGGGTTSNRSSLSDDDNHEHFSFRNMIDVAAKDSDFSFV---SGPRRDDTQQSN  289

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             DLE+EM+RL+LELKQTMDMY++ACKEAI AK+ AKEL   K+EE +++EQ R  EE+A  
Sbjct  290   DLEAEMRRLRLELKQTMDMYSSACKEAINAKQKAKELNDWKLEELRKYEQTRYTEESAHA  349

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             +VEMEKAKCKAA+EAAE AQK+AE EAQ+ K+AE+KAK+E  EKNRAL+ L+++D RYRK
Sbjct  350   LVEMEKAKCKAAIEAAEAAQKLAEKEAQKRKFAELKAKQEADEKNRALTALAQNDVRYRK  409

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSIDEIE ATEKFS   KIGEGGYGPVYRG+LDHTPVAIKVLRPDAAQGR+QFQQEVEVL
Sbjct  410   YSIDEIEVATEKFSPQYKIGEGGYGPVYRGRLDHTPVAIKVLRPDAAQGRRQFQQEVEVL  469

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S MRHP+MVLLLGACPEYGCLVYEYM NGSLEDRLLRKG TP+I W +RFKI+AEIA AL
Sbjct  470   SSMRHPHMVLLLGACPEYGCLVYEYMNNGSLEDRLLRKGGTPSISWRVRFKIAAEIAIAL  529

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
              FLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVA+ VTQYHMTSAAGTF
Sbjct  530   TFLHQAKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVANSVTQYHMTSAAGTF  589

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG L TKSD+YSLG+MLLQIITAKP MGL+HHV+RAI+ GTF+++LDPT+ 
Sbjct  590   CYIDPEYQQTGMLTTKSDVYSLGIMLLQIITAKPAMGLSHHVQRAIDNGTFSEMLDPTVH  649

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
             DWPV+EAL FAK++L+C ELRK+DRPD+GS++LPEL RL++  +
Sbjct  650   DWPVDEALSFAKMALKCCELRKRDRPDIGSIVLPELCRLRDFGM  693



>ref|XP_010491956.1| PREDICTED: U-box domain-containing protein 51-like isoform X1 
[Camelina sativa]
Length=706

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/707 (60%), Positives = 528/707 (75%), Gaps = 32/707 (5%)
 Frame = -3

Query  2378  PTISSDGATTGPI--TVVAVDKDKNSASAVKWTVDNLLI---SNPFVILLHVRHKASPNH  2214
             P  S DG    P+  TVVA+DKDKNS  AV+W VD+L     +N  +IL+HVR K S NH
Sbjct  4     PYPSEDGHGHAPVNSTVVAIDKDKNSHYAVRWAVDHLFNMNNNNTSMILVHVRLKNS-NH  62

Query  2213  QNGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNV  2034
                     G + D++ + +F P+R Y AR+GI M E  +EDT+VAKAI+ Y+N + V+N+
Sbjct  63    G-------GNIDDNEINQLFVPYRGYCARKGITMMEVILEDTDVAKAILDYVNNNLVTNL  115

Query  2033  VLGASSRSAISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTH  1863
             VLG+SS+S  +R  KF  +HDVP  V K+ P+FCS+YVISKGK QS + A RP+TN  T 
Sbjct  116   VLGSSSKSPFARSLKFTKSHDVPASVLKSMPEFCSIYVISKGKVQSSKTAQRPITN--TL  173

Query  1862  IWshhgsssrassrgssaasssAGDDRISACSSRGEHSG---RPFRRSEDRDADGSV---  1701
             +     SS+  +             +  ++   R  H G   +P R  +    +GS+   
Sbjct  174   VPPRAPSSTFHTPDNDQDHLPRNQRNARNSTPERHSHDGNGYKPMREMQKIPTNGSLDFN  233

Query  1700  ---RRPW----NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFT-RisdagsdassiaS  1545
                R+P     +SS RNS  ++ D+ + +  G      A+NLD     S +  ++ S ++
Sbjct  234   YDFRQPRCQKNSSSARNSFTDEGDVGSVMMMGASIDLTAENLDLVVGASASSDESVSQST  293

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EMKRLK+ELKQTMDMY++ACKEA+ AKK A EL   K+EE++RFE+AR +EEAAL
Sbjct  294   RDIEAEMKRLKIELKQTMDMYSSACKEALNAKKKANELNLWKMEEARRFEEARVSEEAAL  353

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + EMEKAKC+AA+EAAEKAQ++AE+E QR K AE+KA++E+ EK+RALS L ++D RYR
Sbjct  354   AVAEMEKAKCRAAIEAAEKAQRMAELEGQRRKQAEIKARRESQEKDRALSALVQNDVRYR  413

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             +YSI+EIE AT+ F+ + KIGEGGYGPVY G LDHTPVAIKVLRPDAAQG+KQFQQEVEV
Sbjct  414   RYSIEEIEEATDNFANNRKIGEGGYGPVYYGTLDHTPVAIKVLRPDAAQGKKQFQQEVEV  473

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHP+MVLLLGACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATA
Sbjct  474   LSSIRHPHMVLLLGACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIAAEIATA  533

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             L FLHQ+KPEPLVHRDLKPANILLD+N+VSKISDVGLARLVP SVA+ VTQ+HMTSAAGT
Sbjct  534   LSFLHQAKPEPLVHRDLKPANILLDKNYVSKISDVGLARLVPASVANTVTQFHMTSAAGT  593

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTGKL TKSDIYSLG+MLLQIITAK PMGL HHV RAI+KGTF DLLDP +
Sbjct  594   FCYIDPEYQQTGKLTTKSDIYSLGIMLLQIITAKNPMGLAHHVSRAIDKGTFKDLLDPAV  653

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQS  324
             +DWPVEEA +FAKL LQCAELRK+DRPDLG  I+PEL RLK L + +
Sbjct  654   TDWPVEEATNFAKLCLQCAELRKRDRPDLGKEIVPELLRLKNLGMNN  700



>ref|XP_002533173.1| kinase, putative [Ricinus communis]
 gb|EEF29210.1| kinase, putative [Ricinus communis]
Length=752

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/685 (61%), Positives = 521/685 (76%), Gaps = 33/685 (5%)
 Frame = -3

Query  2333  VAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCVF  2154
             VA+DKDKNS   V+W +D+L+I+NP +IL+HVRHK   +H N G D    +   +   +F
Sbjct  18    VAIDKDKNSQHVVRWAIDHLIINNPVIILVHVRHKNHQHHANNGND----VDSDEVQQLF  73

Query  2153  TPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVP  1974
              PFR Y AR+G+ +KE  +ED +VA+A++ YI+ + + ++V+GAS+R+A +RKF   DVP
Sbjct  74    VPFRGYCARKGVQLKEIILEDNDVARALLDYISKNFLGSIVVGASTRNAFTRKFKNQDVP  133

Query  1973  TIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaasssA  1794
             + + K+ PDFCSVYVISKGK  S+R A RP  N P         +  A    +    S  
Sbjct  134   SSLIKSTPDFCSVYVISKGKIASVRTAQRPANNPPI---PPKVPNMLALPGPTPHDHSDY  190

Query  1793  GDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWN------------------SSCRNS  1668
              DD I     R   S  P R    RD     R P N                  S+ R S
Sbjct  191   YDDGIRFPYER---SNDPMRGQLIRD---RTRTPSNLSMDSIDISFPGGAAPRISTSRVS  244

Query  1667  LAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMD  1488
               ED+D  +P + G  + ++ QN DF+ +      A+S A++D+E+EM+RL++ELKQT+D
Sbjct  245   TYEDHDFSSPFALGSIDISS-QNPDFS-LGSPKDLAASQAARDIEAEMRRLRVELKQTID  302

Query  1487  MYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaek  1308
             MY+ AC+EA+TAKK A EL Q K+EE++RFE+AR AEEAAL + EMEKAKCKAA+EAAEK
Sbjct  303   MYSTACREALTAKKKANELHQWKMEEARRFEEARHAEEAALAIAEMEKAKCKAAIEAAEK  362

Query  1307  aqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMK  1128
             AQ++A+MEAQ+ KYAE+KAK+E  EKNRAL+ L+ +D RYRKY+I+EIE ATEKFS+S K
Sbjct  363   AQRLAKMEAQKRKYAELKAKREAEEKNRALTALAHNDVRYRKYTIEEIEDATEKFSQSNK  422

Query  1127  IGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEY  948
             IGEGGYGPVY+G LDHT VAIKVLRPDAAQG+KQFQQEVEVLS +RHP+MVLLLGACPEY
Sbjct  423   IGEGGYGPVYKGTLDHTAVAIKVLRPDAAQGKKQFQQEVEVLSCIRHPHMVLLLGACPEY  482

Query  947   GCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKP  768
             GCLVYEYM+NGSLEDRLL++ NTP I W  RFKI+AEI+TALLFLHQ+KPEPLVHRDLKP
Sbjct  483   GCLVYEYMDNGSLEDRLLQRDNTPPISWRRRFKIAAEISTALLFLHQAKPEPLVHRDLKP  542

Query  767   ANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSD  588
             ANILLDRN+VSKISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTG L T+SD
Sbjct  543   ANILLDRNYVSKISDVGLARLVPPSVADSVTQYHMTSAAGTFCYIDPEYQQTGMLTTRSD  602

Query  587   IYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCA  408
             IYSLG++LLQIITAKPPMGL HHV +AIE+GTF  +LDP++ DWPVEEAL+FAKL+L+CA
Sbjct  603   IYSLGILLLQIITAKPPMGLAHHVGKAIERGTFEKMLDPSVVDWPVEEALNFAKLALKCA  662

Query  407   ELRKKDRPDLGSVILPELNRLKELA  333
             ELRKKDRP+L +VI+PEL+R+++L 
Sbjct  663   ELRKKDRPNLLTVIVPELSRIRDLG  687



>gb|KGN47604.1| hypothetical protein Csa_6G363600 [Cucumis sativus]
Length=742

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/696 (60%), Positives = 531/696 (76%), Gaps = 31/696 (4%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
             T VA+DKDKNS  AV+W +D+L+ISNP +IL+HVRHKA+     G  D+  G  + D   
Sbjct  17    TAVAIDKDKNSHHAVRWAIDHLVISNPLIILIHVRHKAN----QGASDSENG--ETDAQQ  70

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F P+R Y AR+G+ +KE  ++D +++KA+V Y++ + +++ V+GAS+RSA++RKF   D
Sbjct  71    LFVPYRGYCARKGVQLKEVVLDDPDISKALVDYVHKNCINSFVVGASTRSALARKFKAPD  130

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL------PTHIWshhgsssrassrg  1818
             VPT + KTAP+FCSVYVISK K  S R A RP+ N       P+ +       S +SS  
Sbjct  131   VPTSIIKTAPEFCSVYVISKAKIISARAALRPVANTAMPPRQPSPLGVQPNGQSDSSSEP  190

Query  1817  ssaas--------ssAGDDRISACSSRGEHSGRPFRRSEDRDADGSV---------RRPW  1689
              + A          SAG +R+ A  + G    +   R   + +  ++         R   
Sbjct  191   ENGAKCQVAKEGWKSAGTERMLAERNGGGKQAKALTRERPKTSPTNISLENIEVPNRGSR  250

Query  1688  NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFT-RisdagsdassiaSKDLESEMKRLK  1512
             +S  R+S+++DN + A ++ G  +  A Q+LDF+   + +   A+  ++++LE+EMKRLK
Sbjct  251   SSFSRDSISDDNMMTAQMAFGSMDVTA-QSLDFSANSNLSMDSAAGQSTRELEAEMKRLK  309

Query  1511  LELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakck  1332
             LELKQTMDMY++ACKEAI+AK  A+EL Q K +E+++FE+ R AEEAAL + EMEKAKCK
Sbjct  310   LELKQTMDMYSSACKEAISAKNKARELSQWKQDEARKFEEVRLAEEAALAIAEMEKAKCK  369

Query  1331  aameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFAT  1152
             AA+EAAE AQK+AE EAQR K AEMKA++E  EK RAL+ L+++D RYRKY+I+EIE +T
Sbjct  370   AAIEAAEAAQKLAEREAQRRKQAEMKARREAEEKKRALNALAQNDVRYRKYTIEEIEEST  429

Query  1151  EKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVL  972
             EKFS+ +KIGEGGYGPVY GKLDHT VAIKVLRPDAAQGRKQFQQEVEVL  +RHPNMVL
Sbjct  430   EKFSEKLKIGEGGYGPVYGGKLDHTAVAIKVLRPDAAQGRKQFQQEVEVLCCIRHPNMVL  489

Query  971   LLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEP  792
             LLGACPEYGCLVYEYM NGSLEDRL R+GN+P + W  RFKI+AEIATALLFLHQ+KPEP
Sbjct  490   LLGACPEYGCLVYEYMHNGSLEDRLFRRGNSPPLSWRRRFKIAAEIATALLFLHQAKPEP  549

Query  791   LVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQT  612
             LVHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD VTQYH+TSAAGTFCYIDPEYQQT
Sbjct  550   LVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADQVTQYHLTSAAGTFCYIDPEYQQT  609

Query  611   GKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHF  432
             GKL TKSDIYS G+MLLQIITAKPPMGL HHV+RAIEK  F ++LDPTISD P+EEA +F
Sbjct  610   GKLTTKSDIYSFGIMLLQIITAKPPMGLAHHVQRAIEKDRFDEMLDPTISDCPLEEATNF  669

Query  431   AKLSLQCAELRKKDRPDLGSVILPELNRLKELALQS  324
             AKL+L+CAELRK+DRPDLG++I+PELNRL+++   S
Sbjct  670   AKLALKCAELRKRDRPDLGTLIVPELNRLRDIGRSS  705



>ref|XP_010419784.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Camelina sativa]
Length=705

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/711 (59%), Positives = 529/711 (74%), Gaps = 37/711 (5%)
 Frame = -3

Query  2405  HPKMDHHHHPTISSDGATTGPITVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRH  2232
             +P  D H H  ++S        TVVA+DKDKNS  AV+W VD+L  + +N  +IL+HVR 
Sbjct  5     NPPEDGHGHAPVNS--------TVVAIDKDKNSHYAVRWAVDHLFNMNNNTSMILVHVRL  56

Query  2231  KASPNHQNGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINT  2052
             K   N  NGG      + D++ + +F P+R Y AR+GI M E  ++DT+VAKA++ Y+N 
Sbjct  57    K---NSNNGG-----NVGDNELNQLFVPYRGYCARKGITMLEVILDDTDVAKAVLDYVNN  108

Query  2051  HRVSNVVLGASSRSAISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPL  1881
             + V+N+VLG+SS+S  +R  KF  +HDVP  V K+ P+FCS+YVISKGK QS + A RP+
Sbjct  109   NLVTNLVLGSSSKSPFARSLKFTKSHDVPASVLKSTPEFCSIYVISKGKVQSSKTAQRPI  168

Query  1880  TNLPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSG---RPFRRSEDRDAD  1710
             TN  T +     SS+   S               ++   R  H G   +P R  +    +
Sbjct  169   TN--TLVPPRAPSSTFHISDNDQDHLPRNQRSARNSTPERHSHDGNGYKPVREMQKIPTN  226

Query  1709  GSV------RRPW----NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFT-Risdagsd  1563
             GS+      R+P     +SS RNS  ++ D+ + +  G      A+NLD     S +  +
Sbjct  227   GSLDFSYDFRQPRCQKNSSSARNSFTDEGDVGSMMMMGASIDLTAENLDLVVGASASSDE  286

Query  1562  assiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarq  1383
             + S +++D+E+EMKRLK+ELKQTMDMY++ACKEA+ AKK A EL   K+EE++RFE+AR 
Sbjct  287   SVSQSTRDIEAEMKRLKIELKQTMDMYSSACKEALNAKKKANELNLWKMEEARRFEEARV  346

Query  1382  aeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSK  1203
             +EEAAL + EMEKAKC+AA+EAAEKAQ++AE+E QR K AE+KA++E+ EK+RALS L +
Sbjct  347   SEEAALAVAEMEKAKCRAAIEAAEKAQRMAELEGQRRKQAEIKARRESQEKDRALSALVQ  406

Query  1202  SDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQF  1023
             +D RYR+YSI+EIE AT+ F+ + KIGEGGYGPVY G LDHTPVAIKVLRPDAAQG+KQF
Sbjct  407   NDVRYRRYSIEEIEEATDNFANNRKIGEGGYGPVYYGTLDHTPVAIKVLRPDAAQGKKQF  466

Query  1022  QQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKIS  843
             QQEVEVLS +RHP+MVLLLGACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+
Sbjct  467   QQEVEVLSSIRHPHMVLLLGACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIA  526

Query  842   AEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHM  663
             AEIATAL FLHQ+KPEPLVHRDLKPANILLD+N+VSKISDVGLARLVP SVA+ VTQ+HM
Sbjct  527   AEIATALSFLHQAKPEPLVHRDLKPANILLDKNYVSKISDVGLARLVPASVANTVTQFHM  586

Query  662   TSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFAD  483
             TSAAGTFCYIDPEYQQTGKL TKSDIYSLG+MLLQIITAK PMGL HHV RAI+KGTF D
Sbjct  587   TSAAGTFCYIDPEYQQTGKLTTKSDIYSLGIMLLQIITAKNPMGLAHHVSRAIDKGTFKD  646

Query  482   LLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
             LLDP ++DWPVEEA +FAKL LQCAELRK+DRPDLG  I+PEL RLK L +
Sbjct  647   LLDPAVTDWPVEEATNFAKLCLQCAELRKRDRPDLGKEIVPELLRLKSLGM  697



>ref|XP_010453263.1| PREDICTED: U-box domain-containing protein 51-like isoform X1 
[Camelina sativa]
Length=705

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/704 (60%), Positives = 527/704 (75%), Gaps = 31/704 (4%)
 Frame = -3

Query  2378  PTISSDGATTGPI--TVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQ  2211
             P  S DG    P+  TVVA+DKDKNS  AV+W VD+L  + +N  +IL+HVR K S NH 
Sbjct  4     PNPSEDGHGHAPVNSTVVAIDKDKNSHYAVRWAVDHLFNMNNNTSMILVHVRLKNS-NHG  62

Query  2210  NGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVV  2031
                    G + D++ + +F P+R Y AR+GI M E  ++DT+VAKA++ Y+N + V+N+V
Sbjct  63    -------GNVDDNELNQLFVPYRGYCARKGITMLEVILDDTDVAKAVLDYVNNNLVTNLV  115

Query  2030  LGASSRSAISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHI  1860
             LG+SS+S  +R  KF  +HDVP  V K+ P+FCS+YVISKGK QS + A RP+TN  T +
Sbjct  116   LGSSSKSPFARSLKFTKSHDVPASVLKSTPEFCSIYVISKGKVQSSKTAQRPITN--TLV  173

Query  1859  WshhgsssrassrgssaasssAGDDRISACSSRGEHSG---RPFRRSEDRDADGSV----  1701
                  SS+                +  ++   R  H G   +P R  +    +GS+    
Sbjct  174   PPRAPSSTFHVPDNDQDHLPRNQRNARNSTPERHSHDGNGYKPVREMQKIPTNGSLDFNY  233

Query  1700  --RRPW----NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFT-RisdagsdassiaSK  1542
               R+P     ++S RNS  ++ D+ + +  G      A+NLD     S +  ++ S +++
Sbjct  234   DFRQPRCQKNSASARNSFTDEGDVGSMMMMGASIDLTAENLDLVVGASASSDESVSQSTR  293

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EMKRLK+ELKQTMDMY++ACKEA+ AKK A EL   K+EE++RFE+AR +EEAAL 
Sbjct  294   DIEAEMKRLKIELKQTMDMYSSACKEALNAKKKANELNLWKMEEARRFEEARVSEEAALA  353

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + EMEKAKC+AAMEAAEKAQ++AE+E QR K AE+KA++E+ EK+RALS L ++D RYR+
Sbjct  354   VAEMEKAKCRAAMEAAEKAQRMAELEGQRRKQAEIKARRESQEKDRALSALVQNDVRYRR  413

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE AT+ F+ + KIGEGGYGPVY G LDHTPVAIKVLRPDAAQG+KQFQQEVEVL
Sbjct  414   YSIEEIEEATDNFANNRKIGEGGYGPVYYGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVL  473

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHP+MVLLLGACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATAL
Sbjct  474   SSIRHPHMVLLLGACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIAAEIATAL  533

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
              FLHQ+KPEPLVHRDLKPANILLD+N+VSKISDVGLARLVP SVA+ VTQ+HMTSAAGTF
Sbjct  534   SFLHQAKPEPLVHRDLKPANILLDKNYVSKISDVGLARLVPASVANTVTQFHMTSAAGTF  593

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTGKL TKSDIYSLG+MLLQIITAK PMGL HHV RAI+KGTF DLLDP ++
Sbjct  594   CYIDPEYQQTGKLTTKSDIYSLGIMLLQIITAKNPMGLAHHVSRAIDKGTFKDLLDPAVT  653

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
             DWPVEEA +FAKL LQCAELRK+DRPDLG  I+PEL RLK L +
Sbjct  654   DWPVEEATNFAKLCLQCAELRKRDRPDLGKEIVPELLRLKSLGM  697



>ref|XP_004167209.1| PREDICTED: U-box domain-containing protein 51-like [Cucumis sativus]
Length=732

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/682 (60%), Positives = 524/682 (77%), Gaps = 20/682 (3%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
             T VA+DKDKNS  AV+W +D+L+ISNP +IL+HVRHKA+ +    G        + D   
Sbjct  17    TAVAIDKDKNSHHAVRWAIDHLVISNPLIILIHVRHKANRSDSENG--------ETDAQQ  68

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F P+R Y AR+G+ +KE  ++D +++KA+V Y++ + +++ V+GAS+RSA++RKF   D
Sbjct  69    LFVPYRGYCARKGVQLKEVVLDDPDISKALVDYVHKNCINSFVVGASTRSALARKFKAPD  128

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaass  1800
             VPT + KTAP+FCSVYVISK K  S R A RP+ N             + + +  S++  
Sbjct  129   VPTSIIKTAPEFCSVYVISKAKIISARAALRPVANTAMPPRQPSPLGVQPNGQSDSSSEP  188

Query  1799  sAGDDRISACSSRGEHSGRPFRRSEDRDADGSV---------RRPWNSSCRNSLAEDNDL  1647
               G   ++  +  G+ + +   R   + +  ++         R   +S  R+S+++DN +
Sbjct  189   ENGAKMLAERNGGGKQA-KALTRERPKTSPTNISLENIEVPNRGSRSSFSRDSISDDNMM  247

Query  1646  FAPISDGFDNAAAAQNLDFT-RisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNAC  1470
              A ++ G  +  A Q+LDF+   + +   A+  ++++LE+EMKRLKLELKQTMDMY++AC
Sbjct  248   TAQMAFGSMDVTA-QSLDFSANSNLSMDSAAGQSTRELEAEMKRLKLELKQTMDMYSSAC  306

Query  1469  KEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiae  1290
             KEAI+AK  A+EL Q K +E+++FE+ R AEEAAL + EMEKAKCKAA+EAAE AQK+AE
Sbjct  307   KEAISAKNKARELSQWKQDEARKFEEVRLAEEAALAIAEMEKAKCKAAIEAAEAAQKLAE  366

Query  1289  meAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGY  1110
              EAQR K AEMKA++E  EK RAL+ L+++D RYRKY+I+EIE +TEKFS+ +KIGEGGY
Sbjct  367   REAQRRKQAEMKARREAEEKKRALNALAQNDVRYRKYTIEEIEESTEKFSEKLKIGEGGY  426

Query  1109  GPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYE  930
             GPVY GKLDHT VAIKVLRPDAAQGRKQFQQEVEVL  +RHPNMVLLLGACPEYGCLVYE
Sbjct  427   GPVYGGKLDHTAVAIKVLRPDAAQGRKQFQQEVEVLCCIRHPNMVLLLGACPEYGCLVYE  486

Query  929   YMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLD  750
             YM NGSLEDRL R+GN+P + W  RFKI+AEIATALLFLHQ+KPEPLVHRDLKPANILLD
Sbjct  487   YMHNGSLEDRLFRRGNSPPLSWRRRFKIAAEIATALLFLHQAKPEPLVHRDLKPANILLD  546

Query  749   RNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGV  570
             RNFVSKISDVGLARLVPPSVAD VTQYH+TSAAGTFCYIDPEYQQTGKL TKSDIYS G+
Sbjct  547   RNFVSKISDVGLARLVPPSVADQVTQYHLTSAAGTFCYIDPEYQQTGKLTTKSDIYSFGI  606

Query  569   MLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKD  390
             MLLQIITAKPPMGL HHV+RAIEK  F ++LDPTISD P+EEA +FAKL+L+CAELRK+D
Sbjct  607   MLLQIITAKPPMGLAHHVQRAIEKDRFDEMLDPTISDCPLEEATNFAKLALKCAELRKRD  666

Query  389   RPDLGSVILPELNRLKELALQS  324
             RPDLG++I+PELNRL+++   S
Sbjct  667   RPDLGTLIVPELNRLRDIGRSS  688



>ref|XP_008808214.1| PREDICTED: U-box domain-containing protein 52 [Phoenix dactylifera]
Length=790

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/750 (57%), Positives = 531/750 (71%), Gaps = 69/750 (9%)
 Frame = -3

Query  2402  PKMDHHHHPTI--SSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHK  2229
             P+  H  H T   S+   T+ P+T VAVDKDK+S  AV+W VD+L +SN  +IL+HV+ K
Sbjct  11    PQPMHPAHATADDSNRPPTSAPLTAVAVDKDKSSQQAVRWAVDHLSVSNHAIILIHVKCK  70

Query  2228  ASPNH----QNGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGY  2061
                +H         +A+    + D   +F PF+ + AR+G+ MKE  +ED +V+KAI+ Y
Sbjct  71    NVQHHGFAMSETTSEANREQMEADVQQLFIPFKGFCARKGVQMKEVVLEDVDVSKAIIDY  130

Query  2060  INTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPA-ARP  1884
             I  + + N+V+G S+R+AI++KF   DVPT + K+ P+FCSVYVISKGK  ++R A A P
Sbjct  131   ITANHIHNIVVGNSNRNAITKKFRNPDVPTNLIKSVPEFCSVYVISKGKPVTVRSAKANP  190

Query  1883  LTNLPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGR---------PFRR  1731
                 P+H+        R  S   S       DD +    +R  + G          P RR
Sbjct  191   A---PSHL--------RQPSNPGSLHYHPDHDDAVKTPFTRASYRGSLPPPGPSAVPERR  239

Query  1730  SEDRDADGSVRRPWN-SSCRNS-------------------------LAEDNDLFAPISD  1629
             S +++ D      W  S  R +                          AED D       
Sbjct  240   SFEKNTDFMRAPAWPLSGARTAPVHTLLEFTEPSHRPPRPSSSSRESWAEDMD-------  292

Query  1628  GFDNAAAAQNLDFTRisdagsdassi--------aSKDLESEMKRLKLELKQTMDMYNNA  1473
              F  + A+Q++DF+   D  S+ S          +S+DLE+EM+RL+LELKQTMDMY+NA
Sbjct  293   -FHGSVASQSMDFSDSIDLSSNLSDSPRGPYSPNSSRDLEAEMRRLRLELKQTMDMYSNA  351

Query  1472  CKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkia  1293
             CKEAI+AK+ AKEL Q K+EE ++FE+AR AEEAAL + EMEKAK KAA+EAAE AQ+IA
Sbjct  352   CKEAISAKQKAKELHQWKMEEVRKFEEARHAEEAALALAEMEKAKAKAALEAAEAAQRIA  411

Query  1292  emeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGG  1113
             ++EAQ+   AEMKAK E  EK + L  L+++D RYRKYSI+EIE AT+ FS+++KIGEGG
Sbjct  412   KLEAQKRLNAEMKAKHEAEEKMKVLDALAQNDVRYRKYSIEEIEIATDYFSENLKIGEGG  471

Query  1112  YGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVY  933
             YGPVYR  LDHTPVAIKVLRPDAAQGR+QFQQEVEVLS +RHPNMVLLLGACPEYGCLVY
Sbjct  472   YGPVYRASLDHTPVAIKVLRPDAAQGRRQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVY  531

Query  932   EYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILL  753
             EYM++GSLEDRL R+G+TP IPW +RFKI+AEIAT LLFLHQ+KPEPLVHRDLKPANILL
Sbjct  532   EYMDSGSLEDRLFRRGSTPPIPWSVRFKIAAEIATGLLFLHQTKPEPLVHRDLKPANILL  591

Query  752   DRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLG  573
             DRN+VSKISDVGLARLVPPSVAD VTQY MTS AGTFCYIDPEYQQTG LG KSDIYSLG
Sbjct  592   DRNYVSKISDVGLARLVPPSVADSVTQYRMTSTAGTFCYIDPEYQQTGMLGIKSDIYSLG  651

Query  572   VMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKK  393
             VMLLQIITAKPPMGL+HHV+++IE+GTF ++LDPT+ DWPVEEAL FAKL+L+C ELR+K
Sbjct  652   VMLLQIITAKPPMGLSHHVDKSIERGTFQEMLDPTVPDWPVEEALGFAKLALKCVELRRK  711

Query  392   DRPDLGSVILPELNRLKELALQSLASKNGT  303
             DRPDLG+VILPELNRL+ L     A+ +G+
Sbjct  712   DRPDLGTVILPELNRLRNLGHAYEAASHGS  741



>ref|XP_008220512.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Prunus 
mume]
Length=747

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/705 (60%), Positives = 531/705 (75%), Gaps = 30/705 (4%)
 Frame = -3

Query  2354  TTGPI--TVVAVDKD-KNSASAVKWTVDNLLI--SNPFVILLHVRHKASPNHQNGGPDAH  2190
             T  PI  T VAVDKD KNS  AV++ +D+L+   +NP++IL+HVRHK    HQ+ G    
Sbjct  10    TVPPINATAVAVDKDNKNSNHAVRFAIDHLVANNTNPYIILIHVRHKNHHPHQSDGESG-  68

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
                 +HDGH VF P+RAY AR+   +KE  ++D +VAKA++ YIN H ++N+ +GAS+R+
Sbjct  69    ----NHDGHHVFVPYRAYCARKEAQVKEVILDDHDVAKALLEYINNHYINNIAVGASTRN  124

Query  2009  AISRKFWT-HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN------------LP  1869
             A++RKF   +DVPT + K AP+FCSVYVISKGK    R A RP+ N            LP
Sbjct  125   ALTRKFKIGYDVPTSLVKLAPEFCSVYVISKGKMVVGRTAKRPVVNTATPPKQPSPQGLP  184

Query  1868  THIWshhgsssrassrgssaa---sssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVR  1698
               I +    +   +    +     +S+ G ++I     R   +  P   S D D      
Sbjct  185   PCIPTEQTEADNGARGQPAVRGGWNSAGGSEKIPVARERTRSA--PVNLSMDIDIPNHGS  242

Query  1697  RPWNSSCRNSLAEDNDLFAPISDGFDNA-AAAQNLDFTRisdagsdassiaSKDLESEMK  1521
                + S RNS A++N+ F  + + F +    +Q LDF+  S +  ++S  +++D+E+EMK
Sbjct  243   SRCSLSSRNSNADENE-FPGMFNSFGSVDIISQGLDFSSASCSPKESSRQSARDIEAEMK  301

Query  1520  RLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemeka  1341
             RLKLELKQTMDMY++ACKEAI+AK  AKEL Q K EE+++FE AR AEEAAL + EMEKA
Sbjct  302   RLKLELKQTMDMYSSACKEAISAKNKAKELNQWKQEEARKFEDARHAEEAALAIAEMEKA  361

Query  1340  kckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIE  1161
             KCKAA+EAAE +Q++AEMEAQR + AEMKAKKE  EKNRAL+ L+ +D RYRKY+I+EIE
Sbjct  362   KCKAAIEAAEASQRVAEMEAQRRRQAEMKAKKEAQEKNRALNALAHNDVRYRKYTIEEIE  421

Query  1160  FATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPN  981
              AT++FS S KIGEGGYGPVY+GKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS +R+PN
Sbjct  422   QATQEFSASNKIGEGGYGPVYKGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSCIRYPN  481

Query  980   MVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSK  801
             MVLLLGACPE+GCLVYEYM+NGSLED L R+GNTP I W  RFKI+AEI+T LLFLHQ+K
Sbjct  482   MVLLLGACPEFGCLVYEYMDNGSLEDLLFRRGNTPPISWRRRFKIAAEISTTLLFLHQAK  541

Query  800   PEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEY  621
             PEPLVHRDLKPANIL+DRN+VSKISDVGLARLVPPS+AD+VTQYHMT+AAGTFCYIDPEY
Sbjct  542   PEPLVHRDLKPANILIDRNYVSKISDVGLARLVPPSMADEVTQYHMTAAAGTFCYIDPEY  601

Query  620   QQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEA  441
             QQ+G L TKSDIYSLG++LLQIITAKP MGL+HHV R+IEKGTF+++LDP + DWP+E A
Sbjct  602   QQSGMLTTKSDIYSLGIVLLQIITAKPAMGLSHHVRRSIEKGTFSEMLDPALPDWPIELA  661

Query  440   LHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNG  306
             L FAKL+LQCAELRKKDRPDLG+V++PELNRL++       S  G
Sbjct  662   LAFAKLALQCAELRKKDRPDLGTVVVPELNRLRDFGRHGEGSHPG  706



>ref|XP_007226500.1| hypothetical protein PRUPE_ppa026359mg, partial [Prunus persica]
 gb|EMJ27699.1| hypothetical protein PRUPE_ppa026359mg, partial [Prunus persica]
Length=733

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/705 (60%), Positives = 529/705 (75%), Gaps = 28/705 (4%)
 Frame = -3

Query  2354  TTGPI--TVVAVDKD-KNSASAVKWTVDNLLI--SNPFVILLHVRHKASPNHQNGGPDAH  2190
             T  PI  T VAVDKD KNS  AV++ +D+L+   +NP++IL+HVRHK    HQ+ G    
Sbjct  10    TVPPINATAVAVDKDNKNSNHAVRFAIDHLVANNTNPYIILIHVRHKNHHPHQSDGESG-  68

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
                 +HDGH VF P+ AY AR+ + +KE  ++D +VAKA++ YIN H ++N+V+GAS+R+
Sbjct  69    ----NHDGHHVFVPYSAYCARKEVQVKEVILDDHDVAKALLEYINNHYINNIVVGASTRN  124

Query  2009  AISRKFWT-HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssr  1833
             A++RKF   +DVPT + K AP+FCSVYVISKGK    R A RP+ N  T           
Sbjct  125   ALTRKFKIGYDVPTSLVKLAPEFCSVYVISKGKMVVGRTAKRPVVNTATPPKQPSPQGLP  184

Query  1832  assrgssaasssAGDDRISACSSRGEHSGR-----PFRRSEDRDA------DGSVRRPWN  1686
                      + +    R       G  +G      P  R   R A      D  +  P +
Sbjct  185   PCIPTEQTEADNGARSRGQPAVRGGWKNGGGSEKIPVVRERTRSAPVNLSMDIDIPNPGS  244

Query  1685  SSC----RNSLAEDNDLFAPISDGFDNA-AAAQNLDFTRisdagsdassiaSKDLESEMK  1521
             S C    RNS A++N+ F  + + F +    +Q LDF+  S +  ++S  +++D+E+EMK
Sbjct  245   SRCSLSSRNSNADENE-FPGMFNSFGSVDIISQGLDFSSASCSPKESSRQSARDIEAEMK  303

Query  1520  RLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemeka  1341
             RLKLELKQTMDMY++ACKEAI+AK  AKEL Q K EE+++FE+AR AEEAAL + EMEKA
Sbjct  304   RLKLELKQTMDMYSSACKEAISAKNKAKELNQWKQEEARKFEEARHAEEAALAIAEMEKA  363

Query  1340  kckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIE  1161
             KCKAA+EAAE +Q++AEMEAQR + AEMKAKKE  EKNRAL+ L+ +D RYRKY+I+EIE
Sbjct  364   KCKAAIEAAEASQRVAEMEAQRRRQAEMKAKKEAQEKNRALNALAHNDVRYRKYTIEEIE  423

Query  1160  FATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPN  981
              AT++FS S KIGEGGYGPVY+GKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS +R+PN
Sbjct  424   QATQEFSASNKIGEGGYGPVYKGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSCIRYPN  483

Query  980   MVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSK  801
             MVLLLGACPE+GCLVYEYM+NGSLED L R+GNTP I W  RFKI+AEI+T LLFLHQ+K
Sbjct  484   MVLLLGACPEFGCLVYEYMDNGSLEDLLFRRGNTPPISWRRRFKIAAEISTTLLFLHQAK  543

Query  800   PEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEY  621
             PEPLVHRDLKPANIL+DRN+VSKISDVGLARLVPPS+AD+VTQYHMT+AAGTFCYIDPEY
Sbjct  544   PEPLVHRDLKPANILIDRNYVSKISDVGLARLVPPSMADEVTQYHMTAAAGTFCYIDPEY  603

Query  620   QQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEA  441
             QQ+G L TKSDIYSLG++LLQIITAKP MGL+HHV R+IEKGTF+++LDP + DWP+E A
Sbjct  604   QQSGMLTTKSDIYSLGIVLLQIITAKPAMGLSHHVRRSIEKGTFSEMLDPAVPDWPIELA  663

Query  440   LHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNG  306
             L FA+L+LQCAELRK+DRPDLG+V++PELNRL++       S +G
Sbjct  664   LAFAQLALQCAELRKRDRPDLGTVVVPELNRLRDFGRHGEGSHHG  708



>ref|XP_008220511.1| PREDICTED: U-box domain-containing protein 52 isoform X1 [Prunus 
mume]
Length=749

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/707 (60%), Positives = 531/707 (75%), Gaps = 32/707 (5%)
 Frame = -3

Query  2354  TTGPI--TVVAVDKD-KNSASAVKWTVDNLLI--SNPFVILLHVRHKASPNHQNGGPDAH  2190
             T  PI  T VAVDKD KNS  AV++ +D+L+   +NP++IL+HVRHK    HQ+ G    
Sbjct  10    TVPPINATAVAVDKDNKNSNHAVRFAIDHLVANNTNPYIILIHVRHKNHHPHQSDGESG-  68

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
                 +HDGH VF P+RAY AR+   +KE  ++D +VAKA++ YIN H ++N+ +GAS+R+
Sbjct  69    ----NHDGHHVFVPYRAYCARKEAQVKEVILDDHDVAKALLEYINNHYINNIAVGASTRN  124

Query  2009  AISRKFWT-HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN------------LP  1869
             A++RKF   +DVPT + K AP+FCSVYVISKGK    R A RP+ N            LP
Sbjct  125   ALTRKFKIGYDVPTSLVKLAPEFCSVYVISKGKMVVGRTAKRPVVNTATPPKQPSPQGLP  184

Query  1868  THIWshhgsssrassrgssaa-----sssAGDDRISACSSRGEHSGRPFRRSEDRDADGS  1704
               I +    +   +      A     +S+ G ++I     R   +  P   S D D    
Sbjct  185   PCIPTEQTEADNGARSRGQPAVRGGWNSAGGSEKIPVARERTRSA--PVNLSMDIDIPNH  242

Query  1703  VRRPWNSSCRNSLAEDNDLFAPISDGFDNA-AAAQNLDFTRisdagsdassiaSKDLESE  1527
                  + S RNS A++N+ F  + + F +    +Q LDF+  S +  ++S  +++D+E+E
Sbjct  243   GSSRCSLSSRNSNADENE-FPGMFNSFGSVDIISQGLDFSSASCSPKESSRQSARDIEAE  301

Query  1526  MKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVeme  1347
             MKRLKLELKQTMDMY++ACKEAI+AK  AKEL Q K EE+++FE AR AEEAAL + EME
Sbjct  302   MKRLKLELKQTMDMYSSACKEAISAKNKAKELNQWKQEEARKFEDARHAEEAALAIAEME  361

Query  1346  kakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDE  1167
             KAKCKAA+EAAE +Q++AEMEAQR + AEMKAKKE  EKNRAL+ L+ +D RYRKY+I+E
Sbjct  362   KAKCKAAIEAAEASQRVAEMEAQRRRQAEMKAKKEAQEKNRALNALAHNDVRYRKYTIEE  421

Query  1166  IEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRH  987
             IE AT++FS S KIGEGGYGPVY+GKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS +R+
Sbjct  422   IEQATQEFSASNKIGEGGYGPVYKGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSCIRY  481

Query  986   PNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQ  807
             PNMVLLLGACPE+GCLVYEYM+NGSLED L R+GNTP I W  RFKI+AEI+T LLFLHQ
Sbjct  482   PNMVLLLGACPEFGCLVYEYMDNGSLEDLLFRRGNTPPISWRRRFKIAAEISTTLLFLHQ  541

Query  806   SKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDP  627
             +KPEPLVHRDLKPANIL+DRN+VSKISDVGLARLVPPS+AD+VTQYHMT+AAGTFCYIDP
Sbjct  542   AKPEPLVHRDLKPANILIDRNYVSKISDVGLARLVPPSMADEVTQYHMTAAAGTFCYIDP  601

Query  626   EYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVE  447
             EYQQ+G L TKSDIYSLG++LLQIITAKP MGL+HHV R+IEKGTF+++LDP + DWP+E
Sbjct  602   EYQQSGMLTTKSDIYSLGIVLLQIITAKPAMGLSHHVRRSIEKGTFSEMLDPALPDWPIE  661

Query  446   EALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNG  306
              AL FAKL+LQCAELRKKDRPDLG+V++PELNRL++       S  G
Sbjct  662   LALAFAKLALQCAELRKKDRPDLGTVVVPELNRLRDFGRHGEGSHPG  708



>ref|XP_010925037.1| PREDICTED: U-box domain-containing protein 52 [Elaeis guineensis]
Length=783

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/733 (57%), Positives = 521/733 (71%), Gaps = 61/733 (8%)
 Frame = -3

Query  2390  HHHHPTISSDG----ATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS  2223
             H  HP  + D      T+  +T VAVD+DKNS  AVKWTVD+LL+ N  ++L+HVR K  
Sbjct  8     HPQHPAAAVDDNNRLPTSATLTAVAVDRDKNSQQAVKWTVDHLLVKNETIVLVHVRCK--  65

Query  2222  PNHQNG------GPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGY  2061
              N+  G        +A+    + +   +F PF+ + AR+G+ MKE  ++D +V+KAIV Y
Sbjct  66    -NYGFGFATGEATSEANREQIEAEMQQLFIPFKGFCARKGVQMKEVVLDDIDVSKAIVDY  124

Query  2060  INTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPL  1881
             +  + + N+V+G+S+R+A+++KF   DVPT + K+AP+FCSVYVISKGK  ++R A    
Sbjct  125   LTANHIHNIVVGSSNRNALTKKFRNPDVPTSLIKSAPEFCSVYVISKGKPVTVRSAKAST  184

Query  1880  TNLPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGR---------PFRRS  1728
              +L            + SS   S       DD +    +R  + G          P R S
Sbjct  185   ASL---------QHRQPSSNLGSVHYHPDHDDAVKTPFARANYRGSLPPAGPSAVPERWS  235

Query  1727  EDRDAD-------------------------GSVRRPWNSS-CRNSLAEDNDLFAPISDG  1626
              +++AD                          S R P  SS  R+S AED D     S G
Sbjct  236   FEKNADFMKAPARPLSGARTAPVQMLLEFSEASQRPPRPSSYSRDSFAEDTDSHG--STG  293

Query  1625  FDNAAAAQNLDFTRisdag--sdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITA  1452
             F +     +++ +           S  +S+DLE+EM+RL+LELKQTMDMY+NACKEAI+A
Sbjct  294   FQSIDFGDSIELSSNLSDSPRGSYSPNSSRDLEAEMRRLRLELKQTMDMYSNACKEAISA  353

Query  1451  KKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRT  1272
             K+ AKEL Q K+EE+++FE+AR AEEAAL + EMEKAK KAA+EAAE AQ+IA +EAQ+ 
Sbjct  354   KQKAKELHQWKMEEARKFEEARHAEEAALALAEMEKAKAKAALEAAEAAQRIAMLEAQKR  413

Query  1271  kyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRG  1092
               AEMKAK+E  EK +AL  L+  D RYRKY I+EIE AT+ FS+++KIGEGGYGPVY+ 
Sbjct  414   LNAEMKAKREADEKMKALDALAHHDVRYRKYGIEEIEIATDYFSENLKIGEGGYGPVYKA  473

Query  1091  KLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGS  912
              LDHTPVAIKVLRPDAAQGR+QFQQEVEVLS MRHPNMVLLLGACPEYGCLVYEYM+NGS
Sbjct  474   SLDHTPVAIKVLRPDAAQGRQQFQQEVEVLSCMRHPNMVLLLGACPEYGCLVYEYMDNGS  533

Query  911   LEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSK  732
             LEDRL R+GNTP IPW +RFKI+AEIAT LLFLHQSKPEPLVHRDLKPANILLDRN+VSK
Sbjct  534   LEDRLFRRGNTPPIPWNVRFKIAAEIATGLLFLHQSKPEPLVHRDLKPANILLDRNYVSK  593

Query  731   ISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQII  552
             ISDVGLARLVPPSVA+ VTQY MTS AGTFCYIDPEYQQTG LG KSDIYSLGVMLLQII
Sbjct  594   ISDVGLARLVPPSVANTVTQYRMTSTAGTFCYIDPEYQQTGMLGIKSDIYSLGVMLLQII  653

Query  551   TAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGS  372
             TAKP MGL+HHVE++IE+GTF ++LDP++ DWP+EEAL FAKL+L+C ELR+KDRPDLG+
Sbjct  654   TAKPAMGLSHHVEKSIERGTFPEMLDPSVPDWPLEEALGFAKLALKCVELRRKDRPDLGT  713

Query  371   VILPELNRLKELA  333
             VILPELNRL+ L 
Sbjct  714   VILPELNRLRNLG  726



>ref|XP_008365052.1| PREDICTED: U-box domain-containing protein 52-like [Malus domestica]
Length=739

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/700 (60%), Positives = 532/700 (76%), Gaps = 34/700 (5%)
 Frame = -3

Query  2369  SSDGATTGPI--TVVAVDKD-KNSASAVKWTVDNLLISN--PFVILLHVRHKASPNHQNG  2205
             SSD A   PI  T VAVDKD KNS  AV+W +D+L+I++  P++IL+HV+HK   NHQ+ 
Sbjct  6     SSDDAVP-PINATAVAVDKDNKNSNYAVRWAIDHLVIASATPYIILIHVKHK---NHQSD  61

Query  2204  GPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLG  2025
             G        D++GH VF P+RAY AR+G  +KE  +++ +VAKA++ YIN + ++++V+G
Sbjct  62    GE------GDNNGHSVFIPYRAYCARKGAQVKEVILDEGDVAKALLEYINCNYLNSIVVG  115

Query  2024  ASSRSAISRKFWT-HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN---------  1875
             AS+R+A++RKF + +DV + + K AP+FCSVYVI KGK  S RPA RP  N         
Sbjct  116   ASTRNALTRKFKSGNDVSSSLVKLAPEFCSVYVIQKGKMLSXRPAKRPALNTAAPPKQPS  175

Query  1874  ---LPTHIWshhgsssrassrgssaas--ssAGDDRISACSSRGEHSGRPFRRSEDRD-A  1713
                LP +I + H      +    ++     + G +++ A   R   +        + D A
Sbjct  176   SLGLPPYIPADHNEFENGARGQPASRGGWKAPGSEKMPAARERTRSAPNNLSLDINLDMA  235

Query  1712  DGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLE  1533
             + +  RP + SCR S A++ DL  P+    D     Q  DF+   ++  ++S  +++DLE
Sbjct  236   NHTSARP-SLSCRTSNADERDLSMPLFGSMD--ITNQCFDFSSALNSPKESSRQSARDLE  292

Query  1532  SEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVe  1353
             +EM+RLKLELKQTMDMY++ACKEAI AK  AKEL Q K EE+++F++ R AEE AL +VE
Sbjct  293   AEMRRLKLELKQTMDMYSSACKEAIXAKNKAKELSQWKQEEARKFDEVRVAEETALAIVE  352

Query  1352  mekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSI  1173
             MEKAKCKAA+EAAE AQK+AEMEAQR + AEMKAKKE  EK RAL+ L+++D RYRKY+I
Sbjct  353   MEKAKCKAAIEAAEAAQKLAEMEAQRRRQAEMKAKKEAEEKIRALNALAQNDVRYRKYTI  412

Query  1172  DEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLM  993
             +EIE ATEKF+++ KIGEGGYGPVY+GKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS +
Sbjct  413   EEIEEATEKFTEANKIGEGGYGPVYKGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSCL  472

Query  992   RHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFL  813
             R+PNMVLLLGACPEYGCLVYEYME GSLEDRL R+GNTP I W  RFKI++EI+  L FL
Sbjct  473   RYPNMVLLLGACPEYGCLVYEYMEYGSLEDRLFRRGNTPPISWRRRFKIASEISITLHFL  532

Query  812   HQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYI  633
             HQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD+VTQYHMT+AAGTFCYI
Sbjct  533   HQAKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADEVTQYHMTAAAGTFCYI  592

Query  632   DPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWP  453
             DPEYQQTG L TKSDIYSLG++LLQIITAKP MG  HHV R+IEKGTF+++LDP ++DWP
Sbjct  593   DPEYQQTGMLTTKSDIYSLGIVLLQIITAKPAMGXAHHVRRSIEKGTFSEMLDPAVTDWP  652

Query  452   VEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             +EEAL FA L+LQC ELRKKDRPDLG+V++PELNRL++  
Sbjct  653   IEEALAFANLALQCTELRKKDRPDLGTVVVPELNRLRDFG  692



>ref|XP_009334725.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
Length=739

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/700 (60%), Positives = 534/700 (76%), Gaps = 34/700 (5%)
 Frame = -3

Query  2369  SSDGATTGPI--TVVAVDKD-KNSASAVKWTVDNLLISN--PFVILLHVRHKASPNHQNG  2205
             SSD A   PI  T VAVDKD KNS  AV+W +D+L+I++  P+VIL+HV+HK   N+Q+ 
Sbjct  6     SSDDAVP-PINATAVAVDKDNKNSNYAVRWAIDHLVIASNTPYVILIHVKHK---NNQSD  61

Query  2204  GPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLG  2025
             G + H     ++GH VF P+RAY AR+G  +KE  +++++VAKA++ YIN + ++++V+G
Sbjct  62    G-EGH-----NNGHSVFVPYRAYCARKGAQVKEVILDESDVAKALLEYINCNYLNSIVVG  115

Query  2024  ASSRSAISRKFWT-HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN---------  1875
             AS+R+A++RK  + +DV + + K AP+FCSVYVI KGK  S R A RP+ N         
Sbjct  116   ASTRNALTRKLRSGNDVSSSLVKLAPEFCSVYVIQKGKMLSTRTAKRPVLNTAAPPKQPS  175

Query  1874  ---LPTHIWshhgsssrassrgssaas--ssAGDDRISACSSRGEHSGRPFRRSEDRD-A  1713
                LP HI + H      +    ++     + G +++ A   R   +        + D A
Sbjct  176   SQGLPPHIPADHNEFENGARGQPASRGGWKAPGSEKMPAARERTRSAPNNLSLDINLDMA  235

Query  1712  DGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLE  1533
             + +  RP + SCR S A+++DL  P+    D     Q  DF+   ++  ++S  +++DLE
Sbjct  236   NHTSARP-SLSCRTSNADESDLSMPLFGSMD--ITNQCFDFSSALNSPKESSRQSARDLE  292

Query  1532  SEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVe  1353
             +EM+RLKLELKQTMDMY++ACKEAI+AK  AKEL Q K EE+++F++ R AEE AL +VE
Sbjct  293   AEMRRLKLELKQTMDMYSSACKEAISAKNKAKELSQWKQEEARKFDEVRVAEETALAIVE  352

Query  1352  mekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSI  1173
             MEKAKCKAA+EAA+ AQK+AEME QR + AEMKAKKE  EK RAL+ L+++D RYRKY+I
Sbjct  353   MEKAKCKAAIEAAQAAQKLAEMEVQRRRQAEMKAKKEAEEKIRALNALAQNDVRYRKYTI  412

Query  1172  DEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLM  993
             +EIE ATEKF+++ KIGEGGYGPVY+GKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS M
Sbjct  413   EEIEEATEKFAEANKIGEGGYGPVYKGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSCM  472

Query  992   RHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFL  813
             R+PNMVLLLGACPEYGCLVYEYME GSLEDRL R+GNTP I W  RFKI++EI   L FL
Sbjct  473   RYPNMVLLLGACPEYGCLVYEYMEYGSLEDRLFRRGNTPPISWRRRFKIASEITITLHFL  532

Query  812   HQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYI  633
             HQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD+VTQYHMT+AAGTFCYI
Sbjct  533   HQAKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADEVTQYHMTAAAGTFCYI  592

Query  632   DPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWP  453
             DPEYQQTG L TKSDIYSLG++LLQIITAKP MGL HHV R+IEKGTF+++LDP ++DWP
Sbjct  593   DPEYQQTGMLTTKSDIYSLGIVLLQIITAKPAMGLAHHVRRSIEKGTFSEMLDPAVTDWP  652

Query  452   VEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             +EEAL FA L+LQC ELRKKDRPDLG+V++PELNRL++  
Sbjct  653   IEEALAFANLALQCTELRKKDRPDLGTVVVPELNRLRDFG  692



>ref|XP_002873544.1| kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49803.1| kinase [Arabidopsis lyrata subsp. lyrata]
Length=700

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/702 (60%), Positives = 525/702 (75%), Gaps = 34/702 (5%)
 Frame = -3

Query  2378  PTISSDGATTGPITVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQNG  2205
             P  S DG T    TVVA+DKDKNS  AV+W VD+L  +++N  +IL+HVR K S NH   
Sbjct  4     PHPSDDGHTLVNSTVVAIDKDKNSHYAVRWAVDHLFNMVNNAKMILVHVRLKNS-NHG--  60

Query  2204  GPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLG  2025
                  G + D++ + +F P+R Y AR+GI M E  ++DT+VAKA++ Y+N + V+N+VLG
Sbjct  61    -----GNIDDNELNQLFVPYRGYCARKGISMIEVILDDTDVAKAVLDYVNNNLVTNLVLG  115

Query  2024  ASSRSAISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL------  1872
             +SS+S  +R  KF  +HDV + V K+ P+FCS+YVISKGK  S R A RP+TN       
Sbjct  116   SSSKSPFARSLKFTKSHDVASSVLKSTPEFCSIYVISKGKVHSSRTAQRPITNTLVPPRA  175

Query  1871  ---------PTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDR  1719
                      P H+ S  G  +  ++     +  + G   +        +    F   E R
Sbjct  176   PSSTFHLPDPDHVHSPRGQRNARNTVPERYSHDNKGFKPVREMHKIPTNGSLDFN-YEFR  234

Query  1718  DADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKD  1539
              A G      NS+ R+S ++D D+ + +  G  + +A +N D    S +  ++ S +++D
Sbjct  235   QAKGQ----RNSTGRSSFSDDADVGSMMMMGSIDLSA-ENFDMVGASGSSDESVSQSTRD  289

Query  1538  LESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRM  1359
             +E+EMKRLK+ELKQTMDMY++ACKEA+ AKK A EL Q K+EE++RFE+AR AEEAAL +
Sbjct  290   IEAEMKRLKIELKQTMDMYSSACKEALNAKKKANELNQWKLEEARRFEEARNAEEAALAV  349

Query  1358  VemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKY  1179
              EMEKAKC+AA+EAAEKAQ++AE+E QR K AEMKA++E+ EK+RALS L ++D RYR+Y
Sbjct  350   AEMEKAKCRAALEAAEKAQRMAELEGQRRKQAEMKARRESQEKDRALSALVQNDVRYRRY  409

Query  1178  SIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS  999
             SIDEIE ATE+F+ + KIGEGGYGPVY G LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS
Sbjct  410   SIDEIEVATERFANNRKIGEGGYGPVYHGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVLS  469

Query  998   LMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALL  819
              +RHP+MVLLLGACPEYGCLVYE+M+NGSLEDRL R+GN+P + W  RF+I+AEIATAL 
Sbjct  470   SIRHPHMVLLLGACPEYGCLVYEFMDNGSLEDRLFRRGNSPPLSWRKRFQIAAEIATALS  529

Query  818   FLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFC  639
             FLHQ+KPEPLVHRDLKPANILLD+N+VSKISDVGLARLVP SVA+ VTQYHMTSAAGTFC
Sbjct  530   FLHQAKPEPLVHRDLKPANILLDKNYVSKISDVGLARLVPASVANTVTQYHMTSAAGTFC  589

Query  638   YIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISD  459
             YIDPEYQQTGKL TKSDI+SLG+MLLQIITAK PMGL HHV RAI+KGTF D+LDP + D
Sbjct  590   YIDPEYQQTGKLTTKSDIFSLGIMLLQIITAKSPMGLAHHVSRAIDKGTFKDMLDPVVPD  649

Query  458   WPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             WPVEEAL+FAKL L+CAELRK+DRPDLG  I+PEL RL+ L 
Sbjct  650   WPVEEALNFAKLCLKCAELRKRDRPDLGKEIVPELLRLRSLG  691



>ref|XP_004144270.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
51-like [Cucumis sativus]
Length=725

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/684 (60%), Positives = 524/684 (77%), Gaps = 22/684 (3%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLI--SNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             T VA+DKDKNS  AV+W +D+L+I  SNP +IL+HVRHKA+ +    G        + D 
Sbjct  17    TAVALDKDKNSHHAVRWAIDHLIIWISNPLIILIHVRHKANRSDSENG--------ETDA  68

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
               +F P+R Y AR+G+ +KE  ++D +++KA+V Y++ + +++ V+GAS+RSA++RKF  
Sbjct  69    QQLFVPYRGYCARKGVQLKEVVLDDPDISKALVDYVHKNCINSFVVGASTRSALARKFKA  128

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaa  1806
              DVPT + KTAP+FCSVYVISK K  S R A RP+ N             + + +  S++
Sbjct  129   PDVPTSIIKTAPEFCSVYVISKAKIISARAALRPVANTAMPPRQPSPLGVQPNGQSDSSS  188

Query  1805  sssAGDDRISACSSRGEHSGRPFRRSEDRDADGSV---------RRPWNSSCRNSLAEDN  1653
                 G   ++  +  G+ + +   R   + +  ++         R   +S  R+S+++DN
Sbjct  189   EPENGAKMLAERNGGGKQA-KALTRERPKTSPTNISLENIEVPNRGSRSSFSRDSISDDN  247

Query  1652  DLFAPISDGFDNAAAAQNLDFT-RisdagsdassiaSKDLESEMKRLKLELKQTMDMYNN  1476
              + A ++ G  +  A Q+LDF+   + +   A+  ++++LE+EMKRLKLELKQTMDMY++
Sbjct  248   MMTAQMAFGSMDVTA-QSLDFSANSNLSMDSAAGQSTRELEAEMKRLKLELKQTMDMYSS  306

Query  1475  ACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqki  1296
             ACKEAI+AK  A+EL Q K +E+++FE+ R AEEAAL + EMEKAKCKAA+EAAE AQK+
Sbjct  307   ACKEAISAKNKARELSQWKQDEARKFEEVRLAEEAALAIAEMEKAKCKAAIEAAEAAQKL  366

Query  1295  aemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEG  1116
             AE EAQR K AEMKA++E  EK RAL+ L+++D RYRKY+I+EIE +TEKFS+ +KIGEG
Sbjct  367   AEREAQRRKQAEMKARREAEEKKRALNALAQNDVRYRKYTIEEIEESTEKFSEKLKIGEG  426

Query  1115  GYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLV  936
             GYGPVY GKLDHT VAIKVLRPDAAQGRKQFQQEVEVL  +RHPNMVLLLGACPEYGCLV
Sbjct  427   GYGPVYGGKLDHTAVAIKVLRPDAAQGRKQFQQEVEVLCCIRHPNMVLLLGACPEYGCLV  486

Query  935   YEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANIL  756
             YEYM NGSLEDRL R+GN+P + W  RFKI+AEIATALLFLHQ+KPEPLVHRDLKPANIL
Sbjct  487   YEYMHNGSLEDRLFRRGNSPPLSWRRRFKIAAEIATALLFLHQAKPEPLVHRDLKPANIL  546

Query  755   LDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSL  576
             LDRNFVSKISDVGLARLVPPSVAD VTQYH+TSAAGTFCYIDPEYQQTGKL TKSDIYS 
Sbjct  547   LDRNFVSKISDVGLARLVPPSVADQVTQYHLTSAAGTFCYIDPEYQQTGKLTTKSDIYSF  606

Query  575   GVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRK  396
             G+MLLQIITAKPPMGL HHV+RAIEK  F ++LDPTISD P+EEA +FAKL+L+CAELRK
Sbjct  607   GIMLLQIITAKPPMGLAHHVQRAIEKDRFDEMLDPTISDCPLEEATNFAKLALKCAELRK  666

Query  395   KDRPDLGSVILPELNRLKELALQS  324
             +DRPDLG++I+PELNRL+++   S
Sbjct  667   RDRPDLGTLIVPELNRLRDIGRSS  690



>gb|KFK25461.1| hypothetical protein AALP_AA8G117900 [Arabis alpina]
Length=693

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/706 (60%), Positives = 528/706 (75%), Gaps = 33/706 (5%)
 Frame = -3

Query  2369  SSDGATTGPITVVAVDKDKNSASAVKWTVDNLL--ISNPFVILLHVRHKASPNHQNGGPD  2196
             S DG T    TVVAVDKDKNS  AV+W VD+L   I+NP +IL+HVR K           
Sbjct  6     SEDGYTPVNSTVVAVDKDKNSNYAVRWAVDHLFNTINNPNMILVHVRLKN----------  55

Query  2195  AHGGMSDHDG-HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
              HGG  D+D  + +F PFR Y AR+GI M E  ++DT++AKAI+ Y+N + V+N+V+G+S
Sbjct  56    -HGGSHDNDELNQLFIPFRGYCARKGISMTEVVLDDTDIAKAILDYVNNNLVNNIVVGSS  114

Query  2018  SRSAISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshh  1848
             S+S  +R  KF  +HDV   + K  P+FCS++VISKGK QS RPA RP+TN      +  
Sbjct  115   SKSPFARSLKFTKSHDVAASILKATPEFCSIFVISKGKVQSSRPAQRPITNTLVPPRTPS  174

Query  1847  gsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPW-------  1689
                   +   +       GD R +      ++S +  R      A GS    +       
Sbjct  175   SQFIHQNIADAVQDPIPRGDQRNARYPY--DNSFKAVRERNKSPALGSFDLLYDFKQANG  232

Query  1688  --NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRL  1515
               NS  R+S ++D D+ + +    D    +QN D    S +  ++ S +++D+E+EM+RL
Sbjct  233   QRNSMGRSSFSDDADVGSLMMGSID--LGSQNFDAIGASSSSDESHSPSARDIEAEMRRL  290

Query  1514  KLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakc  1335
             KLELKQTMDMY++ACKEA+ AKK A EL Q K+EE++RFE+AR AEEAAL + EMEKAKC
Sbjct  291   KLELKQTMDMYSSACKEALNAKKKANELNQWKMEEARRFEEARSAEEAALAVAEMEKAKC  350

Query  1334  kaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFA  1155
             +AA+EAAEKAQ++AE+EAQR K AEMKA++E+ EK+RAL+ L ++D RYR+YSI+EIE A
Sbjct  351   RAAIEAAEKAQRMAELEAQRRKQAEMKARRESQEKDRALNALVQNDVRYRRYSIEEIEEA  410

Query  1154  TEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMV  975
             T  F+ + KIGEGGYGPVY+G LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RHPNMV
Sbjct  411   TLNFANNRKIGEGGYGPVYKGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSSIRHPNMV  470

Query  974   LLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPE  795
             LLLGACPEYGCLVYE+M+NGSLEDRL R+GN+ A+ W  RF+I+AEIATAL FLHQ+KPE
Sbjct  471   LLLGACPEYGCLVYEFMDNGSLEDRLFRRGNSQALSWRKRFQIAAEIATALSFLHQAKPE  530

Query  794   PLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQ  615
             PLVHRDLKPANIL+DRN+VSKISDVGLARLVP SVAD VTQYHMTSAAGTFCYIDPEYQQ
Sbjct  531   PLVHRDLKPANILIDRNYVSKISDVGLARLVPASVADTVTQYHMTSAAGTFCYIDPEYQQ  590

Query  614   TGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALH  435
             TGKL TKSD+YSLG+MLLQIITAK PMGL HHV RA++KGTF D+LDPT+ DWPV+EA++
Sbjct  591   TGKLTTKSDVYSLGIMLLQIITAKSPMGLAHHVSRALDKGTFEDMLDPTVPDWPVDEAIN  650

Query  434   FAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQT  297
             FAKLSL+CAELRKKDRPDLG VI+PEL RL+ L +    +++G+Q+
Sbjct  651   FAKLSLKCAELRKKDRPDLGKVIVPELVRLRSLGMD---NESGSQS  693



>emb|CAB87673.1| putative receptor-like kinase [Arabidopsis thaliana]
Length=703

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/698 (60%), Positives = 518/698 (74%), Gaps = 25/698 (4%)
 Frame = -3

Query  2378  PTISSDGATTGPITVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQNG  2205
             P  S D  T    TVVA+DKDKNS  AV+W VD+L  +I N  +ILLHVR K S NH   
Sbjct  4     PHPSDDSHTLVNSTVVAIDKDKNSHFAVRWAVDHLFNMIINSKMILLHVRLKNS-NHG--  60

Query  2204  GPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLG  2025
                  G + D + + +F P+R Y AR+GI M E  ++DT+V+KA++ Y+N + V+N+VLG
Sbjct  61    -----GNIDDSELNQLFVPYRGYCARKGISMMEVILDDTDVSKAVLDYVNNNLVTNLVLG  115

Query  2024  ASSRSAISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN--LPTHI  1860
             +SS+S  +R  KF  +HDV + V K+ P+FCSVYVISKGK  S R A RP+TN  +P  +
Sbjct  116   SSSKSPFARSLKFTKSHDVASSVLKSTPEFCSVYVISKGKVHSSRTAQRPITNTLVPPRV  175

Query  1859  WshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPW---  1689
                            S  S   G + +    S      +P R       +GS+   +   
Sbjct  176   -PSSTFHLPDPDHDRSPRSQRNGRNTVPERYSHENKGFKPVREMHKIPTNGSLDFNYEFR  234

Query  1688  ------NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESE  1527
                   NS+ R+S ++++     +        +A+N D    S +  +++S +++D+E+E
Sbjct  235   QGKGQRNSTGRSSFSDESSDVGSMMMMGSIDLSAENFDMVGGSGSSDESASQSTRDIEAE  294

Query  1526  MKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVeme  1347
             MKRLK+ELKQTMDMY++ACKEA+ AKK A EL Q K+EE++RFE+AR AEEAAL + EME
Sbjct  295   MKRLKIELKQTMDMYSSACKEALNAKKKANELNQWKMEEARRFEEARNAEEAALAVAEME  354

Query  1346  kakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDE  1167
             KAKC+AA+EAAEKAQ++AE+E QR K AEMKA++E+ EK+RALS L ++D RYRKYSIDE
Sbjct  355   KAKCRAALEAAEKAQRMAELEGQRRKQAEMKARRESQEKDRALSALVQNDVRYRKYSIDE  414

Query  1166  IEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRH  987
             IE ATE+F+ + KIGEGGYGPVY G LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RH
Sbjct  415   IEVATERFANNRKIGEGGYGPVYHGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSSIRH  474

Query  986   PNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQ  807
             P+MVLLLGACPEYGCLVYE+M+NGSLEDRL R+GN+P + W  RF+I+AEIATAL FLHQ
Sbjct  475   PHMVLLLGACPEYGCLVYEFMDNGSLEDRLFRRGNSPPLSWRKRFQIAAEIATALSFLHQ  534

Query  806   SKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDP  627
             +KPEPLVHRDLKPANILLD+N+VSKISDVGLARLVP SVA+ VTQYHMTSAAGTFCYIDP
Sbjct  535   AKPEPLVHRDLKPANILLDKNYVSKISDVGLARLVPASVANTVTQYHMTSAAGTFCYIDP  594

Query  626   EYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVE  447
             EYQQTGKL TKSDI+SLG+MLLQIITAK PMGL HHV RAI+KGTF D+LDP + DWPVE
Sbjct  595   EYQQTGKLTTKSDIFSLGIMLLQIITAKSPMGLAHHVSRAIDKGTFKDMLDPVVPDWPVE  654

Query  446   EALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             EAL+FAKL L+CAELRK+DRPDLG  I+PEL RL+ L 
Sbjct  655   EALNFAKLCLRCAELRKRDRPDLGKEIVPELLRLRNLG  692



>ref|XP_011009941.1| PREDICTED: U-box domain-containing protein 35-like [Populus euphratica]
Length=759

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/699 (58%), Positives = 504/699 (72%), Gaps = 40/699 (6%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
             T VA+DKDKNS  AV+W VDNL  +N  ++L+HV+HK   NHQ    +   G    + H 
Sbjct  14    TSVAIDKDKNSQHAVRWAVDNLASNNSVLVLIHVKHK---NHQYQVANGQDGDDADEAHQ  70

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +FTP+R Y AR+G+ +KE  ++D +VA+A+  YIN + + N+V GAS R+ ++RKF   D
Sbjct  71    LFTPYRGYCARKGVRLKEVVLDDIDVARAVADYININLIGNIVFGASGRNVLTRKFKNQD  130

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAAR-PLTNLPTHIWshhgsssrassrgssaas  1803
             VPT   K APDFCSVYVI+KGK  S + A R P  N+P    S     S++    +    
Sbjct  131   VPTSFMKIAPDFCSVYVITKGKILSTQKAQRSPTYNVPQKTASMPVIPSQSLQDNAELDL  190

Query  1802  ssAGDDRISACSSRG-----EHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAP  1638
                  D + A S +G     E  G P  +  D        R  NS    S+   +  + P
Sbjct  191   -----DGVRAQSEKGGWRSAEAGGFPLDKVNDPIRGSQPERGRNSISNFSI---DSTYLP  242

Query  1637  ------------ISDGFDNA---------AAAQNLDFTRisdagsdassiaSKDLESEMK  1521
                          SDG + +         ++AQ+ +F+    + S+ +   +  LE EM+
Sbjct  243   SSCGRPSTSRVSTSDGSEFSGLFATSVMDSSAQSSEFS--VASASNLNESNADHLEVEMR  300

Query  1520  RLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemeka  1341
             RL+LELKQTM+MY+ ACKEA +AK+ A EL Q KI+E ++FE+A+ A EAAL + E+EKA
Sbjct  301   RLRLELKQTMEMYSTACKEAFSAKQKASELNQWKIDEVRKFEEAKLAGEAALAVAELEKA  360

Query  1340  kckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIE  1161
             KCK A+EAAEK+QK+AE+E Q+ K+AE KA++ET EKNRAL+ L+ +D RYR+Y+I+EIE
Sbjct  361   KCKVAIEAAEKSQKLAELEGQKRKHAEKKAERETEEKNRALNALAHNDVRYRRYTIEEIE  420

Query  1160  FATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPN  981
              AT+KFS S KIGEGGYGPVY+GKLDHTPVAIK LRPDAAQG+KQ QQEVEVLS +RHP+
Sbjct  421   EATDKFSPSNKIGEGGYGPVYKGKLDHTPVAIKALRPDAAQGKKQLQQEVEVLSCIRHPH  480

Query  980   MVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSK  801
             MVLLLGACPEYG LVYEYM+NGSLEDRLL+K NTP IPW IRFKI+AEIATALLFLHQ+K
Sbjct  481   MVLLLGACPEYGILVYEYMDNGSLEDRLLQKHNTPPIPWGIRFKIAAEIATALLFLHQAK  540

Query  800   PEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEY  621
             PEPLVHRDLKPANILLD N+V KISDVGLARLVP SVAD VTQYHMTSAAGTFCYIDPEY
Sbjct  541   PEPLVHRDLKPANILLDSNYVCKISDVGLARLVPLSVADSVTQYHMTSAAGTFCYIDPEY  600

Query  620   QQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEA  441
             QQTG L T+SDIYSLG+M LQIITAKPPMGL H V RAIE+G FAD+LD T+SDWPVEEA
Sbjct  601   QQTGMLTTRSDIYSLGIMFLQIITAKPPMGLAHQVGRAIERGKFADMLDQTVSDWPVEEA  660

Query  440   LHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQS  324
             L FA L+L+CAELRKKDRP L +VI+PELNRL++L + +
Sbjct  661   LRFAALALKCAELRKKDRPSLATVIVPELNRLRDLGMNT  699



>ref|NP_196761.2| Protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
 dbj|BAE98858.1| putative receptor - like kinase [Arabidopsis thaliana]
 gb|AED91749.1| Protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
Length=701

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/698 (60%), Positives = 518/698 (74%), Gaps = 25/698 (4%)
 Frame = -3

Query  2378  PTISSDGATTGPITVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQNG  2205
             P  S D  T    TVVA+DKDKNS  AV+W VD+L  +I N  +ILLHVR K S NH   
Sbjct  4     PHPSDDSHTLVNSTVVAIDKDKNSHFAVRWAVDHLFNMIINSKMILLHVRLKNS-NHG--  60

Query  2204  GPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLG  2025
                  G + D + + +F P+R Y AR+GI M E  ++DT+V+KA++ Y+N + V+N+VLG
Sbjct  61    -----GNIDDSELNQLFVPYRGYCARKGISMMEVILDDTDVSKAVLDYVNNNLVTNLVLG  115

Query  2024  ASSRSAISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN--LPTHI  1860
             +SS+S  +R  KF  +HDV + V K+ P+FCSVYVISKGK  S R A RP+TN  +P  +
Sbjct  116   SSSKSPFARSLKFTKSHDVASSVLKSTPEFCSVYVISKGKVHSSRTAQRPITNTLVPPRV  175

Query  1859  WshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPW---  1689
                            S  S   G + +    S      +P R       +GS+   +   
Sbjct  176   -PSSTFHLPDPDHDRSPRSQRNGRNTVPERYSHENKGFKPVREMHKIPTNGSLDFNYEFR  234

Query  1688  ------NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESE  1527
                   NS+ R+S ++++     +        +A+N D    S +  +++S +++D+E+E
Sbjct  235   QGKGQRNSTGRSSFSDESSDVGSMMMMGSIDLSAENFDMVGGSGSSDESASQSTRDIEAE  294

Query  1526  MKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVeme  1347
             MKRLK+ELKQTMDMY++ACKEA+ AKK A EL Q K+EE++RFE+AR AEEAAL + EME
Sbjct  295   MKRLKIELKQTMDMYSSACKEALNAKKKANELNQWKMEEARRFEEARNAEEAALAVAEME  354

Query  1346  kakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDE  1167
             KAKC+AA+EAAEKAQ++AE+E QR K AEMKA++E+ EK+RALS L ++D RYRKYSIDE
Sbjct  355   KAKCRAALEAAEKAQRMAELEGQRRKQAEMKARRESQEKDRALSALVQNDVRYRKYSIDE  414

Query  1166  IEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRH  987
             IE ATE+F+ + KIGEGGYGPVY G LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RH
Sbjct  415   IEVATERFANNRKIGEGGYGPVYHGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSSIRH  474

Query  986   PNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQ  807
             P+MVLLLGACPEYGCLVYE+M+NGSLEDRL R+GN+P + W  RF+I+AEIATAL FLHQ
Sbjct  475   PHMVLLLGACPEYGCLVYEFMDNGSLEDRLFRRGNSPPLSWRKRFQIAAEIATALSFLHQ  534

Query  806   SKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDP  627
             +KPEPLVHRDLKPANILLD+N+VSKISDVGLARLVP SVA+ VTQYHMTSAAGTFCYIDP
Sbjct  535   AKPEPLVHRDLKPANILLDKNYVSKISDVGLARLVPASVANTVTQYHMTSAAGTFCYIDP  594

Query  626   EYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVE  447
             EYQQTGKL TKSDI+SLG+MLLQIITAK PMGL HHV RAI+KGTF D+LDP + DWPVE
Sbjct  595   EYQQTGKLTTKSDIFSLGIMLLQIITAKSPMGLAHHVSRAIDKGTFKDMLDPVVPDWPVE  654

Query  446   EALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             EAL+FAKL L+CAELRK+DRPDLG  I+PEL RL+ L 
Sbjct  655   EALNFAKLCLRCAELRKRDRPDLGKEIVPELLRLRNLG  692



>ref|XP_006289405.1| hypothetical protein CARUB_v10002905mg, partial [Capsella rubella]
 gb|EOA22303.1| hypothetical protein CARUB_v10002905mg, partial [Capsella rubella]
Length=711

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/714 (59%), Positives = 528/714 (74%), Gaps = 37/714 (5%)
 Frame = -3

Query  2393  DHHHHPTISSDGATTGPI--TVVAVDKDKNSASAVKWTVDNLL--ISNPFVILLHVRHKA  2226
             D H H      G    P+  TVVA+DKDKNS  AV+W VD+L   I+NP +IL+HVR K 
Sbjct  9     DGHGH------GHGQSPVNSTVVAIDKDKNSHYAVRWAVDHLFNTITNPNLILVHVRLKN  62

Query  2225  SPNHQNGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHR  2046
             S  +Q    D  G + D +   +F P+R Y AR+GI M E  ++DT+VAKA++ Y+N + 
Sbjct  63    S--NQTLVADG-GNIDDSELKQLFVPYRGYCARKGITMMEVILDDTDVAKAVMDYVNNNL  119

Query  2045  VSNVVLGASSRSAISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN  1875
             V+N+VLG+SSRS  +R  KF  +HDVP  V K  P+FCS+YVISKGK  S + A R +TN
Sbjct  120   VTNLVLGSSSRSPFARSLKFTKSHDVPASVLKLTPEFCSIYVISKGKVHSSKTAQRTITN  179

Query  1874  --LP-----THIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRD  1716
               +P     +             +RG  +++ ++  +R S  SS G    +P R  +   
Sbjct  180   TLVPPRAPLSSFHLPDNDQDHLPARGQQSSTRNSTPERRSHDSSNGY---KPVREMKKIP  236

Query  1715  ADGSV---------RRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTR-isdags  1566
               GSV         R   NSS +NS   + D+ + +  G  + +  +N D    +S +  
Sbjct  237   TSGSVDFSYDFRQARGQKNSSAKNSFTNEGDVGSLMMMGSIDLSN-ENFDIVAGVSASSD  295

Query  1565  dassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqar  1386
             ++ S +++D+E+EMKRLK+ELKQTMDMY++ACKEA+ AKK A EL Q K+EE++RFE+AR
Sbjct  296   ESVSQSTRDIEAEMKRLKIELKQTMDMYSSACKEALNAKKKANELNQWKVEEARRFEEAR  355

Query  1385  qaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLS  1206
              +EEAAL + EMEKAKC+AAM+AAEKAQ++AE+E QR K AE+KA++E+ EK+RALS L 
Sbjct  356   VSEEAALAVAEMEKAKCRAAMDAAEKAQRMAELEGQRRKQAEIKARRESQEKDRALSALV  415

Query  1205  KSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQ  1026
             ++D RYR+YSI+EIE ATE+F+ + KIGEGGYGPVY G LDHTPVAIKVLRPDAAQG++Q
Sbjct  416   QNDVRYRRYSIEEIEEATERFANNKKIGEGGYGPVYHGTLDHTPVAIKVLRPDAAQGKRQ  475

Query  1025  FQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKI  846
             FQQEVEVLS +RHP+MVLLLGACPEYGCLVYEYM+NGSLEDRL R+GN+P + W  RF+I
Sbjct  476   FQQEVEVLSSIRHPHMVLLLGACPEYGCLVYEYMDNGSLEDRLFRRGNSPPLSWRKRFQI  535

Query  845   SAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYH  666
             +AEIATAL FLHQ+KPEPLVHRDLKPANILLD+N+VSKISDVGLARLVP SVA+ VTQ+H
Sbjct  536   AAEIATALSFLHQAKPEPLVHRDLKPANILLDKNYVSKISDVGLARLVPASVANTVTQFH  595

Query  665   MTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFA  486
             MTSAAGTFCYIDPEYQQTGKL TKSDIYSLG+MLLQ+ITAK PMGL H V RAI+KGTF 
Sbjct  596   MTSAAGTFCYIDPEYQQTGKLTTKSDIYSLGIMLLQVITAKSPMGLAHQVSRAIDKGTFK  655

Query  485   DLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQS  324
             DLLDP + DWPVEEA +FAKL L+CAELRK+DRPDLG  I+PEL RL+ L + +
Sbjct  656   DLLDPVVPDWPVEEATNFAKLCLKCAELRKRDRPDLGKEIVPELLRLRNLGMNN  709



>ref|XP_006399719.1| hypothetical protein EUTSA_v10012830mg [Eutrema salsugineum]
 gb|ESQ41172.1| hypothetical protein EUTSA_v10012830mg [Eutrema salsugineum]
Length=699

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/707 (59%), Positives = 525/707 (74%), Gaps = 34/707 (5%)
 Frame = -3

Query  2369  SSDGATTGPITVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQNGGPD  2196
             S DG      TVVA+DKDKNS  AV+W VD+L  LI+NP +IL+HVR K S         
Sbjct  6     SDDGHAPVNSTVVAIDKDKNSHYAVRWAVDHLFNLINNPNMILVHVRLKNS---------  56

Query  2195  AHGGMSDHDG-HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
              HGG +D+D  + +F P+R Y AR+GI M E  +EDT+VAKA++ Y+N + V+N+VLG+S
Sbjct  57    HHGGNNDNDDLNQLFVPYRGYCARKGISMTEVILEDTDVAKAVLDYVNNNLVNNIVLGSS  116

Query  2018  SRSAISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN--LPTHIWs  1854
             S++  +R  KF  +HDV   + K+ P+FCS+YVISKGK QS R A RP+TN  +P    S
Sbjct  117   SKNPFARSLKFTKSHDVAASILKSTPEFCSIYVISKGKVQSSRTAQRPITNTLVPPRAPS  176

Query  1853  hhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRD---ADGSV------  1701
                             +    + R +        +G  F    DR    A+GS+      
Sbjct  177   STFHLQNLPDPDQDPVARVQRNARNTTLERHAHDNG--FNAVRDRHKSPANGSLDFNHDF  234

Query  1700  ---RRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRis-dagsdassiaSKDLE  1533
                +   NS  R+S ++++D+   +    D    A N D    S  +    +S +++D+E
Sbjct  235   RQGKSQKNSMGRSSFSDESDVGTLMMGSID--LTAHNFDIVGGSGSSDESVNSQSNRDIE  292

Query  1532  SEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVe  1353
             +EMKRLK+EL+QTMDMY++ACKEA+ AKK A EL Q K+EE++RFE+AR AEEAAL + E
Sbjct  293   AEMKRLKIELRQTMDMYSSACKEALNAKKKANELNQWKMEEARRFEEARSAEEAALAVAE  352

Query  1352  mekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSI  1173
             +EKAKC+AAMEAAEKAQ++AE+E QR K AEMKA++E+ EK+RALS L ++D RYRKYSI
Sbjct  353   IEKAKCRAAMEAAEKAQRMAELEGQRRKQAEMKARRESQEKDRALSALVQNDVRYRKYSI  412

Query  1172  DEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLM  993
             +EIE AT++F+ + KIGEGGYGPVY+G LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +
Sbjct  413   EEIEEATDRFASNRKIGEGGYGPVYKGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSCI  472

Query  992   RHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFL  813
             RHP+MVLLLGACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATAL F+
Sbjct  473   RHPHMVLLLGACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIAAEIATALSFI  532

Query  812   HQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYI  633
             HQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVP SVAD VTQYHMTSAAGTFCYI
Sbjct  533   HQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPASVADTVTQYHMTSAAGTFCYI  592

Query  632   DPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWP  453
             DPEYQQTGKL TKSDIYSLG+MLLQ+ITAK PMGL HHV RAI+KGTF D+LDP+++DWP
Sbjct  593   DPEYQQTGKLTTKSDIYSLGIMLLQVITAKSPMGLAHHVSRAIDKGTFKDMLDPSVTDWP  652

Query  452   VEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASK  312
             VEEA+ FAKL L+CAELRKKDRPDLG  I+PEL RL+ L + + + K
Sbjct  653   VEEAITFAKLCLKCAELRKKDRPDLGKDIVPELVRLRSLGMNNESGK  699



>ref|XP_002324143.2| kinase family protein, partial [Populus trichocarpa]
 gb|EEF02708.2| kinase family protein, partial [Populus trichocarpa]
Length=707

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/699 (58%), Positives = 502/699 (72%), Gaps = 45/699 (6%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
             T VA+DKDKNS  AV+W VDNL  +N  ++L+H+ H    N Q+G         D + H 
Sbjct  14    TSVAIDKDKNSQHAVRWAVDNLASNNSVLVLIHI-HPEVANGQDGD-------GDDEAHQ  65

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +FTP+R Y AR+G+ +KE  ++D +VA+A+  YIN + + N+V GAS R+ ++RKF   D
Sbjct  66    LFTPYRGYCARKGVRLKEVVLDDIDVARAVADYININLIGNIVFGASGRNVLTRKFKNQD  125

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAAR-PLTNLPTHIWshhgsssrassrgssaas  1803
             VPT   K APDFCSVYVI+KGK  S + A R P  N+P    S     S++    +    
Sbjct  126   VPTSFMKIAPDFCSVYVITKGKILSTQKAQRTPTYNVPQKTASMPVIPSQSLQDNAELDL  185

Query  1802  ssAGDDRISACSSRG-----EHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAP  1638
                  D +   S +G     E  G P  +  D        R  NS    S+   +  + P
Sbjct  186   -----DGVRVQSEKGGWRSAEAGGFPLDKVNDSMRGSQPERGRNSISNFSM---DSTYLP  237

Query  1637  ------------ISDGFDNA---------AAAQNLDFTRisdagsdassiaSKDLESEMK  1521
                          SDG + +         ++AQ+ DF+    + S+ +   +  LE EM+
Sbjct  238   SSCGRPSTSRVSTSDGSEFSGLFATSIMDSSAQSSDFS--VASASNLNESNADHLEVEMR  295

Query  1520  RLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemeka  1341
             RL+LELKQTM+MY+ ACKEA++AK+ A EL Q KI+E ++FE+A+ A EAAL + E+EKA
Sbjct  296   RLRLELKQTMEMYSTACKEALSAKQKASELNQWKIDEVRKFEEAKLAGEAALAVAELEKA  355

Query  1340  kckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIE  1161
             KCK A+EAAEK+QK+AE+E Q+ K+AE KA++ET EKNRAL+ L+ +D RYR+Y+I+EIE
Sbjct  356   KCKVAIEAAEKSQKLAELEGQKRKHAEKKAERETEEKNRALNALAHNDVRYRRYTIEEIE  415

Query  1160  FATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPN  981
              AT+KFS S KIGEGGYGPVY+GKLDHTPVAIK LRPDAAQG+KQFQQEVEVLS +RHP+
Sbjct  416   EATDKFSPSNKIGEGGYGPVYKGKLDHTPVAIKALRPDAAQGKKQFQQEVEVLSCIRHPH  475

Query  980   MVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSK  801
             MVLLLGACPEYG LVYEYM+NGSLEDRLL+K NTP IPW IRFKI+AEIATALLFLHQ+K
Sbjct  476   MVLLLGACPEYGILVYEYMDNGSLEDRLLQKHNTPPIPWGIRFKIAAEIATALLFLHQAK  535

Query  800   PEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEY  621
             PEPLVHRDLKPANILLD N+V KISDVGLARLVP SVAD VTQYHMTSAAGTFCYIDPEY
Sbjct  536   PEPLVHRDLKPANILLDSNYVCKISDVGLARLVPLSVADSVTQYHMTSAAGTFCYIDPEY  595

Query  620   QQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEA  441
             QQTG L T+SDIYSLG+M LQIITAKPPMGL H V RAIE+G FAD+LD T+ DWPVEEA
Sbjct  596   QQTGMLTTRSDIYSLGIMFLQIITAKPPMGLAHQVGRAIERGKFADMLDQTVPDWPVEEA  655

Query  440   LHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQS  324
             L FA L+L+CAELRKKDRP L +VI+PELNRL++L + +
Sbjct  656   LRFAALALKCAELRKKDRPSLATVIVPELNRLRDLGMNT  694



>gb|KCW79251.1| hypothetical protein EUGRSUZ_C00670 [Eucalyptus grandis]
Length=643

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/667 (59%), Positives = 488/667 (73%), Gaps = 58/667 (9%)
 Frame = -3

Query  2327  VDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCVFTP  2148
             +D+DKNS  AV+W +D+L +S   + L+HVRHK S +H   G D  G   D D   +F  
Sbjct  24    IDRDKNSPHAVRWAIDHLGVSGLVMALIHVRHKNS-HHIASGTDVVGDPVDGDSRDLFVM  82

Query  2147  FRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVPTI  1968
             +R YSAR+ + +KE  +E+ +VAK ++ YI  + +++VV+GA+SR+ ++RK    DV T 
Sbjct  83    YRGYSARKRVQIKEVVVEENDVAKGLLEYIANNCITSVVMGAASRNTLARKLKYTDVSTS  142

Query  1967  VNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaasssAGD  1788
             V+K+APDFCSVYVISKGK  S+R A RP+ N  T                          
Sbjct  143   VSKSAPDFCSVYVISKGKVVSVRQARRPVVNTAT--------------------------  176

Query  1787  DRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAA  1608
                            P R+   R              RNS ++++D+   +S G  +   
Sbjct  177   ---------------PPRQPSSR-------------ARNSTSDESDISGSLSLGSMD-FG  207

Query  1607  AQNLDFT--RisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKE  1434
              Q  DF+          + + +S+DLE+EMKRLKLELKQTMDMY+ ACKEA++AKK A+E
Sbjct  208   DQKFDFSMVESDSPSPSSIAQSSRDLEAEMKRLKLELKQTMDMYSTACKEALSAKKQAEE  267

Query  1433  LQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemk  1254
             L  +KI+E ++FE+AR AEEAAL + +MEKAKCKAA+EAAEKAQK+AEMEAQR + AE+K
Sbjct  268   LHLLKIQEVRKFEEARHAEEAALALADMEKAKCKAAIEAAEKAQKLAEMEAQRRRQAEIK  327

Query  1253  akketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTP  1074
             AK E+ EK RALS L ++D RYR+Y+I+EIE AT++FSK+ KIGEGGYGPVY+GKLDHT 
Sbjct  328   AKLESKEKVRALSALHQNDSRYRRYTIEEIEEATDRFSKTNKIGEGGYGPVYKGKLDHTS  387

Query  1073  VAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLL  894
             VAIKVLRPDA QG++QF QEVEVLS MRHPNMVLLLGAC EYGCLVYEYM+ GSLEDRL 
Sbjct  388   VAIKVLRPDAVQGKRQFHQEVEVLSCMRHPNMVLLLGACTEYGCLVYEYMDRGSLEDRLF  447

Query  893   RKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGL  714
             RKG TP I W+ RF I+AEIATALLFLHQSKPEPLVHRDLKPANILLDRN+ SKISDVGL
Sbjct  448   RKGKTPPISWQKRFDIAAEIATALLFLHQSKPEPLVHRDLKPANILLDRNYKSKISDVGL  507

Query  713   ARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPM  534
             ARLVPP+VAD VTQ+HMT+AAGTFCYIDPEYQQTGKL TKSD+YS G+MLLQIIT +P M
Sbjct  508   ARLVPPAVADSVTQFHMTAAAGTFCYIDPEYQQTGKLTTKSDVYSFGIMLLQIITVQPAM  567

Query  533   GLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPEL  354
             GL+HHV  AIEKGTF ++LDP + DWPVEEAL FAKL+L CAELRKKDRPDLG+V+LPEL
Sbjct  568   GLSHHVRTAIEKGTFEEMLDPAVPDWPVEEALAFAKLALMCAELRKKDRPDLGTVVLPEL  627

Query  353   NRLKELA  333
             NRL++  
Sbjct  628   NRLRDFG  634



>ref|XP_010519836.1| PREDICTED: U-box domain-containing protein 51 isoform X1 [Tarenaya 
hassleriana]
Length=744

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/696 (59%), Positives = 522/696 (75%), Gaps = 28/696 (4%)
 Frame = -3

Query  2369  SSDGATTGPITVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQNGGPD  2196
             S D  + G  TVVA+DKDKNS  AV+W VD+L  +I+N  +IL+HVR K +PNH   G +
Sbjct  8     SDDSHSPGNSTVVAIDKDKNSHYAVRWAVDHLFNMINNSNIILIHVRLK-NPNHGGNGTN  66

Query  2195  AHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASS  2016
                   + D   +F P+R Y AR+GI + E  +EDT++AKA++ Y+N + ++++VLG SS
Sbjct  67    ----RENEDMSNLFVPYRGYCARKGIRLTEVVLEDTDIAKAVLDYVNKNLINSLVLGGSS  122

Query  2015  RSAISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN------LPT-  1866
             ++  +R  KF  +HDV   V K+AP+FCSVYVISKGK Q+ + A RP++N      +P+ 
Sbjct  123   KNPFARSLKFSKSHDVQANVLKSAPEFCSVYVISKGKIQTAKTAQRPISNTAAPPRVPSS  182

Query  1865  -HIWshhgsssrassrgssaasssAGDDRI---SACSSRGEHSGRPFRRSEDRDADGSVR  1698
              ++      S +           +   +R    +   +  E    P   S D + D +  
Sbjct  183   GYVLQSLSDSEQDEGSRRQRNLRNMAQERYPHDNTTKAIQERHKSPTGGSLDLNYDMTQS  242

Query  1697  -RPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMK  1521
                 N++ R+S + DND  + +    D   ++QNLDF         ++    +++E+EM+
Sbjct  243   LYQRNNTNRSSFSNDNDDGSSMMGSID--ISSQNLDFMNAPPEEPQSA----REIEAEMR  296

Query  1520  RLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemeka  1341
             RLKLELKQTMDMY++ACKEA+TAKK A EL Q ++EE+++FE+AR AEEAAL + EMEKA
Sbjct  297   RLKLELKQTMDMYSSACKEALTAKKKANELHQWQMEEARKFEEARLAEEAALAIAEMEKA  356

Query  1340  kckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIE  1161
             KC+AAM+AAEKAQ++AE+E+QR K AE+KA++E  EK+RAL+ L+ +D RYRKY+I+EIE
Sbjct  357   KCRAAMDAAEKAQRMAELESQRRKQAEIKARREAEEKDRALNALAHNDVRYRKYTIEEIE  416

Query  1160  FATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPN  981
              ATE+F+   KIGEGGYGPVY+GKLDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RHPN
Sbjct  417   EATERFANHNKIGEGGYGPVYKGKLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSCIRHPN  476

Query  980   MVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSK  801
             MVLLLGACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+++AEI TAL FLH +K
Sbjct  477   MVLLLGACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWGKRFQVAAEITTALSFLHHAK  536

Query  800   PEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEY  621
             PEPLVHRDLKPANILLDRN+VSKISDVGLARLVP SVA+ VTQYHMTSAAGTFCYIDPEY
Sbjct  537   PEPLVHRDLKPANILLDRNYVSKISDVGLARLVPASVANSVTQYHMTSAAGTFCYIDPEY  596

Query  620   QQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEA  441
             QQTG L TKSDIYSLG+MLLQIITAKPPMGL H V RAIEKGTF D+LDPT+ DWPVEEA
Sbjct  597   QQTGMLTTKSDIYSLGIMLLQIITAKPPMGLAHQVSRAIEKGTFRDMLDPTVPDWPVEEA  656

Query  440   LHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             L FAKLSL+CAELRK+DRPDLG +++PELNRL++L 
Sbjct  657   LAFAKLSLKCAELRKRDRPDLGKIVVPELNRLRKLG  692



>ref|XP_009365576.1| PREDICTED: U-box domain-containing protein 51-like [Pyrus x bretschneideri]
Length=738

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/702 (59%), Positives = 522/702 (74%), Gaps = 31/702 (4%)
 Frame = -3

Query  2369  SSDGATTGPI--TVVAVDKD-KNSASAVKWTVDNLLI--SNPFVILLHVRHKASPNHQNG  2205
             SSD A   PI  T VAVDKD KNS  AV+W +D+L+   +NP++IL+HV+HK   N+Q+ 
Sbjct  6     SSDDAVP-PINATAVAVDKDNKNSNYAVRWAIDHLVTASTNPYIILIHVKHK---NNQSD  61

Query  2204  GPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLG  2025
               D+     D++G  VF P+RAY AR+G  +KE  ++D++VAKA++ Y+N + ++N+V+G
Sbjct  62    AADS----GDNNGRGVFVPYRAYCARKGAQVKEVILDDSDVAKALLEYVNCNYLNNIVVG  117

Query  2024  ASSRSAISRKFWT-HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN---------  1875
             AS+R+A++RKF + +DVP+ + K AP+FCSVYVI KGK+ S R A RP+ N         
Sbjct  118   ASARNALTRKFKSGNDVPSSIVKLAPEFCSVYVIQKGKKLSARTAKRPVVNTAVPPKQPS  177

Query  1874  ---LPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGS  1704
                LP HI + +           ++         +   + R      P     D + D +
Sbjct  178   SQGLPYHIPADNNEFENGVRGQPASRGGWKVPGSVKMPAVRERTRSAPNNLLLDINVDMA  237

Query  1703  VRRPWNSSC--RNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLES  1530
                   SS   R S A+++D   P+    D     Q  DF+   ++  D+S  +++D+E+
Sbjct  238   NHTAARSSLSNRTSNADESDFSMPLFGSVD--MTNQCFDFSSTLNSPKDSSRQSARDMEA  295

Query  1529  EMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVem  1350
             EM+RLKLELKQTMDMY++ACKEAI+AK  A EL Q  ++E+++FE+ + AE+ AL +VEM
Sbjct  296   EMRRLKLELKQTMDMYSSACKEAISAKNKANELSQW-MQEARKFEEVKLAEQTALAIVEM  354

Query  1349  ekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSID  1170
             EKAKCKAA+EAAE +QK+AEMEAQR + AEMKAKKE  EKNRAL+ L+ +D RYRKY+I+
Sbjct  355   EKAKCKAAIEAAEASQKLAEMEAQRRRQAEMKAKKEAEEKNRALNALAHNDLRYRKYTIE  414

Query  1169  EIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMR  990
             EIE ATE F  + KIGEGGYGPVY+GKLDHT VAIKVLRPDAAQGRKQFQQEVEVLS +R
Sbjct  415   EIEEATENFEPANKIGEGGYGPVYKGKLDHTLVAIKVLRPDAAQGRKQFQQEVEVLSCIR  474

Query  989   HPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLH  810
             +PNMVLLLGACPE+GCLVYEYME GSLEDRL R+GNTP+I W  RFKI+AEI+T L FLH
Sbjct  475   YPNMVLLLGACPEFGCLVYEYMEYGSLEDRLFRRGNTPSISWRRRFKIAAEISTTLHFLH  534

Query  809   QSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYID  630
             Q+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVP SVAD+VTQYHMT+AAGTFCYID
Sbjct  535   QAKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPASVADEVTQYHMTAAAGTFCYID  594

Query  629   PEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPV  450
             PEYQQTG L TKSDIYSLG++LLQIITAKP MGL HHV R+IEKG F+++LDP ++DWP+
Sbjct  595   PEYQQTGMLTTKSDIYSLGIVLLQIITAKPAMGLAHHVRRSIEKGIFSEMLDPAVTDWPI  654

Query  449   EEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQS  324
             EEAL FA L+LQC ELRKKDRPDLG+V++PEL RL++    S
Sbjct  655   EEALAFANLALQCTELRKKDRPDLGTVVVPELIRLRDFGRTS  696



>emb|CDX97160.1| BnaC09g44650D [Brassica napus]
Length=700

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/704 (60%), Positives = 525/704 (75%), Gaps = 41/704 (6%)
 Frame = -3

Query  2369  SSDGATTGPI--TVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQNGG  2202
             S DG    P   TVVA+DKDKNS  AV+W  D+L  +I+NP +IL+HVR K+S NH    
Sbjct  6     SEDGHGHAPANSTVVAIDKDKNSHYAVRWAADHLFNMINNPNMILVHVRLKSS-NH----  60

Query  2201  PDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
                     D + + +F P+R Y AR+GI M E  +ED++VA+AI+ Y+N + V+N+V+G+
Sbjct  61    -------GDDELNQLFVPYRGYCARKGISMMEVILEDSDVARAILDYVNNNLVNNIVVGS  113

Query  2021  SSRS----AISRKFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL-----  1872
             +S S    A S KF  +HDV   + K+ P+FCS+YVISKGK QS R A RP+TN      
Sbjct  114   ASSSKNPFARSLKFTKSHDVAASILKSTPEFCSIYVISKGKVQSSRAAQRPITNTLVPPR  173

Query  1871  -PTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRR  1695
              P+  +                  +S         +  G ++ R  RRS    A+GS+  
Sbjct  174   EPSSAFHLQNLPDPDQDPLPRGQRNSRNTTPERYHNDNGFNTMRERRRSA---ANGSLDF  230

Query  1694  PW---------NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSK  1542
              +         N   RNS ++++D  + +    D   +AQN DF   S +  +++S +++
Sbjct  231   NYDFKQANGQRNPVGRNSFSDESDGGSLVMGSID--LSAQNYDFIGASGSSDESASQSTR  288

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EMKRLKLEL+QTMDMY++ACKEA+ AKK+A EL   K EE++RFE+AR AEEAAL 
Sbjct  289   DIEAEMKRLKLELRQTMDMYSSACKEALHAKKTANELNMWKKEEARRFEEARSAEEAALA  348

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + EMEKAKCKAAMEAAEKAQ++AE+E QR K AEMKA++E+ EK+RAL+ L ++D RYRK
Sbjct  349   VAEMEKAKCKAAMEAAEKAQRMAELEGQRRKQAEMKARRESQEKDRALTALGQNDVRYRK  408

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE AT++F+ +MK+GEGGYGPVY+G LDHTPVAIKVLRPDAAQG+KQFQQEVEVL
Sbjct  409   YSIEEIEEATDRFASNMKVGEGGYGPVYKGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVL  468

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHP+MVLLLGACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATAL
Sbjct  469   SCIRHPHMVLLLGACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIAAEIATAL  528

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
              FLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVP SVA++VTQYHMTSAAGTF
Sbjct  529   SFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPASVANNVTQYHMTSAAGTF  588

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTGKL TKSDIYSLG+MLLQIITAK PMGL HHV RAIEKGTF D+LDP ++
Sbjct  589   CYIDPEYQQTGKLTTKSDIYSLGIMLLQIITAKNPMGLAHHVSRAIEKGTFKDMLDPVVT  648

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
             DWPVEEA++FAKL L+CAELRK+DRPDLG  I+PEL RL+ L L
Sbjct  649   DWPVEEAINFAKLCLKCAELRKRDRPDLGKDIVPELVRLRNLGL  692



>ref|XP_011019410.1| PREDICTED: U-box domain-containing protein 35 [Populus euphratica]
Length=726

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/733 (56%), Positives = 511/733 (70%), Gaps = 36/733 (5%)
 Frame = -3

Query  2375  TISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPD  2196
             T   +G +    T VA+DKDKNS  A +W VDN   +NP ++L+HV+HK   NHQ    D
Sbjct  6     TADDNGDSLFNATAVAIDKDKNSQHAFRWAVDNFARNNPVIVLIHVKHK---NHQYKVAD  62

Query  2195  AHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASS  2016
                     +   +FT  R Y AR+G+ +KE  ++  +VA+A+  YIN+  + N+VLGAS 
Sbjct  63    GQA----EEVQRLFTSSRGYCARKGVRLKEVALDHIDVAQAVADYINSSLIGNIVLGASG  118

Query  2015  RSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsss  1836
             R+ ++RKF   DVPT + K APDFCSVYVI+KGK  S + A R     P+         +
Sbjct  119   RNVLTRKFKNQDVPTSLMKIAPDFCSVYVINKGKILSSKKAQR---RPPSAPQKTPSMPA  175

Query  1835  rassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSL---  1665
               S      A   +G  R +    R   S  P   S D+  D  +R P +   R S+   
Sbjct  176   VTSRSQQDNAELDSGGVR-AQTRKRECRSTEPGGFSSDKVHD-LIREPQHERGRKSIPNF  233

Query  1664  -AEDNDLFAPISDGFDNA---------AAAQNLDFTRisdagsdassiaSKDLESEMKRL  1515
               E  D     SD   N          ++AQ LD +    + S  +   +  LE+EM+RL
Sbjct  234   SMESTDPPFSASDASQNTGTFALAIMDSSAQGLDIS--VASASSLNESNADFLEAEMRRL  291

Query  1514  KLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakc  1335
             +LEL QTM MY+ ACKEA++AKK A EL Q K++E ++FE+ + A EAAL M E+EKAKC
Sbjct  292   RLELNQTMAMYSTACKEALSAKKKATELNQWKVDEVRKFEETKLAGEAALAMAELEKAKC  351

Query  1334  kaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFA  1155
             + A+E AEK+QK+AEMEA++ K AEMKA++ET EKNRAL+ L+ +D RYR+Y+I+EIE A
Sbjct  352   RVAIETAEKSQKLAEMEARKRKQAEMKAERETGEKNRALNALAHNDVRYRRYTIEEIEEA  411

Query  1154  TEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMV  975
             T KFS S KIGEGGYGPVY+GKLDHTPVAIK LRP AAQG+KQFQQEVEVLS +RHP+MV
Sbjct  412   TNKFSPSNKIGEGGYGPVYKGKLDHTPVAIKALRPGAAQGKKQFQQEVEVLSTIRHPHMV  471

Query  974   LLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPE  795
             LLLGACPEYG L+YE M+NGSLEDRLL+K NTP IPW  RFKI+AEIATALLFLHQ+KPE
Sbjct  472   LLLGACPEYGVLIYECMDNGSLEDRLLQKDNTPPIPWSTRFKIAAEIATALLFLHQTKPE  531

Query  794   PLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQ  615
             PLVHRDLKPANILLDRN+VSKISDVGLARLVPPS+AD VT+YHMTSAAGTFCYIDPEYQQ
Sbjct  532   PLVHRDLKPANILLDRNYVSKISDVGLARLVPPSIADSVTRYHMTSAAGTFCYIDPEYQQ  591

Query  614   TGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALH  435
             TG L T+SDIYS+G+MLLQIITAKPPMGL H V RAIE+G F+D+LD T+SDWPVEEAL 
Sbjct  592   TGLLTTRSDIYSMGIMLLQIITAKPPMGLAHQVGRAIERGGFSDMLDQTVSDWPVEEALR  651

Query  434   FAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKN-GTQTFGRHYC*IKSIFF  258
             FA L+L+CAELRK+DRP L +VI+PELNRL++  + S   ++ G  + GR      S   
Sbjct  652   FAILALKCAELRKRDRPSLSTVIVPELNRLRDFGMNSEQQQSRGVSSRGR------SCSP  705

Query  257   FNHP--KSPSRIT  225
               HP   SP+R++
Sbjct  706   LPHPTSTSPARMS  718



>ref|XP_009121891.1| PREDICTED: U-box domain-containing protein 51-like isoform X1 
[Brassica rapa]
 emb|CDX69713.1| BnaA10g20620D [Brassica napus]
Length=698

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/702 (59%), Positives = 522/702 (74%), Gaps = 39/702 (6%)
 Frame = -3

Query  2369  SSDGATTGPITVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQNGGPD  2196
             S DG      TVVA+DKDKNS  AV+W  D+L  +I+NP +IL+HVR K S NH      
Sbjct  6     SEDGHAPANSTVVAIDKDKNSHYAVRWAADHLFNMINNPNMILVHVRLKNS-NH------  58

Query  2195  AHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASS  2016
                   D + + +F P+R Y AR+GI M E  +ED++VA+AI+ Y+N + V+N+V+G++S
Sbjct  59    -----GDDELNHLFVPYRGYCARKGISMMEVILEDSDVARAILDYVNNNLVNNIVVGSAS  113

Query  2015  RS----AISRKFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL------P  1869
              S    A S KF  +HDV   + K+ P+FCS+YVISKGK QS R A R +TN       P
Sbjct  114   SSKNPFARSLKFTKSHDVAASILKSTPEFCSIYVISKGKVQSSRAAQRRITNTLVPPREP  173

Query  1868  THIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPW  1689
             +  +                  +S         +  G ++ R  RRS    A+GS+   +
Sbjct  174   SSAFHLQNLPDPDQDPLPRGQRNSRNTTPERYHNDNGFNAMRERRRSA---ANGSLDFNY  230

Query  1688  ---------NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDL  1536
                      N   RNS ++++D  + +    D   +AQN DF   S +  +++S +++D+
Sbjct  231   DFKQANGQRNPVGRNSFSDESDGGSLMMGSVD--LSAQNYDFIGASGSSDESASQSTRDI  288

Query  1535  ESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMV  1356
             E+EMKRLKLEL+QTMDMY++ACKEA+ AKK+A EL   K EE++RFE+AR AEEAAL + 
Sbjct  289   EAEMKRLKLELRQTMDMYSSACKEALNAKKTANELNMWKKEEARRFEEARSAEEAALAVA  348

Query  1355  emekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYS  1176
             EMEKAKCKAAMEAAEKAQ++AE+E QR K AEMKA++E+ EK+RAL+ L ++D RYRKYS
Sbjct  349   EMEKAKCKAAMEAAEKAQRMAELEGQRRKQAEMKARRESQEKDRALTALGQNDVRYRKYS  408

Query  1175  IDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSL  996
             I+EIE AT++F+ +MK+GEGGYGPVY+G LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS 
Sbjct  409   IEEIEEATDRFASNMKVGEGGYGPVYKGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSC  468

Query  995   MRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLF  816
             +RHP+MVLLLGACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATAL F
Sbjct  469   IRHPHMVLLLGACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIAAEIATALSF  528

Query  815   LHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCY  636
             LHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVP SVA++VTQYHMTSAAGTFCY
Sbjct  529   LHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPASVANNVTQYHMTSAAGTFCY  588

Query  635   IDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDW  456
             IDPEYQQTGKL TKSDIYSLG+MLLQIITAK PMGL HHV RAIEKGTF D+LDP ++DW
Sbjct  589   IDPEYQQTGKLTTKSDIYSLGIMLLQIITAKNPMGLAHHVSRAIEKGTFKDMLDPVVTDW  648

Query  455   PVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
             PVEEA++FAKL L+C+ELRK+DRPDLG  I+PEL RL+ L L
Sbjct  649   PVEEAINFAKLCLKCSELRKRDRPDLGKDIVPELVRLRNLGL  690



>ref|XP_010262238.1| PREDICTED: U-box domain-containing protein 52, partial [Nelumbo 
nucifera]
Length=668

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/697 (58%), Positives = 502/697 (72%), Gaps = 54/697 (8%)
 Frame = -3

Query  2372  ISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDA  2193
             + SD +     T VAVDKDKNS SAVKWT+D+LL+ NP V+L+HV+++   N  +   D+
Sbjct  6     VFSDDSPAVNSTAVAVDKDKNSQSAVKWTIDHLLMKNPNVVLIHVKNR---NLHHTALDS  62

Query  2192  HGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSR  2013
             +  + D +   +F P+R + +R+G+ ++E  +ED +V+KAI  YIN + +SN+V+GASSR
Sbjct  63    NREV-DTETQQIFLPYRGFCSRKGVQVREVVLEDVDVSKAITDYINNNYISNIVVGASSR  121

Query  2012  SAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR---------------PLT  1878
             +AI+R+F   DV + + K+APDFC+VYVISKGK  ++R A+R               PL 
Sbjct  122   NAITRRFRNADVASCLTKSAPDFCTVYVISKGKVSTVRSASRPVPAPSNPNPPPSKQPLI  181

Query  1877  NLPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVR  1698
              LP                          DD I +   +G  S  P   S +R   GS+ 
Sbjct  182   VLPPQF----------------PPDQFESDDSIKSPFGKGWKS--PGGASLER---GSIE  220

Query  1697  RPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKR  1518
             R  +    +      DL             ++NL+    +   S +SS      E E + 
Sbjct  221   RSSDYGSGSMRFLSGDL------------TSENLELHSDTSPRSSSSSSTQSVREVEAEM  268

Query  1517  LKLE--LKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemek  1344
              +L+  L+QTM++Y+ ACKEAI+AK+ A EL Q ++EES++ E+ARQAEEAAL + E EK
Sbjct  269   KRLKLELRQTMELYSVACKEAISAKQKALELHQWQMEESRKLEEARQAEEAALAIAEKEK  328

Query  1343  akckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEI  1164
             A+CKAA+EAAE AQ++AEMEA + K AE+KA +E  EK R L  L+ +D RYRKY+I+EI
Sbjct  329   ARCKAAIEAAEAAQRLAEMEANKRKNAEIKAMRELEEKVRVLDALASNDFRYRKYTIEEI  388

Query  1163  EFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHP  984
             E ATE F+ SMKIGEGGYGPVY+  LDHTPVAIKVLR DAAQGRKQF QEVE+LS +RHP
Sbjct  389   EAATESFTPSMKIGEGGYGPVYKATLDHTPVAIKVLRQDAAQGRKQFHQEVEILSCIRHP  448

Query  983   NMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQS  804
             NMVLLLGACPEYGCLVYEYMENGSLEDRL R+GNTP IPW+IRFKI+AEIAT LLFLHQ+
Sbjct  449   NMVLLLGACPEYGCLVYEYMENGSLEDRLFRRGNTPPIPWQIRFKIAAEIATGLLFLHQT  508

Query  803   KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPE  624
             KPEPLVHRDLKPANILLD N+VSKISDVGLARLVPPSVAD +TQYHMT+ AGTFCYIDPE
Sbjct  509   KPEPLVHRDLKPANILLDINYVSKISDVGLARLVPPSVADSITQYHMTATAGTFCYIDPE  568

Query  623   YQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEE  444
             YQQTGKLG KSDIYSLGV+LLQIITA+PPMGLTH VE+AI KGT A+LLDPT+ DWPVEE
Sbjct  569   YQQTGKLGIKSDIYSLGVLLLQIITARPPMGLTHTVEKAISKGTLAELLDPTVPDWPVEE  628

Query  443   ALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             AL FAKL+L+C+ELRKKDRPDLG+V+LPELNRL+ L 
Sbjct  629   ALVFAKLALKCSELRKKDRPDLGTVVLPELNRLRNLG  665



>ref|XP_010050404.1| PREDICTED: U-box domain-containing protein 52-like [Eucalyptus 
grandis]
Length=806

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/687 (59%), Positives = 506/687 (74%), Gaps = 30/687 (4%)
 Frame = -3

Query  2327  VDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCVFTP  2148
             +D+DKNS  AV+W +D+L +S   + L+HVRHK          ++H    D D   +F  
Sbjct  90    IDRDKNSPHAVRWAIDHLGVSGLVMALIHVRHK----------NSHHNPVDGDSRDLFVM  139

Query  2147  FRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVPTI  1968
             +R YSAR+ + +KE  +E+ +VAK ++ YI  + +++VV+GA+SR+ ++RK    DV T 
Sbjct  140   YRGYSARKRVQIKEVVVEENDVAKGLLEYIANNCITSVVMGAASRNTLARKLKYTDVSTS  199

Query  1967  VNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTH-----------IWshhgsssrassr  1821
             V+K+APDFCSVYVISKGK  S+R A RP+ N  T            I+S   +    ++R
Sbjct  200   VSKSAPDFCSVYVISKGKVVSVRQARRPVVNTATPPRQPSSRAVSPIYSREQTKLHDTAR  259

Query  1820  gssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFA  1641
                    S G D +S  + R   +       ++ D  G    P     RNS ++++D+  
Sbjct  260   YGRGRRRSTGSDMLSMGNERSRAAVVNLSL-DNYDFRGLSPPPQ----RNSTSDESDISG  314

Query  1640  PISDGFDNAAAAQNLDFT--RisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACK  1467
              +S G  +    Q  DF+          + + +S+DLE+EMKRLKLELKQTMDMY+ ACK
Sbjct  315   SLSLGSMDFGD-QKFDFSMVESDSPSPSSIAQSSRDLEAEMKRLKLELKQTMDMYSTACK  373

Query  1466  EAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaem  1287
             EA++AKK A+EL  +KI+E ++FE+AR AEEAAL + +MEKAKCKAA+EAAEKAQK+AEM
Sbjct  374   EALSAKKQAEELHLLKIQEVRKFEEARHAEEAALALADMEKAKCKAAIEAAEKAQKLAEM  433

Query  1286  eAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYG  1107
             EAQR + AE+KAK E+ EK RALS L ++D RYR+Y+I+EIE AT++FSK+ KIGEGGYG
Sbjct  434   EAQRRRQAEIKAKLESKEKVRALSALHQNDSRYRRYTIEEIEEATDRFSKTNKIGEGGYG  493

Query  1106  PVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEY  927
             PVY+GKLDHT VAIKVLRPDA QG++QF QEVEVLS MRHPNMVLLLGAC EYGCLVYEY
Sbjct  494   PVYKGKLDHTSVAIKVLRPDAVQGKRQFHQEVEVLSCMRHPNMVLLLGACTEYGCLVYEY  553

Query  926   MENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDR  747
             M+ GSLEDRL RKG TP I W+ RF I+AEIATALLFLHQSKPEPLVHRDLKPANILLDR
Sbjct  554   MDRGSLEDRLFRKGKTPPISWQKRFDIAAEIATALLFLHQSKPEPLVHRDLKPANILLDR  613

Query  746   NFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVM  567
             N+ SKISDVGLARLVPP+VAD VTQ+HMT+AAGTFCYIDPEYQQTGKL TKSD+YS G+M
Sbjct  614   NYKSKISDVGLARLVPPAVADSVTQFHMTAAAGTFCYIDPEYQQTGKLTTKSDVYSFGIM  673

Query  566   LLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDR  387
             LLQIIT +P MGL+HHV  AIEKGTF ++LDP + DWPVEEAL FAKL+L CAELRKKDR
Sbjct  674   LLQIITVQPAMGLSHHVRTAIEKGTFEEMLDPAVPDWPVEEALAFAKLALMCAELRKKDR  733

Query  386   PDLGSVILPELNRLKELALQSLASKNG  306
             PDLG+V+LPELNRL++    +L S +G
Sbjct  734   PDLGTVVLPELNRLRDFG-SNLESSSG  759



>ref|XP_011094049.1| PREDICTED: U-box domain-containing protein 35-like [Sesamum indicum]
Length=772

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/708 (56%), Positives = 500/708 (71%), Gaps = 37/708 (5%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASP---NHQNGGPDAHGGMSDH  2172
             +  VA+DKDK S +A+KW VD+LL     V LLHV+ K S    NH +GG  A     D+
Sbjct  17    MVAVAIDKDKGSQAALKWAVDHLLAKGKSVALLHVKQKTSAPLGNHADGGKVAL----DN  72

Query  2171  DGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKF  1992
                 +F PFR +  R+ I + E  +EDT++A+++  Y+  + + ++V+GAS +S   R+F
Sbjct  73    QAKELFLPFRCFCTRKDIQVNEVLLEDTDIARSLCDYVKNNNIEHLVVGASVKSGFVRRF  132

Query  1991  WTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAA--------RPLTNLPTHIWshhgsss  1836
              T D+P  V+K AP+FC+VYVISKGK  SIR A+        R L N P   +     + 
Sbjct  133   KTADIPGNVSKLAPEFCTVYVISKGKAASIRAASGGPTKEGSRSLHNAPDPRYMQSNGTR  192

Query  1835  rassrgssaasssAGD-DRISACSSRGEHSGRPFRRSEDRDADGSV---RRPWNSSCRNS  1668
                    +  +    + D I +  +RG+ + R F      D+D S     RP +    ++
Sbjct  193   GGPMSPFAGRTVPTEEVDSIKSPFTRGK-ANRSFGELSMTDSDISFVSSGRPSSDRMMSA  251

Query  1667  LAEDNDLFAPISDGFD-----------------NAAAAQNLDFTRisdagsdassiaSKD  1539
             L +D  +   +S   D                 N++       +  S   S + S + +D
Sbjct  252   LEQDMMMAPRLSSSSDTENRLSFGSPFARSSDANSSFGVYSSSSNESGNFSWSGSQSLED  311

Query  1538  LESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRM  1359
             +E+EM+RLK ELKQTMDMY++ACKEA+TAK+ A EL + K+EE QR E+AR AEEAAL +
Sbjct  312   VEAEMRRLKQELKQTMDMYSSACKEALTAKQKAMELHRWKVEEQQRLEEARLAEEAALAI  371

Query  1358  VemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKY  1179
              E EK KC+AA+E AE AQ+IAE+EAQ+   AEMKA KE  EK + +  L+K+D RYRKY
Sbjct  372   AEKEKEKCRAAIEKAEAAQRIAELEAQKRINAEMKALKEAEEKKKVMDKLAKNDVRYRKY  431

Query  1178  SIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS  999
             +I+EIE ATE F+KS KIGEGGYGPVY+  LDHT VA+KVLRPDAAQGR QFQQEVEVLS
Sbjct  432   TIEEIEAATEFFTKSRKIGEGGYGPVYKCYLDHTEVAVKVLRPDAAQGRSQFQQEVEVLS  491

Query  998   LMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALL  819
              +RHPNMVLLLGACPEYGCLVYEYM NGSL+D L R+GNTP +PW++RF+I+AEI T LL
Sbjct  492   CIRHPNMVLLLGACPEYGCLVYEYMANGSLDDCLFRRGNTPVLPWQLRFRIAAEIGTGLL  551

Query  818   FLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFC  639
             FLHQ+KPEPLVHRDLKP NILLDRNFVSKISDVGLARLVPPSVAD VTQY MT+ AGTFC
Sbjct  552   FLHQTKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTATAGTFC  611

Query  638   YIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISD  459
             YIDPEYQQTG LG KSD+YSLGVMLLQIITAKPPMGLTHHV+RAIEKGTFAD+LDP + D
Sbjct  612   YIDPEYQQTGMLGIKSDVYSLGVMLLQIITAKPPMGLTHHVDRAIEKGTFADMLDPEVLD  671

Query  458   WPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
             WP+EEAL FAKL+L+C ELR+KDRPDLG+V+LPELNRL+ LA +++ S
Sbjct  672   WPIEEALIFAKLALKCTELRRKDRPDLGTVVLPELNRLRSLAEETMPS  719



>ref|XP_009388676.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata 
subsp. malaccensis]
Length=755

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/698 (58%), Positives = 502/698 (72%), Gaps = 22/698 (3%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             VVAVDKDKNS  A+KW VD+LLI+   +IL+HVR +  P+  N   +      + +   +
Sbjct  27    VVAVDKDKNSQQAMKWAVDHLLINTNSIILVHVRTQ--PDLLNTNQEMSKEQVEAELTQL  84

Query  2156  FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDV  1977
             F P+R + AR+G+ + E  +ED +V+KAI+ YI ++ + NVV+GASSR+A+ RKF   DV
Sbjct  85    FVPYRGFCARKGLQLTEVILEDFDVSKAIIDYITSNNIQNVVVGASSRNAL-RKFMNPDV  143

Query  1976  PTIVNKTAPDFCSVYVISKGKQQSIRPAA--RPLTNLPTHIWshhgsssrassrgssaas  1803
             PT + K AP+FC VYVI KGK  +IR A    P+   P        S  R +     +  
Sbjct  144   PTCLTKGAPEFCGVYVIYKGKPLTIRTAKVPAPVNTFPPKQQMALDSPYRQAEHFDHSIR  203

Query  1802  ssAGDDRISAC--SSRGEHSGR-----PFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLF  1644
             S+  +  I+    S R     R     P  R    DA   +    +SS R+S    +D +
Sbjct  204   SATENAVITKYRNSERPPDYMRGNKPLPTPRMTSNDAYIDI---LDSSVRSSRTNYHDSY  260

Query  1643  A-----PISDGF-DNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMY  1482
                   P S  F  + + A  L +T         +  + ++ E+EM+RL+LELKQT +MY
Sbjct  261   TGNIDFPASTSFRSDLSDAFELGYTESPRGFLPPAISSMREAEAEMRRLRLELKQTAEMY  320

Query  1481  NNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaq  1302
             N ACKEAI AK+ A+ELQ++KIEE++R E+ RQ+EEAAL +VE+EKAKCKAAMEAAE AQ
Sbjct  321   NAACKEAIMAKEKARELQKLKIEEARRIEELRQSEEAALVLVELEKAKCKAAMEAAEAAQ  380

Query  1301  kiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIG  1122
             KIAE+EA+R   AE+KA++E  E+ +A   + +S+  YRKYSIDEIE AT  FS ++K+G
Sbjct  381   KIAELEARRRYNAELKARREAKERKKATESVLRSEIHYRKYSIDEIEVATNFFSSALKVG  440

Query  1121  EGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGC  942
             EGGYGPV+R  LDHT VAIKVLRPDA+QGRKQFQQEVE+LS +RHPNMVLLLGACPEYGC
Sbjct  441   EGGYGPVFRATLDHTQVAIKVLRPDASQGRKQFQQEVEILSCIRHPNMVLLLGACPEYGC  500

Query  941   LVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPAN  762
             LVYEYM+ GSLEDRLLR+GNTP IPW  RFKI+AEIATALLFLHQ+KPEPLVHRDLKPAN
Sbjct  501   LVYEYMDYGSLEDRLLRRGNTPPIPWATRFKIAAEIATALLFLHQTKPEPLVHRDLKPAN  560

Query  761   ILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIY  582
             ILLD N+VSKISDVGLARLVP SVAD VTQY +TS AGT CYIDPEYQQTG LG KSDIY
Sbjct  561   ILLDHNYVSKISDVGLARLVPASVADSVTQYRITSTAGTLCYIDPEYQQTGMLGVKSDIY  620

Query  581   SLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAEL  402
             SLG+MLLQIITAKPPM LTHHVER+IEKG FAD+LDP I DWPVEE L FAKL+L+CAEL
Sbjct  621   SLGIMLLQIITAKPPMSLTHHVERSIEKGNFADMLDPAIEDWPVEETLAFAKLALKCAEL  680

Query  401   RKKDRPDLGSVILPELNRLKELALQSLASK-NGTQTFG  291
             R+KDRPDLG V+LPEL+RL+ +  +  AS+ N ++  G
Sbjct  681   RRKDRPDLGKVVLPELSRLRSIGQEYKASRSNNSRHLG  718



>dbj|BAK03904.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=748

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/687 (57%), Positives = 496/687 (72%), Gaps = 21/687 (3%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVR-HKASPNHQNGGPDAHGGMSDHDGHC  2160
             VVA+D+D+NS  A+KW VD+LL     +ILLHV  H  + NH     +      + +   
Sbjct  28    VVAIDRDRNSQLAMKWVVDHLLSGASHIILLHVAAHHPAANHGFAMAETTQDALEAEMKE  87

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F PFR + +R G++  E  +E+ +++KAI+ YI+ +++ ++ LGAS+R+A ++K+   D
Sbjct  88    IFVPFRGFCSRNGVLESEVILEEADISKAIIDYISANKIQSIALGASNRNAFTKKWKNPD  147

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIR------PAARPLTNLPTHIWshhgsssrassrg  1818
             VP+ + K APD+C++YV++KGK  ++R      PA      L T+      S        
Sbjct  148   VPSSLMKGAPDYCNIYVVAKGKPVNVRLAKCGVPADDSDFVLATYSRRSSRSQLPPVMPE  207

Query  1817  ssaasssAGDDRISACSSRGEHSGRPFRRSEDR----------DADGSVRRPWNSSCRNS  1668
             S  + S    DR    ++R     RP   S               DGS R    ++  + 
Sbjct  208   SMISCSRRSIDR-PELTTRPPFRERPLAASATTKPLLLSGRMDSTDGSYRSTLRTNSHDP  266

Query  1667  LAEDNDLFAPISDGFDNAAAAQNLD-FTRisdagsdassiaSKDLESEMKRLKLELKQTM  1491
                D D    I   F +    +NLD  +          S A +++E+EM+RLKLELKQTM
Sbjct  267   SNLDPDFAQAIH--FSSMDFGENLDALSLSPRESGSPLSAAQREVEAEMRRLKLELKQTM  324

Query  1490  DMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaae  1311
             DMYN ACKEAI+AK+ AKE+  +K+EE++R E+ARQAEEAAL + EMEK KC+AAMEAAE
Sbjct  325   DMYNAACKEAISAKQRAKEMHLLKMEEARRLEEARQAEEAALALAEMEKVKCRAAMEAAE  384

Query  1310  kaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSM  1131
              AQ++A++EAQR + AE++A++E  EK RAL  ++  D RYRKY+IDEIE ATE+FS+S+
Sbjct  385   AAQRLADLEAQRRRNAEVRARREADEKVRALDAIANHDFRYRKYNIDEIEIATERFSESL  444

Query  1130  KIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPE  951
             KIGEGGYGPVY   LDHTPVAIKVLRPDA QGRKQFQQEVEVLS +RHPNMVLLLGACPE
Sbjct  445   KIGEGGYGPVYSASLDHTPVAIKVLRPDAQQGRKQFQQEVEVLSCIRHPNMVLLLGACPE  504

Query  950   YGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLK  771
             YGCLVYEYMENGSLEDRL R+G TP +PW  RF+ISAEIATALLFLHQ+KPEPLVHRDLK
Sbjct  505   YGCLVYEYMENGSLEDRLFRRGGTPTLPWSQRFRISAEIATALLFLHQTKPEPLVHRDLK  564

Query  770   PANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKS  591
             PANILLDRN+VSKISDVGLARLVPP+VAD VTQY +T+ AGTFCYIDPEYQQTGKLG KS
Sbjct  565   PANILLDRNYVSKISDVGLARLVPPAVADSVTQYRLTATAGTFCYIDPEYQQTGKLGVKS  624

Query  590   DIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQC  411
             DIYSLGV+LLQ+ITA+PPMGLTHHVE+AIE GTFA +LD TI DWPVE+AL FAKLSL+C
Sbjct  625   DIYSLGVLLLQVITARPPMGLTHHVEKAIESGTFAQMLDVTIKDWPVEDALGFAKLSLKC  684

Query  410   AELRKKDRPDLGSVILPELNRLKELAL  330
              E+R++DRPDLG+V+LPELNRL+ L +
Sbjct  685   TEMRRRDRPDLGTVVLPELNRLRNLGI  711



>ref|XP_010491957.1| PREDICTED: U-box domain-containing protein 51-like isoform X2 
[Camelina sativa]
Length=654

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/639 (61%), Positives = 490/639 (77%), Gaps = 19/639 (3%)
 Frame = -3

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
             G + D++ + +F P+R Y AR+GI M E  +EDT+VAKAI+ Y+N + V+N+VLG+SS+S
Sbjct  12    GNIDDNEINQLFVPYRGYCARKGITMMEVILEDTDVAKAILDYVNNNLVTNLVLGSSSKS  71

Query  2009  AISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgss  1839
               +R  KF  +HDVP  V K+ P+FCS+YVISKGK QS + A RP+TN  T +     SS
Sbjct  72    PFARSLKFTKSHDVPASVLKSMPEFCSIYVISKGKVQSSKTAQRPITN--TLVPPRAPSS  129

Query  1838  srassrgssaasssAGDDRISACSSRGEHSG---RPFRRSEDRDADGSV------RRPW-  1689
             +  +             +  ++   R  H G   +P R  +    +GS+      R+P  
Sbjct  130   TFHTPDNDQDHLPRNQRNARNSTPERHSHDGNGYKPMREMQKIPTNGSLDFNYDFRQPRC  189

Query  1688  ---NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFT-RisdagsdassiaSKDLESEMK  1521
                +SS RNS  ++ D+ + +  G      A+NLD     S +  ++ S +++D+E+EMK
Sbjct  190   QKNSSSARNSFTDEGDVGSVMMMGASIDLTAENLDLVVGASASSDESVSQSTRDIEAEMK  249

Query  1520  RLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemeka  1341
             RLK+ELKQTMDMY++ACKEA+ AKK A EL   K+EE++RFE+AR +EEAAL + EMEKA
Sbjct  250   RLKIELKQTMDMYSSACKEALNAKKKANELNLWKMEEARRFEEARVSEEAALAVAEMEKA  309

Query  1340  kckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIE  1161
             KC+AA+EAAEKAQ++AE+E QR K AE+KA++E+ EK+RALS L ++D RYR+YSI+EIE
Sbjct  310   KCRAAIEAAEKAQRMAELEGQRRKQAEIKARRESQEKDRALSALVQNDVRYRRYSIEEIE  369

Query  1160  FATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPN  981
              AT+ F+ + KIGEGGYGPVY G LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RHP+
Sbjct  370   EATDNFANNRKIGEGGYGPVYYGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSSIRHPH  429

Query  980   MVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSK  801
             MVLLLGACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATAL FLHQ+K
Sbjct  430   MVLLLGACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIAAEIATALSFLHQAK  489

Query  800   PEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEY  621
             PEPLVHRDLKPANILLD+N+VSKISDVGLARLVP SVA+ VTQ+HMTSAAGTFCYIDPEY
Sbjct  490   PEPLVHRDLKPANILLDKNYVSKISDVGLARLVPASVANTVTQFHMTSAAGTFCYIDPEY  549

Query  620   QQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEA  441
             QQTGKL TKSDIYSLG+MLLQIITAK PMGL HHV RAI+KGTF DLLDP ++DWPVEEA
Sbjct  550   QQTGKLTTKSDIYSLGIMLLQIITAKNPMGLAHHVSRAIDKGTFKDLLDPAVTDWPVEEA  609

Query  440   LHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQS  324
              +FAKL LQCAELRK+DRPDLG  I+PEL RLK L + +
Sbjct  610   TNFAKLCLQCAELRKRDRPDLGKEIVPELLRLKNLGMNN  648



>emb|CCM07282.1| putative Serine threonine kinase 1-l [Musa balbisiana]
Length=749

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/700 (57%), Positives = 499/700 (71%), Gaps = 32/700 (5%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             VVAVDKDKNS  A+KW VD+LLI+   +IL+HVR +   + +           + +   +
Sbjct  24    VVAVDKDKNSQQAMKWAVDHLLINTNSIILIHVRTQQEMSKEQ---------VEAELTQL  74

Query  2156  FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDV  1977
             F P+R + AR+G+ + E  +ED +V+KAI+ YI ++ + NVV+GASSR+A+ RKF   DV
Sbjct  75    FVPYRGFCARKGLQLTEVILEDFDVSKAIIDYITSNNIQNVVVGASSRNAL-RKFMNPDV  133

Query  1976  PTIVNKTAPDFCSVYVISKGKQQSIRPAA--RPLTNLPTHIWshhgsssrassrgssaas  1803
             PT + K AP+FC VYVI KGK  +IR A    P+   P        S  R +     +  
Sbjct  134   PTCLTKGAPEFCGVYVIYKGKPLTIRTAKVPAPVNTFPPKQQMALDSPYRQAEHFDYSIR  193

Query  1802  ssAGDDRISACSSRGEHSGRP-----------FRRSEDRDADGSVRRPWNSSCRNSLAED  1656
             S+  +   +A  ++  +S RP             R    DA   +    +SS R+S    
Sbjct  194   SATENAIENAVITKYRNSERPPDYMRGNKPLPTPRMTSNDAYIDI---LDSSVRSSRTNY  250

Query  1655  NDLFA-----PISDGF-DNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQT  1494
             +D +      P S  F  + + A  L +T         +  + ++ E+EM+RL+LELKQT
Sbjct  251   HDSYTGNIDFPASTSFRSDLSDAFELGYTESPRGFLPPAISSMREAEAEMRRLRLELKQT  310

Query  1493  MDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaa  1314
             ++MYN ACKEAI AK+ A+ELQ++KIEE++R E+ RQ+EEAAL +VE+EKAKCKAAMEAA
Sbjct  311   VEMYNAACKEAIMAKEKARELQKLKIEEARRIEELRQSEEAALALVELEKAKCKAAMEAA  370

Query  1313  ekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKS  1134
             E AQKIAE+EA+R   AE+KA++   E+ +A   + +S+  YRKYSIDEIE AT  FS +
Sbjct  371   EAAQKIAELEARRRYNAELKARRVAKERKKATESVLRSEIHYRKYSIDEIEVATNFFSSA  430

Query  1133  MKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACP  954
             +K+GEGGYGPV+R  LDHT VAIKVLRPDA+QGRKQFQQEVE+LS +RHPNMVLLLGACP
Sbjct  431   LKVGEGGYGPVFRATLDHTQVAIKVLRPDASQGRKQFQQEVEILSCIRHPNMVLLLGACP  490

Query  953   EYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDL  774
             EYGCLVYEYM+ GSLEDRLLR+GNTP IPW  RFKI+AEIATALLFLHQ+KPEPLVHRDL
Sbjct  491   EYGCLVYEYMDYGSLEDRLLRRGNTPPIPWATRFKIAAEIATALLFLHQTKPEPLVHRDL  550

Query  773   KPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTK  594
             KPANILLD N+VSKISDVGLARLVP SVAD VTQY +TS AGT CYIDPEYQQTG LG K
Sbjct  551   KPANILLDHNYVSKISDVGLARLVPASVADSVTQYRITSTAGTLCYIDPEYQQTGMLGVK  610

Query  593   SDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQ  414
             SDIYSLG+MLLQIITAKPPM L HHVER+IEKG FAD+LDP I DWPVEE L FAKL+L+
Sbjct  611   SDIYSLGIMLLQIITAKPPMSLMHHVERSIEKGNFADMLDPAIEDWPVEETLAFAKLALK  670

Query  413   CAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQTF  294
             CAELR+KDRPDLG V+LPEL+RL+ +  +  AS++    +
Sbjct  671   CAELRRKDRPDLGKVVLPELSRLRSIGQEYKASRSNNSRY  710



>ref|XP_009618440.1| PREDICTED: U-box domain-containing protein 35 [Nicotiana tomentosiformis]
Length=794

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/744 (56%), Positives = 511/744 (69%), Gaps = 62/744 (8%)
 Frame = -3

Query  2369  SSDGATTGP--ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS---PNH--Q  2211
             SS G   G    TVVA+DKDK S  A+KW VDNLL     V LLHV+ + S   PN    
Sbjct  7     SSSGEKKGEEKATVVAIDKDKGSQYALKWAVDNLLGKGKSVTLLHVKLRPSNSIPNADVN  66

Query  2210  NGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVV  2031
             +G P  +    D     +F PFR +  R+ I + E  IE  ++A +I  Y+  +   N+V
Sbjct  67    DGTPRVYRSDPDSQAKELFLPFRCFCNRKNIHVNEVVIEGIDIANSISDYVAANVTENLV  126

Query  2030  LGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWsh  1851
             +GA+SR+    +F T DVP+ V+K AP FC+VYVI+KGK  SIR A+ P+ N P  +  +
Sbjct  127   VGAASRNGFVSRFKTMDVPSSVSKIAPGFCTVYVIAKGKVLSIRNASAPVPNPPPSLLQN  186

Query  1850  hgsssrassrgssaasssAGDDRISACSSRGEHS-----------------GRPFRRS--  1728
               SSS  +  G   A  +  +D   + + R  ++                 G+P  RS  
Sbjct  187   QTSSSLGAKLGFIEARYAPSNDSRGSMADRSPYAPRSSTEDSDFIKSPFNRGKPVNRSYG  246

Query  1727  -----EDRDADGSVRRPWNSSC-----------------RNSLAEDNDLFAP-ISDG---  1626
                  E   +  S  RP +S C                  NS   DN   AP +S+    
Sbjct  247   DLSVAESDISFVSSNRP-SSDCTFPISSDSHDLGLPPRLSNSSDTDNRFSAPRLSNSSET  305

Query  1625  -----FDNAAAAQNLD----FTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNA  1473
                  F ++ +A  L     F+  S   ++ S+   +D+E+EM+RLK ELKQTMDMY+ A
Sbjct  306   DSRLSFGSSFSATRLSEVNAFSSNSFDSANGSTNNLEDIEAEMRRLKQELKQTMDMYSTA  365

Query  1472  CKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkia  1293
             CKEA++AK  A EL + K+EE QR E+AR AEEAAL + E EKAKCKAA+EAAE+AQ+IA
Sbjct  366   CKEALSAKHKALELHRWKVEEEQRLEEARSAEEAALAIAEKEKAKCKAALEAAEEAQRIA  425

Query  1292  emeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGG  1113
             E EAQR  +AE KA KE  EK + L  L++SDCRYRKY+I+EIE AT+ F+ S KIGEGG
Sbjct  426   EREAQRRIHAERKALKEAEEKKKVLDALAQSDCRYRKYTIEEIEAATDNFAASRKIGEGG  485

Query  1112  YGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVY  933
             YGPVY+  LDHT VAIKVLRPDAAQGR QFQQEVEVLS +RHPNMVLLLGACPE+GCLVY
Sbjct  486   YGPVYKCCLDHTQVAIKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPEFGCLVY  545

Query  932   EYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILL  753
             EYM NGSL+DRL R+GNTP +PW++RF+I+AE+ T+LLFLHQ+KPEPLVHRDLKP NILL
Sbjct  546   EYMANGSLDDRLFRRGNTPVLPWQLRFRIAAEVGTSLLFLHQTKPEPLVHRDLKPGNILL  605

Query  752   DRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLG  573
             DRN+VSKISDVGLARLVPPSVAD VTQY MTS AGTFCYIDPEYQQTG LGTKSDIYS G
Sbjct  606   DRNYVSKISDVGLARLVPPSVADSVTQYRMTSTAGTFCYIDPEYQQTGMLGTKSDIYSFG  665

Query  572   VMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKK  393
             +MLLQIITA+PPMGLTHHVERAIEKGTFA++LDP + DWPVEEAL FAKL+L+CAELR+K
Sbjct  666   IMLLQIITARPPMGLTHHVERAIEKGTFAEMLDPAVRDWPVEEALTFAKLALKCAELRRK  725

Query  392   DRPDLGSVILPELNRLKELALQSL  321
             DRPDL +V+LPELNRL+ LA +++
Sbjct  726   DRPDLATVVLPELNRLRLLAEEAI  749



>ref|XP_010915203.1| PREDICTED: U-box domain-containing protein 52-like [Elaeis guineensis]
Length=759

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/713 (56%), Positives = 515/713 (72%), Gaps = 24/713 (3%)
 Frame = -3

Query  2369  SSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASP-NHQNGGPDA  2193
             + +G+    +T VAVDKDKNS  AVKW VD+++     V L+HV+ ++ P N      +A
Sbjct  13    TGEGSGPAAVTAVAVDKDKNSLHAVKWAVDHVIGDTKIVTLIHVKIRSHPHNRVETSTEA  72

Query  2192  HGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSR  2013
                 +D +   +F P+  + AR+G+ + E  +ED +V+KAI+ YI+ + + N+V+GAS+R
Sbjct  73    TREQADEEIAQLFRPYIGFFARKGLQLNEVILEDVDVSKAIIEYISANHIQNIVVGASNR  132

Query  2012  SAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPA-------ARPLTNLPT-HIW  1857
             +A+ R+F   DVP+ + K  P+FC+V+VI KGK  ++R A       A P    P  H  
Sbjct  133   NALMRRFRNPDVPSNLTKAVPEFCAVHVICKGKPITVRAAKGSSPANAAPPRQPPARHRL  192

Query  1856  shhgsssrassrgssaasssAGDDRISACSSRGEHSGR-PFRRSEDRDADGSVRRPWNSS  1680
             SH  + +  S R     +S  G     A   R    G+  + ++  RD   +  R  +++
Sbjct  193   SHQATDAEDSVRNPFGRASLRGLGTHPASLERTSFEGQYDYMKTTSRDRPLAGARSASNA  252

Query  1679  CRNSLAEDNDLFAP--------ISD--GFDNAAAAQNLDFTRisdagsdassiaSKDLES  1530
               +SL  D+ + AP        + D  G  +   + +L+F+  S + ++  +IA +D+E+
Sbjct  253   SFDSL--DSSVRAPRFFHGDTDLQDNMGLQSMEFSDSLEFS-SSASFANHPAIAGQDVEA  309

Query  1529  EMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVem  1350
             EMKRL+LELK+TM+MYN ACKEAI AK+ A+ELQQ K++E++ FE+ + AEE AL + EM
Sbjct  310   EMKRLRLELKRTMEMYNTACKEAIMAKQKARELQQWKMDETRMFEELKHAEETALAIAEM  369

Query  1349  ekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSID  1170
             EKAKC+AA+EAAE AQKIAE EAQ+   AE+KAK+E  EK +AL  L ++D RYRKY+I+
Sbjct  370   EKAKCQAAIEAAEAAQKIAEHEAQKRLNAELKAKREAEEKKKALEALVQNDVRYRKYTIE  429

Query  1169  EIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMR  990
             +IE AT +FS ++KIGEGGYGPVY+  LDHTPVAIKVLRPDAA GR+QF QEVEVLS +R
Sbjct  430   DIEVATNEFSAALKIGEGGYGPVYKASLDHTPVAIKVLRPDAAHGRRQFLQEVEVLSCIR  489

Query  989   HPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLH  810
             HPNMVLLLGACPEYG LVYEYM+ GSLEDRL R+GNTP IPW +RFKI+AEIAT LLFLH
Sbjct  490   HPNMVLLLGACPEYGILVYEYMDYGSLEDRLFRRGNTPPIPWTVRFKIAAEIATGLLFLH  549

Query  809   QSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYID  630
             Q+KPEPLVHRDLKPANILL+RN+VSKISDVGLARLVPPSVA++VTQY MTS AGTFCYID
Sbjct  550   QAKPEPLVHRDLKPANILLNRNYVSKISDVGLARLVPPSVANNVTQYRMTSTAGTFCYID  609

Query  629   PEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPV  450
             PEYQQTG LG KSDIYSLG+MLLQIITAKPPMGLTHHVERAIEKG F  +LDP ++DWPV
Sbjct  610   PEYQQTGMLGVKSDIYSLGIMLLQIITAKPPMGLTHHVERAIEKGAFEQMLDPAVTDWPV  669

Query  449   EEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQTFG  291
             EEAL FAKL+L+CAELR+KDRPDLG+VILPEL+R ++    +     G   FG
Sbjct  670   EEALSFAKLALKCAELRRKDRPDLGTVILPELDRFRKFG-HAYKENAGGNIFG  721



>ref|XP_010419785.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Camelina sativa]
Length=654

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/637 (61%), Positives = 488/637 (77%), Gaps = 19/637 (3%)
 Frame = -3

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
             G + D++ + +F P+R Y AR+GI M E  ++DT+VAKA++ Y+N + V+N+VLG+SS+S
Sbjct  12    GNVGDNELNQLFVPYRGYCARKGITMLEVILDDTDVAKAVLDYVNNNLVTNLVLGSSSKS  71

Query  2009  AISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgss  1839
               +R  KF  +HDVP  V K+ P+FCS+YVISKGK QS + A RP+TN  T +     SS
Sbjct  72    PFARSLKFTKSHDVPASVLKSTPEFCSIYVISKGKVQSSKTAQRPITN--TLVPPRAPSS  129

Query  1838  srassrgssaasssAGDDRISACSSRGEHSG---RPFRRSEDRDADGSV------RRPW-  1689
             +   S               ++   R  H G   +P R  +    +GS+      R+P  
Sbjct  130   TFHISDNDQDHLPRNQRSARNSTPERHSHDGNGYKPVREMQKIPTNGSLDFSYDFRQPRC  189

Query  1688  ---NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFT-RisdagsdassiaSKDLESEMK  1521
                +SS RNS  ++ D+ + +  G      A+NLD     S +  ++ S +++D+E+EMK
Sbjct  190   QKNSSSARNSFTDEGDVGSMMMMGASIDLTAENLDLVVGASASSDESVSQSTRDIEAEMK  249

Query  1520  RLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemeka  1341
             RLK+ELKQTMDMY++ACKEA+ AKK A EL   K+EE++RFE+AR +EEAAL + EMEKA
Sbjct  250   RLKIELKQTMDMYSSACKEALNAKKKANELNLWKMEEARRFEEARVSEEAALAVAEMEKA  309

Query  1340  kckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIE  1161
             KC+AA+EAAEKAQ++AE+E QR K AE+KA++E+ EK+RALS L ++D RYR+YSI+EIE
Sbjct  310   KCRAAIEAAEKAQRMAELEGQRRKQAEIKARRESQEKDRALSALVQNDVRYRRYSIEEIE  369

Query  1160  FATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPN  981
              AT+ F+ + KIGEGGYGPVY G LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RHP+
Sbjct  370   EATDNFANNRKIGEGGYGPVYYGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSSIRHPH  429

Query  980   MVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSK  801
             MVLLLGACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATAL FLHQ+K
Sbjct  430   MVLLLGACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIAAEIATALSFLHQAK  489

Query  800   PEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEY  621
             PEPLVHRDLKPANILLD+N+VSKISDVGLARLVP SVA+ VTQ+HMTSAAGTFCYIDPEY
Sbjct  490   PEPLVHRDLKPANILLDKNYVSKISDVGLARLVPASVANTVTQFHMTSAAGTFCYIDPEY  549

Query  620   QQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEA  441
             QQTGKL TKSDIYSLG+MLLQIITAK PMGL HHV RAI+KGTF DLLDP ++DWPVEEA
Sbjct  550   QQTGKLTTKSDIYSLGIMLLQIITAKNPMGLAHHVSRAIDKGTFKDLLDPAVTDWPVEEA  609

Query  440   LHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
              +FAKL LQCAELRK+DRPDLG  I+PEL RLK L +
Sbjct  610   TNFAKLCLQCAELRKRDRPDLGKEIVPELLRLKSLGM  646



>ref|XP_010453264.1| PREDICTED: U-box domain-containing protein 51-like isoform X2 
[Camelina sativa]
Length=654

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/637 (61%), Positives = 488/637 (77%), Gaps = 19/637 (3%)
 Frame = -3

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
             G + D++ + +F P+R Y AR+GI M E  ++DT+VAKA++ Y+N + V+N+VLG+SS+S
Sbjct  12    GNVDDNELNQLFVPYRGYCARKGITMLEVILDDTDVAKAVLDYVNNNLVTNLVLGSSSKS  71

Query  2009  AISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgss  1839
               +R  KF  +HDVP  V K+ P+FCS+YVISKGK QS + A RP+TN  T +     SS
Sbjct  72    PFARSLKFTKSHDVPASVLKSTPEFCSIYVISKGKVQSSKTAQRPITN--TLVPPRAPSS  129

Query  1838  srassrgssaasssAGDDRISACSSRGEHSG---RPFRRSEDRDADGSV------RRPW-  1689
             +                +  ++   R  H G   +P R  +    +GS+      R+P  
Sbjct  130   TFHVPDNDQDHLPRNQRNARNSTPERHSHDGNGYKPVREMQKIPTNGSLDFNYDFRQPRC  189

Query  1688  ---NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFT-RisdagsdassiaSKDLESEMK  1521
                ++S RNS  ++ D+ + +  G      A+NLD     S +  ++ S +++D+E+EMK
Sbjct  190   QKNSASARNSFTDEGDVGSMMMMGASIDLTAENLDLVVGASASSDESVSQSTRDIEAEMK  249

Query  1520  RLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemeka  1341
             RLK+ELKQTMDMY++ACKEA+ AKK A EL   K+EE++RFE+AR +EEAAL + EMEKA
Sbjct  250   RLKIELKQTMDMYSSACKEALNAKKKANELNLWKMEEARRFEEARVSEEAALAVAEMEKA  309

Query  1340  kckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIE  1161
             KC+AAMEAAEKAQ++AE+E QR K AE+KA++E+ EK+RALS L ++D RYR+YSI+EIE
Sbjct  310   KCRAAMEAAEKAQRMAELEGQRRKQAEIKARRESQEKDRALSALVQNDVRYRRYSIEEIE  369

Query  1160  FATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPN  981
              AT+ F+ + KIGEGGYGPVY G LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RHP+
Sbjct  370   EATDNFANNRKIGEGGYGPVYYGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSSIRHPH  429

Query  980   MVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSK  801
             MVLLLGACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATAL FLHQ+K
Sbjct  430   MVLLLGACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIAAEIATALSFLHQAK  489

Query  800   PEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEY  621
             PEPLVHRDLKPANILLD+N+VSKISDVGLARLVP SVA+ VTQ+HMTSAAGTFCYIDPEY
Sbjct  490   PEPLVHRDLKPANILLDKNYVSKISDVGLARLVPASVANTVTQFHMTSAAGTFCYIDPEY  549

Query  620   QQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEA  441
             QQTGKL TKSDIYSLG+MLLQIITAK PMGL HHV RAI+KGTF DLLDP ++DWPVEEA
Sbjct  550   QQTGKLTTKSDIYSLGIMLLQIITAKNPMGLAHHVSRAIDKGTFKDLLDPAVTDWPVEEA  609

Query  440   LHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
              +FAKL LQCAELRK+DRPDLG  I+PEL RLK L +
Sbjct  610   TNFAKLCLQCAELRKRDRPDLGKEIVPELLRLKSLGM  646



>ref|XP_010252202.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Nelumbo nucifera]
Length=796

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/725 (56%), Positives = 510/725 (70%), Gaps = 54/725 (7%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPD----------A  2193
             +  VA+DKDK S  ++KW VD++L     VIL+HV  KAS      G            A
Sbjct  17    LVAVAIDKDKGSQYSLKWAVDHILGKGQTVILIHVNQKASTLPSPTGSQVSISDVRDDVA  76

Query  2192  HGGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
                  + DG    +F PFR +  R+ I  K+  IED ++AKA++ Y++ + + N+V+GAS
Sbjct  77    STYRQEQDGQTKELFLPFRCFCTRKDIQCKDVVIEDVDIAKALIEYVSHNVIENLVVGAS  136

Query  2018  SRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP---LTNLPTHIWshh  1848
             +++   R+F + DV T V+K APDFC+VYVISKGK  S+R A+RP   ++ L   + + +
Sbjct  137   TKNGFMRRFKSTDVATTVSKGAPDFCTVYVISKGKISSVRSASRPAPTVSPLRNQLQAQN  196

Query  1847  gsssrassrgssaasssAGDDRIS-------ACSSRGEHSGRPF-RRSEDRDADGSVRRP  1692
               S ++    S+ + SS G   +S       +  S  E    PF RR  +  + G +  P
Sbjct  197   QLSIKSEPVESNNSYSSRGAAPLSPFEPPRNSIHSELESMKSPFTRRGLNGKSYGEISLP  256

Query  1691  -----WNSSCRNSLAEDNDLFAPISDGFDNA-----AAAQNLDFTRisdags--------  1566
                  + SS R S+   + +F PI D  +++     +   +LD        S        
Sbjct  257   DSDISFVSSGRPSV---DRMFPPIYDHLESSRTPRLSNCSDLDLQSFESVQSGPKSDLHS  313

Query  1565  ----------dassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKI  1416
                         SS   +D+E+EM+RLKLELKQTMDMY+ ACKEA+TAK+ A+EL + K+
Sbjct  314   MHGISSFSHESDSSQTMEDVEAEMRRLKLELKQTMDMYSTACKEALTAKQKARELHRWKM  373

Query  1415  eesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketa  1236
             EE +R E+AR AEEAAL + E EKAKCKAA+EAAE AQ+IAE+EAQ+   AEMKA KE+ 
Sbjct  374   EEERRLEEARLAEEAALAIAEKEKAKCKAAIEAAEAAQRIAELEAQKRLNAEMKAIKESE  433

Query  1235  eKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVL  1056
             E+ + L  L+  DCRYRKY+I+EIE ATE FS++ KIGEGGYGPVY+  LDHTPVAIKVL
Sbjct  434   ERKKVLESLAHKDCRYRKYTIEEIEAATEYFSETRKIGEGGYGPVYKCYLDHTPVAIKVL  493

Query  1055  RPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTP  876
             RPDAAQGR+QFQQEVE+LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL R+GNTP
Sbjct  494   RPDAAQGRQQFQQEVEILSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTP  553

Query  875   AIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPP  696
              + W++RF+I+AEI T LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPP
Sbjct  554   VLSWQVRFRIAAEIGTGLLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPP  613

Query  695   SVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHV  516
             +VAD+VTQY MTS AGTFCYIDPEYQQTG LG KSDIYSLG+M LQIITAKPPMGLTHHV
Sbjct  614   NVADNVTQYRMTSTAGTFCYIDPEYQQTGMLGIKSDIYSLGIMFLQIITAKPPMGLTHHV  673

Query  515   ERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKEL  336
             E AIEKG F ++LDP + DWP+EEAL FAKLSL+C+ELR+KDRPDLG+ +LPELNRL+ L
Sbjct  674   EHAIEKGKFTEMLDPAVPDWPIEEALCFAKLSLRCSELRRKDRPDLGTEVLPELNRLRNL  733

Query  335   ALQSL  321
             A +++
Sbjct  734   AEENM  738



>ref|XP_008445511.1| PREDICTED: U-box domain-containing protein 51 isoform X2 [Cucumis 
melo]
Length=696

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/651 (61%), Positives = 499/651 (77%), Gaps = 26/651 (4%)
 Frame = -3

Query  2207  GGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVL  2028
             G  D+  G  + D   +F P+R Y AR+G+ +KE  ++D +++KA+V Y++ + +++ V+
Sbjct  10    GASDSENG--ETDAQQLFVPYRGYCARKGVQLKEVVLDDPDISKALVDYVHKNCINSFVV  67

Query  2027  GASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL------PT  1866
             GAS+RSA++RKF   DVPT + KTAP+FCSVYVISK K  S R A RP+ N       P+
Sbjct  68    GASTRSALARKFKAPDVPTSIIKTAPEFCSVYVISKAKIISARAALRPVANTAMPPRQPS  127

Query  1865  HIWshhgsssrassrgssaas--------ssAGDDRISACSSRGEHSGRPFRRSEDRDAD  1710
              +         +SS   + A          SAG +R+ A  + G    +   R   + + 
Sbjct  128   PLGVQSNGQPDSSSEPENGAKMQVAKEGWKSAGTERMLAERNGGGKPAKALTRERPKTSP  187

Query  1709  GSV---------RRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdas  1557
              ++         R   +S  R+S+++DN + A ++ G  +A A Q+LDF+  S+   D++
Sbjct  188   TNISLENIEVPNRGSRSSFSRDSISDDNMMTAQMAFGSMDATA-QSLDFSASSNLSMDSA  246

Query  1556  siaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqae  1377
             S ++++LE+EMKRLKLELKQTMDMY++ACKEAI+AK  A+EL Q K +E+++FE+ R AE
Sbjct  247   SQSTRELEAEMKRLKLELKQTMDMYSSACKEAISAKNKARELSQWKQDEARKFEEVRLAE  306

Query  1376  eaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSD  1197
             EAAL + EMEKAKCKAA+EAAE AQK+AE EAQR K AEMKA++E  EK RAL+ L+++D
Sbjct  307   EAALAIAEMEKAKCKAAIEAAEAAQKLAEREAQRRKQAEMKARREAEEKKRALNALAQND  366

Query  1196  CRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQ  1017
              RYRKY+I+EIE +TEKFS+ +KIGEGGYGPVY GKLDHT VAIKVLRPDAAQGRKQFQQ
Sbjct  367   VRYRKYTIEEIEESTEKFSEKLKIGEGGYGPVYGGKLDHTAVAIKVLRPDAAQGRKQFQQ  426

Query  1016  EVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAE  837
             EVEVL  +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL R+GN+P + W  RFKI+AE
Sbjct  427   EVEVLCCIRHPNMVLLLGACPEYGCLVYEYMHNGSLEDRLFRRGNSPPLSWRRRFKIAAE  486

Query  836   IATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTS  657
             IATALLFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD VTQYH+TS
Sbjct  487   IATALLFLHQAKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADQVTQYHLTS  546

Query  656   AAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLL  477
             AAGTFCYIDPEYQQTGKL TKSDIYS G+MLLQIITAKPPMGL HHV+RAIEK  F ++L
Sbjct  547   AAGTFCYIDPEYQQTGKLTTKSDIYSFGIMLLQIITAKPPMGLAHHVQRAIEKDRFDEML  606

Query  476   DPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQS  324
             DPTISD P+EEA +FAKL+L+CAELRK+DRPDLG+VI+PELNRL+++   S
Sbjct  607   DPTISDCPLEEATNFAKLALKCAELRKRDRPDLGTVIVPELNRLRDIGRSS  657



>ref|XP_004969416.1| PREDICTED: U-box domain-containing protein 35-like [Setaria italica]
Length=757

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/707 (55%), Positives = 504/707 (71%), Gaps = 21/707 (3%)
 Frame = -3

Query  2348  GPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVR-HKASPNHQNGGPDAHGGMSDH  2172
              P  VVA+D+D+NS  A KW VD+LL S   VILLHV  H  +  H     +   G  + 
Sbjct  24    APTIVVAIDRDRNSPLAAKWVVDHLLSSASHVILLHVAAHYPAATHGFALAETTQGALEA  83

Query  2171  DGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKF  1992
             +   +F P+R +  R  + + E  +E+ +V+KAI+GYI  +++ ++ LG + R+A ++KF
Sbjct  84    EMKEIFVPYRGFFNRNAVEVSEVILEEADVSKAILGYITANKIQSIALGGACRNAFTKKF  143

Query  1991  WTHDVPTIVNKTAPDFCSVYVISKGKQQSIR------PAARPLTNLPTHIWshhgsssra  1830
                DVP+ + K APD+C++YV++KGK  ++R      PA      LP +          +
Sbjct  144   KNADVPSTLMKCAPDYCNIYVVAKGKSVNVRLAKCGVPAVTGTDVLPDNESLRGAVGLYS  203

Query  1829  ssrgssaasssAGDDR--ISACSSRGEHSGRP-FR-RSEDRDADGSVRRPWNSSCRNSLA  1662
                       +  D R  + + S+  E + RP FR RS    A   +    + S  +S +
Sbjct  204   RRGSRGLLPPAMPDARRSVDSRSTLPELTSRPPFRERSLPSSAKHVMPAGKDYSDASSRS  263

Query  1661  EDNDLFAPISDG----FDNAAAAQNLDFTRisdag------sdassiaSKDLESEMKRLK  1512
               ++  A +  G    F +   ++NLD +    A       S A+  A +++E+EM+RL+
Sbjct  264   TRHESLAELDFGQSTRFSSIDFSENLDMSTTLAASPGGEPMSPATCQAQREVEAEMRRLR  323

Query  1511  LELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakck  1332
             LELKQTMDMYN AC+EAI AK+ AKE+Q +K+E+++R E+A+ AEEAAL + EMEKAKC+
Sbjct  324   LELKQTMDMYNAACREAINAKQRAKEMQMLKLEDARRLEEAQHAEEAALAVAEMEKAKCR  383

Query  1331  aameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFAT  1152
             AAMEAAE AQ++A++EAQR + AE++A++E  EK RAL  ++  D RYR+Y IDEIE +T
Sbjct  384   AAMEAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAITNHDFRYRRYHIDEIEMST  443

Query  1151  EKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVL  972
             E+FS  +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQFQQEVEVLS +RHPNMVL
Sbjct  444   ERFSDELKIGEGGYGPVYRASLDHTPVAIKVLRPDAHQGRKQFQQEVEVLSCIRHPNMVL  503

Query  971   LLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEP  792
             LLGACPEYGCLVYEYM+NGSLEDRL R+G TP IPW  RF+I+AEIATALLFLHQ+KPEP
Sbjct  504   LLGACPEYGCLVYEYMDNGSLEDRLYRRGGTPPIPWSQRFRIAAEIATALLFLHQTKPEP  563

Query  791   LVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQT  612
             LVHRDLKPANILLDRN+VSKISDVGLARLVPP+VAD VTQY +T+ AGTFCYIDPEYQQT
Sbjct  564   LVHRDLKPANILLDRNYVSKISDVGLARLVPPAVADSVTQYRLTATAGTFCYIDPEYQQT  623

Query  611   GKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHF  432
             GKLG KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTF  +LD T+ DWPV+EAL F
Sbjct  624   GKLGVKSDIYSLGVLLLQVVTARPPMGLTHHVEKAIDAGTFHQMLDITVKDWPVDEALGF  683

Query  431   AKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQTFG  291
             AKL+L+C E+R++DRPDL +VILPELNRL+ L +   AS     ++G
Sbjct  684   AKLALKCTEIRRRDRPDLATVILPELNRLRNLGIAYDASVTAGPSYG  730



>ref|XP_002308542.2| hypothetical protein POPTR_0006s24180g [Populus trichocarpa]
 gb|EEE92065.2| hypothetical protein POPTR_0006s24180g [Populus trichocarpa]
Length=740

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/721 (56%), Positives = 504/721 (70%), Gaps = 36/721 (5%)
 Frame = -3

Query  2375  TISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPD  2196
             T   +G +    T VA+DKDKNS  A +W VDN   +NP ++L+HV+HK   NHQ    D
Sbjct  6     TADDNGDSLFNATAVAIDKDKNSQHAFRWAVDNFARNNPVIVLIHVKHK---NHQYKVAD  62

Query  2195  AHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASS  2016
                  ++ +   +FT  R Y AR+G+ +K+  ++  +VA+A+  YIN+  + N+VLGAS 
Sbjct  63    GQADEAE-EVQQLFTSSRGYCARKGVRLKQVALDHIDVAQAVADYINSSLIGNIVLGASG  121

Query  2015  RSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsss  1836
             R+ ++RKF   DVPT + K APDFCSVYVI+KGK  S + A R    +P         S 
Sbjct  122   RNVLTRKFKNQDVPTSLMKIAPDFCSVYVITKGKILSSKKAQR----MPPSSAPQKTPSM  177

Query  1835  rassrgssaasssAGDDRISACSSRGE-HSGRPFRRSEDRDADGSVRRPWNSSCRNSLA-  1662
              A S  S   ++    D + A + + E  S  P     D+  D  +R P +   R  ++ 
Sbjct  178   PAVSSRSQQDNAELDSDGVRAQTRKRECRSTEPGGFPSDKVHD-LIREPQHEGGRKPISN  236

Query  1661  ---EDND----------LFAPISDGFDNA---------AAAQNLDFTRisdagsdassia  1548
                E  D               SD   N          ++AQ LD +  S +  + S+  
Sbjct  237   FSMESTDPPFSAGRLSTFRYSTSDASQNTGTFALAIMDSSAQGLDKSIASASSLNESNAD  296

Query  1547  SKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaa  1368
               + E    RL  ELKQTM MY+ ACKEA++AKK A  L Q K++E ++FE+ + A EAA
Sbjct  297   FLEAEMRRLRL--ELKQTMAMYSTACKEALSAKKKATGLNQWKVDEVRKFEETKLAGEAA  354

Query  1367  lRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRY  1188
             L M E+EKAKC+ A+EAAEK+QK+AEMEA++ K AEMKA++ET EKNRAL+ L+ +D RY
Sbjct  355   LAMAELEKAKCRVAIEAAEKSQKLAEMEARKRKQAEMKAERETGEKNRALNALAHNDVRY  414

Query  1187  RKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVE  1008
             R+Y+I+EIE AT+KFS S KIGEGGYGPVY+GKLDHTPVAIK LRP AAQG+KQFQQEVE
Sbjct  415   RRYTIEEIEEATDKFSPSNKIGEGGYGPVYKGKLDHTPVAIKALRPGAAQGKKQFQQEVE  474

Query  1007  VLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIAT  828
             VLS +RHP+MVLLLGACPEYG L+YE M+NGSLEDRLL+K NTP IPW  RFKI+AEIAT
Sbjct  475   VLSTIRHPHMVLLLGACPEYGVLIYECMDNGSLEDRLLQKDNTPPIPWSTRFKIAAEIAT  534

Query  827   ALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAG  648
             ALLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPS+AD VTQYHMTSAAG
Sbjct  535   ALLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSIADSVTQYHMTSAAG  594

Query  647   TFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPT  468
             TFCYIDPEYQQTG L T+SDIYS+G+MLLQIITAKPPMGL H V RAIE+G F+D+LD T
Sbjct  595   TFCYIDPEYQQTGMLTTRSDIYSMGIMLLQIITAKPPMGLAHQVGRAIERGGFSDMLDHT  654

Query  467   ISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKN-GTQTFG  291
             +SDWPVEEAL FA L+L+CAELRK+DRP L +VI+PELNRL++  + S   ++ G  + G
Sbjct  655   VSDWPVEEALRFAILALKCAELRKRDRPSLATVIVPELNRLRDFGMNSEQQQSRGVSSRG  714

Query  290   R  288
             R
Sbjct  715   R  715



>emb|CAN69465.1| hypothetical protein VITISV_023046 [Vitis vinifera]
Length=768

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/704 (57%), Positives = 491/704 (70%), Gaps = 36/704 (5%)
 Frame = -3

Query  2345  PITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             P+  VA+DKDK S SA+KW +DN+L     V+L+HV+ K S +H     D    + DH  
Sbjct  16    PLVAVAIDKDKGSQSALKWAIDNILNRGQTVVLIHVKLKQSHSHSYPTGDEVAKL-DHYT  74

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
               +F PFR +  R+ I  K+  +EDT+V KA++ Y++   +  +V+GA ++    R+F  
Sbjct  75    KELFLPFRCFCTRKDIQCKDVILEDTDVVKALIEYVSHSAIEVLVVGAPAKGGFLRRFKA  134

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIR------PAARPLTN--------------LPT  1866
              D+P  + K APDFC+VYVISKGK  S R      PA  PL N              LP 
Sbjct  135   IDIPGSITKGAPDFCTVYVISKGKISSTRSASRAAPAISPLRNQIMNQGSIRPDPSDLPI  194

Query  1865  -HIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDR------DADG  1707
              H  S  G  S        A        RI   S     SGRP   S DR      D++ 
Sbjct  195   PHAPSSRGHHSLEEQEAQMADHMGKFHYRIRYISFVS--SGRP---STDRMFPPFYDSNI  249

Query  1706  SVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDF--TRisdagsdassiaSKDLE  1533
              + R  N    NS   DN  F     G  +       +F      +  +  SS +++D+E
Sbjct  250   DIIRS-NPRLSNSSDMDNQTFESSQMGRKSMEIGSPPEFLAISQENDRTSWSSQSAEDVE  308

Query  1532  SEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVe  1353
             +EM+RLKLELKQTMDMY+ ACKEA++AK+ A+ELQ+ K+EE QR E+AR AEEAAL + E
Sbjct  309   AEMRRLKLELKQTMDMYSTACKEALSAKQKARELQRWKLEEEQRLEEARLAEEAALAIAE  368

Query  1352  mekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSI  1173
              EKAK +AA+E AE AQ+IAE+EAQ+   AEMKA KE  EK + L  L+++D RYRKY+I
Sbjct  369   REKAKSRAAIEHAEAAQRIAELEAQKRINAEMKAIKEAEEKKKVLDSLAQTDVRYRKYTI  428

Query  1172  DEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLM  993
             +EIE ATE FS+S KIGEGGYGPVY+  LDHT VAIKVLRPDAAQGR QFQQEVEVLS +
Sbjct  429   EEIESATEFFSESRKIGEGGYGPVYKCNLDHTQVAIKVLRPDAAQGRSQFQQEVEVLSCI  488

Query  992   RHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFL  813
             RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL R+G++P + W++RF+I+AEI T LLFL
Sbjct  489   RHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGDSPPLSWQLRFRIAAEIGTGLLFL  548

Query  812   HQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYI  633
             HQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY MTS AGTFCYI
Sbjct  549   HQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRMTSTAGTFCYI  608

Query  632   DPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWP  453
             DPEYQQTG LG KSD+YSLG+MLLQIITAKPPMGLTH VERAIEK TF ++LDP + DWP
Sbjct  609   DPEYQQTGMLGIKSDVYSLGIMLLQIITAKPPMGLTHLVERAIEKDTFEEMLDPVVPDWP  668

Query  452   VEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             +EEAL FAK++LQCAELR+KDRPDLG  +LPELNRL+EL+ + L
Sbjct  669   LEEALSFAKIALQCAELRRKDRPDLGKAVLPELNRLRELSEEHL  712



>ref|XP_010252203.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Nelumbo nucifera]
Length=795

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/725 (56%), Positives = 509/725 (70%), Gaps = 55/725 (8%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPD----------A  2193
             +  VA+DKDK S  ++KW VD++L     VIL+HV  KAS      G            A
Sbjct  17    LVAVAIDKDKGSQYSLKWAVDHILGKGQTVILIHVNQKASTLPSPTGSQVSISDVRDDVA  76

Query  2192  HGGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
                  + DG    +F PFR +  R+ I  K+  IED ++AKA++ Y++ + + N+V+GAS
Sbjct  77    STYRQEQDGQTKELFLPFRCFCTRKDIQCKDVVIEDVDIAKALIEYVSHNVIENLVVGAS  136

Query  2018  SRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP---LTNLPTHIWshh  1848
             +++   R F + DV T V+K APDFC+VYVISKGK  S+R A+RP   ++ L   + + +
Sbjct  137   TKNGFMR-FKSTDVATTVSKGAPDFCTVYVISKGKISSVRSASRPAPTVSPLRNQLQAQN  195

Query  1847  gsssrassrgssaasssAGDDRIS-------ACSSRGEHSGRPF-RRSEDRDADGSVRRP  1692
               S ++    S+ + SS G   +S       +  S  E    PF RR  +  + G +  P
Sbjct  196   QLSIKSEPVESNNSYSSRGAAPLSPFEPPRNSIHSELESMKSPFTRRGLNGKSYGEISLP  255

Query  1691  -----WNSSCRNSLAEDNDLFAPISDGFDNA-----AAAQNLDFTRisdags--------  1566
                  + SS R S+   + +F PI D  +++     +   +LD        S        
Sbjct  256   DSDISFVSSGRPSV---DRMFPPIYDHLESSRTPRLSNCSDLDLQSFESVQSGPKSDLHS  312

Query  1565  ----------dassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKI  1416
                         SS   +D+E+EM+RLKLELKQTMDMY+ ACKEA+TAK+ A+EL + K+
Sbjct  313   MHGISSFSHESDSSQTMEDVEAEMRRLKLELKQTMDMYSTACKEALTAKQKARELHRWKM  372

Query  1415  eesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketa  1236
             EE +R E+AR AEEAAL + E EKAKCKAA+EAAE AQ+IAE+EAQ+   AEMKA KE+ 
Sbjct  373   EEERRLEEARLAEEAALAIAEKEKAKCKAAIEAAEAAQRIAELEAQKRLNAEMKAIKESE  432

Query  1235  eKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVL  1056
             E+ + L  L+  DCRYRKY+I+EIE ATE FS++ KIGEGGYGPVY+  LDHTPVAIKVL
Sbjct  433   ERKKVLESLAHKDCRYRKYTIEEIEAATEYFSETRKIGEGGYGPVYKCYLDHTPVAIKVL  492

Query  1055  RPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTP  876
             RPDAAQGR+QFQQEVE+LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL R+GNTP
Sbjct  493   RPDAAQGRQQFQQEVEILSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTP  552

Query  875   AIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPP  696
              + W++RF+I+AEI T LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPP
Sbjct  553   VLSWQVRFRIAAEIGTGLLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPP  612

Query  695   SVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHV  516
             +VAD+VTQY MTS AGTFCYIDPEYQQTG LG KSDIYSLG+M LQIITAKPPMGLTHHV
Sbjct  613   NVADNVTQYRMTSTAGTFCYIDPEYQQTGMLGIKSDIYSLGIMFLQIITAKPPMGLTHHV  672

Query  515   ERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKEL  336
             E AIEKG F ++LDP + DWP+EEAL FAKLSL+C+ELR+KDRPDLG+ +LPELNRL+ L
Sbjct  673   EHAIEKGKFTEMLDPAVPDWPIEEALCFAKLSLRCSELRRKDRPDLGTEVLPELNRLRNL  732

Query  335   ALQSL  321
             A +++
Sbjct  733   AEENM  737



>ref|XP_010928974.1| PREDICTED: U-box domain-containing protein 35-like [Elaeis guineensis]
Length=777

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/699 (56%), Positives = 491/699 (70%), Gaps = 32/699 (5%)
 Frame = -3

Query  2345  PITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             P+  VAVDKDK S +A+KW +DN++     + L+HV  K +   Q   P + G  S    
Sbjct  33    PLVAVAVDKDKGSQNALKWALDNVVTKGQTITLIHVNTKPTGLGQQEDPASAGSQSKE--  90

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
                F PFR +  R+ +  K+  +EDT++A+AI+ +++   +  +V+GA S+S   R F T
Sbjct  91    --FFVPFRCFCTRKNVHCKDIILEDTDIARAIIEFVSQAAIEKLVVGAPSKSGFVR-FRT  147

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP---LTNLPTHIWshhgsssrassrgs  1815
              D  T ++K APDFC+VY+ISKGK  S+R A RP    + L +HI S     +       
Sbjct  148   TDTATNISKAAPDFCTVYIISKGKVSSMRNAVRPPPAFSPLRSHIQSQASIKAEHVDPPL  207

Query  1814  saasssAGDDRISACSSRGEHSGRPFRRS-------EDRDADGSVRRPWNSSCRNSLAED  1656
             S+        +     S  E    PF R           D+  +    + S  R S+   
Sbjct  208   SSGVKGEAALQARHVQSEREPIRSPFTRGPYAYNAKAHTDSIANSDISFVSGGRPSI---  264

Query  1655  NDLFAP---ISDGFDNAAAAQN--------LDFT---RisdagsdassiaSKDLESEMKR  1518
             + +F P   +SDG D++   Q+          F          S +SS+  +D+E+EMKR
Sbjct  265   DRIFNPRLSMSDGLDDSFEMQSPRKSMGGGYSFGTGFSSISQDSTSSSLNMEDVEAEMKR  324

Query  1517  LKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekak  1338
             L+LELKQTM+MY+ ACKEA+TAK+ A EL + K+EE +R E+AR AEEAAL + E EKA+
Sbjct  325   LRLELKQTMEMYSTACKEALTAKQKAMELHRWKMEEERRLEEARLAEEAALALAEKEKAR  384

Query  1337  ckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEF  1158
             CKAA+EAAE +++IAE+EAQ+   AEMK  KE  EK RAL  L+ +D RYRKY+I+EIE 
Sbjct  385   CKAAIEAAEASKRIAELEAQKRINAEMKVLKEAEEKKRALDALAHTDVRYRKYTIEEIEA  444

Query  1157  ATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNM  978
             ATE FS+  KIGEGGYGPVY+G LDHT  AIKVLRPDAAQGR QFQQEVE+LS +RHPNM
Sbjct  445   ATENFSEKRKIGEGGYGPVYKGYLDHTAAAIKVLRPDAAQGRSQFQQEVEILSCIRHPNM  504

Query  977   VLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKP  798
             VLLLGACPEYGCLVYEYM NGSLEDRL R+GNTP IPW+ RF+I+AEI T LLFLH++KP
Sbjct  505   VLLLGACPEYGCLVYEYMANGSLEDRLFRQGNTPPIPWQHRFRIAAEIGTGLLFLHETKP  564

Query  797   EPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQ  618
             EPLVHRDLKPANILLD+N+VSKISDVGLARLVPPSVA++VTQY MTS AGTFCYIDPEYQ
Sbjct  565   EPLVHRDLKPANILLDQNYVSKISDVGLARLVPPSVAENVTQYRMTSTAGTFCYIDPEYQ  624

Query  617   QTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEAL  438
             QTG LG KSDIYSLGVMLLQ+ITA+PPMGLTHHVERAIEKGTFA++LDP ++DWPVE+AL
Sbjct  625   QTGMLGVKSDIYSLGVMLLQLITARPPMGLTHHVERAIEKGTFAEMLDPLVTDWPVEDAL  684

Query  437   HFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
               AK++L+CAELR+KDRPDL +V+ PEL RL+  A Q++
Sbjct  685   SLAKIALKCAELRRKDRPDLATVVFPELERLRNFAEQNM  723



>gb|KDP34071.1| hypothetical protein JCGZ_07642 [Jatropha curcas]
Length=711

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/693 (58%), Positives = 495/693 (71%), Gaps = 64/693 (9%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
             T VA+DKDKNS  AV+W +D+L+I+NP +IL+HV+                         
Sbjct  16    TAVAIDKDKNSQQAVRWAIDHLIINNPVIILVHVQ-------------------------  50

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
                            ++E  ++D++VA+A++ YI+ H + ++ +GAS+R+A++RKF   D
Sbjct  51    ---------------LREVVLDDSDVARALLDYISKHYIGSIAVGASTRNALTRKFKNQD  95

Query  1979  VPTIVNKTAPDFCSVYVISKGK----QQSIRPAARPLTNLPTHIWshhgsssrassrgss  1812
             VPT + K+APDFCSVYVISKGK    + + RPAA P     +   +    +    S    
Sbjct  96    VPTSLVKSAPDFCSVYVISKGKIVSARTAQRPAANPPIPPKSPPLALPAPNHHDHSEHED  155

Query  1811  aasssAGDDRISACSSRG-EHSGRPFR---RSEDRDAD------------GSVRRPWNSS  1680
                   G  R +       E +   FR   R  +R               G+   P  S 
Sbjct  156   GTRGGKGYLRNTGSDKHHHEKTNDSFRAQLRERNRTPSNLSLDSIDISFPGTGTAPRMSI  215

Query  1679  CRNSLAEDNDLFAP-ISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLEL  1503
              R+S +ED++     I    D A+   + DF+    + +D     +++LE+EM+RLKLEL
Sbjct  216   GRDSTSEDSEFSGSYILGSSDGASQISSADFS--MGSHNDGYLQNARELEAEMRRLKLEL  273

Query  1502  KQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaam  1323
             KQT+DMY+ AC+EA+ AKK A EL Q K+EE++RFE+AR AEEAAL + E+EKAKCKAAM
Sbjct  274   KQTIDMYSTACREALNAKKKANELHQWKMEEARRFEEARNAEEAALAIAEIEKAKCKAAM  333

Query  1322  eaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKF  1143
             EAA+KAQ++AEMEAQ+ KYAEMKAK+E  EK RAL+ L+  D RYRKY+I+EIE +TEKF
Sbjct  334   EAADKAQRLAEMEAQKRKYAEMKAKREAEEKKRALNALAH-DVRYRKYTIEEIEASTEKF  392

Query  1142  SKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLG  963
             S+S KIGEGGYGPVY+GKLDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RHPNMVLLLG
Sbjct  393   SQSNKIGEGGYGPVYKGKLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSCIRHPNMVLLLG  452

Query  962   ACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVH  783
             ACPEYGCLVYEYMENGSLEDRLLR+ NTP I W  RFKI++EIATALLFLHQ+KPEPLVH
Sbjct  453   ACPEYGCLVYEYMENGSLEDRLLRRENTPPISWRRRFKIASEIATALLFLHQAKPEPLVH  512

Query  782   RDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKL  603
             RDLKPANILLDRN+VSKISDVGLARLVP SVAD VTQYHMTSAAGTFCYIDPEYQQTG L
Sbjct  513   RDLKPANILLDRNYVSKISDVGLARLVPQSVADSVTQYHMTSAAGTFCYIDPEYQQTGML  572

Query  602   GTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKL  423
              T+SDIYS G+MLLQIITAKPPMGL H V +AIEKGTF ++LDP +SDWPVEEAL FAK+
Sbjct  573   TTRSDIYSFGIMLLQIITAKPPMGLAHRVGKAIEKGTFEEMLDPAVSDWPVEEALSFAKM  632

Query  422   SLQCAELRKKDRPDLGSVILPELNRLKELALQS  324
             +L+CAELRKKDRP L + I+PELNRL++L   S
Sbjct  633   ALKCAELRKKDRPSLATDIVPELNRLRDLGRNS  665



>ref|XP_008782816.1| PREDICTED: U-box domain-containing protein 35-like [Phoenix dactylifera]
Length=749

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/698 (56%), Positives = 490/698 (70%), Gaps = 30/698 (4%)
 Frame = -3

Query  2345  PITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             P+  VA+DKDK S +A+KW +DN++     + L+HV  K +    +G  + H     H  
Sbjct  10    PLVAVAIDKDKGSQNALKWALDNIVTRGQTITLIHVNSKHT---GSGAQEDHASAGSHSK  66

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
               +F PFR +  R+ +  K+  +EDT++AKAI+ +++   +  +V+GA S+S   R F T
Sbjct  67    D-LFVPFRCFCTRKNVHCKDVILEDTDIAKAIIEFVSNAAIEKLVVGAPSKSGFVR-FRT  124

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaa  1806
              DV T ++K APDFC+VY+ISKGK  S+R A R    +    +     +  +        
Sbjct  125   TDVATNISKGAPDFCTVYIISKGKVSSMRNAVRSAPAVSP--YRAQIQNHASIKTEHVDP  182

Query  1805  sssAGDDRISACSSRGEHSGR-PFRRSEDRDADGSVRRPWNSSC-----------RNSLA  1662
               S G    +A  +R   S R P R    R A  S  + +  S            R S+ 
Sbjct  183   PRSYGIKGGAALEARNVQSEREPIRSPFTRGARASNAKSYAESIADSDISFVSGGRTSID  242

Query  1661  EDNDLFAPISDGFDNAAAAQN--------LDFTRi---sdagsdassiaSKDLESEMKRL  1515
                +    +SDG D++   Q+          F          S +SS A +D+E+EMKRL
Sbjct  243   GIFNQRLSMSDGLDSSFEMQSPRRSVGGGYSFGTAFSSISQDSTSSSHAMEDVEAEMKRL  302

Query  1514  KLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakc  1335
             +LELKQTM+MY+ ACKEA+TAK+ A EL + K+EE +R E+AR AE AAL + E EKA+C
Sbjct  303   RLELKQTMEMYSTACKEALTAKQKAMELHRWKMEEERRLEEARLAEGAALALAEKEKARC  362

Query  1334  kaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFA  1155
             KAA+EAAE +++IAE+EAQ+   AEMKA KE  EK RAL  L+ +D RYRKY+I+EIE A
Sbjct  363   KAAIEAAEASKRIAELEAQKRINAEMKAFKEGEEKKRALDALAHTDVRYRKYTIEEIEVA  422

Query  1154  TEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMV  975
             TE FS+  KIGEGGYGPVYR  LDHTP AIKVLRPDAAQGR QFQQEVE+LS +RHPNMV
Sbjct  423   TEYFSEKRKIGEGGYGPVYRCYLDHTPAAIKVLRPDAAQGRSQFQQEVEILSCIRHPNMV  482

Query  974   LLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPE  795
             LLLGACPEYGCLVYEYM NGSLEDRL R+GNTP IPW+ RF+I+AEI+T LLFLHQ+KPE
Sbjct  483   LLLGACPEYGCLVYEYMANGSLEDRLFRRGNTPPIPWQHRFRIAAEISTGLLFLHQTKPE  542

Query  794   PLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQ  615
             PLVHRDLKPANILLD+N+VSKI DVGLARLVPPSVA++VTQY MTS AGTFCYIDPEYQQ
Sbjct  543   PLVHRDLKPANILLDQNYVSKIGDVGLARLVPPSVAENVTQYRMTSTAGTFCYIDPEYQQ  602

Query  614   TGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALH  435
             TG LG KSDIYSLG+MLLQ+ITA+PPMGLTHHVERAIEKG FA++LDP ++DWPVEEAL 
Sbjct  603   TGMLGVKSDIYSLGIMLLQLITARPPMGLTHHVERAIEKGMFAEMLDPLVTDWPVEEALS  662

Query  434   FAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              AK++L+CAELR+KDRPDL +V+LPEL RL+ LA +++
Sbjct  663   LAKIALKCAELRRKDRPDLATVVLPELERLRSLAEENM  700



>gb|AFO66517.1| putative kinase [Brassica napus]
Length=1266

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/702 (59%), Positives = 522/702 (74%), Gaps = 39/702 (6%)
 Frame = -3

Query  2369  SSDGATTGPITVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQNGGPD  2196
             S DG      TVVA+DKDKNS  AV+W  D+L  +I+NP +IL+HVR K S NH      
Sbjct  511   SEDGHAPANSTVVAIDKDKNSHYAVRWAADHLFNMINNPNMILVHVRLKNS-NH------  563

Query  2195  AHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASS  2016
                   D + + +F P+R Y AR+GI M E  +ED++VA+AI+ Y+N + V+N+V+G++S
Sbjct  564   -----GDDELNHLFVPYRGYCARKGISMMEVILEDSDVARAILDYVNNNLVNNIVVGSAS  618

Query  2015  RS----AISRKFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL------P  1869
              S    A S KF  +HDV   + K+ P+FCS+YVISKGK QS R A R +TN       P
Sbjct  619   SSKNPFARSLKFTKSHDVAASILKSTPEFCSIYVISKGKVQSSRAAQRRITNTLVPPREP  678

Query  1868  THIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPW  1689
             +  +                  +S         +  G ++ R  RRS    A+GS+   +
Sbjct  679   SSAFHLQNLPDPDQDPLPRGQRNSRNTTPERYHNDNGFNAMRERRRSA---ANGSLDFNY  735

Query  1688  ---------NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDL  1536
                      N   RNS ++++D  + +    D   +AQN DF   S +  +++S +++D+
Sbjct  736   DFKQANGQRNPVGRNSFSDESDGGSLMMGSVD--LSAQNYDFIGASGSSDESASQSTRDI  793

Query  1535  ESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMV  1356
             E+EMKRLKLEL+QTMDMY++ACKEA+ AKK+A EL   K EE++RFE+AR AEEAAL + 
Sbjct  794   EAEMKRLKLELRQTMDMYSSACKEALNAKKTANELNMWKKEEARRFEEARSAEEAALAVA  853

Query  1355  emekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYS  1176
             EMEKAKCKAAMEAAEKAQ++A++E QR K AEMKA++E+ EK+RAL+ L ++D RYRKYS
Sbjct  854   EMEKAKCKAAMEAAEKAQRMADLEGQRRKQAEMKARRESQEKDRALTALGQNDVRYRKYS  913

Query  1175  IDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSL  996
             I+EIE AT++F+ +MK+GEGGYGPVY+G LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS 
Sbjct  914   IEEIEEATDRFASNMKVGEGGYGPVYKGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSC  973

Query  995   MRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLF  816
             +RHP+MVLLLGACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATAL F
Sbjct  974   IRHPHMVLLLGACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIAAEIATALSF  1033

Query  815   LHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCY  636
             LHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVP SVA++VTQYHMTSAAGTFCY
Sbjct  1034  LHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPASVANNVTQYHMTSAAGTFCY  1093

Query  635   IDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDW  456
             IDPEYQQTGKL TKSDIYSLG+MLLQIITAK PMGL HHV RAIEKGTF D+LDP ++DW
Sbjct  1094  IDPEYQQTGKLTTKSDIYSLGIMLLQIITAKNPMGLAHHVARAIEKGTFKDMLDPVVTDW  1153

Query  455   PVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
             PVEEA++FAKL L+C+ELRK+DRPDLG  I+PEL RL+ L L
Sbjct  1154  PVEEAINFAKLCLKCSELRKRDRPDLGKDIVPELVRLRNLGL  1195



>ref|XP_007137133.1| hypothetical protein PHAVU_009G102500g [Phaseolus vulgaris]
 gb|ESW09127.1| hypothetical protein PHAVU_009G102500g [Phaseolus vulgaris]
Length=776

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/721 (54%), Positives = 497/721 (69%), Gaps = 56/721 (8%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKA---SPNHQNGGPDAHGGMSD-  2175
             +  VA+DK K S +A+KW VDNLL+ +  VIL+HV+  A   SP+     P     + D 
Sbjct  17    LVAVAIDKKKGSQTALKWAVDNLLMRSATVILIHVKLLAPTLSPSPSLFVPRISAFLGDD  76

Query  2174  -----HDGHC----VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
                   +  C    +F P+R +  R+ I  K+  +ED++V+KAI  Y +   + ++VLG+
Sbjct  77    SSVVGKEHECQNKNLFLPYRVFCTRKDIHCKDVQLEDSDVSKAITEYASQTGIEHLVLGS  136

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR-PLTNLPTHIWshhg  1845
             S+++++ ++F   D+P  ++K APDFC+VYVI+KGK Q++R A R P T  P  ++    
Sbjct  137   SAKTSLLKRFKVSDIPGEISKGAPDFCTVYVIAKGKIQTMRSATRQPPTIFPNLVYQGSV  196

Query  1844  sssra-----------ssrgssaasssAGDDRISACSSRGEHSGRPF-------------  1737
              S+ +             +  S  S+S  D+   +  +R  ++GR +             
Sbjct  197   RSNISDPNMHSDPNIKEEQSHSFDSASQYDESFRSPFTRKHYNGRHYGDTPNSDMDISFV  256

Query  1736  ---RRSEDR-----DADGSVRRPWNSSCRNSLAEDNDL---FAPISDGFDNAAAAQNLDF  1590
                R+S DR     + D  +  P     R S + D D    F  I  G  +       +F
Sbjct  257   STGRKSTDRLIPSLNLDTGISNP-----RLSYSSDTDANLSFESIHYGRKSPELNSPNEF  311

Query  1589  TRisdag--sdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKI  1416
             T  S        +S A+ D+E+EM+RLKLELKQTM+MYN ACKEA+TA + A ELQQ KI
Sbjct  312   TSFSFESDNQSFTSQATDDMEAEMRRLKLELKQTMEMYNTACKEALTAHQKAVELQQWKI  371

Query  1415  eesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketa  1236
             EE  R E+A+ A + A+ M E EKAK KAA+E AE  ++IAE+E+Q+   AEMKA +E+ 
Sbjct  372   EEEMRMEEAKLAGKKAMAMAEKEKAKSKAAIETAEAQKRIAELESQKRLVAEMKAIRESE  431

Query  1235  eKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVL  1056
             EK + L  L   D RYRKY+I+EIE AT  FS+S+KIGEGGYGPV++  LDHTPVA+KVL
Sbjct  432   EKRKVLDALVNVDIRYRKYTIEEIEEATNFFSESLKIGEGGYGPVFKCHLDHTPVAVKVL  491

Query  1055  RPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTP  876
             RPDA QGR QFQ+EVEVLS +RHPNMVLLLGACPEYGCLVYEYM NGSL++ L RKGNTP
Sbjct  492   RPDAQQGRSQFQREVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDNCLFRKGNTP  551

Query  875   AIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPP  696
              +PW++RFKI+AEI T LLFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPP
Sbjct  552   PLPWQLRFKIAAEIGTGLLFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPP  611

Query  695   SVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHV  516
             SVAD VTQYHMTSAAGTFCYIDPEYQQTG LG KSDIYSLG++ LQ++TAK PMGLTHHV
Sbjct  612   SVADTVTQYHMTSAAGTFCYIDPEYQQTGMLGVKSDIYSLGIIFLQLLTAKAPMGLTHHV  671

Query  515   ERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKEL  336
             ERAIEKGT  ++LDP++SDWP EEAL FAKL++QCAELR+KDRPDLG VILPEL+RL+ L
Sbjct  672   ERAIEKGTLDEILDPSLSDWPQEEALKFAKLAVQCAELRRKDRPDLGKVILPELHRLRNL  731

Query  335   A  333
             A
Sbjct  732   A  732



>ref|XP_003569258.2| PREDICTED: U-box domain-containing protein 35-like [Brachypodium 
distachyon]
Length=752

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/690 (56%), Positives = 497/690 (72%), Gaps = 27/690 (4%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVR-HKASPNHQNGGPDAHGGMSDHDGHC  2160
             VVA+D+D+NS  A+KW VD+LL S   +ILLHV  H  + NH     +   G  + +   
Sbjct  29    VVAIDRDRNSQLAMKWVVDHLLNSAAHIILLHVAAHHPAANHGFAMAEPTPGALEAEMKE  88

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F PFR +  + G+   E  +E+ +V+KAI+ YI  +++ ++ LGAS+R+A ++K+   D
Sbjct  89    IFVPFRGFCDKNGVEQSEVILEEADVSKAILEYITANKIQSIALGASNRNAFTKKWKNPD  148

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaass  1800
             VP+ + K APD+C++YV++KGK  ++R A   ++   +        S R+S         
Sbjct  149   VPSSLMKGAPDYCNIYVVAKGKPVNVRLAKCGVSTDDSDFALGPTYSRRSSRNHLPPPMP  208

Query  1799  sAGDDRISACSSRGEHSGRP-FRRSEDRDADGSVRRPW------------NSSCRNSLAE  1659
              +   R S   +  E + RP FR   +R    SV +P               S R S + 
Sbjct  209   ESLSCRRSIDRNIPELTTRPPFR---ERSLPASVTKPLLLCGRVDSTDGTYRSTRRSASH  265

Query  1658  DNDLFAPISDGFDNAAAAQNLDFTRisdagsda-------ssiaSKDLESEMKRLKLELK  1500
             D+     +   F  A  + ++DF+   DA + +        S A +++E EM+RL+LELK
Sbjct  266   DS---VDVDPDFAQAVHSSSMDFSENLDALNLSPRESCSPLSGAQREVEGEMRRLRLELK  322

Query  1499  QTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaame  1320
             QTMDMYN ACKEAI+AK+ A+E+  + +EE++  E++RQAEEAAL   EMEK KC+AAME
Sbjct  323   QTMDMYNAACKEAISAKQRAREMHLLSMEEARLLEESRQAEEAALHQAEMEKLKCRAAME  382

Query  1319  aaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFS  1140
             AAE AQ++A++EAQR + AE++A++E+ EK RAL  +S  D R RKY+IDEIE ATE+F 
Sbjct  383   AAEAAQRLADLEAQRRRNAEVRARRESDEKVRALDAISSHDFRCRKYTIDEIELATERFD  442

Query  1139  KSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGA  960
             + +KIGEGGYGPVY   LDHTPVAIKVLRPDA QGRKQFQQEVEVLS +RHPNMVLLLGA
Sbjct  443   EKLKIGEGGYGPVYSASLDHTPVAIKVLRPDAQQGRKQFQQEVEVLSCIRHPNMVLLLGA  502

Query  959   CPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHR  780
             CPEYGCLVYEYMENGSLEDRL R+G TP +PW  RF+ISAEIATALLFLHQ++PEPLVHR
Sbjct  503   CPEYGCLVYEYMENGSLEDRLFRRGGTPPMPWSQRFRISAEIATALLFLHQTRPEPLVHR  562

Query  779   DLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLG  600
             DLKPANILLDRN+VSKISDVGLARLVPP+VAD VT+Y +T+ AGTFCYIDPEYQQTGKLG
Sbjct  563   DLKPANILLDRNYVSKISDVGLARLVPPAVADSVTRYRLTATAGTFCYIDPEYQQTGKLG  622

Query  599   TKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLS  420
              KSDIYSLGV+LLQ+ITA+PPMGLTHHVE+AIE  TFA +LD T+ DWPVE+AL FAKL+
Sbjct  623   VKSDIYSLGVLLLQVITARPPMGLTHHVEKAIESDTFAQMLDITVKDWPVEDALGFAKLA  682

Query  419   LQCAELRKKDRPDLGSVILPELNRLKELAL  330
             L+C E+R++DRPDLG+VILPELNRL+ L +
Sbjct  683   LKCTEMRRRDRPDLGTVILPELNRLRNLGI  712



>emb|CDM83211.1| unnamed protein product [Triticum aestivum]
Length=744

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/684 (56%), Positives = 486/684 (71%), Gaps = 23/684 (3%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVR-HKASPNHQNGGPDAHGGMSDHDGHC  2160
             VVA+D+D+NS  A+KW VD+LL     +ILLHV  H  + NH     +      + +   
Sbjct  28    VVAIDRDRNSQLAMKWVVDHLLSGASHIILLHVAAHPPAANHGFAMAETTQDALEAEMME  87

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F PFR + +R G+   E  +E+ +V KAI+ YI+ +++ ++ LGAS+R+A ++K+   D
Sbjct  88    IFVPFRGFCSRNGVQESEVILEEADVPKAIIDYISANKIQSIALGASNRNAFTKKWKNPD  147

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaass  1800
             VP+ + K APD+C++YV++KGK  ++R A   +    +       S   + S+       
Sbjct  148   VPSSLMKGAPDYCNIYVVAKGKPVNVRLAKCGVPADDSDFLLATYSRRSSRSQLPPVLPD  207

Query  1799  sAGDDRISACSSRGEHSGR-PFRRSEDRDADGSVRRP------WNSSCRNSLAEDNDLFA  1641
                  R S    R E + R PFR   +R    S  +P       +S+   S + D     
Sbjct  208   FLSSSRRSI--DRPELTTRPPFR---ERPLQASATKPHLLLARMDSTTLRSNSHDPSSLD  262

Query  1640  PISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLK-------LELKQTMDMY  1482
             P    F  A    ++DF    DA   +       L +  + ++       LELKQTMDMY
Sbjct  263   P---DFAQAVHFPSMDFGENMDALPLSPREPGTPLSAAQREVEAEMRRLKLELKQTMDMY  319

Query  1481  NNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaq  1302
             N ACKEAI AK+ AKE+  +K+EE++R E+ARQ+EEAAL + EMEK KC+AAMEAAE AQ
Sbjct  320   NAACKEAINAKQRAKEMHLLKMEEARRLEEARQSEEAALALAEMEKVKCRAAMEAAEAAQ  379

Query  1301  kiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIG  1122
             ++A++EAQR + AE++A++E  EK RAL  ++  D RYRKYSIDEIE ATE FS+S+KIG
Sbjct  380   RLADLEAQRRRNAEVRARREADEKVRALDAIANHDFRYRKYSIDEIEIATEGFSESLKIG  439

Query  1121  EGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGC  942
             EGGYGPVY   LDHTPVAIKVLRPDA QGRKQFQQEVEVLS +RHPNMVLLLGACPEYGC
Sbjct  440   EGGYGPVYSASLDHTPVAIKVLRPDAQQGRKQFQQEVEVLSRIRHPNMVLLLGACPEYGC  499

Query  941   LVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPAN  762
             LVYEYMENGSLEDRL R+G TP +PW  RF+ISAEIATALLFLHQ+KPEPLVHRDLKPAN
Sbjct  500   LVYEYMENGSLEDRLYRRGGTPTLPWSQRFRISAEIATALLFLHQTKPEPLVHRDLKPAN  559

Query  761   ILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIY  582
             ILLDRN+VSKISDVGLARLVPP+VAD VTQY +T+ AGTFCYIDPEYQQTGKLG KSDIY
Sbjct  560   ILLDRNYVSKISDVGLARLVPPAVADSVTQYRLTATAGTFCYIDPEYQQTGKLGVKSDIY  619

Query  581   SLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAEL  402
             SLGV+LLQ+ITA+PPMGLTHHVE+AIE GTFA +LD T+ DWPVE+AL FAKLSL C E+
Sbjct  620   SLGVLLLQVITARPPMGLTHHVEKAIESGTFAQMLDITVKDWPVEDALGFAKLSLNCTEM  679

Query  401   RKKDRPDLGSVILPELNRLKELAL  330
             R++DRPDLG+VILPELNRL+ L +
Sbjct  680   RRRDRPDLGTVILPELNRLRNLGI  703



>gb|KFK25460.1| hypothetical protein AALP_AA8G117900 [Arabis alpina]
Length=645

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/644 (61%), Positives = 492/644 (76%), Gaps = 20/644 (3%)
 Frame = -3

Query  2189  GGMSDHDG-HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSR  2013
             GG  D+D  + +F PFR Y AR+GI M E  ++DT++AKAI+ Y+N + V+N+V+G+SS+
Sbjct  9     GGSHDNDELNQLFIPFRGYCARKGISMTEVVLDDTDIAKAILDYVNNNLVNNIVVGSSSK  68

Query  2012  SAISR--KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgs  1842
             S  +R  KF  +HDV   + K  P+FCS++VISKGK QS RPA RP+TN      +    
Sbjct  69    SPFARSLKFTKSHDVAASILKATPEFCSIFVISKGKVQSSRPAQRPITNTLVPPRTPSSQ  128

Query  1841  ssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPW---------  1689
                 +   +       GD R +      ++S +  R      A GS    +         
Sbjct  129   FIHQNIADAVQDPIPRGDQRNARYPY--DNSFKAVRERNKSPALGSFDLLYDFKQANGQR  186

Query  1688  NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKL  1509
             NS  R+S ++D D+ + +    D    +QN D    S +  ++ S +++D+E+EM+RLKL
Sbjct  187   NSMGRSSFSDDADVGSLMMGSID--LGSQNFDAIGASSSSDESHSPSARDIEAEMRRLKL  244

Query  1508  ELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakcka  1329
             ELKQTMDMY++ACKEA+ AKK A EL Q K+EE++RFE+AR AEEAAL + EMEKAKC+A
Sbjct  245   ELKQTMDMYSSACKEALNAKKKANELNQWKMEEARRFEEARSAEEAALAVAEMEKAKCRA  304

Query  1328  ameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATE  1149
             A+EAAEKAQ++AE+EAQR K AEMKA++E+ EK+RAL+ L ++D RYR+YSI+EIE AT 
Sbjct  305   AIEAAEKAQRMAELEAQRRKQAEMKARRESQEKDRALNALVQNDVRYRRYSIEEIEEATL  364

Query  1148  KFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLL  969
              F+ + KIGEGGYGPVY+G LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RHPNMVLL
Sbjct  365   NFANNRKIGEGGYGPVYKGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSSIRHPNMVLL  424

Query  968   LGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPL  789
             LGACPEYGCLVYE+M+NGSLEDRL R+GN+ A+ W  RF+I+AEIATAL FLHQ+KPEPL
Sbjct  425   LGACPEYGCLVYEFMDNGSLEDRLFRRGNSQALSWRKRFQIAAEIATALSFLHQAKPEPL  484

Query  788   VHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTG  609
             VHRDLKPANIL+DRN+VSKISDVGLARLVP SVAD VTQYHMTSAAGTFCYIDPEYQQTG
Sbjct  485   VHRDLKPANILIDRNYVSKISDVGLARLVPASVADTVTQYHMTSAAGTFCYIDPEYQQTG  544

Query  608   KLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFA  429
             KL TKSD+YSLG+MLLQIITAK PMGL HHV RA++KGTF D+LDPT+ DWPV+EA++FA
Sbjct  545   KLTTKSDVYSLGIMLLQIITAKSPMGLAHHVSRALDKGTFEDMLDPTVPDWPVDEAINFA  604

Query  428   KLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQT  297
             KLSL+CAELRKKDRPDLG VI+PEL RL+ L +    +++G+Q+
Sbjct  605   KLSLKCAELRKKDRPDLGKVIVPELVRLRSLGMD---NESGSQS  645



>ref|XP_008368671.1| PREDICTED: U-box domain-containing protein 35-like [Malus domestica]
Length=752

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/734 (56%), Positives = 488/734 (66%), Gaps = 87/734 (12%)
 Frame = -3

Query  2372  ISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDA  2193
             +   G   G    VAVDKDK S  A+KW VD+LL     + LLHV    S   Q  G   
Sbjct  5     VRGHGGKRGESVAVAVDKDKGSEHAIKWAVDHLLTRGKPLTLLHVNQTGSDPQQTQG---  61

Query  2192  HGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSR  2013
                        +F  FR+  +++ I   E  I+DT++  AI+ Y+  + V  +VLG  S+
Sbjct  62    -----------LFLSFRSLCSKKNIKCNEVVIKDTDIPNAIIDYVTANTVEILVLGVPSK  110

Query  2012  SAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAA---------RPLTNLPTHI  1860
             S + R F   DVP+ V+K APDFCSVY I KGK   +R A            +   P+ I
Sbjct  111   SGLFR-FKLTDVPSTVSKGAPDFCSVYAIGKGKVSYMRCATSAPQKSAQRNQVQRQPSPI  169

Query  1859  WshhgsssrassrgssaasssAGDDRISACSSRGE------------------HSGRPFR  1734
              S   SS+    +  SA +   GD +I +  +RG                    SGRP  
Sbjct  170   -SEARSSALNRMQHYSARNQPDGDIQIKSPFARGRPSMDKSYELSPETDISFVSSGRP--  226

Query  1733  RSEDR-------------------DADGSVRRPWNSSCRNSLAEDNDLFAPIS----DGF  1623
              S DR                    +DG  R   +S  R+   +   L   +S    DG 
Sbjct  227   -SIDRMSPRCDFGVESGMNSRLSIGSDGDNRSSTSSYSRHKFLDMGSLQYEMSSCSTDGG  285

Query  1622  DNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKS  1443
              + +++QN+D                 D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK  
Sbjct  286   KSWSSSQNMD-----------------DVEAEMRRLKLELKQTMEMYSTACKEAMTAKDK  328

Query  1442  AKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkya  1263
              KE+ + K+E+ QR E AR AEEAAL +VE EKAKCKAA+EAA+ AQ+IAE+EAQ+ K A
Sbjct  329   EKEINRWKMEDEQRLEAARHAEEAALALVEREKAKCKAAIEAAKAAQRIAELEAQKRKVA  388

Query  1262  emkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLD  1083
             EMKA KE+ EKN+AL   S  D RYRKY+I EIE AT  FS++ KIGEGGYGPVYRG+LD
Sbjct  389   EMKAHKESEEKNKALQARS-YDLRYRKYTIQEIESATNDFSQARKIGEGGYGPVYRGELD  447

Query  1082  HTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLED  903
             HTPVAIKVLRPDAAQG+ QF+QEVEVLS +RHPNMVLLLGACPEYGCLVYEYM NGSLED
Sbjct  448   HTPVAIKVLRPDAAQGQSQFKQEVEVLSSIRHPNMVLLLGACPEYGCLVYEYMSNGSLED  507

Query  902   RLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISD  723
             RL R+GNTP IPW+IRF+I+AEI T LLF HQ+KPEPLVHRDLKP NILLD N+VSKISD
Sbjct  508   RLFRRGNTPVIPWQIRFRIAAEIGTGLLFFHQAKPEPLVHRDLKPGNILLDHNYVSKISD  567

Query  722   VGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAK  543
             VGLARLVPPSVA+ +TQYHMTS AGTFCYIDPEYQQTG LGTKSDIYSLGVMLLQ+ITAK
Sbjct  568   VGLARLVPPSVANSITQYHMTSTAGTFCYIDPEYQQTGMLGTKSDIYSLGVMLLQLITAK  627

Query  542   PPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVIL  363
             PPMGLTHHVERAIE GTFA +LDP + DWPVEEAL FAKL LQCAE+R+KDRPDLG V+L
Sbjct  628   PPMGLTHHVERAIETGTFAXMLDPAVPDWPVEEALKFAKLCLQCAEMRRKDRPDLGKVVL  687

Query  362   PELNRLKELALQSL  321
             PELNRL+ LA +S 
Sbjct  688   PELNRLRALADESF  701



>dbj|BAK03771.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=727

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/719 (54%), Positives = 504/719 (70%), Gaps = 34/719 (5%)
 Frame = -3

Query  2396  MDHHHHPTISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPN  2217
             + H   P    D +T     +VAVD+DKNS  A KW VD L+     + L+HVR   S  
Sbjct  9     VSHSGEPEAGKDSST-----IVAVDRDKNSQQAAKWAVDRLMARGSTLQLVHVRANQSTQ  63

Query  2216  HQNGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSN  2037
                 G    G  +D +   +F  +R Y AR+G+ + E  ++ ++++KAI+ Y   H +++
Sbjct  64    TGEAG---RGVDTDAEMSQLFISYRGYCARKGMHLNEVILDGSDISKAIIDYATGHAITD  120

Query  2036  VVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLT-------  1878
             +V+GASSR+   R+F   DVPT + K APD+C+V+VI KGK   ++ A  P         
Sbjct  121   IVVGASSRNTFIRRFRNPDVPTCLMKMAPDYCTVHVIHKGKVVQVKAAKAPAPFSTLPPK  180

Query  1877  -----NLPTHIWshhgsssrassrgssaasssAGDDRISACS---SRGEH--SGRPFRRS  1728
                  N+    ++      R  S  SS  +S    DR+S  +   +R  H  SGR   + 
Sbjct  181   QNSQPNIEPDAFARSSREWRKFSNPSSPRTSRTSVDRLSGYAKVPTRDRHLLSGRQAPQK  240

Query  1727  EDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassia  1548
             +  D    +  P  S  R+S ++D D   P+S   ++   A++L+ +  S A  ++ S A
Sbjct  241   DFDDYIDFIAPPRPSVTRSSFSDDVDF--PMSMELNSVDYAESLELS--SYASLESLSSA  296

Query  1547  SKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaa  1368
              KD+E+EM+RL+LELKQTM+MYN+ACKEA+ AK+ A +L QMK+EES+ +++ R +EE A
Sbjct  297   GKDVEAEMRRLRLELKQTMEMYNSACKEALDAKQKAAQLSQMKVEESKLYQELRSSEEEA  356

Query  1367  lRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRY  1188
             L +VEMEKAKCKAA+EAAE AQKIAE+EAQ+   AE KAK+E  E+ RA    S++D RY
Sbjct  357   LALVEMEKAKCKAALEAAEAAQKIAELEAQKRLRAEWKAKREFEERRRA----SETDLRY  412

Query  1187  RKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVE  1008
             R+YSID+IE AT KF +++KIGEGGYGPVY+  LDHT VAIK+LRPDA+QGRKQFQQE+E
Sbjct  413   RRYSIDDIEAATHKFDRALKIGEGGYGPVYKAVLDHTNVAIKILRPDASQGRKQFQQEIE  472

Query  1007  VLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIAT  828
             +LS MRHPNMVLLLGACPEYGCLVYEYM+ GSLEDRL R+GNT  IPW IRF+I+A+IAT
Sbjct  473   ILSSMRHPNMVLLLGACPEYGCLVYEYMDYGSLEDRLCRRGNTKPIPWNIRFRIAADIAT  532

Query  827   ALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAG  648
              LLFLHQ+KPEPLVHRDLKP NILLD NFVSKISDVGLARLVP S+A +VTQY MTS AG
Sbjct  533   GLLFLHQAKPEPLVHRDLKPGNILLDHNFVSKISDVGLARLVPQSIA-EVTQYRMTSTAG  591

Query  647   TFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPT  468
             TFCYIDPEYQQTG L TKSDIYS G++LLQI+TA+ PMGLTH VE AIEKG F ++LDPT
Sbjct  592   TFCYIDPEYQQTGMLTTKSDIYSFGILLLQIVTARSPMGLTHQVEHAIEKGAFQEVLDPT  651

Query  467   ISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQTFG  291
             ++DWPVEEAL F +L+L+CAELRKKDRPDLG  ILPELNRL+ L  +  A++  + + G
Sbjct  652   VTDWPVEEALVFTQLALKCAELRKKDRPDLGKEILPELNRLRTLGQEYEAAQVSSTSTG  710



>ref|NP_001046304.1| Os02g0218400 [Oryza sativa Japonica Group]
 dbj|BAD17180.1| putative serine threonine kinase [Oryza sativa Japonica Group]
 dbj|BAF08218.1| Os02g0218400 [Oryza sativa Japonica Group]
 gb|EAY85030.1| hypothetical protein OsI_06387 [Oryza sativa Indica Group]
 gb|EAZ22252.1| hypothetical protein OsJ_05907 [Oryza sativa Japonica Group]
Length=730

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/695 (56%), Positives = 497/695 (72%), Gaps = 32/695 (5%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
             TVVAVD+DKNS  AVKW VD LL     + L+HV  K   N + G        +D +   
Sbjct  25    TVVAVDRDKNSQQAVKWAVDRLLARGSVLQLVHV--KPQQNAEAG--------ADAEMQQ  74

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F  +R Y AR+G+ +KE  ++ ++++KAIV Y  ++ ++++V+GAS+R+   RKF   D
Sbjct  75    MFISYRGYCARKGMQLKEVILDGSDISKAIVEYATSNAITDIVVGASTRNTFIRKFRNPD  134

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAARP--LTNLPTHIWshhgsss----------  1836
             VPT + K  PD+C+V+VI KGK   ++ A  P   T LP   +S     S          
Sbjct  135   VPTCLMKMVPDYCTVHVIHKGKAIQVKAAKAPAPFTTLPPKQYSQSSIESDGYPRSRGDW  194

Query  1835  rassrgssaasssAGDDRISACSSRGEHSGRPF---RRSEDRDADGSV---RRPWNSSCR  1674
             +  S  SS  ++    DR+S  + +     RP    R +  +D D  +     P  S  R
Sbjct  195   KKISNQSSPKANRPSVDRLSGFA-KAPTRERPLSGARSAPPKDFDDYIDFIAPPRPSVTR  253

Query  1673  NSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQT  1494
             +S ++D D   P+S    +     +L+ +  +    ++ S A KD+E+EM+RL+LELKQT
Sbjct  254   SSFSDDVDF--PLSLELPSMDFGDSLELSLSASMSIESLSSAGKDVETEMRRLRLELKQT  311

Query  1493  MDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaa  1314
             M+MYN+ACKEAI AK+ A ++ QMK+EES+++++ R AEE AL +V+MEKAKC+AA+EAA
Sbjct  312   MEMYNSACKEAIDAKQKAAQMHQMKMEESKKYQELRNAEEEALALVQMEKAKCRAALEAA  371

Query  1313  ekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKS  1134
             E AQ+IAE+EAQ+   AE KAK+E  E+ RA   ++ +D RYR+YSID+IE AT KF K+
Sbjct  372   EAAQRIAELEAQKRLRAEWKAKREAEERKRATEAMNNTDLRYRRYSIDDIEAATHKFDKA  431

Query  1133  MKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACP  954
             +KIGEGGYGPVY+  +DHT VAIK+LRPDA+QGRKQFQQE+EVLS MRHPNMVLLLGACP
Sbjct  432   LKIGEGGYGPVYKAVMDHTNVAIKILRPDASQGRKQFQQEIEVLSCMRHPNMVLLLGACP  491

Query  953   EYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDL  774
             EYGCLVYEYM+ GSLEDRL R+G T  IPW IRF+I+A+IAT LLFLHQ+KPEPLVHRDL
Sbjct  492   EYGCLVYEYMDYGSLEDRLCRRGKTLPIPWNIRFRIAADIATGLLFLHQAKPEPLVHRDL  551

Query  773   KPANILLDRNFVSKISDVGLARLVPPS-VADDVTQYHMTSAAGTFCYIDPEYQQTGKLGT  597
             KPANILLD NFVSKISDVGLARLVP S  A + TQY MTS AGTFCYIDPEYQQTG L T
Sbjct  552   KPANILLDHNFVSKISDVGLARLVPQSAAAAEATQYRMTSTAGTFCYIDPEYQQTGMLTT  611

Query  596   KSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSL  417
              SDIYSLG++LLQIITA+ PMGLTHHVE AIE+GTF ++LDP ++DWPVEEAL FAKL+L
Sbjct  612   MSDIYSLGILLLQIITARSPMGLTHHVESAIERGTFQEVLDPMVTDWPVEEALVFAKLAL  671

Query  416   QCAELRKKDRPDLGSVILPELNRLKELALQSLASK  312
             +CAELRKKDRPDLG  ILPELNRL+ L+ +  ASK
Sbjct  672   RCAELRKKDRPDLGKEILPELNRLRCLSQEYDASK  706



>ref|XP_007137134.1| hypothetical protein PHAVU_009G102500g [Phaseolus vulgaris]
 gb|ESW09128.1| hypothetical protein PHAVU_009G102500g [Phaseolus vulgaris]
Length=775

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/721 (54%), Positives = 496/721 (69%), Gaps = 57/721 (8%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKA---SPNHQNGGPDAHGGMSD-  2175
             +  VA+DK K S +A+KW VDNLL+ +  VIL+HV+  A   SP+     P     + D 
Sbjct  17    LVAVAIDKKKGSQTALKWAVDNLLMRSATVILIHVKLLAPTLSPSPSLFVPRISAFLGDD  76

Query  2174  -----HDGHC----VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
                   +  C    +F P+R +  R+ I  K+  +ED++V+KAI  Y +   + ++VLG+
Sbjct  77    SSVVGKEHECQNKNLFLPYRVFCTRKDIHCKDVQLEDSDVSKAITEYASQTGIEHLVLGS  136

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR-PLTNLPTHIWshhg  1845
             S+++++  KF   D+P  ++K APDFC+VYVI+KGK Q++R A R P T  P  ++    
Sbjct  137   SAKTSL-LKFKVSDIPGEISKGAPDFCTVYVIAKGKIQTMRSATRQPPTIFPNLVYQGSV  195

Query  1844  sssra-----------ssrgssaasssAGDDRISACSSRGEHSGRPF-------------  1737
              S+ +             +  S  S+S  D+   +  +R  ++GR +             
Sbjct  196   RSNISDPNMHSDPNIKEEQSHSFDSASQYDESFRSPFTRKHYNGRHYGDTPNSDMDISFV  255

Query  1736  ---RRSEDR-----DADGSVRRPWNSSCRNSLAEDNDL---FAPISDGFDNAAAAQNLDF  1590
                R+S DR     + D  +  P     R S + D D    F  I  G  +       +F
Sbjct  256   STGRKSTDRLIPSLNLDTGISNP-----RLSYSSDTDANLSFESIHYGRKSPELNSPNEF  310

Query  1589  TRisdag--sdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKI  1416
             T  S        +S A+ D+E+EM+RLKLELKQTM+MYN ACKEA+TA + A ELQQ KI
Sbjct  311   TSFSFESDNQSFTSQATDDMEAEMRRLKLELKQTMEMYNTACKEALTAHQKAVELQQWKI  370

Query  1415  eesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketa  1236
             EE  R E+A+ A + A+ M E EKAK KAA+E AE  ++IAE+E+Q+   AEMKA +E+ 
Sbjct  371   EEEMRMEEAKLAGKKAMAMAEKEKAKSKAAIETAEAQKRIAELESQKRLVAEMKAIRESE  430

Query  1235  eKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVL  1056
             EK + L  L   D RYRKY+I+EIE AT  FS+S+KIGEGGYGPV++  LDHTPVA+KVL
Sbjct  431   EKRKVLDALVNVDIRYRKYTIEEIEEATNFFSESLKIGEGGYGPVFKCHLDHTPVAVKVL  490

Query  1055  RPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTP  876
             RPDA QGR QFQ+EVEVLS +RHPNMVLLLGACPEYGCLVYEYM NGSL++ L RKGNTP
Sbjct  491   RPDAQQGRSQFQREVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDNCLFRKGNTP  550

Query  875   AIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPP  696
              +PW++RFKI+AEI T LLFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPP
Sbjct  551   PLPWQLRFKIAAEIGTGLLFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPP  610

Query  695   SVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHV  516
             SVAD VTQYHMTSAAGTFCYIDPEYQQTG LG KSDIYSLG++ LQ++TAK PMGLTHHV
Sbjct  611   SVADTVTQYHMTSAAGTFCYIDPEYQQTGMLGVKSDIYSLGIIFLQLLTAKAPMGLTHHV  670

Query  515   ERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKEL  336
             ERAIEKGT  ++LDP++SDWP EEAL FAKL++QCAELR+KDRPDLG VILPEL+RL+ L
Sbjct  671   ERAIEKGTLDEILDPSLSDWPQEEALKFAKLAVQCAELRRKDRPDLGKVILPELHRLRNL  730

Query  335   A  333
             A
Sbjct  731   A  731



>ref|XP_008654459.1| PREDICTED: uncharacterized protein LOC100216601 isoform X4 [Zea 
mays]
Length=753

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/703 (55%), Positives = 496/703 (71%), Gaps = 28/703 (4%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             VVA+D+D+NS  AVKW VD+LL     ++LLHV       H     +   G  + +   +
Sbjct  28    VVAIDRDRNSQLAVKWVVDHLLSGASHIVLLHVAVHYHTTHGFAMVETTQGALEAEMKEI  87

Query  2156  FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDV  1977
             F P+R +  R G+ + E  +E+ +V+KAI+GYI  +++ ++ LG ++R+A ++KF   DV
Sbjct  88    FVPYRGFFNRNGVEVSEVVLEEADVSKAILGYITANKIQSIALGGANRNAFTKKFKNADV  147

Query  1976  PTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaasss  1797
             P+ + K APD+C++YV++KGK  ++R A   +  + T       + S   S       S 
Sbjct  148   PSTLMKCAPDYCNIYVVAKGKSVNVRLAKCGVPPMHTGADIASDTDSLRESVLYMRRGSR  207

Query  1796  AGDDRISACSSRG-------EHSGRPFRRSEDRDADGSVRR--------PWNSSCR----  1674
                 R++  + R        E S RP  R     +  + +          + +S R    
Sbjct  208   GHLPRVTPDAWRSIDGRTPPELSTRPLFRERLLSSSATTKNFVVLPGKDNFETSSRSARH  267

Query  1673  NSLAEDNDLFAPISDGFDNAAAAQNLDF--TRisdagsdassiaSKDLESEMKRLKLELK  1500
             +SL  D D F P S  F      +NLD   T  +      ++ A +D E+EM+RL+LELK
Sbjct  268   DSLGGDLD-FGP-STRFSYIDLGENLDMSTTLPALEPMSPATGAQRDTEAEMRRLRLELK  325

Query  1499  QTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaame  1320
             QTMDMYN ACKEAI AK+ AKE+  MK+EE++R E+AR AEEAAL + EMEKAKC+AAME
Sbjct  326   QTMDMYNAACKEAINAKQRAKEMHMMKLEEARRLEEARNAEEAALAVAEMEKAKCRAAME  385

Query  1319  aaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFS  1140
             AAE AQ++A++EAQR + AE++A++E  EK RAL  +S  D RYRKY IDEIE ATE+FS
Sbjct  386   AAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAISNHDFRYRKYHIDEIEMATERFS  445

Query  1139  KSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGA  960
               +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQF QEVEVLS +RHPNMVLLLGA
Sbjct  446   DELKIGEGGYGPVYRASLDHTPVAIKVLRPDAHQGRKQFLQEVEVLSCIRHPNMVLLLGA  505

Query  959   CPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHR  780
             CPEYGCLVYEYM++GSLEDRL R+G TP + W  RF+I+AEIATALLFLHQ+KPEPLVHR
Sbjct  506   CPEYGCLVYEYMDHGSLEDRLFRRGGTPPLAWAQRFRIAAEIATALLFLHQTKPEPLVHR  565

Query  779   DLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLG  600
             DLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY +T+ AGTFCYIDPEYQQTGKLG
Sbjct  566   DLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRLTATAGTFCYIDPEYQQTGKLG  625

Query  599   TKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLS  420
              KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTF  +LD T+ DWPVEEAL +AKL+
Sbjct  626   VKSDIYSLGVLLLQVVTARPPMGLTHHVEKAIDAGTFEQMLDITVKDWPVEEALGYAKLA  685

Query  419   LQCAELRKKDRPDLGSVILPELNRLKEL-----ALQSLASKNG  306
             L+C E+R++DRPDL +VILPELNRL+ L     A  S A  NG
Sbjct  686   LKCTEMRRRDRPDLATVILPELNRLRNLGHAYEARMSAARANG  728



>ref|XP_004951440.1| PREDICTED: U-box domain-containing protein 52-like [Setaria italica]
Length=721

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/693 (55%), Positives = 495/693 (71%), Gaps = 35/693 (5%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             +VAVD+DKNS  A KW VD LL     + L+HVR +A       G D       H    +
Sbjct  26    IVAVDRDKNSQQAAKWAVDKLLSRGSTLQLVHVRAEA-------GKDEGDAEITH----L  74

Query  2156  FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDV  1977
             F  +R Y AR+G+ +KE  ++  +++K I+ Y  ++ ++++V+GAS+++   R+F   DV
Sbjct  75    FISYRGYCARKGMHLKEVILDGNDISKEIIDYATSNAITDIVVGASTKNTFIRRFRNPDV  134

Query  1976  PTIVNKTAPDFCSVYVISKGKQQSIRPAARPLT------------NLPTHIWshhgsssr  1833
             PT + K APD+C+V+VI K K   ++ A  P              N+ + +        R
Sbjct  135   PTCLMKMAPDYCTVHVIHKAKAIQVKAAKAPAPFSTLPPKQYSQPNIESDVSRASRGDWR  194

Query  1832  assrgssaasssAGDDRISACSSRGEHSGRPF---RRSEDRDADGSV---RRPWNSSCRN  1671
              +S  SS  ++    DR+SA  ++     RP    R +  +D D  +     P  S  R+
Sbjct  195   KTSHTSSPVANRNSVDRLSA-YAKAPSRDRPLSGARTAPQKDFDDYIDFIAPPRPSVTRS  253

Query  1670  SLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTM  1491
             S ++D DL  P+S    +   A +++ +  S    ++ S A KD+E+EM+RL+LELKQTM
Sbjct  254   SFSDDIDL--PMSMELPSIDFADSMELS--SAMSMESLSYAGKDVETEMRRLRLELKQTM  309

Query  1490  DMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaae  1311
             +MYN+ACKEAI AK+ A ++ QMK+EES++F++ R AEE AL +V+MEKAKC+AA+EAAE
Sbjct  310   EMYNSACKEAIDAKQKAAQMHQMKVEESKKFQELRNAEEEALALVQMEKAKCRAALEAAE  369

Query  1310  kaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSM  1131
              AQKIAE+EAQ+   AE KAK+E  ++ +A   L+++D RYR+YSID+IE AT KF K++
Sbjct  370   AAQKIAELEAQKRLRAEWKAKREAEDRKKATDALNRNDLRYRRYSIDDIEAATHKFDKAL  429

Query  1130  KIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPE  951
             KIGEGGYGPVY+  LDHT VAIK+LRPDA+QGRKQFQQE+EVLS MRHPNMVLLLGACPE
Sbjct  430   KIGEGGYGPVYKAVLDHTNVAIKILRPDASQGRKQFQQEIEVLSCMRHPNMVLLLGACPE  489

Query  950   YGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLK  771
             YGCLVYEYM+ GSLEDRL R+G T  IPW IRF+I+A+IAT LLFLHQ+KPEPLVHRDLK
Sbjct  490   YGCLVYEYMDYGSLEDRLCRRGKTLPIPWSIRFRIAADIATGLLFLHQAKPEPLVHRDLK  549

Query  770   PANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKS  591
             PANILLD NFVSKISDVGLARLVP S A DVTQY MTS AGTFCYIDPEYQQTG L T S
Sbjct  550   PANILLDHNFVSKISDVGLARLVPQSAA-DVTQYRMTSTAGTFCYIDPEYQQTGMLTTMS  608

Query  590   DIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQC  411
             DIYSLG+MLLQIITA+ PMGLTHHVE AIE+GTF ++LDP ++DWPVEEA+ FAKL+L+C
Sbjct  609   DIYSLGIMLLQIITARSPMGLTHHVENAIERGTFQEILDPMVTDWPVEEAMEFAKLALRC  668

Query  410   AELRKKDRPDLGSVILPELNRLKELALQSLASK  312
             AELRKKDRPDLG  ILPELNRL+ L  +  A++
Sbjct  669   AELRKKDRPDLGKEILPELNRLRNLGHEYEAAQ  701



>ref|XP_006647075.1| PREDICTED: U-box domain-containing protein 52-like [Oryza brachyantha]
Length=732

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/699 (55%), Positives = 489/699 (70%), Gaps = 51/699 (7%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
             T+VAVD+DKNS  A KW VD LL     + L+HVR   +     GG D     +D +   
Sbjct  27    TLVAVDRDKNSQQAAKWAVDRLLARGSVLQLVHVRPTQNAEAGRGGKDE----ADAEMQQ  82

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F  +R Y AR+G+ +KE  ++  +++KAIV Y  ++ +++VV+GAS+R+   RKF + D
Sbjct  83    MFISYRGYCARKGMQLKEVILDGADISKAIVDYATSNAITDVVVGASTRNTFIRKFRSPD  142

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAA--RPLTNLPTHIWshhgsssrassrgssaa  1806
             VPT + K  PD+C+V+VI KGK   ++ A    P T LP   +S     S   +R     
Sbjct  143   VPTCLMKMVPDYCTVHVIHKGKAIQVKAAKGPAPFTTLPPKQYSQSSIDSDGYARSR---  199

Query  1805  sssAGD-DRISACSSRGEHSGRPF---------RRSEDRDADGS--------------VR  1698
                 GD  +IS  SS    + RP            S DR   G+              + 
Sbjct  200   ----GDWKKISHQSS--PKANRPLVDRLPGIGKAPSRDRPLSGARTAPPKDFDDYIDFIA  253

Query  1697  RPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdas----siaSKDLES  1530
              P  S  R+S ++D D        F+ +    ++DF    +  +  S    S A KD+E+
Sbjct  254   PPRPSVTRSSFSDDVD--------FNMSMELPSMDFVDSMELSASMSMESLSSAGKDVET  305

Query  1529  EMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVem  1350
             EMKRL+LELKQTM+MYN+ACKEAI AK  A ++ QMK+EES+++++ R AEE AL +V+M
Sbjct  306   EMKRLRLELKQTMEMYNSACKEAIDAKNKAAQMHQMKVEESKKYQELRNAEEEALALVQM  365

Query  1349  ekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSID  1170
             EKAKC+AA+EAAE AQ+IAE+EAQ+   AE KAK+E  E+ RA   ++ +D RYR+YSID
Sbjct  366   EKAKCRAALEAAEAAQRIAELEAQKRLRAEWKAKREAEERTRATDAMNNTDLRYRRYSID  425

Query  1169  EIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMR  990
             +IE AT KF +++KIGEGGYGPVY+  +DHT VAIK+LRPDA+QGRKQFQQE+EVLS MR
Sbjct  426   DIEAATHKFDRALKIGEGGYGPVYKAVMDHTNVAIKILRPDASQGRKQFQQEIEVLSCMR  485

Query  989   HPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLH  810
             HPNMVLLLGACPEYGCLVYEYM+ G LEDRL R+GNT  IPW IRF+I+A+IAT LLFLH
Sbjct  486   HPNMVLLLGACPEYGCLVYEYMDYGGLEDRLCRRGNTLPIPWNIRFRIAADIATGLLFLH  545

Query  809   QSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYID  630
             Q+KPEPLVHRDLKPANILLD NFVSKISDVGLARLVP + A + TQY MTS AGTFCYID
Sbjct  546   QAKPEPLVHRDLKPANILLDHNFVSKISDVGLARLVPAAAAAEATQYRMTSTAGTFCYID  605

Query  629   PEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPV  450
             PEYQQTG L TKSDIYSLG++LLQI+TA+ PMGLTHHVE AIE+G F ++LDPT++DWPV
Sbjct  606   PEYQQTGMLTTKSDIYSLGILLLQIVTARSPMGLTHHVESAIERGAFQEVLDPTVTDWPV  665

Query  449   EEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             E+A+ FA+L+L+CAELRKKDRPDLG  ILPELNRL+ L 
Sbjct  666   EDAMAFARLALRCAELRKKDRPDLGKEILPELNRLRCLG  704



>ref|XP_008654456.1| PREDICTED: uncharacterized protein LOC100216601 isoform X1 [Zea 
mays]
Length=756

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/706 (55%), Positives = 496/706 (70%), Gaps = 31/706 (4%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             VVA+D+D+NS  AVKW VD+LL     ++LLHV       H     +   G  + +   +
Sbjct  28    VVAIDRDRNSQLAVKWVVDHLLSGASHIVLLHVAVHYHTTHGFAMVETTQGALEAEMKEI  87

Query  2156  FTPFRAYSARRGI---IMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
             F P+R +  R G+    + E  +E+ +V+KAI+GYI  +++ ++ LG ++R+A ++KF  
Sbjct  88    FVPYRGFFNRNGVNQVEVSEVVLEEADVSKAILGYITANKIQSIALGGANRNAFTKKFKN  147

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaa  1806
              DVP+ + K APD+C++YV++KGK  ++R A   +  + T       + S   S      
Sbjct  148   ADVPSTLMKCAPDYCNIYVVAKGKSVNVRLAKCGVPPMHTGADIASDTDSLRESVLYMRR  207

Query  1805  sssAGDDRISACSSRG-------EHSGRPFRRSEDRDADGSVRR--------PWNSSCR-  1674
              S     R++  + R        E S RP  R     +  + +          + +S R 
Sbjct  208   GSRGHLPRVTPDAWRSIDGRTPPELSTRPLFRERLLSSSATTKNFVVLPGKDNFETSSRS  267

Query  1673  ---NSLAEDNDLFAPISDGFDNAAAAQNLDF--TRisdagsdassiaSKDLESEMKRLKL  1509
                +SL  D D F P S  F      +NLD   T  +      ++ A +D E+EM+RL+L
Sbjct  268   ARHDSLGGDLD-FGP-STRFSYIDLGENLDMSTTLPALEPMSPATGAQRDTEAEMRRLRL  325

Query  1508  ELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakcka  1329
             ELKQTMDMYN ACKEAI AK+ AKE+  MK+EE++R E+AR AEEAAL + EMEKAKC+A
Sbjct  326   ELKQTMDMYNAACKEAINAKQRAKEMHMMKLEEARRLEEARNAEEAALAVAEMEKAKCRA  385

Query  1328  ameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATE  1149
             AMEAAE AQ++A++EAQR + AE++A++E  EK RAL  +S  D RYRKY IDEIE ATE
Sbjct  386   AMEAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAISNHDFRYRKYHIDEIEMATE  445

Query  1148  KFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLL  969
             +FS  +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQF QEVEVLS +RHPNMVLL
Sbjct  446   RFSDELKIGEGGYGPVYRASLDHTPVAIKVLRPDAHQGRKQFLQEVEVLSCIRHPNMVLL  505

Query  968   LGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPL  789
             LGACPEYGCLVYEYM++GSLEDRL R+G TP + W  RF+I+AEIATALLFLHQ+KPEPL
Sbjct  506   LGACPEYGCLVYEYMDHGSLEDRLFRRGGTPPLAWAQRFRIAAEIATALLFLHQTKPEPL  565

Query  788   VHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTG  609
             VHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY +T+ AGTFCYIDPEYQQTG
Sbjct  566   VHRDLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRLTATAGTFCYIDPEYQQTG  625

Query  608   KLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFA  429
             KLG KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTF  +LD T+ DWPVEEAL +A
Sbjct  626   KLGVKSDIYSLGVLLLQVVTARPPMGLTHHVEKAIDAGTFEQMLDITVKDWPVEEALGYA  685

Query  428   KLSLQCAELRKKDRPDLGSVILPELNRLKEL-----ALQSLASKNG  306
             KL+L+C E+R++DRPDL +VILPELNRL+ L     A  S A  NG
Sbjct  686   KLALKCTEMRRRDRPDLATVILPELNRLRNLGHAYEARMSAARANG  731



>ref|XP_002453538.1| hypothetical protein SORBIDRAFT_04g007620 [Sorghum bicolor]
 gb|EES06514.1| hypothetical protein SORBIDRAFT_04g007620 [Sorghum bicolor]
Length=725

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/686 (56%), Positives = 486/686 (71%), Gaps = 34/686 (5%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             +VAVD+DKNS  A KW VD LL     + L+HVR +    +++ G +            +
Sbjct  26    IVAVDRDKNSQQAAKWAVDRLLTRGSMLQLVHVRAQEIEANKDEGDEITQ---------L  76

Query  2156  FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDV  1977
             F  +R Y AR+G+ +KE  ++ ++++KAI+ Y  T+ ++++V+GAS+++   R+F   DV
Sbjct  77    FISYRGYCARKGMHLKELILDGSDISKAIIDYATTNAITDIVVGASTKNTFIRRFRNPDV  136

Query  1976  PTIVNKTAPDFCSVYVISKGKQQSIRPAARP--LTNLP--THIWshhgsssrassrgssa  1809
             PT + K APD+C+V+VI K K   ++ A  P   T LP   H   +  S +  +SRG   
Sbjct  137   PTCLMKMAPDYCTVHVIHKAKAIQVKAAKAPAPFTTLPPKQHSQPNIESDASRASRGDWK  196

Query  1808  asssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAP---  1638
              +S       S+ +S    S      S DR   G+   P     +    +  D  AP   
Sbjct  197   KTSHTSSPLASSRNSVDRLSAYAKAPSRDRPLTGAKTAP-----QKDFDDYIDFIAPPRP  251

Query  1637  ------ISDGFDNAAAAQ--NLDFTRisdagsdassiaS----KDLESEMKRLKLELKQT  1494
                    SD  D A + +  ++DF    +  S  S  +     KD+E+EM+RL+LELKQT
Sbjct  252   SVTRSSFSDDIDFAMSMELPSIDFGESLELSSAMSMESLSCSGKDVEAEMRRLRLELKQT  311

Query  1493  MDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaa  1314
             M+MYN+ACKEAI AK  A ++ QMK+EES+++++ R AEE AL +VEMEKAKC+AA+EAA
Sbjct  312   MEMYNSACKEAIDAKHKAAQMHQMKVEESKKYQELRNAEEEALALVEMEKAKCRAALEAA  371

Query  1313  ekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKS  1134
             E AQKIAE+EAQ+   AE KAK+E  ++ +A   L+K+D RYR+YSID+IE AT KF K+
Sbjct  372   EAAQKIAELEAQKRLRAEWKAKREAEDRKKATDALNKNDIRYRRYSIDDIEAATHKFDKA  431

Query  1133  MKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACP  954
             +KIGEGGYGPVY+  LDHT VAIK+LRPDA+QGRKQFQQE+EVLS MRHPNMVLLLGACP
Sbjct  432   LKIGEGGYGPVYKAVLDHTNVAIKILRPDASQGRKQFQQEIEVLSCMRHPNMVLLLGACP  491

Query  953   EYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDL  774
             EYGCLVYEYM+ GSLEDRL R+G T  IPW IRF+I+A+IAT LLFLHQ+KPEPLVHRDL
Sbjct  492   EYGCLVYEYMDYGSLEDRLCRRGKTLPIPWSIRFRIAADIATGLLFLHQAKPEPLVHRDL  551

Query  773   KPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTK  594
             KPANILLD NFVSKISDVGLARLVP S A DVTQY MTS AGTFCYIDPEYQQTG L TK
Sbjct  552   KPANILLDHNFVSKISDVGLARLVPQSAA-DVTQYRMTSTAGTFCYIDPEYQQTGMLTTK  610

Query  593   SDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQ  414
             SDIYSLG+MLLQIITA+ PMGLTHHVE AIE+G F ++LDPT++DWPVEEAL FAKL+L+
Sbjct  611   SDIYSLGIMLLQIITARSPMGLTHHVENAIERGAFQEILDPTVTDWPVEEALEFAKLALR  670

Query  413   CAELRKKDRPDLGSVILPELNRLKEL  336
             CAELRKKDRPDLG  ILPEL RL+ L
Sbjct  671   CAELRKKDRPDLGKEILPELTRLRNL  696



>ref|XP_008654458.1| PREDICTED: uncharacterized protein LOC100216601 isoform X3 [Zea 
mays]
Length=754

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/704 (55%), Positives = 496/704 (70%), Gaps = 29/704 (4%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             VVA+D+D+NS  AVKW VD+LL     ++LLHV       H     +   G  + +   +
Sbjct  28    VVAIDRDRNSQLAVKWVVDHLLSGASHIVLLHVAVHYHTTHGFAMVETTQGALEAEMKEI  87

Query  2156  FTPFRAYSARRG-IIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             F P+R +  R G + + E  +E+ +V+KAI+GYI  +++ ++ LG ++R+A ++KF   D
Sbjct  88    FVPYRGFFNRNGQVEVSEVVLEEADVSKAILGYITANKIQSIALGGANRNAFTKKFKNAD  147

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaass  1800
             VP+ + K APD+C++YV++KGK  ++R A   +  + T       + S   S       S
Sbjct  148   VPSTLMKCAPDYCNIYVVAKGKSVNVRLAKCGVPPMHTGADIASDTDSLRESVLYMRRGS  207

Query  1799  sAGDDRISACSSRG-------EHSGRPFRRSEDRDADGSVRR--------PWNSSCR---  1674
                  R++  + R        E S RP  R     +  + +          + +S R   
Sbjct  208   RGHLPRVTPDAWRSIDGRTPPELSTRPLFRERLLSSSATTKNFVVLPGKDNFETSSRSAR  267

Query  1673  -NSLAEDNDLFAPISDGFDNAAAAQNLDF--TRisdagsdassiaSKDLESEMKRLKLEL  1503
              +SL  D D F P S  F      +NLD   T  +      ++ A +D E+EM+RL+LEL
Sbjct  268   HDSLGGDLD-FGP-STRFSYIDLGENLDMSTTLPALEPMSPATGAQRDTEAEMRRLRLEL  325

Query  1502  KQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaam  1323
             KQTMDMYN ACKEAI AK+ AKE+  MK+EE++R E+AR AEEAAL + EMEKAKC+AAM
Sbjct  326   KQTMDMYNAACKEAINAKQRAKEMHMMKLEEARRLEEARNAEEAALAVAEMEKAKCRAAM  385

Query  1322  eaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKF  1143
             EAAE AQ++A++EAQR + AE++A++E  EK RAL  +S  D RYRKY IDEIE ATE+F
Sbjct  386   EAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAISNHDFRYRKYHIDEIEMATERF  445

Query  1142  SKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLG  963
             S  +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQF QEVEVLS +RHPNMVLLLG
Sbjct  446   SDELKIGEGGYGPVYRASLDHTPVAIKVLRPDAHQGRKQFLQEVEVLSCIRHPNMVLLLG  505

Query  962   ACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVH  783
             ACPEYGCLVYEYM++GSLEDRL R+G TP + W  RF+I+AEIATALLFLHQ+KPEPLVH
Sbjct  506   ACPEYGCLVYEYMDHGSLEDRLFRRGGTPPLAWAQRFRIAAEIATALLFLHQTKPEPLVH  565

Query  782   RDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKL  603
             RDLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY +T+ AGTFCYIDPEYQQTGKL
Sbjct  566   RDLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRLTATAGTFCYIDPEYQQTGKL  625

Query  602   GTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKL  423
             G KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTF  +LD T+ DWPVEEAL +AKL
Sbjct  626   GVKSDIYSLGVLLLQVVTARPPMGLTHHVEKAIDAGTFEQMLDITVKDWPVEEALGYAKL  685

Query  422   SLQCAELRKKDRPDLGSVILPELNRLKEL-----ALQSLASKNG  306
             +L+C E+R++DRPDL +VILPELNRL+ L     A  S A  NG
Sbjct  686   ALKCTEMRRRDRPDLATVILPELNRLRNLGHAYEARMSAARANG  729



>ref|XP_008654457.1| PREDICTED: uncharacterized protein LOC100216601 isoform X2 [Zea 
mays]
 gb|AFW83076.1| lycopene epsilon cyclase1 [Zea mays]
Length=755

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/705 (55%), Positives = 494/705 (70%), Gaps = 30/705 (4%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             VVA+D+D+NS  AVKW VD+LL     ++LLHV       H     +   G  + +   +
Sbjct  28    VVAIDRDRNSQLAVKWVVDHLLSGASHIVLLHVAVHYHTTHGFAMVETTQGALEAEMKEI  87

Query  2156  FTPFRAYSARRGIIMKEDFIED--TEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTH  1983
             F P+R +  R G+ ++   +     +V+KAI+GYI  +++ ++ LG ++R+A ++KF   
Sbjct  88    FVPYRGFFNRNGVNVEVSEVVLEEADVSKAILGYITANKIQSIALGGANRNAFTKKFKNA  147

Query  1982  DVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaas  1803
             DVP+ + K APD+C++YV++KGK  ++R A   +  + T       + S   S       
Sbjct  148   DVPSTLMKCAPDYCNIYVVAKGKSVNVRLAKCGVPPMHTGADIASDTDSLRESVLYMRRG  207

Query  1802  ssAGDDRISACSSRG-------EHSGRPFRRSEDRDADGSVRR--------PWNSSCR--  1674
             S     R++  + R        E S RP  R     +  + +          + +S R  
Sbjct  208   SRGHLPRVTPDAWRSIDGRTPPELSTRPLFRERLLSSSATTKNFVVLPGKDNFETSSRSA  267

Query  1673  --NSLAEDNDLFAPISDGFDNAAAAQNLDF--TRisdagsdassiaSKDLESEMKRLKLE  1506
               +SL  D D F P S  F      +NLD   T  +      ++ A +D E+EM+RL+LE
Sbjct  268   RHDSLGGDLD-FGP-STRFSYIDLGENLDMSTTLPALEPMSPATGAQRDTEAEMRRLRLE  325

Query  1505  LKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaa  1326
             LKQTMDMYN ACKEAI AK+ AKE+  MK+EE++R E+AR AEEAAL + EMEKAKC+AA
Sbjct  326   LKQTMDMYNAACKEAINAKQRAKEMHMMKLEEARRLEEARNAEEAALAVAEMEKAKCRAA  385

Query  1325  meaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEK  1146
             MEAAE AQ++A++EAQR + AE++A++E  EK RAL  +S  D RYRKY IDEIE ATE+
Sbjct  386   MEAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAISNHDFRYRKYHIDEIEMATER  445

Query  1145  FSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLL  966
             FS  +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQF QEVEVLS +RHPNMVLLL
Sbjct  446   FSDELKIGEGGYGPVYRASLDHTPVAIKVLRPDAHQGRKQFLQEVEVLSCIRHPNMVLLL  505

Query  965   GACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLV  786
             GACPEYGCLVYEYM++GSLEDRL R+G TP + W  RF+I+AEIATALLFLHQ+KPEPLV
Sbjct  506   GACPEYGCLVYEYMDHGSLEDRLFRRGGTPPLAWAQRFRIAAEIATALLFLHQTKPEPLV  565

Query  785   HRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGK  606
             HRDLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY +T+ AGTFCYIDPEYQQTGK
Sbjct  566   HRDLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRLTATAGTFCYIDPEYQQTGK  625

Query  605   LGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAK  426
             LG KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTF  +LD T+ DWPVEEAL +AK
Sbjct  626   LGVKSDIYSLGVLLLQVVTARPPMGLTHHVEKAIDAGTFEQMLDITVKDWPVEEALGYAK  685

Query  425   LSLQCAELRKKDRPDLGSVILPELNRLKEL-----ALQSLASKNG  306
             L+L+C E+R++DRPDL +VILPELNRL+ L     A  S A  NG
Sbjct  686   LALKCTEMRRRDRPDLATVILPELNRLRNLGHAYEARMSAARANG  730



>gb|KCW80744.1| hypothetical protein EUGRSUZ_C02137 [Eucalyptus grandis]
Length=732

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/688 (57%), Positives = 483/688 (70%), Gaps = 29/688 (4%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGH  2163
             +  VA+DKDK S +A+KWT+DNLL     VIL+HV+ K+ P    G    H    + D  
Sbjct  16    LVAVAIDKDKGSQNALKWTIDNLLQRGQVVILVHVKVKSLPTAPLGSSPRH----ELDPK  71

Query  2162  CVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTH  1983
              +F PFR +  R+ I  K+  +EDT+VAKA++ Y++ + + N+VLG+SS+S   R F   
Sbjct  72    ELFLPFRCFCTRKDIQCKDILLEDTDVAKALIEYVSHNSIENLVLGSSSKSGFLRTFKAT  131

Query  1982  DVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPL---TNLPTHIWshhgsssrassrgss  1812
             DVP+ V K APDFC+VYVI+KGK  ++R A RP    + L   I +     +  S     
Sbjct  132   DVPSSVAKGAPDFCTVYVITKGKITTMRSATRPAPMASPLSNQIHNQLVPRAHQSEPRVP  191

Query  1811  aasssAGDD------RISACSSRGEHS-GRPFRRSEDRDADGSVRRPWNSSCRNSLAEDN  1653
               +S  G+       R  +  +RG+ S GR +      D D S    + SS R S+   +
Sbjct  192   QTNSIRGERFCTLNLRFLSPFTRGKGSNGRLYGEVGTPDTDIS----FVSSGRQSV---D  244

Query  1652  DLFAPISDGFDNAAAAQ-----NLDFTR---isdagsdassiaSKDLESEMKRLKLELKQ  1497
              +F    D  D   + +     N D+ +    +     +   +  D+E+EMKRLK ELKQ
Sbjct  245   RMFPSFYDNLDGGYSPRLSNTSNTDYRQGFDAALLAQRSVDSSIDDVEAEMKRLKQELKQ  304

Query  1496  TMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaamea  1317
             TM+MY+ ACK+A++AK+ A ELQ  K+EE +R E+AR AEEAAL + E EKAK KAAMEA
Sbjct  305   TMEMYSKACKDALSAKQKAIELQHWKLEEERRVEEARLAEEAALALAEKEKAKSKAAMEA  364

Query  1316  aekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSK  1137
             AE AQ+IAE+EAQ+   AEMKA KE  EK + L  L++SD RYR+YSI+EIE ATE F +
Sbjct  365   AEAAQRIAELEAQKRINAEMKAIKEAEEKKKVLDALAQSDVRYRRYSIEEIENATEFFLE  424

Query  1136  SMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGAC  957
             S KIGEGGYGPVY+  LDHT VAIKVLRPDAAQGR QF QEVEVLS +RHPNMVLLLGAC
Sbjct  425   SRKIGEGGYGPVYKCYLDHTLVAIKVLRPDAAQGRSQFLQEVEVLSCIRHPNMVLLLGAC  484

Query  956   PEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRD  777
             PEYGCLVYE+M NGSL+DRL  +GNT  + W++RFKI+A I T LLFLHQ+KPEPLVHRD
Sbjct  485   PEYGCLVYEFMANGSLDDRLFCRGNTRPLSWQLRFKIAAGIGTGLLFLHQAKPEPLVHRD  544

Query  776   LKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGT  597
             LKP NILLD NFV KISDVGLARLVPPSVAD VTQY MTS AGTFCYIDPEYQQTG LG 
Sbjct  545   LKPGNILLDSNFVCKISDVGLARLVPPSVADSVTQYRMTSTAGTFCYIDPEYQQTGMLGV  604

Query  596   KSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSL  417
             KSDIYSLG++ LQ++TAKPPMGLTHHVERAIE GTFA++LDP + DWP  EAL FA+++L
Sbjct  605   KSDIYSLGIIFLQLLTAKPPMGLTHHVERAIENGTFAEMLDPAVPDWPYNEALAFAQMAL  664

Query  416   QCAELRKKDRPDLGSVILPELNRLKELA  333
             +C+ELR+KDRPDL  VILPEL+RLK LA
Sbjct  665   KCSELRRKDRPDLAKVILPELDRLKALA  692



>ref|XP_010519837.1| PREDICTED: U-box domain-containing protein 51 isoform X2 [Tarenaya 
hassleriana]
Length=694

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/630 (60%), Positives = 481/630 (76%), Gaps = 21/630 (3%)
 Frame = -3

Query  2177  DHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISR  1998
             + D   +F P+R Y AR+GI + E  +EDT++AKA++ Y+N + ++++VLG SS++  +R
Sbjct  19    NEDMSNLFVPYRGYCARKGIRLTEVVLEDTDIAKAVLDYVNKNLINSLVLGGSSKNPFAR  78

Query  1997  --KFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN------LPT--HIWsh  1851
               KF  +HDV   V K+AP+FCSVYVISKGK Q+ + A RP++N      +P+  ++   
Sbjct  79    SLKFSKSHDVQANVLKSAPEFCSVYVISKGKIQTAKTAQRPISNTAAPPRVPSSGYVLQS  138

Query  1850  hgsssrassrgssaasssAGDDRI---SACSSRGEHSGRPFRRSEDRDADGSVR-RPWNS  1683
                S +           +   +R    +   +  E    P   S D + D +      N+
Sbjct  139   LSDSEQDEGSRRQRNLRNMAQERYPHDNTTKAIQERHKSPTGGSLDLNYDMTQSLYQRNN  198

Query  1682  SCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLEL  1503
             + R+S + DND  + +    D   ++QNLDF         ++    +++E+EM+RLKLEL
Sbjct  199   TNRSSFSNDNDDGSSMMGSID--ISSQNLDFMNAPPEEPQSA----REIEAEMRRLKLEL  252

Query  1502  KQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaam  1323
             KQTMDMY++ACKEA+TAKK A EL Q ++EE+++FE+AR AEEAAL + EMEKAKC+AAM
Sbjct  253   KQTMDMYSSACKEALTAKKKANELHQWQMEEARKFEEARLAEEAALAIAEMEKAKCRAAM  312

Query  1322  eaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKF  1143
             +AAEKAQ++AE+E+QR K AE+KA++E  EK+RAL+ L+ +D RYRKY+I+EIE ATE+F
Sbjct  313   DAAEKAQRMAELESQRRKQAEIKARREAEEKDRALNALAHNDVRYRKYTIEEIEEATERF  372

Query  1142  SKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLG  963
             +   KIGEGGYGPVY+GKLDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RHPNMVLLLG
Sbjct  373   ANHNKIGEGGYGPVYKGKLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSCIRHPNMVLLLG  432

Query  962   ACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVH  783
             ACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+++AEI TAL FLH +KPEPLVH
Sbjct  433   ACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWGKRFQVAAEITTALSFLHHAKPEPLVH  492

Query  782   RDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKL  603
             RDLKPANILLDRN+VSKISDVGLARLVP SVA+ VTQYHMTSAAGTFCYIDPEYQQTG L
Sbjct  493   RDLKPANILLDRNYVSKISDVGLARLVPASVANSVTQYHMTSAAGTFCYIDPEYQQTGML  552

Query  602   GTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKL  423
              TKSDIYSLG+MLLQIITAKPPMGL H V RAIEKGTF D+LDPT+ DWPVEEAL FAKL
Sbjct  553   TTKSDIYSLGIMLLQIITAKPPMGLAHQVSRAIEKGTFRDMLDPTVPDWPVEEALAFAKL  612

Query  422   SLQCAELRKKDRPDLGSVILPELNRLKELA  333
             SL+CAELRK+DRPDLG +++PELNRL++L 
Sbjct  613   SLKCAELRKRDRPDLGKIVVPELNRLRKLG  642



>ref|XP_010424341.1| PREDICTED: U-box domain-containing protein 51-like [Camelina 
sativa]
Length=713

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/684 (57%), Positives = 507/684 (74%), Gaps = 21/684 (3%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLL--ISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             TVVAVDK+K+S  A++WT+D+LL  I NP +IL+HVR K+S NH   G +    +++ + 
Sbjct  17    TVVAVDKEKHSNYAIRWTIDHLLNMIHNPVMILVHVRLKSS-NHGGNGAN----LNNDEL  71

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW-  1989
             + +F P+R Y AR+GI MKE  ++D++V  AI+ Y+N + V+N+VLGASS++  +R F  
Sbjct  72    NQLFIPYRGYCARKGISMKEVVLDDSDVTTAILEYVNNNLVNNLVLGASSKNTFARSFMF  131

Query  1988  --THDVPTIVNKTAPDFCSVYVISKG-KQQSIRPAARPLTN------LPTHIWshhgsss  1836
                H+V   + K+ P+FCSVYVISKG K QS RPA RP+TN      +P+  +     S 
Sbjct  132   SKPHEVQANIMKSTPEFCSVYVISKGGKIQSSRPAQRPITNTLAPPRIPSSGFLIQSLSD  191

Query  1835  rassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRR---PWNSSCRNSL  1665
                         +      +A       +  P       D +  + +     N + ++S 
Sbjct  192   SEQDLIPRVQRGARNKSNETAYPHNRAVNTTPKSYKTPMDFNNGLTQVAFQRNPTLQSSF  251

Query  1664  AEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDM  1485
             ++++++   +    D  +A  N+D+   S +  ++   ++KD+E+EM+RLKLELKQTMDM
Sbjct  252   SDESEVGGSMMGSID-LSAHNNVDYYGASSSSEESIPQSTKDIEAEMRRLKLELKQTMDM  310

Query  1484  YNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaeka  1305
             Y++ACKEA+TAK+ A EL Q KIEE+++FE+AR +EEAAL + EMEKAKC+AA+EAAEKA
Sbjct  311   YSSACKEALTAKRKANELNQWKIEEARKFEKARLSEEAALAVAEMEKAKCRAAIEAAEKA  370

Query  1304  qkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKI  1125
             Q++AE+E QR K AEMKAK E  +K+RA+S L+ +D RYRKY+I+EIE ATE+F+   KI
Sbjct  371   QRMAELEGQRRKQAEMKAKSEEEDKDRAVSALAHNDVRYRKYTIEEIEEATEQFANHRKI  430

Query  1124  GEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYG  945
             GEGGYGPVY G+LDHTPVAIK LRPDAAQG+KQFQQEVEVLS +RHP+MVLLLGACPEYG
Sbjct  431   GEGGYGPVYNGELDHTPVAIKFLRPDAAQGKKQFQQEVEVLSSIRHPHMVLLLGACPEYG  490

Query  944   CLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPA  765
             CLVYEYMENGSLEDRL R+GN+P I W  RF+I+AEIATAL FLHQ+KPEPLVHRDLKP 
Sbjct  491   CLVYEYMENGSLEDRLFRRGNSPPISWRKRFEIAAEIATALSFLHQAKPEPLVHRDLKPG  550

Query  764   NILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDI  585
             NILLDRN+VSKISDVGLARLVP +VA++VTQYHMTSAAGT+CYIDPEYQQTG L TKSD+
Sbjct  551   NILLDRNYVSKISDVGLARLVPATVANNVTQYHMTSAAGTWCYIDPEYQQTGMLTTKSDV  610

Query  584   YSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAE  405
             YSLG++LLQIITA+ PMGL H V RAI KGTF ++LDP + DWP++EA  FA LSL+CAE
Sbjct  611   YSLGILLLQIITARQPMGLAHQVSRAISKGTFKEMLDPVVPDWPLQEAQSFATLSLKCAE  670

Query  404   LRKKDRPDLGSVILPELNRLKELA  333
             LRK+DRPDLG  ++P L RLK+  
Sbjct  671   LRKRDRPDLGKDVVPHLIRLKKFG  694



>ref|XP_003571113.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Brachypodium 
distachyon]
Length=742

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/725 (54%), Positives = 506/725 (70%), Gaps = 52/725 (7%)
 Frame = -3

Query  2390  HHHHPTISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVR-HKASPNH  2214
             H   P    D +T     +VAVD+DKNS  A KW VD LL     + L+HVR +++S N 
Sbjct  11    HSGEPEAGKDSST-----IVAVDRDKNSQQAAKWAVDRLLARGSTLQLVHVRTNQSSQNA  65

Query  2213  QNG-GPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSN  2037
             + G G DA   MS      +F  +R Y AR+G+ + E  +++ +++KAIV Y  +H +++
Sbjct  66    EAGRGVDADAEMSQ-----LFISYRGYCARKGMHLNEVILDNNDISKAIVDYATSHTITD  120

Query  2036  VVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAA--RPLTNLP--  1869
             +V+GAS+R+   R+F   DVPT + K APD+C+V+VI KGK   ++ A    P T LP  
Sbjct  121   IVVGASTRNTFIRRFRNPDVPTCLMKMAPDYCTVHVIHKGKAIQVKAAKGPAPFTTLPPK  180

Query  1868  ---------------THIWshhgsssrassrgssa-------asssAGDDRISACS---S  1764
                            +  W      S   S  SS          +    +R+SA S   +
Sbjct  181   QNSQPNIESDPFARSSRDWRKFSQPSSPKSNRSSVDRNRPSVERNRPSVERLSAYSKAPT  240

Query  1763  RGEH--SGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDF  1590
             +  H  SGR   + +  D    +  P  S  R+S ++D D   P+S   ++    ++L+ 
Sbjct  241   KDRHLLSGRQAPQRDFDDYIDFIAPPRPSVTRSSFSDDIDF--PMSMELNSMDYGESLEL  298

Query  1589  TRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIee  1410
             +  S    ++ S A KD+E+EM+RL+LELKQTM+MYN+ACKEA+ AK+ A +L QMK+EE
Sbjct  299   S--SYVSIESLSSAGKDVEAEMRRLRLELKQTMEMYNSACKEAVDAKQKAAQLSQMKVEE  356

Query  1409  sqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeK  1230
             S+++E+ R +EE AL +VEMEKAKC+AA+EAAE AQKIAE+EAQ+   AE KAK+ET E+
Sbjct  357   SKKYEELRNSEEEALALVEMEKAKCRAALEAAEAAQKIAELEAQKRLRAEWKAKRETDER  416

Query  1229  NRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRP  1050
              RA    + +D RYR+YSID+IE AT KF +++KIGEGGYGPVY+  LDHT VAIK+LRP
Sbjct  417   RRA----TDTDLRYRRYSIDDIEAATHKFDRALKIGEGGYGPVYKAVLDHTNVAIKILRP  472

Query  1049  DAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAI  870
             DA+QGR+QFQQE+E+LS MRHPNMVLLLGACPEYGCLVYEYM+ GSLEDRL R+GNT  I
Sbjct  473   DASQGRQQFQQEIEILSSMRHPNMVLLLGACPEYGCLVYEYMDYGSLEDRLCRRGNTKPI  532

Query  869   PWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSV  690
             PW IRF+I+A+IAT LLFLHQ+KPEPLVHRDLKP NILLD NFVSKISDVGLARLVP S+
Sbjct  533   PWNIRFRIAADIATGLLFLHQAKPEPLVHRDLKPGNILLDHNFVSKISDVGLARLVPQSI  592

Query  689   ADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVER  510
             A +VTQY MTS AGTFCYIDPEYQQTG L TKSDIYS G++LLQIITA+ PMGLTH VE 
Sbjct  593   A-EVTQYRMTSTAGTFCYIDPEYQQTGMLTTKSDIYSFGILLLQIITARSPMGLTHQVED  651

Query  509   AIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
             AIE+G F ++LD T++DWPVEEAL FA+L+L+CAELRKKDRPDLG  I+PELNRL+ L  
Sbjct  652   AIERGAFQEVLDQTVTDWPVEEALAFAQLALKCAELRKKDRPDLGKEIMPELNRLRNLGQ  711

Query  329   QSLAS  315
             +  AS
Sbjct  712   EYEAS  716



>ref|XP_002874302.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50561.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=707

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/690 (57%), Positives = 505/690 (73%), Gaps = 36/690 (5%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLL--ISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             TVVA+DK+K+S  AV+W VD+LL  I  P +IL+HVR K S NH          +++ D 
Sbjct  17    TVVAIDKEKHSHYAVRWAVDHLLNMIHKPVMILVHVRSKNS-NHG-------ANLNNDDL  68

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW-  1989
             + +F P+R Y AR+G+++     +D++VAKAI+ YIN + V+N+V+GASS+++ +R F  
Sbjct  69    NQLFIPYRGYCARKGVVL-----DDSDVAKAILDYINNNLVNNLVMGASSKNSFARSFMF  123

Query  1988  --THDVPTIVNKTAPDFCSVYVISKG-KQQSIRPAARPLTNL--PTHIWshhgsssrass  1824
                H+V + + K+ PDFCSVYVISKG K QS RPA RP+TN   P  + S        S 
Sbjct  124   SKPHEVQSSIMKSTPDFCSVYVISKGGKVQSSRPAQRPITNTLAPPRVPSSGFLIQSLSD  183

Query  1823  rgssaasssAGDDRISACSSRGEHSGRPF---RRSEDRDADGS---------VRRPWNSS  1680
                          R     +   H+ R F   ++S     +GS         V    N +
Sbjct  184   SEQDLIPRVQRSARNKPNETTYPHN-RAFNTTQKSYKNTINGSMDLNNGFNQVAFQRNPT  242

Query  1679  CRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdass-iaSKDLESEMKRLKLEL  1503
              ++S ++++++   +    D  +A  N+DF   + + S+ S   ++KD+E+EM+RLKLEL
Sbjct  243   LQSSFSDESEVGLGMMGSID-LSAHNNMDFYHGASSSSEESIPQSTKDIEAEMRRLKLEL  301

Query  1502  KQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaam  1323
             KQTMDMY++ACKEA+TAK+ A EL Q KIEE+++FE+AR +EEAAL + EMEKAKC+ A 
Sbjct  302   KQTMDMYSSACKEALTAKRKANELNQWKIEEARKFEKARLSEEAALAVAEMEKAKCRTAE  361

Query  1322  eaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKF  1143
             EAAEKAQ++AE+E QR K AEMKA  E  +K+RA+S L+ +D RYRKY+I+EIE ATE+F
Sbjct  362   EAAEKAQRMAELEGQRRKQAEMKAISEEKDKDRAVSALAHNDVRYRKYTIEEIEEATEQF  421

Query  1142  SKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLG  963
             +   KIGEGGYGPVY G+LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RHP+MVLLLG
Sbjct  422   ANHRKIGEGGYGPVYNGELDHTPVAIKVLRPDAAQGKKQFQQEVEVLSSIRHPHMVLLLG  481

Query  962   ACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVH  783
             ACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATAL FLHQ+KPEPLVH
Sbjct  482   ACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFEIAAEIATALSFLHQAKPEPLVH  541

Query  782   RDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKL  603
             RDLKPANILLDRN+VSKISDVGLARLVP SVA+ VTQYHMTSAAGTFCYIDPEYQQTG L
Sbjct  542   RDLKPANILLDRNYVSKISDVGLARLVPASVANSVTQYHMTSAAGTFCYIDPEYQQTGML  601

Query  602   GTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKL  423
              TKSD+YS G++LLQIITA+PPMGL H V RAI KGTF ++LDP + DWP++EA  FA L
Sbjct  602   TTKSDVYSFGILLLQIITARPPMGLAHQVSRAISKGTFKEMLDPVVHDWPLQEAQSFATL  661

Query  422   SLQCAELRKKDRPDLGSVILPELNRLKELA  333
             SL+CAELRK+DRPDLG  ++P L RLK   
Sbjct  662   SLKCAELRKRDRPDLGKEVVPHLIRLKNFG  691



>ref|XP_007216833.1| hypothetical protein PRUPE_ppa022664mg [Prunus persica]
 gb|EMJ18032.1| hypothetical protein PRUPE_ppa022664mg [Prunus persica]
Length=744

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/719 (54%), Positives = 479/719 (67%), Gaps = 58/719 (8%)
 Frame = -3

Query  2333  VAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNG---------GPDAHGGM  2181
             VAVDKDK S  A+KWTVDNLL     V LLHV+  AS +H +              H   
Sbjct  16    VAVDKDKGSQHAIKWTVDNLLSRGQNVTLLHVKETASHHHNHHHHTGHGTEEAGKVHQSQ  75

Query  2180  SDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAIS  2001
             +D     +F PFR Y  ++ I   E  IED +++KA+V Y+ T+ +  +VLG  S++ + 
Sbjct  76    ADAQAKELFLPFRGYCTKKAIKCHEIIIEDNDISKALVNYVTTNLIEILVLGTPSKNGLF  135

Query  2000  RKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssras--  1827
             R F T DVPTIV+K APDFC+VYVI +GK   +R A   +     +  +   + S     
Sbjct  136   R-FMTTDVPTIVSKKAPDFCTVYVIGRGKISIVRSATGSIDMFNKYKGNSALNKSYELPP  194

Query  1826  -srgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADG------------------S  1704
              S  S  +S + G D +         SG   R S + D D                   S
Sbjct  195   DSDISYVSSGTPGRDHMFPSFYDSMSSGMTSRFSINSDLDSRSSTSTASYSGTKFIDMSS  254

Query  1703  VRRPWNSSCRNSLAEDNDLFAPISDGFDNA-------AAAQNLDFTRisdagsdassiaS  1545
             ++  ++S  RN  +  +D  +P  D   ++       +++QN D                
Sbjct  255   LQHDFSSPLRNLSSPHHDFSSPQHDFSSSSFESGNSWSSSQNAD----------------  298

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
              D+++EM+RL+LELK T DMYN ACKE +T K   KE+ Q K+EE  R E+AR  EEAAL
Sbjct  299   -DVDAEMRRLRLELKHTRDMYNTACKEGVTEKHKGKEVNQWKLEEELRLEEARTVEEAAL  357

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              +V  EKAKC+AAMEAAE AQ+IAE+E Q+ +  E+KA +ET  +  AL   +  D RYR
Sbjct  358   SLVGKEKAKCRAAMEAAEAAQRIAELETQKRRNVELKALRETEHRKTALES-NAYDLRYR  416

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE AT  FS   KIGEGGYGPVYRG+LDHTPVAIKVLRPDAA G +QF++EVEV
Sbjct  417   KYTIEEIETATNDFSAGYKIGEGGYGPVYRGELDHTPVAIKVLRPDAAHGEEQFKKEVEV  476

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPE+GCLVYEYM NGSLEDRL R+GNTP IPW++RF+I+AEIAT 
Sbjct  477   LSCIRHPNMVLLLGACPEFGCLVYEYMANGSLEDRLFRRGNTPVIPWQLRFRIAAEIATG  536

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKP NILLD N+VSKISDVGLARLVP SVA+ VTQYHMTS AGT
Sbjct  537   LLFLHQTKPEPLVHRDLKPGNILLDHNYVSKISDVGLARLVPASVANSVTQYHMTSTAGT  596

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLGV+LLQI+TA+PPMGLTH VE AI+ G FA++LDP I
Sbjct  597   FCYIDPEYQQTGLLGVKSDVYSLGVLLLQIVTARPPMGLTHLVEEAIDTGAFAEVLDPAI  656

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASK--NGTQTF  294
             SDWP+EEAL FAKLSLQCAE+R+KDRPDLG V+LPELNR +E    S+      G+Q F
Sbjct  657   SDWPIEEALKFAKLSLQCAEMRRKDRPDLGKVLLPELNRFREFGQDSMNRLMFGGSQVF  715



>gb|KHN18232.1| U-box domain-containing protein 52 [Glycine soja]
Length=784

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/722 (52%), Positives = 494/722 (68%), Gaps = 52/722 (7%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKA---SPNHQNGGPDAHGGMSDH  2172
             +  VA+DK+K S +A+KW VDNLL  +  VIL+HV+  A   SP+     P     + D 
Sbjct  17    LVAVAIDKEKGSQNALKWAVDNLLTKSATVILIHVKLLAPILSPSPSLFTPRISALLGDD  76

Query  2171  ----------DGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
                       +   VF P+R +  R+ I   +  +ED++++KA++ Y +   + ++VLG+
Sbjct  77    TSLVSKEPEGNNKNVFLPYRVFCTRKDIQCTDVLLEDSDISKALIEYASQAGIEHLVLGS  136

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgs  1842
             S+++++ ++F   D P  V+K APDFC+VYVI+KGK Q++R A+RP   +  ++ S    
Sbjct  137   STKTSLLKRFKVSDTPGAVSKGAPDFCTVYVIAKGKIQTMRSASRPAPAIVPNLLSQASV  196

Query  1841  ssrassrgssaasssAGDDRIS-----------------ACSSRGEHSGRPFRRSEDRDA  1713
                +      A S    + R S                 +  +R  +SGR +  +   D 
Sbjct  197   RKDSDPNVLLAQSIKEQETRHSFDAALPRRSQDESETFRSPFTRKGYSGRQYGNTPKPDM  256

Query  1712  DGSVRRPWNSSCRN---SLAEDNDLFAP---ISDGFDNAAAAQNLDFTRisdag------  1569
             D S       S  N   SL  D  +  P   +    D + + +++   R S         
Sbjct  257   DISFPSTGRKSIENFFPSLNSDTGMSNPRLSLGSDIDGSFSFESMHHGRKSMETGTPPEF  316

Query  1568  ----------sdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMK  1419
                       S ++S A  D+E+EM+RLKLELKQTM++YN ACKEA TA++ A EL++ K
Sbjct  317   SSLSFESDRHSSSTSQAVDDMEAEMRRLKLELKQTMELYNTACKEAFTAQQKAVELKKWK  376

Query  1418  IeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakket  1239
             +EE +R E+AR AEE AL + E E+AK KAA+EAAE  ++IA++EAQ+   AEMKA +E+
Sbjct  377   LEEERRLEEARLAEETALAVAEKERAKSKAAIEAAEAQKRIAQLEAQKRLTAEMKALRES  436

Query  1238  aeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKV  1059
              EK + L  L   D RYR+Y+I+EIE AT+ F++S+KIGEGGYGPV++  LDHTPVA+KV
Sbjct  437   EEKKKVLDALVNVDIRYRRYTIEEIEAATDFFAESLKIGEGGYGPVFKCLLDHTPVAVKV  496

Query  1058  LRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNT  879
             LRPDA QGR QFQ+EVEVLS +RHPNMVLLLGACPEYGCLVYEYM NGSL+D L R+G+T
Sbjct  497   LRPDAQQGRSQFQREVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDCLFRQGST  556

Query  878   PAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVP  699
             P +PW++RFKI+AEI T LLFLHQ+KPEPLVHRDLKP NILL+RN+V+KISDVGLARLVP
Sbjct  557   PPLPWQLRFKIAAEIGTGLLFLHQTKPEPLVHRDLKPGNILLNRNYVAKISDVGLARLVP  616

Query  698   PSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHH  519
             PSVAD VTQYHMTS AGTFCYIDPEYQQTG LG KSDIYSLG++ LQI+TAK PMGLTHH
Sbjct  617   PSVADSVTQYHMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIIFLQILTAKSPMGLTHH  676

Query  518   VERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKE  339
             VERAIEKGTFA++LDP++ DWP+E+A+  AK+ LQCAELR+KDRPDLG VILPELNRL++
Sbjct  677   VERAIEKGTFAEMLDPSVVDWPMEDAMKLAKMGLQCAELRRKDRPDLGKVILPELNRLRD  736

Query  338   LA  333
             LA
Sbjct  737   LA  738



>ref|XP_009121892.1| PREDICTED: U-box domain-containing protein 51-like isoform X2 
[Brassica rapa]
Length=650

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/636 (61%), Positives = 485/636 (76%), Gaps = 25/636 (4%)
 Frame = -3

Query  2177  DHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS----  2010
             D + + +F P+R Y AR+GI M E  +ED++VA+AI+ Y+N + V+N+V+G++S S    
Sbjct  12    DDELNHLFVPYRGYCARKGISMMEVILEDSDVARAILDYVNNNLVNNIVVGSASSSKNPF  71

Query  2009  AISRKFW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL------PTHIWsh  1851
             A S KF  +HDV   + K+ P+FCS+YVISKGK QS R A R +TN       P+  +  
Sbjct  72    ARSLKFTKSHDVAASILKSTPEFCSIYVISKGKVQSSRAAQRRITNTLVPPREPSSAFHL  131

Query  1850  hgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPW------  1689
                             +S         +  G ++ R  RRS    A+GS+   +      
Sbjct  132   QNLPDPDQDPLPRGQRNSRNTTPERYHNDNGFNAMRERRRSA---ANGSLDFNYDFKQAN  188

Query  1688  ---NSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKR  1518
                N   RNS ++++D  + +    D   +AQN DF   S +  +++S +++D+E+EMKR
Sbjct  189   GQRNPVGRNSFSDESDGGSLMMGSVD--LSAQNYDFIGASGSSDESASQSTRDIEAEMKR  246

Query  1517  LKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekak  1338
             LKLEL+QTMDMY++ACKEA+ AKK+A EL   K EE++RFE+AR AEEAAL + EMEKAK
Sbjct  247   LKLELRQTMDMYSSACKEALNAKKTANELNMWKKEEARRFEEARSAEEAALAVAEMEKAK  306

Query  1337  ckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEF  1158
             CKAAMEAAEKAQ++AE+E QR K AEMKA++E+ EK+RAL+ L ++D RYRKYSI+EIE 
Sbjct  307   CKAAMEAAEKAQRMAELEGQRRKQAEMKARRESQEKDRALTALGQNDVRYRKYSIEEIEE  366

Query  1157  ATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNM  978
             AT++F+ +MK+GEGGYGPVY+G LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RHP+M
Sbjct  367   ATDRFASNMKVGEGGYGPVYKGTLDHTPVAIKVLRPDAAQGKKQFQQEVEVLSCIRHPHM  426

Query  977   VLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKP  798
             VLLLGACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATAL FLHQ+KP
Sbjct  427   VLLLGACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIAAEIATALSFLHQTKP  486

Query  797   EPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQ  618
             EPLVHRDLKPANILLDRN+VSKISDVGLARLVP SVA++VTQYHMTSAAGTFCYIDPEYQ
Sbjct  487   EPLVHRDLKPANILLDRNYVSKISDVGLARLVPASVANNVTQYHMTSAAGTFCYIDPEYQ  546

Query  617   QTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEAL  438
             QTGKL TKSDIYSLG+MLLQIITAK PMGL HHV RAIEKGTF D+LDP ++DWPVEEA+
Sbjct  547   QTGKLTTKSDIYSLGIMLLQIITAKNPMGLAHHVSRAIEKGTFKDMLDPVVTDWPVEEAI  606

Query  437   HFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
             +FAKL L+C+ELRK+DRPDLG  I+PEL RL+ L L
Sbjct  607   NFAKLCLKCSELRKRDRPDLGKDIVPELVRLRNLGL  642



>emb|CDX91180.1| BnaC02g04170D [Brassica napus]
Length=905

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/691 (58%), Positives = 502/691 (73%), Gaps = 48/691 (7%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             TVVA+DKDKNS  AV+W V++L  LI N  +IL+HVR K S          HGG  + + 
Sbjct  16    TVVAIDKDKNSHYAVRWAVEHLFNLIDNRNMILVHVRLKNS---------NHGGNVNDEL  66

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS-SRSAISR--K  1995
             + +F P+R Y AR+GI M E  ++D +VA AI+ Y N + V+N+VLG++ S++  +R  K
Sbjct  67    NKLFIPYRGYCARKGISMMEVILDDIDVANAILDYANNNLVNNIVLGSTYSKNPFARSLK  126

Query  1994  FW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrg  1818
             F  +HDV   V K+ P+FCSVYVISKGK QS R A RP+TN            + A  R 
Sbjct  127   FTKSHDVAASVLKSTPEFCSVYVISKGKVQSSRAAQRPITN------------TLAPPRA  174

Query  1817  ssaasssAGDDRISACSSRGEHSGR---PFRRSEDRDADGSVRRPWNSSCRNSLAEDNDL  1647
              +    +  D        RG+ +GR   P R     +   +VR       R+  A + D 
Sbjct  175   PTFHLQNLPDPDQDHHLPRGQRNGRNITPERYRPHENGFNAVRE------RHKSAANYDF  228

Query  1646  FAPISD-GFDNA-----------AAAQNLDFTRisdagsdassiaSKDLESEMKRLKLEL  1503
               P+    FD              +A N D    + +  ++ S ++KD+E+EM+RLK+EL
Sbjct  229   NQPMGQRNFDEPDFGTRMMGSIDQSAHNFDIIGSTSSSDESVSQSNKDVEAEMRRLKIEL  288

Query  1502  KQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaam  1323
             KQTMDMY++ACKEA+ AK+ A EL + K+EE+ RFE+AR AEEAAL + E EKAKCKAAM
Sbjct  289   KQTMDMYSSACKEALDAKQKANELNKWKLEETLRFEEARSAEEAALAVAETEKAKCKAAM  348

Query  1322  eaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKF  1143
             EAAEK+Q++A++E QR K AEMKA++E+ EK+RA+S L ++D RYR+YSI+EIE AT++F
Sbjct  349   EAAEKSQRMADLEGQRRKQAEMKARRESQEKDRAISALVQNDVRYRRYSIEEIEEATDRF  408

Query  1142  SKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLG  963
             + + +IGEGGYGPV+ G LDHTPVAIKVLR DAAQG+KQF QEVEVLS +RHP+MVLLLG
Sbjct  409   ASNRQIGEGGYGPVFEGTLDHTPVAIKVLRADAAQGKKQFNQEVEVLSCIRHPHMVLLLG  468

Query  962   ACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVH  783
             ACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATAL FLHQ+KPEPLVH
Sbjct  469   ACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIAAEIATALSFLHQTKPEPLVH  528

Query  782   RDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKL  603
             RDLKPANILLDRN+VSKISDVGLARLVP SVAD VTQYHMTSAAGTFCYIDPEYQQTGKL
Sbjct  529   RDLKPANILLDRNYVSKISDVGLARLVPASVADTVTQYHMTSAAGTFCYIDPEYQQTGKL  588

Query  602   GTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKL  423
              TKSD+YS+G+MLLQIITAK PMGL HHV RAI KGTF D+LDP ++DWPVEEA+ FAKL
Sbjct  589   TTKSDVYSVGIMLLQIITAKSPMGLAHHVSRAISKGTFKDMLDPVVTDWPVEEAMAFAKL  648

Query  422   SLQCAELRKKDRPDLGSVILPELNRLKELAL  330
              L+CAELRKKDRPDLG  I+PEL RL+   +
Sbjct  649   CLKCAELRKKDRPDLGKDIVPELVRLRNFGM  679



>ref|XP_007216961.1| hypothetical protein PRUPE_ppa015558mg [Prunus persica]
 gb|EMJ18160.1| hypothetical protein PRUPE_ppa015558mg [Prunus persica]
Length=777

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/707 (54%), Positives = 488/707 (69%), Gaps = 38/707 (5%)
 Frame = -3

Query  2366  SDGATTGPITVVAVDKDKNSASAVKWTVDNLL-ISNPFVILLHVRHKASPNHQNGGPDAH  2190
             S G   GP T+VA++KDKNS  AVKW VDNLL   N    L+HVR  +   H +G P   
Sbjct  8     SVGEDVGP-TLVAINKDKNSQCAVKWAVDNLLGDKNAHCTLIHVRSHSF--HHHGRPPTE  64

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
               +        F P+R + AR+GI+ KE  + D +V  A+V Y+  + + N+V+GAS  +
Sbjct  65    AELQQ-----FFLPYRGFCARKGIVAKEVVLHDIDVPNALVDYVVRNSICNIVVGASHHN  119

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssra  1830
             A++RKF   DV T + K+ P+ C+VYVISKGK Q+ R A  P T  P    S+  +    
Sbjct  120   ALTRKFRPADVATSLLKSVPETCAVYVISKGKIQTSRSATGPQT--PK---SNGATPRNN  174

Query  1829  ssrgssaasssAGDDRISACSSRGEHSGR-PFRRSED--------RDADGSVRRPWNSSC  1677
             SS+ +  +S   G        S+G  +GR P  +  D          +      P  S  
Sbjct  175   SSQRTPLSSFLHGVSAFEDVISQGSSAGRIPLDKKADFKHVPPKAHRSGSKTNSPTQSVT  234

Query  1676  R---------NSLAEDNDLFAPIS---DGFDNAAAAQNLDFTRisdagsdassiaSKDLE  1533
                       NS++  +D   P+S   +G DN   + N   +  S     + +     L+
Sbjct  235   SVTSDKLYHGNSMSGGSDFSGPLSFQSNGSDNVDFSMN---SEGSINSFSSHTPLQSALD  291

Query  1532  SEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVe  1353
             +EM+RL+LELKQTMDMY +ACKEA+ AK+  ++LQ+ K  E  + E+A+ AEEAAL + +
Sbjct  292   AEMRRLRLELKQTMDMYTSACKEALAAKEKTRDLQKWKTSEEHKLEEAKLAEEAALALAD  351

Query  1352  mekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSI  1173
             +E+ K KAA EAA+ AQ++A ME  + K AE KAK+E  E+ RA+  L+ +  RYR+Y+I
Sbjct  352   VERQKSKAATEAAQMAQRLAGMETHKRKIAERKAKQEAGERRRAMDALAHNHIRYRRYTI  411

Query  1172  DEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLM  993
             +EIE AT+ F  S K+GEGGYGPVYR  LDHT VAIKVLRPD +QG++QFQQEVEVLS +
Sbjct  412   EEIELATDYFKISNKVGEGGYGPVYRAWLDHTAVAIKVLRPDISQGQRQFQQEVEVLSCI  471

Query  992   RHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFL  813
             RHP+MVLL+GACPEYGCL+YEYMENGSLEDRL  K NTP IPW +RFKI+AEIATALLFL
Sbjct  472   RHPHMVLLVGACPEYGCLIYEYMENGSLEDRLFLKSNTPPIPWGVRFKIAAEIATALLFL  531

Query  812   HQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYI  633
             HQ+KPEPLVHRDLKPANILLDRN+VSKI+DVGLARLVPPSVAD VTQY +T+AAGTFCYI
Sbjct  532   HQTKPEPLVHRDLKPANILLDRNYVSKIADVGLARLVPPSVADAVTQYRVTAAAGTFCYI  591

Query  632   DPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWP  453
             DPEYQQTG LG KSDIYSLGVMLLQIITAKP MGL+H VE AIEKG FA+ LDP ++DWP
Sbjct  592   DPEYQQTGMLGVKSDIYSLGVMLLQIITAKPAMGLSHQVEEAIEKGAFAETLDPAVTDWP  651

Query  452   VEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASK  312
             VEEAL +AK++L+C ELR++DRPDL +VILPELNRL++L +++ A++
Sbjct  652   VEEALSYAKMALKCCELRRRDRPDLSTVILPELNRLRDLGMKNEANQ  698



>ref|XP_008679842.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
35-like [Zea mays]
Length=722

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/689 (55%), Positives = 486/689 (71%), Gaps = 43/689 (6%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             +VAVD+DKNS  A KW VD LL     + L+HVR +A  N   G         D +   +
Sbjct  26    IVAVDRDKNSQQAAKWAVDKLLTRGSMLQLVHVRVEA--NKDEG---------DAEITQL  74

Query  2156  FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDV  1977
             F  +R Y AR+G+ +KE  ++ T+++KAI+ Y  ++ ++++V+GAS+++   R+F   DV
Sbjct  75    FISYRGYCARKGMHLKELILDGTDISKAIIDYATSNAITDIVVGASTKNTFIRRFRNPDV  134

Query  1976  PTIVNKTAPDFCSVYVISKGK------------QQSIRPAARPLTNLPTHIWshhgsssr  1833
             PT + K APD+C+V+VI K K              ++ P      N+ +          +
Sbjct  135   PTCLMKMAPDYCTVHVIHKAKAIQVKAAKAPAPFATLPPKQHSQPNIESDASRASRGDWK  194

Query  1832  assrgssaasssAGD-DRISACSSRGEHSGRPF---RRSEDRDADGSV---RRPWNSSCR  1674
              +   SS  +S     DR+SA  ++     RP    R +  +D D  +     P  S  R
Sbjct  195   KTPPTSSPLASRXNSVDRLSA-YAKAPSRDRPLTGARTAPQKDFDDYIDFIAPPRPSVAR  253

Query  1673  NSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSK---DLESEMKRLKLEL  1503
             +S ++D D        F  +    ++DF    +  S  S  +     D+E+EM+RL+LEL
Sbjct  254   SSFSDDID--------FAMSMELPSIDFGESMELSSAMSMESLSCAGDVEAEMRRLRLEL  305

Query  1502  KQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaam  1323
             KQTM+MYN+ACKEA+ AK+ A ++ QMK+EES+++++ R +EE AL +VEMEKAKC+AA+
Sbjct  306   KQTMEMYNSACKEAVDAKQKAAQMHQMKVEESKKYQELRNSEEEALALVEMEKAKCRAAL  365

Query  1322  eaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKF  1143
             EAAE AQKIAE+EAQ+   AE KAK+E  ++ +A   L+K+D RYR+YSID+IE AT KF
Sbjct  366   EAAEAAQKIAELEAQKRLRAEWKAKREAEDRKKATDALNKNDIRYRRYSIDDIEAATHKF  425

Query  1142  SKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLG  963
              K++KIGEGGYGPVY+  LDHT VAIK+LRPDA+QGRKQFQQE+EVLS MRHPNMVLLLG
Sbjct  426   DKALKIGEGGYGPVYKAVLDHTNVAIKILRPDASQGRKQFQQEIEVLSCMRHPNMVLLLG  485

Query  962   ACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVH  783
             ACPEYGCLVYEYM+ GSLEDRL R+G T  IPW IRF+I+A+IAT LLFLHQ+KPEPLVH
Sbjct  486   ACPEYGCLVYEYMDYGSLEDRLCRRGKTLPIPWSIRFRIAADIATGLLFLHQAKPEPLVH  545

Query  782   RDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKL  603
             RDLKPANILLD NFVSKISDVGLARLVP S A DVTQY MTS AGTFCYIDPEYQQTG L
Sbjct  546   RDLKPANILLDHNFVSKISDVGLARLVPQSAA-DVTQYRMTSTAGTFCYIDPEYQQTGML  604

Query  602   GTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKL  423
              TKSD+YSLG+MLLQIITA+ PMGLTHHVE AIE+G F ++LDPT++DWPVEEAL FAKL
Sbjct  605   TTKSDVYSLGIMLLQIITARSPMGLTHHVENAIERGAFQEILDPTVTDWPVEEALEFAKL  664

Query  422   SLQCAELRKKDRPDLGSVILPELNRLKEL  336
             +L+CAELRKKDRPDLG  ILPELNRL+ L
Sbjct  665   ALRCAELRKKDRPDLGKEILPELNRLRNL  693



>ref|XP_009375498.1| PREDICTED: U-box domain-containing protein 52-like [Pyrus x bretschneideri]
Length=754

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/728 (54%), Positives = 478/728 (66%), Gaps = 75/728 (10%)
 Frame = -3

Query  2333  VAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCVF  2154
             VA+DKDK S  A+KW VD+LL     + LLHV   +SP  +   P    G+        F
Sbjct  18    VAIDKDKGSEHAIKWAVDHLLARGRPLTLLHVDQTSSP--EGSDPQQTQGL--------F  67

Query  2153  TPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVP  1974
               FR++ +++ I   E  I+D ++  AI+ Y+  + +  +VLG  S+S I R F   DVP
Sbjct  68    LSFRSFCSKKNIKCNEVVIKDNDIPNAIIDYVMVNTIEILVLGTPSKSGIFR-FKLTDVP  126

Query  1973  TIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL--PTHIWshhgsssrassrgss--aa  1806
             + V+K APDFCSVYVI +GK   +R A     N   P  +     S S A S G      
Sbjct  127   STVSKRAPDFCSVYVIGRGKVSYMRYATSTPQNFAQPGQVQHQPSSVSEARSSGVFPPHD  186

Query  1805  sssAGDDRISACSSRGEHSG-----RPFRR-------------------------SEDR-  1719
             +  +  DR+  CS+R E  G      PF R                         S DR 
Sbjct  187   NHISSSDRVQYCSTRNEPDGDIQIKSPFARGRPSMDKSYELSPETDISFVSIGRPSIDRM  246

Query  1718  ------------------DADGSVRRPWNSSCRNSLAEDNDLFAPIS----DGFDNAAAA  1605
                                +DG  R P +S  R+   +   L   +S    D   + +++
Sbjct  247   SPRCDFGVESGINSRLSIGSDGDNRSPTSSYSRHKFLDMGSLQCEMSSCSVDSGKSLSSS  306

Query  1604  QNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQ  1425
             QN+           +      ++E+EM+RLKLELKQTM+MY+ ACKEA+ AK   KE+ Q
Sbjct  307   QNM-----VLKIIPSIYCKQDNVEAEMRRLKLELKQTMEMYSTACKEALIAKHKEKEINQ  361

Query  1424  MKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakk  1245
              K+E+ QR E AR AEE AL +VE EKAKCKAA+EAAE AQ+IAE+EAQ+ +        
Sbjct  362   WKMEDEQRLEAARHAEEVALALVEKEKAKCKAAIEAAEAAQRIAELEAQK-RRVAEMKAF  420

Query  1244  etaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAI  1065
             + +E+ +AL   S  D RYRKY+I EIE AT  FS+  KIGEGGYGPVYRG+LDHT VAI
Sbjct  421   KESEEKKALQARS-YDLRYRKYTIQEIEKATNDFSQDRKIGEGGYGPVYRGELDHTTVAI  479

Query  1064  KVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKG  885
             K+LRPDAAQG+ QF+QEVEVLS +RHPNMVLLLGACP+YGCLVYEYM NGSLEDRL R+G
Sbjct  480   KILRPDAAQGQSQFKQEVEVLSCIRHPNMVLLLGACPDYGCLVYEYMGNGSLEDRLFRRG  539

Query  884   NTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARL  705
             NTP IPW++RF+I+AEI T LLFLHQ+KPEPLVHRDLKP NILLD N+VSKISDVGLARL
Sbjct  540   NTPVIPWQLRFRIAAEIGTGLLFLHQTKPEPLVHRDLKPGNILLDHNYVSKISDVGLARL  599

Query  704   VPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLT  525
             VPPSVA+ VTQYHMTS AGTFCYIDPEYQQTG LGTKSDIYSLGVM LQ+ITAKPPMGLT
Sbjct  600   VPPSVANAVTQYHMTSTAGTFCYIDPEYQQTGLLGTKSDIYSLGVMFLQLITAKPPMGLT  659

Query  524   HHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRL  345
             HH+ERAIE GTFA++LDP + DWPVEEAL FAKL LQCAE+R+KDRPDLG V+LPELNRL
Sbjct  660   HHIERAIETGTFAEMLDPAVPDWPVEEALKFAKLCLQCAEMRRKDRPDLGKVVLPELNRL  719

Query  344   KELALQSL  321
             + LA +SL
Sbjct  720   RALADESL  727



>ref|XP_006582487.1| PREDICTED: U-box domain-containing protein 52-like [Glycine max]
Length=791

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/729 (52%), Positives = 497/729 (68%), Gaps = 59/729 (8%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKA---SPNHQNGGPD---AHGGM  2181
             +  VA+DK+K S +A+KW VDNLL  +  VIL+HV+  A   SP+     P    A  G+
Sbjct  17    LVAVAIDKEKGSQNALKWAVDNLLTKSATVILIHVKLLAPILSPSPSLFTPISLVALAGI  76

Query  2180  S--------------DHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRV  2043
             S              + +   VF P+R +  R+ I   +  +ED++++KA++ Y +   +
Sbjct  77    SALLGDDTSLVSKEPEGNNKNVFLPYRVFCTRKDIQCTDVLLEDSDISKALIEYASQAGI  136

Query  2042  SNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTH  1863
              ++VLG+S+++++ ++F   D P  V+K APDFC+VYVI+KGK Q++R A+RP   +  +
Sbjct  137   EHLVLGSSTKTSLLKRFKVSDTPGAVSKGAPDFCTVYVIAKGKIQTMRSASRPAPAIVPN  196

Query  1862  IWshhgsssrassrgssaasssAGDDRIS-----------------ACSSRGEHSGRPFR  1734
             + S       +      A S    + R S                 +  +R  +SGR + 
Sbjct  197   LLSQASVRKDSDPNVLLAQSIKEQETRHSFDAALPRRSQDESETFRSPFTRKGYSGRQYG  256

Query  1733  RSEDRDADGSVRRPWNSSCRN---SLAEDNDLFAP---ISDGFDNAAAAQNLDFTRisda  1572
              +   D D S       S  N   SL  D  +  P   +    D + + +++   R S  
Sbjct  257   NTPKPDMDISFPSTGRKSIENFFPSLNSDTGMSNPRLSLGSDIDGSFSFESMHHGRKSME  316

Query  1571  g----------------sdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSA  1440
                              S ++S A  D+E+EM+RLKLELKQTM++YN ACKEA TA++ A
Sbjct  317   TGTPPEFSSLSFESDRHSSSTSQAVDDMEAEMRRLKLELKQTMELYNTACKEAFTAQQKA  376

Query  1439  KELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyae  1260
              EL++ K+EE +R E+AR AEE AL + E E+AK KAA+EAAE  ++IA++EAQ+   AE
Sbjct  377   VELKKWKLEEERRLEEARLAEETALAVAEKERAKSKAAIEAAEAQKRIAQLEAQKRLTAE  436

Query  1259  mkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDH  1080
             MKA +E+ EK + L  L   D RYR+Y+I+EIE AT+ F++S+KIGEGGYGPV++  LDH
Sbjct  437   MKALRESEEKKKVLDALVNVDIRYRRYTIEEIEAATDFFAESLKIGEGGYGPVFKCLLDH  496

Query  1079  TPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDR  900
             TPVA+KVLRPDA QGR QFQ+EVEVLS +RHPNMVLLLGACPEYGCLVYEYM NGSL+D 
Sbjct  497   TPVAVKVLRPDAQQGRSQFQREVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDC  556

Query  899   LLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDV  720
             L R+G+TP +PW++RFKI+AEI T LLFLHQ+KPEPLVHRDLKP NILL+RN+V+KISDV
Sbjct  557   LFRQGSTPPLPWQLRFKIAAEIGTGLLFLHQTKPEPLVHRDLKPGNILLNRNYVAKISDV  616

Query  719   GLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKP  540
             GLARLVPPSVAD VTQYHMTS AGTFCYIDPEYQQTG LG KSDIYSLG++ LQI+TAK 
Sbjct  617   GLARLVPPSVADSVTQYHMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIIFLQILTAKS  676

Query  539   PMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILP  360
             PMGLTHHVERAIEKGTFA++LDP++ DWP+E+A+  AK+ LQCAELR+KDRPDLG VILP
Sbjct  677   PMGLTHHVERAIEKGTFAEMLDPSVVDWPMEDAMKLAKMGLQCAELRRKDRPDLGKVILP  736

Query  359   ELNRLKELA  333
             ELNRL++LA
Sbjct  737   ELNRLRDLA  745



>ref|XP_010493873.1| PREDICTED: U-box domain-containing protein 51-like [Camelina 
sativa]
Length=712

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/684 (57%), Positives = 505/684 (74%), Gaps = 22/684 (3%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLL--ISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             TVVAVDK+K+S  A++W +D+LL  I NP +IL+HVR K+S NH   G +    ++  + 
Sbjct  17    TVVAVDKEKHSNYAIRWAIDHLLNMIHNPVMILVHVRLKSS-NHGGNGTN----LNSDEL  71

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW-  1989
             + +F P+R Y AR+GI MKE  ++D++V  AI+ Y+N + V+N+VLGASS++  +R F  
Sbjct  72    NQLFIPYRGYCARKGISMKEVILDDSDVTTAILEYVNNNLVNNLVLGASSKNTFARSFMF  131

Query  1988  --THDVPTIVNKTAPDFCSVYVISKG-KQQSIRPAARPLTN------LPTHIWshhgsss  1836
                H+V   + K+ P+FCSVYVISKG K QS RPA RP+TN      +P+  +     S 
Sbjct  132   SKPHEVQANIMKSTPEFCSVYVISKGGKIQSSRPAQRPITNTLAPPRIPSSGFLIQSLSD  191

Query  1835  rassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADG---SVRRPWNSSCRNSL  1665
                         +      +A       +  P       D +     V    N + ++S 
Sbjct  192   SEQDLIPRVQRGARNKPNETAYPHNRAVNTTPKSNKTPMDFNNGFTQVAFQRNPTLQSSF  251

Query  1664  AEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDM  1485
             ++++++   +    D  +A  N+D+   S +  ++   ++KD+E+EM+RLKLELKQTMDM
Sbjct  252   SDESEVGGSMMGSID-LSAHNNIDYYGASSSSEESIPQSTKDIEAEMRRLKLELKQTMDM  310

Query  1484  YNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaeka  1305
             Y++ACKEA+TAK+ A EL Q KIEE+++FE+AR +EEAAL + EMEKAKC+AA+EAAEKA
Sbjct  311   YSSACKEALTAKRKANELNQWKIEEARKFEKARLSEEAALAVAEMEKAKCRAAIEAAEKA  370

Query  1304  qkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKI  1125
             Q++AE+E QR K AEMKAK E  +K+RA+S L+ +D RYRKY+I+EIE ATE+F+   KI
Sbjct  371   QRMAELEGQRRKQAEMKAKSEEEDKDRAVSALAHNDVRYRKYTIEEIEEATEQFANHRKI  430

Query  1124  GEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYG  945
             GEGGYGPVY G+LDHTPVAIKVLRPDAAQG+KQFQQEVEVLS +RHP+MVLLLGACPEYG
Sbjct  431   GEGGYGPVYNGELDHTPVAIKVLRPDAAQGKKQFQQEVEVLSSIRHPHMVLLLGACPEYG  490

Query  944   CLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPA  765
             CLVYEYMENGSLEDRL R+GN+P I W  RF+I+AEIATAL FLHQ+KPEPLVHRDLKPA
Sbjct  491   CLVYEYMENGSLEDRLFRRGNSPPISWRKRFEIAAEIATALSFLHQAKPEPLVHRDLKPA  550

Query  764   NILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDI  585
             NILLDRN+VSKISDVGLARLV P+VA++VTQYHMTSAAGT+CYIDPEYQQTG L TKSD+
Sbjct  551   NILLDRNYVSKISDVGLARLV-PAVANNVTQYHMTSAAGTWCYIDPEYQQTGMLTTKSDV  609

Query  584   YSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAE  405
             YSLG++LLQIITA+ PMGL H V RAI KGTF ++LDP + DWP++E   FA LSL+CAE
Sbjct  610   YSLGILLLQIITARQPMGLAHQVSRAISKGTFKEMLDPVVPDWPLQETQSFATLSLKCAE  669

Query  404   LRKKDRPDLGSVILPELNRLKELA  333
             LRK+DRPDLG  ++P L RLK+  
Sbjct  670   LRKRDRPDLGKDVVPHLIRLKKFG  693



>gb|KHN16327.1| U-box domain-containing protein 52 [Glycine soja]
Length=688

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/701 (54%), Positives = 484/701 (69%), Gaps = 58/701 (8%)
 Frame = -3

Query  2369  SSDGATTGP----ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGG  2202
             S  G TT P    +T+VAV+KDKNS  A +WT+++  I NP +I +HV+HK  P+H+  G
Sbjct  3     SHGGTTTTPPPLNVTMVAVEKDKNSGYAFRWTIEH--IDNPVIIAVHVKHKNIPHHE--G  58

Query  2201  PDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
              +      D   H VF P R     + +++KE  I+D+++ K IV Y   +RV+ +V+GA
Sbjct  59    TNVFPPDEDDIAH-VFKPLRHMCHGKVVMLKEAVIDDSDIVKGIVEYAQRNRVNTIVVGA  117

Query  2021  --SSRSAISR---------KF-WTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLT  1878
               SSR+ ++R         KF   HDV T V K+APD+ SVYVISKGK    RPA RP+ 
Sbjct  118   PHSSRNTLARTLNLRSGSKKFKGHHDVSTGVMKSAPDYSSVYVISKGKIVGARPAIRPMI  177

Query  1877  NLPTHIWshhgsssrassrgssaasssAGDDRISACSSR-GEHSGRPFRRSEDRDADGSV  1701
             N+                        S  ++ +   S R G  +GR  R          +
Sbjct  178   NV----------------------VPSQKENGVRTYSHRRGSTNGRSER-------SALL  208

Query  1700  RRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFT----RisdagsdassiaSKDLE  1533
               P  SS   ++ +   LF+  S G+ +++ +   +      +  D GS + S    D+E
Sbjct  209   EMPRCSSAGQTMNQ-RSLFSHTS-GYSDSSGSHKFESADGNKQDCDLGSTSDSQFLGDME  266

Query  1532  SEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVe  1353
             +EM+ L+L+LKQTMDMYN+ CK+ I A+  AKE+ Q K EE    E  +  +EAAL + E
Sbjct  267   AEMRMLRLKLKQTMDMYNSTCKDVILAQTKAKEINQWK-EERIAEEATKLPKEAALELAE  325

Query  1352  mekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSI  1173
              EK K +AA+EA E+A K+ E EAQR   AE+KA++E  EK+RAL++L  +D RYRKYSI
Sbjct  326   KEKVKAQAALEAYEEAIKMVEKEAQRRIQAEVKARREAQEKDRALNLLIINDTRYRKYSI  385

Query  1172  DEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLM  993
              +IE AT+KFS S+K+GEGGYGPV+RG+LDHTPVAIK+L PDA+ GR+QFQQEVE+L  +
Sbjct  386   KDIEEATQKFSPSLKVGEGGYGPVFRGQLDHTPVAIKILNPDASHGRRQFQQEVEILCSI  445

Query  992   RHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFL  813
             RHPNMVLLLGACPEYGCLVYEY+ENGSLEDRLL K ++P IPW  RF+I+AEIATALLFL
Sbjct  446   RHPNMVLLLGACPEYGCLVYEYLENGSLEDRLLMKNDSPPIPWWKRFEIAAEIATALLFL  505

Query  812   HQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYI  633
             HQ+KPEP+VHRDLKPANILLD+NFVSKISDVGLARLVPPSVAD VTQYH+T+AAGTFCYI
Sbjct  506   HQTKPEPIVHRDLKPANILLDKNFVSKISDVGLARLVPPSVADSVTQYHLTAAAGTFCYI  565

Query  632   DPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWP  453
             DPEYQQTGKL  KSDIYSLG+MLLQIITAKPPMGL HHV  AIEK TF+++LD  ISD P
Sbjct  566   DPEYQQTGKLTKKSDIYSLGIMLLQIITAKPPMGLAHHVRMAIEKETFSEMLDIMISDVP  625

Query  452   VEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
             +EEAL F KLSL C EL KKDRPDL +V++PELNRL++  L
Sbjct  626   LEEALAFVKLSLSCTELSKKDRPDLATVVVPELNRLRDFGL  666



>gb|ACE75946.1| calcium-dependent protein kinase [Camellia sinensis]
Length=708

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/689 (57%), Positives = 487/689 (71%), Gaps = 35/689 (5%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             TVVA+DK+K+S+ AV+W VD+L  +I N  +IL+HVR K S NH        G   D D 
Sbjct  17    TVVAIDKEKHSSFAVRWAVDHLFNMILNSVMILVHVRLKNS-NHG-------GNFDDGDL  68

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA---SSRSAISRK  1995
             + +F P+R Y AR+G+     F+ D  VA  +  Y+    V+N+VLGA    S S     
Sbjct  69    NQLFVPYRGYCARKGV-----FLVDFVVADTVFSYVVLDLVNNLVLGAFVLGSFSRCFFF  123

Query  1994  FWTHDVPTIVNKTAPDFCSVY-----VISKGKQQSIRPAARPLTN--LPTHIWshhgsss  1836
                H V + V  ++  FCSVY     VI +    S RP   PL    +P+ +        
Sbjct  124   SSLHLVQSRVVASSVVFCSVYFFSVCVIFQCSVPSSRPVPSPLAPPLVPSCV-FFFPFFF  182

Query  1835  rassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPW---------NS  1683
               +    S     AG + ++A  S       P R       +GS+   +         NS
Sbjct  183   AGADDVLSRVRRRAGSNPVAASYSHDRAGFNPVREVYKIPINGSLDFNYGFSQGAFQRNS  242

Query  1682  SCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLEL  1503
             + R+S ++++     +      +  A    F   S +  ++ S +++D+E+EM+RLKLEL
Sbjct  243   TLRSSFSDESSGVFCVMVLVSLSFRAGMFFFVGGSGSSDESVSQSTRDIEAEMRRLKLEL  302

Query  1502  KQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaam  1323
             KQTMDMY++ACKEA+TAK+ A EL Q K+EE++RFE+AR +EEAAL + EMEKAKC+AA+
Sbjct  303   KQTMDMYSSACKEALTAKRKANELNQWKMEEARRFEEARLSEEAALAVAEMEKAKCRAAL  362

Query  1322  eaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKF  1143
             EAAEKAQ++AE+E QR K AEMKA  E+ EK+RA+S L  +D RYRKY IDEIE ATE+F
Sbjct  363   EAAEKAQRMAELEGQRRKQAEMKAVSESQEKDRAVSALVHNDVRYRKYCIDEIEVATERF  422

Query  1142  SKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLG  963
             +   KIGEGGYGPVY G LDHTPVAIKVLRPDAAQG+KQFQQEVEVL  +RHP+MVLLLG
Sbjct  423   ANHRKIGEGGYGPVYHGALDHTPVAIKVLRPDAAQGKKQFQQEVEVLCCIRHPHMVLLLG  482

Query  962   ACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVH  783
             ACPEYGCLVYE+M  GSLEDRL RKGN+P IPW  RFKI+A IA  LLFLHQ+KPEPLVH
Sbjct  483   ACPEYGCLVYEFMNYGSLEDRLFRKGNSPPIPWRNRFKIAAGIAIGLLFLHQTKPEPLVH  542

Query  782   RDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKL  603
             RDLKPANILLDRNFV KISDVGLARLVPPSVA+ VTQYHMTSAAGTFCYIDPEYQQTG+L
Sbjct  543   RDLKPANILLDRNFVCKISDVGLARLVPPSVANSVTQYHMTSAAGTFCYIDPEYQQTGEL  602

Query  602   GTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKL  423
             GTKSDIYSLGV+LLQIITA+PPMGLTHH++RAI+KGTFA+LLDPT+ DWPVEEA+ FAKL
Sbjct  603   GTKSDIYSLGVLLLQIITARPPMGLTHHIDRAIQKGTFAELLDPTVPDWPVEEAMQFAKL  662

Query  422   SLQCAELRKKDRPDLGSVILPELNRLKEL  336
             +L+C ELRKKDRP+LG  I+PEL RL++L
Sbjct  663   ALKCCELRKKDRPELGLTIMPELARLRDL  691



>ref|XP_004501455.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Cicer arietinum]
Length=703

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/691 (54%), Positives = 486/691 (70%), Gaps = 46/691 (7%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNG--GPDAHGGMSDHD  2169
             IT+VAVDKDKNSA A +W +++L   NP ++ +HV+HK  PN       PD      + D
Sbjct  15    ITMVAVDKDKNSAYAFRWAINHL--DNPVIVAVHVKHKNLPNLGTNVYPPD------EED  66

Query  2168  GHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAIS--RK  1995
                +F   RA   R+ + MKE  I+D +V K ++ + N + + ++V+GAS+++ ++  +K
Sbjct  67    VALIFNNLRAMCQRKAVTMKEAVIDDHDVVKGLLDFANRNSIHSIVIGASNKNHLTSLKK  126

Query  1994  FWT-HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN--------LPTHIWshhgs  1842
             F   HD+P  + K+APD+CSVY+ISK K  S R A R + N        LP  +  H   
Sbjct  127   FKVYHDIPAAIIKSAPDYCSVYIISKLKIASARSAVRSMGNGNQSIPSKLPVQVGQHAEF  186

Query  1841  ssrassrgssaasssAGDDRIS---ACSSRGEHSGRPFRRSEDRDAD-----GSVRRPWN  1686
              +   S    ++ ++ G +  S     +++G+   RP     +   D     G   R W 
Sbjct  187   ETGIRSVLPRSSVTNEGSESRSFDSITATKGQTRERPRSAGSNLSMDKIDIPGGRGRHWA  246

Query  1685  SSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLE  1506
             S     +A    +   + D     +A+                   SKDLE+EMKRL+ E
Sbjct  247   SMDERDMAALGPIDLDVPDSLGTPSASHT-----------------SKDLEAEMKRLRRE  289

Query  1505  LKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaa  1326
             LKQTMDMY++ACK+AI+AK  A+++++ K+EE ++ E+ R ++EAAL M E EKA+ KAA
Sbjct  290   LKQTMDMYSSACKQAISAKNQAEQIRRWKVEEERKVEEVRMSQEAALAMAEREKARAKAA  349

Query  1325  meaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEK  1146
             MEAAE A++ AE EAQR + AEMKA+KE  E++R L+ L+++D RYRKY+++EIE ATEK
Sbjct  350   MEAAEDAKRKAEQEAQRRREAEMKARKEAEERDRVLTALAQNDNRYRKYTMEEIEVATEK  409

Query  1145  FSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLL  966
             FS S K+GEGGYGPVY+G LDHT VAIK+L P+A+QGRKQFQQEVEVLS +RHPNMVLLL
Sbjct  410   FSPSKKLGEGGYGPVYKGHLDHTAVAIKLLNPEASQGRKQFQQEVEVLSCIRHPNMVLLL  469

Query  965   GACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLV  786
             GACPE+GCLVYE+M+NGSLEDRL RK N+  + W+ RF+ISAEIATALLFLHQ+KPEP+V
Sbjct  470   GACPEHGCLVYEFMDNGSLEDRLFRKNNSRPLTWQKRFQISAEIATALLFLHQTKPEPIV  529

Query  785   HRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGK  606
             HRDLKP+NILLDRN+VSKISDVGLARLVP SV D+VTQY+MTSAAGTFCYIDPEYQQTG 
Sbjct  530   HRDLKPSNILLDRNYVSKISDVGLARLVPSSVVDNVTQYYMTSAAGTFCYIDPEYQQTGI  589

Query  605   LGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAK  426
             L TKSDIYSLGVMLLQ+ITAKPPMGL HHV+RA+EK    ++LDP ++DWPVE AL FAK
Sbjct  590   LTTKSDIYSLGVMLLQVITAKPPMGLAHHVKRAVEKDRIVEILDPAVTDWPVEAALSFAK  649

Query  425   LSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             L+L C EL KKDRP+L +V+LPELNRL++L 
Sbjct  650   LALGCVELSKKDRPNLATVVLPELNRLRDLG  680



>ref|XP_006394859.1| hypothetical protein EUTSA_v10005575mg [Eutrema salsugineum]
 gb|ESQ32145.1| hypothetical protein EUTSA_v10005575mg [Eutrema salsugineum]
Length=698

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/689 (57%), Positives = 496/689 (72%), Gaps = 34/689 (5%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLL--ISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             TV+A+DK+K S  AV+W VD+L   I NPF+ LLHVRHK S NH   G       ++ D 
Sbjct  17    TVIAIDKEKQSHYAVRWAVDHLFTAIHNPFITLLHVRHKIS-NHGGNG----ANFNNDDL  71

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW-  1989
             + +F P+R Y AR+G+I+     ED++VAKAI+ Y+N + V+N+VLG+SS++A +R    
Sbjct  72    NQLFVPYRGYCARKGVIL-----EDSDVAKAILDYVNNNLVNNLVLGSSSKNAFARTLMF  126

Query  1988  --THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgs  1815
                H+V   + K+ P+FCSVYVISKGK  S    +RP     T+  +     S      S
Sbjct  127   SKPHEVQASILKSTPEFCSVYVISKGKVVS----SRPAQRPITNTLAPPRVPSSGFLIQS  182

Query  1814  saasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSC--RNSLAEDNDLFA  1641
              + S      R+   + R      P  R+ +      +    N S    N   + +    
Sbjct  183   LSDSEQDFVPRVQRSARRKSTEIYPHNRAFNTTQQRQINPKKNESTDFNNGFTQVSFQRK  242

Query  1640  P-ISDGFDNAA------------AAQNLDFTRisdagsdassiaSKDLESEMKRLKLELK  1500
             P I   F + +            +A NLD+   S +  ++    +KD+E+EM+RLK+ELK
Sbjct  243   PTIQSSFSDESEGGLGMIGSIDLSAHNLDYYGASSSSDESIPQTTKDIEAEMRRLKIELK  302

Query  1499  QTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaame  1320
             QTMDMY++ACKEA+TAK+ A EL Q KIEE+++FE+AR +EEAAL + EMEKAKC+ A+E
Sbjct  303   QTMDMYSSACKEALTAKRKANELNQWKIEEARKFEKARLSEEAALAVAEMEKAKCRTALE  362

Query  1319  aaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFS  1140
             AAEKAQ++AE+E QR K AEMKA+ E  +K+RA++ L+ +D RYR+Y+I+EIE ATE+F 
Sbjct  363   AAEKAQRMAELEGQRRKQAEMKARSEEEDKDRAMTALAHNDARYRRYTIEEIEEATERFG  422

Query  1139  KSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGA  960
                KIGEGGYGPVY+G+LDHTPVAIKVLRPDAAQGRKQFQQEVEVLS +RHPNMVLLLGA
Sbjct  423   NHRKIGEGGYGPVYKGELDHTPVAIKVLRPDAAQGRKQFQQEVEVLSCIRHPNMVLLLGA  482

Query  959   CPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHR  780
             CPEYGCLVYE+MENGSLEDRLLR+GN+  + W  RF+I+A+IATAL FLH +KPEPLVHR
Sbjct  483   CPEYGCLVYEFMENGSLEDRLLRRGNSQPLSWRKRFEIAADIATALSFLHHAKPEPLVHR  542

Query  779   DLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLG  600
             DLKP NILLD+N+VSKISDVGLARLVP SVAD VTQYHMTSAAGTFCYIDPEYQQTGKL 
Sbjct  543   DLKPGNILLDKNYVSKISDVGLARLVPASVADSVTQYHMTSAAGTFCYIDPEYQQTGKLT  602

Query  599   TKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLS  420
             TKSDIYSLG++LLQIITAKPPMGL H V RAI +GTF ++LDP +SDWP++EA  FA LS
Sbjct  603   TKSDIYSLGILLLQIITAKPPMGLAHLVARAISRGTFKEMLDPVVSDWPLQEAQSFAILS  662

Query  419   LQCAELRKKDRPDLGSVILPELNRLKELA  333
             L+CAELRK+DRPDLG  ++P+L RLK L 
Sbjct  663   LKCAELRKRDRPDLGKDVVPQLIRLKNLG  691



>gb|AID16034.1| putative universal stress protein [Catharanthus roseus]
Length=770

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/735 (53%), Positives = 499/735 (68%), Gaps = 72/735 (10%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHK--------------------AS  2223
             +  VA+DKD+ S SA+KW V+NLL     ++L+HV+ +                    ++
Sbjct  9     LIAVAIDKDRASQSALKWAVENLLARGQTILLIHVKIRPGSSSLFSSSSLTMPRLNPISN  68

Query  2222  PNHQNGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRV  2043
             P+ +NG P   GG  D +   +F P+R Y  R+ II ++  +ED++  KA++ +++   V
Sbjct  69    PSDENGTP---GGDIDAETKELFLPYRVYCTRKDIICQDIVLEDSDTVKALLEFVSRTGV  125

Query  2042  SNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP---LTNL  1872
               +VLG++++++  R F   D+P  V K  PDFCSVYVISKGK  S R A+RP   +  L
Sbjct  126   EILVLGSATKNSFFR-FKAKDIPASVLKGVPDFCSVYVISKGKILSTRTASRPAPAIHPL  184

Query  1871  PTHIWshhgsssrassrgssaasssAGDDRI-----------------SACSSRGEHSGR  1743
                I     S S  S        +S G  +                  S  ++R   +GR
Sbjct  185   RQQILQQANSMSAVSEASLQPPINSRGGAKSVSDLPFPQMSNENFSIKSPFNNRKGPNGR  244

Query  1742  PFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAA-----------QNL  1596
             P+      D+D S    + SS R S+  DN   A   + F+                Q+ 
Sbjct  245   PYELIGSLDSDIS----FVSSGRPSI--DNLFPANFHESFETGTTPPRLSSFSEMENQSF  298

Query  1595  DF---------TRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKS  1443
             D          T      S  S+ +  D+E+EM+RLKLELKQTMDMY+ ACKEA++AK+ 
Sbjct  299   DLGYPGRRSVDTLTPPDSSYVSTDSMDDVEAEMRRLKLELKQTMDMYSTACKEALSAKQR  358

Query  1442  AKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkya  1263
             A ELQ+ K EE QR E+AR AEEAAL + E EKAK +AA+E AE AQ+IAE+E+Q+   A
Sbjct  359   AMELQRWKQEEQQRLEEARLAEEAALALAEKEKAKSRAAIEHAEAAQRIAELESQKRINA  418

Query  1262  emkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLD  1083
             E+KA KE+ EKN+ L+ LS  D RYRKY+I+EIE AT+ F++S+KIGEGGYGPVY+  LD
Sbjct  419   ELKALKESEEKNKVLNKLS--DIRYRKYTIEEIESATDYFNQSLKIGEGGYGPVYKCNLD  476

Query  1082  HTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLED  903
             HTPVA+KVLRPDAAQG+ QFQQEVEVLS +RHP+MVLLLGACPEYGCLVYEYM NGSLED
Sbjct  477   HTPVAVKVLRPDAAQGKSQFQQEVEVLSCIRHPHMVLLLGACPEYGCLVYEYMSNGSLED  536

Query  902   RLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISD  723
             RL R+GNTP + W+ RF+I+AEI   LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISD
Sbjct  537   RLFRRGNTPPLSWQHRFRIAAEIGMGLLFLHQTKPEPLVHRDLKPANILLDRNYVSKISD  596

Query  722   VGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAK  543
             VGLARLVPPSVAD+VTQY MTS AGTFCYIDPEYQQTG LG KSDIYSLG++ LQI+T+K
Sbjct  597   VGLARLVPPSVADNVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIIFLQILTSK  656

Query  542   PPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVIL  363
             PPMGLTH+VERAIEKGTFA+LLD  + DWPVE+AL  AKL+L+C+ELR+KDRPDLG V++
Sbjct  657   PPMGLTHYVERAIEKGTFAELLDSAVPDWPVEDALRLAKLALKCSELRRKDRPDLGKVVM  716

Query  362   PELNRLKELALQSLA  318
             PEL RL+ LA ++++
Sbjct  717   PELERLRSLAEENIS  731



>ref|NP_197987.1| protein kinase [Arabidopsis thaliana]
 gb|AED93530.1| protein kinase [Arabidopsis thaliana]
Length=703

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/693 (56%), Positives = 497/693 (72%), Gaps = 41/693 (6%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLL--ISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             TVVA+DK+K+S+ AV+W VD+LL  I NP +IL+HVR K S NH          +++ D 
Sbjct  17    TVVAIDKEKHSSYAVRWAVDHLLNMIHNPVMILVHVRTKNS-NHG-------ANLNNDDL  68

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW-  1989
             + +F P+R Y AR+G+++     +D++VAK I+ Y+N + V+N+VLGAS+++  +R F  
Sbjct  69    NQLFIPYRGYCARKGVVL-----DDSDVAKTILDYVNNNLVNNLVLGASTKNTFARSFMF  123

Query  1988  --THDVPTIVNKTAPDFCSVYVISKG-KQQSIRPAARPLTNLPTHIWshhgsssrassrg  1818
                H+V + + K+ PDFCSVYVISKG K QS    +RP     T+  +     S      
Sbjct  124   SKPHEVQSSIMKSTPDFCSVYVISKGGKVQS----SRPAQRPITNTLAPPRVPSSGFLIQ  179

Query  1817  ssaasssAGDDRIS-ACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSC-------RNSLA  1662
             S + S      R+  +  ++   +  P  R+         + P N S        + +  
Sbjct  180   SLSDSEQDLIPRVQRSARNKPNETTYPHNRAAFNTTQKGYKSPINGSMDFNNGFNQAAFQ  239

Query  1661  EDNDLFAPISDGFDNA---------AAAQNLDFTRisdagsdass-iaSKDLESEMKRLK  1512
              +  L +  SD  D           ++  ++DF   + + S+ S   ++KD+E+EM+RLK
Sbjct  240   RNPTLQSSFSDESDGGFGVMGSVDLSSQNSMDFYHGASSSSEESIPQSTKDIEAEMRRLK  299

Query  1511  LELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakck  1332
             LELKQTMDMY++ACKEA+TAK+ A EL Q KIEE+++FE+AR +EEAAL + E+EKAKC+
Sbjct  300   LELKQTMDMYSSACKEALTAKRKANELNQWKIEEARKFEKARLSEEAALAVAEIEKAKCR  359

Query  1331  aameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFAT  1152
              A+EAAEKAQ++AE+E QR K AEMKA  E  +K+RA+S L+ +D RYRKYSI+EIE AT
Sbjct  360   TAVEAAEKAQRMAELEGQRRKQAEMKAVSEEKDKDRAVSALAHNDVRYRKYSIEEIEEAT  419

Query  1151  EKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVL  972
             E+F+   KIGEGGYGPVY G+LDHTPVAIKVLRPDAAQG+KQFQQEVEVL  +RHP+MVL
Sbjct  420   ERFANHRKIGEGGYGPVYNGELDHTPVAIKVLRPDAAQGKKQFQQEVEVLCSIRHPHMVL  479

Query  971   LLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEP  792
             LLGACPEYGCLVYE+MENGSLEDRL R GN+P + W  RF+I+AEIATAL FLHQ+KPEP
Sbjct  480   LLGACPEYGCLVYEFMENGSLEDRLFRTGNSPPLSWRKRFEIAAEIATALSFLHQAKPEP  539

Query  791   LVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQT  612
             LVHRDLKPANILLD+N+VSKISDVGLARLVP S+AD VTQ+HMTSAAGTFCYIDPEYQQT
Sbjct  540   LVHRDLKPANILLDKNYVSKISDVGLARLVPASIADSVTQFHMTSAAGTFCYIDPEYQQT  599

Query  611   GKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHF  432
             G L TKSD+YSLG++LLQIIT +PPMGL H V RAI KGTF ++LDP + DWPV+EA  F
Sbjct  600   GMLTTKSDVYSLGILLLQIITGRPPMGLAHQVSRAISKGTFKEMLDPVVPDWPVQEAQSF  659

Query  431   AKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             A L+L+CAELRK+DRPDLG  ++P L RLK   
Sbjct  660   ATLALKCAELRKRDRPDLGKEVVPHLIRLKNFG  692



>ref|XP_009125843.1| PREDICTED: U-box domain-containing protein 51 [Brassica rapa]
Length=1140

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/691 (58%), Positives = 497/691 (72%), Gaps = 42/691 (6%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             TVVA+DKDKNS  AV+W V++L  LI N  +IL+HVR K S          HGG  + + 
Sbjct  464   TVVAIDKDKNSHYAVRWAVEHLFNLIDNRNMILVHVRLKNS---------NHGGNVNDEL  514

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS---AISRK  1995
             + +F P+R Y AR+GI M E  ++D +V  AI+ Y N + V+N+VLG +S     A S K
Sbjct  515   NKLFIPYRGYCARKGISMMEVILDDIDVPNAILDYANNNLVNNIVLGTTSSKNPFARSLK  574

Query  1994  FW-THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrg  1818
             F  +HDV   V K+ P+FCSVYVISKGK QS R A RP+TN            + A  R 
Sbjct  575   FTKSHDVAASVLKSTPEFCSVYVISKGKVQSSRAAQRPITN------------TLAPPRA  622

Query  1817  ssaasssAGDDRISACSSRGEHSGR---PFRRSEDRDADGSVRRPWNSSCRNSLAEDNDL  1647
              +    +  D        RG+ +GR   P R     +   +VR    S+    L  + D 
Sbjct  623   PTFHLQNLPDPDQDHHLPRGQRNGRNITPERYRPHENGFNAVRERHKSAANGPLDFNYDF  682

Query  1646  FAPISD-GFDNA-----------AAAQNLDFTRisdagsdassiaSKDLESEMKRLKLEL  1503
               P+    FD              +A N D    S +  ++ S ++KD+E+EM+RLK+EL
Sbjct  683   NQPMGQRNFDEPDFGTRMMGSIDQSAHNFDIIGSSSSSDESVSQSNKDVEAEMRRLKIEL  742

Query  1502  KQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaam  1323
             KQTMDMY++ACKEA+ AK+ A EL + K+EE+ RFE+AR AEEAAL + E EKAKC+AAM
Sbjct  743   KQTMDMYSSACKEALDAKQKANELNKWKLEETLRFEEARSAEEAALAVAETEKAKCRAAM  802

Query  1322  eaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKF  1143
             EAAEK+Q++A++E QR K AEMKA++E+ EK+RA+S L ++D RYR+YSI+EIE AT +F
Sbjct  803   EAAEKSQRMADLEGQRRKQAEMKARRESQEKDRAISALVQNDVRYRRYSIEEIEEATNRF  862

Query  1142  SKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLG  963
             + + +IGEGGYGPV+ G LDHTPVAIKVLR DAAQG+KQF QEVEVLS +RHP+MVLLLG
Sbjct  863   ASNRQIGEGGYGPVFEGTLDHTPVAIKVLRADAAQGKKQFNQEVEVLSCIRHPHMVLLLG  922

Query  962   ACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVH  783
             ACPEYGCLVYE+MENGSLEDRL R+GN+P + W  RF+I+AEIATAL FLHQ+KPEPLVH
Sbjct  923   ACPEYGCLVYEFMENGSLEDRLFRRGNSPPLSWRKRFQIAAEIATALSFLHQTKPEPLVH  982

Query  782   RDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKL  603
             RDLKPANILLDRN+VSKISDVGLARLVP SVAD VTQYHMTSAAGTFCYIDPEYQQTGKL
Sbjct  983   RDLKPANILLDRNYVSKISDVGLARLVPASVADTVTQYHMTSAAGTFCYIDPEYQQTGKL  1042

Query  602   GTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKL  423
              TKSD+YSLG+MLLQIITAK PMGL HHV RAI KGTF D+LDP ++DWPVEEA+ FAKL
Sbjct  1043  TTKSDVYSLGIMLLQIITAKSPMGLAHHVSRAISKGTFKDMLDPVVTDWPVEEAMAFAKL  1102

Query  422   SLQCAELRKKDRPDLGSVILPELNRLKELAL  330
              L+CAELRKKDRP+LG  I+PEL RL+   +
Sbjct  1103  CLKCAELRKKDRPNLGKDIVPELVRLRNFGM  1133



>ref|XP_006466153.1| PREDICTED: U-box domain-containing protein 52-like [Citrus sinensis]
Length=746

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/714 (52%), Positives = 495/714 (69%), Gaps = 37/714 (5%)
 Frame = -3

Query  2366  SDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHG  2187
             ++  T   IT VA+D DK+S  AVKW VDNLL      +LLHVR+ +S N Q     + G
Sbjct  15    ANAITANAITAVAIDADKSSQYAVKWAVDNLLNETSQYVLLHVRNHSS-NPQELEASSIG  73

Query  2186  G--MSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSR  2013
             G   ++ +   +F P+R   AR+ I+ +E  ++D +V+ A++ Y+  + V N+V G SSR
Sbjct  74    GRPATNDELQKLFLPYRGLFARKRILAREVVLQDIDVSSALIYYVKNNSVGNIVAGGSSR  133

Query  2012  SAISRKFWTHDVPTIVNKTAPDFCSVYVIS-KGKQQSIRPAAR---------------PL  1881
             + ++RKF   D+P+ + K+AP+ C+VY+IS KGK QS RPAA                PL
Sbjct  134   NLLTRKFRNLDLPSSLLKSAPESCAVYIISSKGKIQSSRPAASQPQMLSGDALIPKQPPL  193

Query  1880  TNLPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADG--  1707
                P+ I      S        S       D  IS  + R   S    +++++  ++   
Sbjct  194   GERPSVIQPDSPRSVEIGRSDYSC------DSSISKVTDRNYSSSDNSQKAKNGKSESTF  247

Query  1706  ---SVRRPWNSSCRNSLAEDN-----DLFAPISDGFDNAAAAQNLDFTRisdagsdassi  1551
                S   P +S  +NS   ++     D   P+S  + +   ++N+D + +S +  D    
Sbjct  248   PIVSSILPADSHMQNSFNSESESDISDFSVPVS--YQSTEISENIDCSSLSKSSKDHFPQ  305

Query  1550  aSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeea  1371
             + K LE+E+KRL+LELKQ+M++YN+  KEA++  ++A +LQQ K EE+ + E+AR AEEA
Sbjct  306   SPKGLEAEIKRLRLELKQSMEIYNSVSKEAVSTSQTAVKLQQRKKEEALKLEEARLAEEA  365

Query  1370  alRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCR  1191
             AL +V+ E+ K +AAMEAA  AQ++ E+EA + + AE+KA +E  EK   +  ++  + R
Sbjct  366   ALALVKSERQKTRAAMEAALMAQRLVELEAMKREIAELKAMQEEEEKKIVMEAMAYKNVR  425

Query  1190  YRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEV  1011
             YRKY+I+EIE AT+ FS S KIGEGGYGPVY+ +LDHT VAIKVL PD +QG +QF+QEV
Sbjct  426   YRKYTIEEIEAATDYFSISRKIGEGGYGPVYKAQLDHTSVAIKVLGPDISQGPRQFKQEV  485

Query  1010  EVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIA  831
             E+L  MRHPNMV+LLGACPEYGCLVYEYMENGSLEDRL +K N+P I W IRFKI+AEIA
Sbjct  486   EILGSMRHPNMVILLGACPEYGCLVYEYMENGSLEDRLFQKDNSPPIHWSIRFKIAAEIA  545

Query  830   TALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAA  651
             TALLFLHQ+KPEPLVHRDLKPANILLD+N+VSKISDVGLARLVPPS AD +TQYHMT+AA
Sbjct  546   TALLFLHQNKPEPLVHRDLKPANILLDQNYVSKISDVGLARLVPPSAADTITQYHMTTAA  605

Query  650   GTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDP  471
             GTFCYIDPEYQQTG LG KSD+YSLGV+LLQ+ITA+P MGL+H VE+AI+ GTF++LLDP
Sbjct  606   GTFCYIDPEYQQTGMLGVKSDLYSLGVVLLQLITARPAMGLSHQVEQAIQNGTFSELLDP  665

Query  470   TISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKN  309
             T++ WPVE AL  AKL+LQC ELRK+DRPDL SV+LPEL RL++L  ++  +KN
Sbjct  666   TVTGWPVEAALSIAKLALQCCELRKRDRPDLASVVLPELIRLRDLGFENAENKN  719



>ref|XP_006850971.1| hypothetical protein AMTR_s00025p00206220 [Amborella trichopoda]
 gb|ERN12552.1| hypothetical protein AMTR_s00025p00206220 [Amborella trichopoda]
Length=807

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/734 (53%), Positives = 494/734 (67%), Gaps = 71/734 (10%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASP------NH------QNGGPDA  2193
              VA+DKDK S  A+KW VD+L+     + L+HV++K         NH            A
Sbjct  29    AVAIDKDKGSQYALKWAVDHLVTKGQTITLIHVKNKIQTVPTPMGNHVSISEVSEEVASA  88

Query  2192  HGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSR  2013
                  +     +  PFR +  R+ +  K+  +ED++V KAI+ Y+    + N+VLGAS+R
Sbjct  89    FREQMEAQIRELLMPFRCFCTRKDVHCKDAILEDSDVTKAIIDYVALESIDNLVLGASTR  148

Query  2012  SAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPL----------------  1881
             S+  R+F +HD+PT ++K  PDFC+VYVISKGK  S+R A RP                 
Sbjct  149   SSFLRRFKSHDIPTSISKGTPDFCTVYVISKGKLASVRSAVRPAPPPPLRNSSPRNHPIT  208

Query  1880  -TNLPTHIWshhgsssrassrgssaasssAGD--DRISACSSRGEHSGRPF---------  1737
              +N+P+ I             G+       GD  D I +  +RG     P          
Sbjct  209   ASNIPSPI--------HPIKVGAGHEQKRLGDHSDPIMSPFARGGRGSNPRLSENTMPES  260

Query  1736  --------RRSEDRDADGSV-------RRPWNSSCRNSLAED---NDLFAPISDG----F  1623
                     ++S DR    S+       R P  SS  +S+ ED   N  F  I  G     
Sbjct  261   DISYVSHGKKSADRFYPASLYEHFESSRPPRLSSGAHSIEEDFNHNHSFESIHSGDHKSI  320

Query  1622  DNAAAAQNLD-FTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKK  1446
             D+A+ A      ++  ++ +  SS   +D+E+EMKRL+LELKQTMDMY++ACKEA+ AK 
Sbjct  321   DSASTAPEFSTVSQEMESRTSWSSQTMEDVEAEMKRLRLELKQTMDMYSSACKEALNAKN  380

Query  1445  SAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTky  1266
              A+EL   K+EE  R E+A  AEEAA  + E EKAKCKAAMEAAE AQ+IAE+E+Q+ + 
Sbjct  381   KARELHLWKMEEEHRLEEAMLAEEAARAVAEKEKAKCKAAMEAAEAAQRIAELESQKRRN  440

Query  1265  aemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKL  1086
             AE+KA+KET EK +AL  L+ +D RYRKY+I+EIE AT+ F++  KIGEGGYGPVY+  L
Sbjct  441   AELKAQKETEEKKKALDALAHTDVRYRKYTIEEIETATDFFAEDRKIGEGGYGPVYKCYL  500

Query  1085  DHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLE  906
             +HT VAIKVLRPDAAQGR QFQQEVEVLS +RHPNMVLLLGACPEYGCLVYEYM NGSLE
Sbjct  501   EHTSVAIKVLRPDAAQGRMQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLE  560

Query  905   DRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKIS  726
             D L R+GN+P++ W+ RF+I+AEI TALLFLHQ+KPEPLVHRDLKP NILLD N+VSKIS
Sbjct  561   DCLFRRGNSPSLTWQQRFRIAAEIGTALLFLHQTKPEPLVHRDLKPGNILLDHNYVSKIS  620

Query  725   DVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITA  546
             DVGLARLVP +VA+ VTQY MTS AGTFCYIDPEYQQTG LG KSDIYSLG+MLLQ+I+A
Sbjct  621   DVGLARLVPQNVANTVTQYRMTSTAGTFCYIDPEYQQTGMLGIKSDIYSLGIMLLQMISA  680

Query  545   KPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVI  366
             KPPMGLTH++ERAIEK TF D+LDPT+ DWP EEAL FA+L+L+C+ELR+KDRPDL  VI
Sbjct  681   KPPMGLTHYIERAIEKDTFKDMLDPTVPDWPEEEALSFAQLALKCSELRRKDRPDLTKVI  740

Query  365   LPELNRLKELALQS  324
             LPELNRL+ LA +S
Sbjct  741   LPELNRLRALADES  754



>ref|XP_003545424.1| PREDICTED: U-box domain-containing protein 51-like [Glycine max]
Length=860

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/697 (54%), Positives = 480/697 (69%), Gaps = 47/697 (7%)
 Frame = -3

Query  2369  SSDGATTGP----ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGG  2202
             S  G TT P    +T+VAV+KDKNS  A +WT+++  I NP +I +HV+HK  P+H+  G
Sbjct  3     SHGGTTTTPPPLNVTMVAVEKDKNSGYAFRWTIEH--IDNPVIIAVHVKHKNIPHHE--G  58

Query  2201  PDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
              +      D   H VF P R     + +++KE  I+D+++ K IV Y   +RV+ +V+GA
Sbjct  59    TNVFPPDEDDIAH-VFKPLRHMCHGKVVMLKEAVIDDSDIVKGIVEYAQRNRVNTIVVGA  117

Query  2021  --SSRSAISR---------KF-WTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLT  1878
               SSR+ ++R         KF   HDV T V K+APD+ SVYVISKGK    RPA RP+ 
Sbjct  118   PHSSRNTLARTLNLRSGSKKFKGHHDVSTGVMKSAPDYSSVYVISKGKIVGARPAIRPMI  177

Query  1877  NLPTHIWshhgsssrassrgssaasssAGDDRISACSSRGE-HSGRPFRRSEDRDADGSV  1701
             N+      +   +       ++  S  +    +  CSS G+  + R         +D S 
Sbjct  178   NVVPSQKENGVRTYSHRRGSTNGRSERSALLEMPRCSSAGQTMNQRSLFSHTSGYSDSSG  237

Query  1700  RRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMK  1521
                + S+  N   +D DL         + + +Q L F                D+E+EM+
Sbjct  238   SHKFESADGNK--QDCDL--------GSTSDSQFLSF--------------QGDMEAEMR  273

Query  1520  RLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemeka  1341
              L+L+LKQTMDMYN+ CK+ I A+  AKE+ Q K EE    E  +  +EAAL + E EK 
Sbjct  274   MLRLKLKQTMDMYNSTCKDVILAQTKAKEINQWK-EERIAEEATKLPKEAALELAEKEKV  332

Query  1340  kckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIE  1161
             K +AA+EA E+A K+ E EAQR   AE+KA++E  EK+RAL++L  +D RYRKYSI +IE
Sbjct  333   KAQAALEAYEEAIKMVEKEAQRRIQAEVKARREAQEKDRALNLLIINDTRYRKYSIKDIE  392

Query  1160  FATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPN  981
              AT+KFS S+K+GEGGYGPV+RG+LDHTPVAIK+L PDA+ GR+QFQQEVE+L  +RHPN
Sbjct  393   EATQKFSPSLKVGEGGYGPVFRGQLDHTPVAIKILNPDASHGRRQFQQEVEILCSIRHPN  452

Query  980   MVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSK  801
             MVLLLGACPEYGCLVYEY+ENGSLEDRLL K ++P IPW  RF+I+AEIATALLFLHQ+K
Sbjct  453   MVLLLGACPEYGCLVYEYLENGSLEDRLLMKNDSPPIPWWKRFEIAAEIATALLFLHQTK  512

Query  800   PEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEY  621
             PEP+VHRDLKPANILLD+NFVSKISDVGLARLVPPSVAD VTQYH+T+AAGTFCYIDPEY
Sbjct  513   PEPIVHRDLKPANILLDKNFVSKISDVGLARLVPPSVADSVTQYHLTAAAGTFCYIDPEY  572

Query  620   QQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEA  441
             QQTGKL  KSDIYSLG+MLLQIITAKPPMGL HHV  AIEK TF+++LD  ISD P+EEA
Sbjct  573   QQTGKLTKKSDIYSLGIMLLQIITAKPPMGLAHHVRMAIEKETFSEMLDIMISDVPLEEA  632

Query  440   LHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
             L F KLSL C EL KKDRPDL +V++PELNRL++  L
Sbjct  633   LAFVKLSLSCTELSKKDRPDLATVVVPELNRLRDFGL  669



>ref|XP_004501454.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Cicer arietinum]
Length=718

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/701 (53%), Positives = 488/701 (70%), Gaps = 51/701 (7%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQ------------NGGP  2199
             IT+VAVDKDKNSA A +W +++L   NP ++ +HV+HK  PN +              G 
Sbjct  15    ITMVAVDKDKNSAYAFRWAINHL--DNPVIVAVHVKHKNLPNRRLIFYIYMVILLIAVGT  72

Query  2198  DAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
             + +    + D   +F   RA   R+ + MKE  I+D +V K ++ + N + + ++V+GAS
Sbjct  73    NVYPP-DEEDVALIFNNLRAMCQRKAVTMKEAVIDDHDVVKGLLDFANRNSIHSIVIGAS  131

Query  2018  SRSAIS--RKFWT-HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN--------L  1872
             +++ ++  +KF   HD+P  + K+APD+CSVY+ISK K  S R A R + N        L
Sbjct  132   NKNHLTSLKKFKVYHDIPAAIIKSAPDYCSVYIISKLKIASARSAVRSMGNGNQSIPSKL  191

Query  1871  PTHIWshhgsssrassrgssaasssAGDDRIS---ACSSRGEHSGRPFRRSEDRDAD---  1710
             P  +  H    +   S    ++ ++ G +  S     +++G+   RP     +   D   
Sbjct  192   PVQVGQHAEFETGIRSVLPRSSVTNEGSESRSFDSITATKGQTRERPRSAGSNLSMDKID  251

Query  1709  --GSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDL  1536
               G   R W S     +A    +   + D     +A+                   SKDL
Sbjct  252   IPGGRGRHWASMDERDMAALGPIDLDVPDSLGTPSASHT-----------------SKDL  294

Query  1535  ESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMV  1356
             E+EMKRL+ ELKQTMDMY++ACK+AI+AK  A+++++ K+EE ++ E+ R ++EAAL M 
Sbjct  295   EAEMKRLRRELKQTMDMYSSACKQAISAKNQAEQIRRWKVEEERKVEEVRMSQEAALAMA  354

Query  1355  emekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYS  1176
             E EKA+ KAAMEAAE A++ AE EAQR + AEMKA+KE  E++R L+ L+++D RYRKY+
Sbjct  355   EREKARAKAAMEAAEDAKRKAEQEAQRRREAEMKARKEAEERDRVLTALAQNDNRYRKYT  414

Query  1175  IDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSL  996
             ++EIE ATEKFS S K+GEGGYGPVY+G LDHT VAIK+L P+A+QGRKQFQQEVEVLS 
Sbjct  415   MEEIEVATEKFSPSKKLGEGGYGPVYKGHLDHTAVAIKLLNPEASQGRKQFQQEVEVLSC  474

Query  995   MRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLF  816
             +RHPNMVLLLGACPE+GCLVYE+M+NGSLEDRL RK N+  + W+ RF+ISAEIATALLF
Sbjct  475   IRHPNMVLLLGACPEHGCLVYEFMDNGSLEDRLFRKNNSRPLTWQKRFQISAEIATALLF  534

Query  815   LHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCY  636
             LHQ+KPEP+VHRDLKP+NILLDRN+VSKISDVGLARLVP SV D+VTQY+MTSAAGTFCY
Sbjct  535   LHQTKPEPIVHRDLKPSNILLDRNYVSKISDVGLARLVPSSVVDNVTQYYMTSAAGTFCY  594

Query  635   IDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDW  456
             IDPEYQQTG L TKSDIYSLGVMLLQ+ITAKPPMGL HHV+RA+EK    ++LDP ++DW
Sbjct  595   IDPEYQQTGILTTKSDIYSLGVMLLQVITAKPPMGLAHHVKRAVEKDRIVEILDPAVTDW  654

Query  455   PVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             PVE AL FAKL+L C EL KKDRP+L +V+LPELNRL++L 
Sbjct  655   PVEAALSFAKLALGCVELSKKDRPNLATVVLPELNRLRDLG  695



>ref|XP_008228381.1| PREDICTED: U-box domain-containing protein 35 [Prunus mume]
Length=783

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/749 (52%), Positives = 496/749 (66%), Gaps = 79/749 (11%)
 Frame = -3

Query  2366  SDGATTGPITVVAVDKDKNSASAVKWTVDNLL-ISNPFVILLHVRHKASPNHQN------  2208
             S G   GP T+VA++KDKNS  AVKW VDNLL   N    L+HVR  +  +  N      
Sbjct  8     SVGEDVGP-TLVAINKDKNSQCAVKWAVDNLLGDKNAHCTLIHVRSHSFHHRSNFDVKCN  66

Query  2207  -------------------------GGPDAHGGMSDHDG--------HCVFTPFRAYSAR  2127
                                      G  D HG +S  DG           F P+R + AR
Sbjct  67    DHASSFSFSWSFISLRLCMCLICALGFADDHGAVSK-DGRPPTEAELQQFFLPYRGFCAR  125

Query  2126  RGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPD  1947
             +GI+ KE  + D +V  A+V Y+  + + N+V+GAS  +A++RKF   DV T + K+ P+
Sbjct  126   KGIVAKEVVLHDIDVPNALVDYVVRNSICNIVVGASHHNALTRKFRPADVATSLLKSVPE  185

Query  1946  FCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaasssAGDDRISACS  1767
              C+VYVISKGK ++ R A  P T   ++  +   +SS+ +   S        +D I   S
Sbjct  186   TCAVYVISKGKIRTSRSATGPQTP-KSNAATPRNNSSQRTPLSSFLHGVPDFEDVIGQGS  244

Query  1766  SRGEHSGRPFRRSEDRDAD-----------GS-VRRPWNS---------SCRNSLAEDND  1650
             S G       R S D+ AD           GS    P  S         S  NS++  +D
Sbjct  245   SAG-------RISLDKSADFKNVPPKAHRSGSKTNSPTQSVTSATSDKLSHGNSISGGSD  297

Query  1649  LFAPIS---DGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYN  1479
                P S   +G DN   + N + +      +  SS     L++EM+RL+LELKQTMDMY 
Sbjct  298   FSGPFSFQSNGSDNVDISMNSEGS-----INSFSSHTPSALDAEMRRLRLELKQTMDMYT  352

Query  1478  NACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqk  1299
             + CKEA+ AK+  ++LQ+ K  E  + E+A+ AEEAAL +  +E+ K KAAMEAA  AQ+
Sbjct  353   SVCKEALAAKEKTRDLQKWKTSEEHKLEEAKLAEEAALALANVERQKSKAAMEAARMAQR  412

Query  1298  iaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGE  1119
             +A ME  + K AE KAK+E  E+ RA+  L+++  RYR+Y+I+EIE AT+ F  S K+GE
Sbjct  413   LAGMETHKRKIAERKAKQEAGERRRAMDALAQNHIRYRRYTIEEIELATDYFKISNKVGE  472

Query  1118  GGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCL  939
             GGYGPVYR  LDHT VAIKVLRPD +QG++QFQQEVEVLS +RHP+MVLL+GACPEYGCL
Sbjct  473   GGYGPVYRAWLDHTAVAIKVLRPDISQGQRQFQQEVEVLSCIRHPHMVLLVGACPEYGCL  532

Query  938   VYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANI  759
             +YEYMENGSLEDRL  K NTP IPW +RFKI+AEIATALLFLHQ+KPEPLVHRDLKPANI
Sbjct  533   IYEYMENGSLEDRLFLKSNTPPIPWGVRFKIAAEIATALLFLHQTKPEPLVHRDLKPANI  592

Query  758   LLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYS  579
             LLDRN+VSKI+DVGLARLVPPSVAD VTQY MT+AAGTFCYIDPEYQQTG LG KSDIYS
Sbjct  593   LLDRNYVSKIADVGLARLVPPSVADAVTQYRMTAAAGTFCYIDPEYQQTGMLGVKSDIYS  652

Query  578   LGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELR  399
             LGVMLLQIITAKP MGL+H VE AIEKG FA++LDP ++DWPVEEAL +AK++L+C ELR
Sbjct  653   LGVMLLQIITAKPAMGLSHQVEEAIEKGAFAEILDPAVTDWPVEEALSYAKMALKCCELR  712

Query  398   KKDRPDLGSVILPELNRLKELALQSLASK  312
             K+DRPDL +VILPELNRL++L +++ AS+
Sbjct  713   KRDRPDLSTVILPELNRLRDLGMKNEASE  741



>ref|XP_006289371.1| hypothetical protein CARUB_v10002865mg [Capsella rubella]
 gb|EOA22269.1| hypothetical protein CARUB_v10002865mg [Capsella rubella]
Length=668

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/691 (55%), Positives = 488/691 (71%), Gaps = 60/691 (9%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             TVVAVDK+K+S  AV+W VD+L  +I NP +IL+HVR K+S                   
Sbjct  17    TVVAVDKEKHSHCAVRWAVDHLINMIHNPVMILVHVRLKSS-------------------  57

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW-  1989
                                   ++D++VA AI+ Y++ + V+N+VLGA+S++  +R F  
Sbjct  58    -------------------NLVLDDSDVATAILEYVSNNLVNNLVLGATSKNTFARSFMF  98

Query  1988  --THDVPTIVNKTAPDFCSVYVISKG-KQQSIRPAARPLTNL--PTHIWshhgsssrass  1824
                H+V   + K+ P+FCSVYVISKG K  S RPA R +TN   P  + S        S 
Sbjct  99    SKPHEVQAHIMKSTPEFCSVYVISKGGKVHSSRPAQRHITNTLAPPRVPSSGFLIQSLSD  158

Query  1823  rgssaasssAGDDRISACSSRGEHSGRPF---RRSEDRDADGSV---------RRPWNSS  1680
                          R  +  +   H+ R F   ++S +   +GS+             N +
Sbjct  159   SEQDLIPRVQRGARNKSNETTYPHN-RAFNATQKSYNSLVNGSMDFNNGFNQAAFQRNPT  217

Query  1679  CRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELK  1500
              +NS ++++++        D  +A  N+D+   S +  ++   ++KD+E+EM++LKLELK
Sbjct  218   LQNSFSDESEVGLSTMGSID-LSAHNNIDYYGASSSSEESIPQSTKDIEAEMRKLKLELK  276

Query  1499  QTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaame  1320
             QTMDMY++ACKEA+TAK+ A EL Q KIEE+++FE+AR +EEAAL + EMEKAKC+AA E
Sbjct  277   QTMDMYSSACKEALTAKRKANELNQWKIEEARKFEKARLSEEAALAVAEMEKAKCRAAEE  336

Query  1319  aaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFS  1140
             AAEKAQ++AE+E QR K AEMKA+ E  +K+RA+S L+ +D RYRKY+I+EIE AT++F+
Sbjct  337   AAEKAQRMAELEGQRRKQAEMKARSEEDDKDRAMSALAHNDVRYRKYTIEEIEEATDQFA  396

Query  1139  KSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGA  960
                KIGEGGYGPV+ G+LDHTPVAIKVLRPDA QG++QFQQEVEVL  +RHP+MVLLLGA
Sbjct  397   DHRKIGEGGYGPVFHGELDHTPVAIKVLRPDAVQGKQQFQQEVEVLCSIRHPHMVLLLGA  456

Query  959   CPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHR  780
             CPEYGCLVYEYMENGSLEDRL R+GN+P I W  RF+I+AEIATAL FLHQ+KPEPLVHR
Sbjct  457   CPEYGCLVYEYMENGSLEDRLYRRGNSPPISWRKRFEIAAEIATALSFLHQAKPEPLVHR  516

Query  779   DLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLG  600
             DLKPANILLDRNFVSKISDVGLARLVP SVAD+VTQ+HMTSAAGTFCYIDPEYQQTG L 
Sbjct  517   DLKPANILLDRNFVSKISDVGLARLVPVSVADNVTQFHMTSAAGTFCYIDPEYQQTGMLT  576

Query  599   TKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLS  420
             TKSD+YSLG++LLQIITA+ PMGLTHHV RAI KGTF ++LDP ++DWPVEEA  FA LS
Sbjct  577   TKSDVYSLGILLLQIITARQPMGLTHHVSRAISKGTFKEMLDPVVNDWPVEEAQSFAMLS  636

Query  419   LQCAELRKKDRPDLGSVILPELNRLKELALQ  327
             L+CAELRK+DRPDLG  ++P L RL+    +
Sbjct  637   LKCAELRKRDRPDLGKDVVPHLIRLRNFGYE  667



>gb|KDO65137.1| hypothetical protein CISIN_1g005343mg [Citrus sinensis]
Length=701

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/688 (53%), Positives = 479/688 (70%), Gaps = 30/688 (4%)
 Frame = -3

Query  2366  SDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVR-HKASPNHQNGGPDAH  2190
             ++  T   IT VA+D DK+S  AVKW VDNLL      +LLHVR H ++P    G P   
Sbjct  15    ANAITANAITAVAIDADKSSQYAVKWAVDNLLNETSQYVLLHVRNHSSNPR---GRP---  68

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
                ++ +   +F P+R   AR+ I+ +E  ++D +V+ A++ Y+  + V N+V G SSR+
Sbjct  69    --ATNDELQKLFLPYRGLFARKRILAREVVLQDIDVSSALIYYVKNNSVGNIVAGGSSRN  126

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVIS-KGKQQSIRPAARPLTNLPTHIWshhgsssr  1833
              ++RKF   D+P+ + K+AP+ C+VY+IS KGK QS RPAA     L             
Sbjct  127   LLTRKFRNLDLPSSLLKSAPESCAVYIISSKGKLQSSRPAASQPQMLSGDALIPKQPPL-  185

Query  1832  assrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDN  1653
                            +R S        S    R     D D  ++  +NS   + ++   
Sbjct  186   --------------GERPSVIQPDSPRSVEIGRSDYSCDTDSHMQNSFNSESESDIS---  228

Query  1652  DLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNA  1473
             D   P+S  + +   ++N+DF+ +S +  D    + K LE+E+KRL+LELKQ+M++YN+ 
Sbjct  229   DFSVPVS--YQSTEISENIDFSSLSKSSKDHFPQSPKGLEAEIKRLRLELKQSMEIYNSV  286

Query  1472  CKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkia  1293
              KEA++  ++A +LQQ K EE+ + E+AR AEEAAL +V+ E+ K +AAMEAA  AQ++ 
Sbjct  287   SKEAVSTSQTAVKLQQRKKEEALKLEEARLAEEAALALVKSERQKTRAAMEAALMAQRLV  346

Query  1292  emeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGG  1113
             E+EA + + AE+KA +E  EK   +  ++  + RYRKY+I+EIE AT+ FS S KIGEGG
Sbjct  347   ELEAMKREIAELKAMQEEEEKKIVMEAMAYKNVRYRKYTIEEIEAATDYFSISRKIGEGG  406

Query  1112  YGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVY  933
             YGPVY+ +LDHT VAIKVL PD +QG +QF+QEVE+L  MRH NMV+LLGACPEYGCLVY
Sbjct  407   YGPVYKAQLDHTSVAIKVLGPDISQGPRQFKQEVEILGSMRHTNMVILLGACPEYGCLVY  466

Query  932   EYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILL  753
             EYMENGSLEDRL +K N+P I W IRFKI+AEIATALLFLHQ+KPEPLVHRDLKPANILL
Sbjct  467   EYMENGSLEDRLFQKDNSPPIHWSIRFKIAAEIATALLFLHQNKPEPLVHRDLKPANILL  526

Query  752   DRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLG  573
             D+N+VSKISDVGLARLVPPS AD +TQYHMT+AAGTFCYIDPEYQQTG LG KSD+YSLG
Sbjct  527   DQNYVSKISDVGLARLVPPSAADTITQYHMTTAAGTFCYIDPEYQQTGMLGVKSDLYSLG  586

Query  572   VMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKK  393
             V+LLQ+ITA+P MGL+H VE+AI  GTF++LLDPT++ WPVE AL  AKL+LQC ELRK+
Sbjct  587   VVLLQLITARPAMGLSHQVEQAIRNGTFSELLDPTVTGWPVEAALSIAKLALQCCELRKR  646

Query  392   DRPDLGSVILPELNRLKELALQSLASKN  309
             DRPDL SV+LPEL RL++L  ++  +KN
Sbjct  647   DRPDLVSVVLPELIRLRDLGFENAENKN  674



>gb|EYU22082.1| hypothetical protein MIMGU_mgv1a001807mg [Erythranthe guttata]
Length=757

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/714 (54%), Positives = 494/714 (69%), Gaps = 37/714 (5%)
 Frame = -3

Query  2369  SSDGATTGP---ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQN---  2208
             S++G    P   +  VA+D+DK S  A+KW VDNLL+    VIL+HV+ K  P+  +   
Sbjct  6     SNNGERMAPMARLVAVAIDRDKGSQIALKWAVDNLLVKGQTVILVHVKVKQPPSGFSPSP  65

Query  2207  --GGPDAHGGMSDHDGHC--------VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYI  2058
               GG  A   M+D +           +F PFR +  R+ I   +  ++DT+V +AIV ++
Sbjct  66    SLGG--AWSNMTDPNEDAGDEALLKELFLPFRVFCTRKDINCYDIVLDDTDVTRAIVEFV  123

Query  2057  NTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLT  1878
                 +  +VLGA+ +     +F   D+P  V K APDFC+VYVI+KGK  S R A+RP  
Sbjct  124   KQSTIDVLVLGATVKGNSIFRFKAKDIPGSVLKGAPDFCNVYVINKGKISSTRAASRPPP  183

Query  1877  NLPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADG---  1707
             ++ + + +   S + +   GS     S+     S+ S        P  R+   +A+    
Sbjct  184   SIFSPLRNQILSQANSKFYGSDPPMPSSTSSSRSSYSGHSRPGSEPSPRARQNEANFIKS  243

Query  1706  --SVRRPWNSSCRNSLAEDND-----------LFAPISDGFDNAAAAQNLD-FTRisdag  1569
               S R+  N    +    DND           +F   S+ +D A     L  F+     G
Sbjct  244   PFSHRKAPNGKAYDLSPPDNDISFVSSRRSVDMFPTFSESYDGAPTPPRLSGFSDADYQG  303

Query  1568  sdassiaSK--DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfe  1395
              D+ S   K  ++E+EM+RLK ELKQTM+MY+ ACKEA++A++ AKELQ+ KIEE +R E
Sbjct  304   FDSWSHGRKSDEVEAEMRRLKQELKQTMEMYSTACKEALSAREKAKELQRWKIEEQKRLE  363

Query  1394  qarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALS  1215
              AR AEEAAL + E EKAK KAA+E AE AQ+IAE+EAQ+   AEMKA KE+ EK+R ++
Sbjct  364   DARLAEEAALAVAEKEKAKSKAALEHAEAAQRIAELEAQKRINAEMKALKESEEKSRVIN  423

Query  1214  VLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQG  1035
              LS SD RYRKY+I+EIE ATE F++S KIGEGGYGPVY+  LDHTPVA+KVLRPDA QG
Sbjct  424   SLSNSDSRYRKYTIEEIEVATEYFAQSRKIGEGGYGPVYKCYLDHTPVAVKVLRPDATQG  483

Query  1034  RKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIR  855
             R QFQQEVE+LS +RHPNMVLLLGACPEYGCLVYEYM +GSL+D L ++G  P + W+ R
Sbjct  484   RSQFQQEVEILSCIRHPNMVLLLGACPEYGCLVYEYMSSGSLDDCLFKRGKNPPLSWQHR  543

Query  854   FKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVT  675
             F+ISAEI T LLFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPPSVAD+VT
Sbjct  544   FRISAEIGTGLLFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPSVADNVT  603

Query  674   QYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKG  495
             QY MTS AGTFCYIDPEYQQTG LG KSDIYSLG++ LQI+T K PMGLTHHV+RAIE+G
Sbjct  604   QYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIIFLQILTGKSPMGLTHHVDRAIERG  663

Query  494   TFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             TFA++LDP+++DWP EEAL+FAKL+L+C+ELR+KDRPDLG V+LP LNRL+ELA
Sbjct  664   TFAEMLDPSVTDWPYEEALNFAKLALKCSELRRKDRPDLGKVVLPHLNRLRELA  717



>gb|EYU39810.1| hypothetical protein MIMGU_mgv1a024838mg [Erythranthe guttata]
Length=737

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/706 (54%), Positives = 487/706 (69%), Gaps = 37/706 (5%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASP---------NHQNGGPDAH  2190
             +  VA+DKDK S +A+KW  +NLL     VIL+HV  ++S             NG    H
Sbjct  22    LVAVAIDKDKGSQAALKWATENLLTRGQTVILIHVVQRSSLASFGYNFALQDLNGATCGH  81

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
               + +     +   F  + +R+ I   +  +EDT+VAKAI  Y+    + N+VLGAS R 
Sbjct  82    KQVHEKQTKELLLTFHCFCSRKDINCFDVVLEDTDVAKAITEYVAHAAIENLVLGAS-RH  140

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssra  1830
                R+  T D+P  V+KTAPDFC+VYVISK K  S++ A+R L    + + +      + 
Sbjct  141   GFIRRLKTVDIPMSVSKTAPDFCTVYVISKTKISSVKNASR-LAQFVSPLKAQIHQMEQG  199

Query  1829  ssrgssaasssAGD-DRISACSSRG-EHSGRPFRRSEDRDADGSVRRPWNSSCRNSL---  1665
             +         S  D D + +  SRG  ++G+P+    + D D S    + SS R S+   
Sbjct  200   NGAEKILLKESVDDIDIVKSPFSRGSRYNGKPYGDFSEPDTDIS----FISSDRPSVDKL  255

Query  1664  --AEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTM  1491
                  +  +  I  G   +      DF+        +SS+ S D+E+EM+RLKLEL++TM
Sbjct  256   MSTSSDSSYGSIRSGARGSEQNSFTDFS--------SSSLESDDVEAEMRRLKLELQRTM  307

Query  1490  DMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaae  1311
             +MY+ ACK A+TA++ A EL + +++E +R E+AR +EE+A    E EKAKC+AAME AE
Sbjct  308   EMYSTACKAALTAQQKAVELHRWRMDEERRLEEARLSEESAKLTAEQEKAKCRAAMENAE  367

Query  1310  kaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSM  1131
              AQ+IAE+E+Q+   AEMKA +E+ EK++A+S+   S  RYR+Y I+EIE ATE F+++ 
Sbjct  368   AAQRIAEIESQKRASAEMKALQESDEKDKAMSM---SQLRYRRYCIEEIEEATEYFAEAR  424

Query  1130  KIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPE  951
             K+GEGGYGPVY+  LDHTPVA+KVLRPDAAQGR QF +EVEVLS MRHPNMVLLLGACPE
Sbjct  425   KVGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFHKEVEVLSCMRHPNMVLLLGACPE  484

Query  950   YGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLK  771
             YGCLVYEYM  GSLEDRL R+GNT A+ W +RF+I+AEIAT L FLHQ+KPEPLVHRDLK
Sbjct  485   YGCLVYEYMAKGSLEDRLFRRGNTGALSWPLRFRIAAEIATGLHFLHQTKPEPLVHRDLK  544

Query  770   PANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKS  591
             P NILLD+N+VSKISDVGLARLVPPSVADDVTQY MTSAAGTFCYIDPEYQQTG LG KS
Sbjct  545   PGNILLDQNYVSKISDVGLARLVPPSVADDVTQYRMTSAAGTFCYIDPEYQQTGMLGVKS  604

Query  590   DIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQC  411
             D+YS GV+LLQIITAK  MGLTHH+ R+IEKGTFA++LDP + DWPVEEAL FAKL+LQC
Sbjct  605   DVYSFGVVLLQIITAKQAMGLTHHISRSIEKGTFAEMLDPAVPDWPVEEALVFAKLALQC  664

Query  410   AELRKKDRPDLGSVILPELNRLKELA----LQSLASKNGTQTFGRH  285
             AELR+KDRPDLG V+LPELNRL++       Q LA+K+      +H
Sbjct  665   AELRRKDRPDLGRVVLPELNRLRDFGDENMNQFLAAKSDPHASSKH  710



>ref|XP_004501223.1| PREDICTED: U-box domain-containing protein 34-like [Cicer arietinum]
Length=794

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/736 (51%), Positives = 499/736 (68%), Gaps = 57/736 (8%)
 Frame = -3

Query  2363  DGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKA---SPNH-------  2214
             DG   G I  VA+DK+K S +A+KW +DNLL  N  VIL+HV+  A   SP+        
Sbjct  12    DGGVNGLI-AVAIDKEKGSQNALKWAIDNLLSRNSTVILIHVKVLAPFLSPSPSLFTLRS  70

Query  2213  -----QNGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTH  2049
                   +      G  ++     +F P+R +  R+ I  K+  +ED +V+KA++ Y    
Sbjct  71    GISILNSNESLTIGKEAETQNKNIFLPYRVFCTRKDIQCKDVLLEDADVSKALIEYATQA  130

Query  2048  RVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL-  1872
              + ++VLG+S+++++ ++F   D+P  V+K APDFC+VYVI KGK  S+R A+RP   + 
Sbjct  131   GIEHLVLGSSAKTSLLKRFKVSDIPGTVSKGAPDFCTVYVIGKGKIHSMRSASRPAPTIS  190

Query  1871  -----PTHIWshhgsssrassrgssaasssAGDD-----------RISACSSRGEHSGRP  1740
                  PT I  +   ++   S         + DD             ++  +R  ++G+ 
Sbjct  191   PLQVNPTTITPYQSDTNVVLSHSEKEQERHSFDDGAPHKSHDGTESFTSPFTRKGYNGKQ  250

Query  1739  FRRSEDRDAD--------GSVRRPWNSSCRNSLA-------------EDNDLFAPISDGF  1623
             +  S   D+D         S+ R     C NS A             + N  F  I  G 
Sbjct  251   YMESSMTDSDISFISTGRASIDRMLPPLCNNSEAGMSNPRLSSSSEPDGNYSFESIYQGK  310

Query  1622  DNAAAAQNLDFTRisdagsdassiaSK---DLESEMKRLKLELKQTMDMYNNACKEAITA  1452
              ++  +   +FT +S      SS +S+   D+E+EM+RLKLELKQTM+MYN ACKEA+TA
Sbjct  311   MSSDFSIPPEFTSLSFDSERLSSSSSQAVDDMEAEMRRLKLELKQTMEMYNTACKEALTA  370

Query  1451  KKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRT  1272
             ++ A ELQ+ K+EE ++ E+AR AEEAAL + E EK K KAA+EAAE  ++IAE EAQR 
Sbjct  371   QQKAVELQRWKLEEERKLEEARLAEEAALAIAEKEKEKSKAAIEAAEAQKRIAEFEAQRR  430

Query  1271  kyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRG  1092
              +AEMKA +E+ EK + +  L   D RYRKY+I+EIE AT  FS+S+KIGEGGYGPV++ 
Sbjct  431   LHAEMKALRESEEKKKVMDALVNVDIRYRKYTIEEIEAATNFFSQSLKIGEGGYGPVFKC  490

Query  1091  KLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGS  912
              LDHTPVA+KVLRPDAAQGR QFQ+EVEVLS +RHPNMVLLLGACPEYGCLVYEY+ NGS
Sbjct  491   LLDHTPVAVKVLRPDAAQGRSQFQREVEVLSCIRHPNMVLLLGACPEYGCLVYEYLSNGS  550

Query  911   LEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSK  732
             L+D L  KGN+P + W+ RFKI+AEI+T LLFLHQ+KPEP+VHRDLKP NILLDRN+V+K
Sbjct  551   LDDCLFHKGNSPPLSWQRRFKIAAEISTGLLFLHQTKPEPIVHRDLKPGNILLDRNYVAK  610

Query  731   ISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQII  552
             ISDVGLARLVPPS+AD VTQY +T+ AGTFCYIDPEYQQTG LG KSDIYSLG++ LQI+
Sbjct  611   ISDVGLARLVPPSIADSVTQYRLTATAGTFCYIDPEYQQTGMLGVKSDIYSLGIIFLQIL  670

Query  551   TAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGS  372
             TAK PMGL H+VERAIEKGTF ++LDP+++DWP+E+AL  AK+++QCAELR+KDRPDLG 
Sbjct  671   TAKSPMGLAHNVERAIEKGTFTEMLDPSVTDWPLEDALTLAKIAVQCAELRRKDRPDLGK  730

Query  371   VILPELNRLKELALQS  324
             V+LPEL+RL++ A  S
Sbjct  731   VVLPELDRLRDHAENS  746



>ref|XP_007161131.1| hypothetical protein PHAVU_001G045100g [Phaseolus vulgaris]
 gb|ESW33125.1| hypothetical protein PHAVU_001G045100g [Phaseolus vulgaris]
Length=671

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/700 (53%), Positives = 477/700 (68%), Gaps = 51/700 (7%)
 Frame = -3

Query  2369  SSDGATTGP---ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGP  2199
             S  GA T     +T+VAVDK K+S  A +WT+ N  I NP +I +HV+HK  P HQ  G 
Sbjct  3     SHGGAATSQLFNVTMVAVDKGKSSGHAFRWTLKN--IDNPVIIAVHVKHKNIP-HQ--GT  57

Query  2198  DAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA-  2022
             +      D   + VF P R       + +KE  I+D+EV + IV Y   +RV+ +V+GA 
Sbjct  58    NVFPPTEDEVAN-VFNPIRQLCQNNNVKLKEAVIDDSEVVRGIVEYAKKNRVNTIVIGAA  116

Query  2021  -SSRSAISRKFWTHD--------VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLP  1869
              S+++ ++R  +           VPT V K+APD  SVYVISKGK    RPA RP+ N+ 
Sbjct  117   HSNKNTLARTLYLRSGSKKLKGLVPTGVMKSAPDHSSVYVISKGKILGARPAIRPMVNMV  176

Query  1868  THIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPW  1689
             T                         ++ IS   +    +G    RSE       +  P 
Sbjct  177   T----------------------PPSENGISENRANAHRTGSTNGRSERSPL---LEMPR  211

Query  1688  NSSCRNSLAEDNDLFAPISDGFDNAAAAQNL----DFTRisdagsd-assiaSKDLESEM  1524
             +SS   S   D  L    S G  +++ +  L    D T+        + S  + ++ESEM
Sbjct  212   SSSVGQST--DRRLLFCRSTGESDSSRSHKLGSAADGTKKEYDSDSPSDSQFTAEMESEM  269

Query  1523  KRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemek  1344
             KRL+L+LKQTMD+YN+ACKE ++ +   KE+ Q K++E +  E A+ ++EAAL M E EK
Sbjct  270   KRLRLKLKQTMDLYNSACKETVSTQSKDKEINQRKLDEERIAEVAKLSKEAALAMAEKEK  329

Query  1343  akckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEI  1164
              K +AA+EAAE+A K+ E EAQR  +AEMKA++E  EK+RAL+ L+  D R RKY+I+++
Sbjct  330   FKARAALEAAEEAIKMVEKEAQRRFHAEMKARREAHEKDRALNQLACRDIRCRKYTINDV  389

Query  1163  EFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHP  984
             E AT KF +++KIGEGGYGPV++G+LDHT VAIK+L PDA  GR+QFQQEVEVL  +RHP
Sbjct  390   EGATRKFCQTLKIGEGGYGPVFKGQLDHTQVAIKILNPDATHGRRQFQQEVEVLCSIRHP  449

Query  983   NMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQS  804
             NMVLL+GACPEYGCLVYEY+ENGSLEDRLL K ++P IPW  RF+I+AEIATALLFLHQ+
Sbjct  450   NMVLLIGACPEYGCLVYEYLENGSLEDRLLMKNDSPPIPWWKRFEIAAEIATALLFLHQT  509

Query  803   KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPE  624
             KPEP+VHRDLKPANILLD+NFVSKISDVGLARLVP SVAD VTQYH+T+AAGTFCYIDPE
Sbjct  510   KPEPIVHRDLKPANILLDKNFVSKISDVGLARLVPASVADSVTQYHLTAAAGTFCYIDPE  569

Query  623   YQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEE  444
             YQQ+G L TKSD+YSLG+MLLQIITAKPPMGL HHV RAI++GTF+++LDP I++WP+EE
Sbjct  570   YQQSGMLTTKSDVYSLGIMLLQIITAKPPMGLAHHVMRAIQEGTFSEMLDPVITNWPLEE  629

Query  443   ALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQS  324
              L F KLSL CAEL K+DRPDL + I+P+LN L++  L S
Sbjct  630   TLEFGKLSLSCAELSKRDRPDLATEIVPKLNHLRDFGLAS  669



>gb|ACN33899.1| unknown [Zea mays]
Length=682

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/644 (57%), Positives = 466/644 (72%), Gaps = 28/644 (4%)
 Frame = -3

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F P+R +  R G+ + E  +E+ +V+KAI+GYI  +++ ++ LG ++R+A ++KF   D
Sbjct  16    IFVPYRGFFNRNGVEVSEVVLEEADVSKAILGYITANKIQSIALGGANRNAFTKKFKNAD  75

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaass  1800
             VP+ + K APD+C++YV++KGK  ++R A   +  + T       + S   S       S
Sbjct  76    VPSTLMKCAPDYCNIYVVAKGKSVNVRLAKCGVPPMHTGADIASDTDSLRESVLYMRRGS  135

Query  1799  sAGDDRISACSSRG-------EHSGRPFRRSEDRDADGSVRR--------PWNSSCR---  1674
                  R++  + R        E S RP  R     +  + +          + +S R   
Sbjct  136   RGHLPRVTPDAWRSIDGRTPPELSTRPLFRERLLSSSATTKNFVVLPGKDNFETSSRSAR  195

Query  1673  -NSLAEDNDLFAPISDGFDNAAAAQNLDF--TRisdagsdassiaSKDLESEMKRLKLEL  1503
              +SL  D D F P S  F      +NLD   T  +      ++ A +D E+EM+RL+LEL
Sbjct  196   HDSLGGDLD-FGP-STRFSYIDLGENLDMSTTLPALEPMSPATGAQRDTEAEMRRLRLEL  253

Query  1502  KQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaam  1323
             KQTMDMYN ACKEAI AK+ AKE+  MK+EE++R E+AR AEEAAL + EMEKAKC+AAM
Sbjct  254   KQTMDMYNAACKEAINAKQRAKEMHMMKLEEARRLEEARNAEEAALAVAEMEKAKCRAAM  313

Query  1322  eaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKF  1143
             EAAE AQ++A++EAQR + AE++A++E  EK RAL  +S  D RYRKY IDEIE ATE+F
Sbjct  314   EAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAISNHDFRYRKYHIDEIEMATERF  373

Query  1142  SKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLG  963
             S  +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQF QEVEVLS +RHPNMVLLLG
Sbjct  374   SDELKIGEGGYGPVYRASLDHTPVAIKVLRPDAHQGRKQFLQEVEVLSCIRHPNMVLLLG  433

Query  962   ACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVH  783
             ACPEYGCLVYEYM++GSLEDRL R+G TP + W  RF+I+AEIATALLFLHQ+KPEPLVH
Sbjct  434   ACPEYGCLVYEYMDHGSLEDRLFRRGGTPPLAWAQRFRIAAEIATALLFLHQTKPEPLVH  493

Query  782   RDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKL  603
             RDLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY +T+ AGTFCYIDPEYQQTGKL
Sbjct  494   RDLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRLTATAGTFCYIDPEYQQTGKL  553

Query  602   GTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKL  423
             G KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTF  +LD T+ DWPVEEAL +AKL
Sbjct  554   GVKSDIYSLGVLLLQVVTARPPMGLTHHVEKAIDAGTFEQMLDITVKDWPVEEALGYAKL  613

Query  422   SLQCAELRKKDRPDLGSVILPELNRLKEL-----ALQSLASKNG  306
             +L+C E+R++DRPDL +VILPELNRL+ L     A  S A  NG
Sbjct  614   ALKCTEMRRRDRPDLATVILPELNRLRNLGHAYEARMSAARANG  657



>ref|XP_010247378.1| PREDICTED: U-box domain-containing protein 34-like [Nelumbo nucifera]
Length=564

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/478 (72%), Positives = 405/478 (85%), Gaps = 3/478 (1%)
 Frame = -3

Query  1712  DGSVRRPWNSSCRNSLAEDNDLFAPI-SDGFDNAAAAQNLDFTRisdagsdassiaSKDL  1536
             D SVR P  S  R+SL++D++ F    S   D    ++N+DF   SD+ +  S  + KD+
Sbjct  55    DISVRNPMGSGFRDSLSDDSEHFRDFGSRSMD--ITSENIDFGNSSDSPTHPSQSSVKDI  112

Query  1535  ESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMV  1356
             E+EMKRLKLELKQTM+MY+ ACKEAI+AK+ A EL Q K+EE+++F++AR AEEAAL + 
Sbjct  113   EAEMKRLKLELKQTMEMYSTACKEAISAKQKALELHQWKVEEARKFQEARMAEEAALAIA  172

Query  1355  emekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYS  1176
             E EKAKCKAA+EAAE AQ++AE+EA + + AE+KAK+E  E+ RAL  LSK D RYRKYS
Sbjct  173   EREKAKCKAAIEAAEAAQRLAEIEANKRRSAELKAKREAEERVRALDALSKHDIRYRKYS  232

Query  1175  IDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSL  996
             IDEIE ATE+F++S+KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQGRKQFQQEVEVLS 
Sbjct  233   IDEIEVATERFAESLKIGEGGYGPVYKAFLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSC  292

Query  995   MRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLF  816
             +RHPNMVLLLGACPEYGCLVYEYM+NGSLEDRL R+ NTPAIPW+IRFKI+AEIAT LLF
Sbjct  293   IRHPNMVLLLGACPEYGCLVYEYMDNGSLEDRLFRRENTPAIPWQIRFKIAAEIATGLLF  352

Query  815   LHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCY  636
             LHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY MTSAAGTFCY
Sbjct  353   LHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYRMTSAAGTFCY  412

Query  635   IDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDW  456
             IDPEYQQTG LG KSDIYSLG+MLLQIITAKPPMGLTHHVERAIE+GTFA++LD +++DW
Sbjct  413   IDPEYQQTGMLGIKSDIYSLGIMLLQIITAKPPMGLTHHVERAIERGTFAEILDQSVTDW  472

Query  455   PVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQTFGRHY  282
             PVEEA  +AKL+L+CAELR+KDRPDLG+V+LPELNRL++L    +++  G     R Y
Sbjct  473   PVEEAFKYAKLALKCAELRRKDRPDLGTVVLPELNRLRDLGNNEISNLGGMSFGPRSY  530



>ref|XP_008462338.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Cucumis melo]
Length=720

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/682 (49%), Positives = 449/682 (66%), Gaps = 39/682 (6%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLL--ISNPFVILLHVRHKA-SPNHQNGGPDAHGGMSDHD  2169
             T++A+ +DKNS  AVKW V++L    +    IL+HVR +   P   +  P  +   ++ +
Sbjct  15    TMIAISRDKNSQYAVKWAVEHLFNRKNTGDCILIHVRSQGLHPQEADSIPKEYRPPTEAE  74

Query  2168  GHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW  1989
              H  F P+R + AR+GI+ KE  I D +V  A++ +++ H +SN+V+GAS+R+ I RKF 
Sbjct  75    LHQFFLPYRGFCARKGIVAKEIIIHDIDVPNALIDHVSKHSISNIVVGASNRNPIMRKFK  134

Query  1988  THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssa  1809
               DV T + K+AP+ CSVYVI++GK  + R   R                   +   +  
Sbjct  135   NPDVATCLLKSAPESCSVYVIARGKVHTKRLRKR-------------------NKSQTDM  175

Query  1808  asssAGDDRISACSSRGEHSGRPFRR--SEDRDADGSVRRPWNSSCRNSLAEDNDLFAPI  1635
               S  G  R+ +  S+   S        SED+  D S       +  +S++  +D   P+
Sbjct  176   NESQTGTPRVGSSLSKTRKSAYSSISGLSEDKYRDSS------GTSNDSMSGISDFSGPL  229

Query  1634  SDGFDNAAAA-QNLDFTRisdagsdassiaSK---DLESEMKRLKLELKQTMDMYNNACK  1467
             S  F +   + +NLDF+  S   S  S ++S     +ESEMKRL+ ELKQ M+MY++A K
Sbjct  230   S--FKSIETSFENLDFSPSSSETSTRSYVSSSTPPSIESEMKRLRFELKQMMEMYDSASK  287

Query  1466  EAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVem---ekakckaameaaekaqki  1296
             EA  AK+ AKEL+Q+K+E+ +  +  R               ++    AA       +  
Sbjct  288   EAAVAKQKAKELEQLKMEKEEDDKIERGKSADEALTALAEFEKQKNKAAAEATLVAQKLA  347

Query  1295  aemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEG  1116
                  ++    E KA+ E  E+ + + +  +S+  YR+YSIDEIE AT+ F++S KIGEG
Sbjct  348   ELETQKKQIITEEKARIEAEERKKTMELFERSNICYRRYSIDEIEVATDHFNESNKIGEG  407

Query  1115  GYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLV  936
             GYGPVY+  LDHT VAIK+LRPD + G++QFQQE+EVLS MRHP+MVLLLGACPEYGCLV
Sbjct  408   GYGPVYQALLDHTSVAIKILRPDRSHGQRQFQQEIEVLSRMRHPHMVLLLGACPEYGCLV  467

Query  935   YEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANIL  756
             YEYMENGSLEDRL RK NTP IPW IRF+I+ +IATALLFLHQ KPEP+VHRDLKPANIL
Sbjct  468   YEYMENGSLEDRLFRKDNTPPIPWRIRFRIACDIATALLFLHQMKPEPVVHRDLKPANIL  527

Query  755   LDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSL  576
             LD N+VSKI DVGLARLVPPSVAD VTQYHMT+AAGTFCYIDPEYQQTG LG KSDIYS 
Sbjct  528   LDHNYVSKIGDVGLARLVPPSVADSVTQYHMTAAAGTFCYIDPEYQQTGMLGVKSDIYSF  587

Query  575   GVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRK  396
             GV+LLQ+ITA+ PMGL++ VE AIE   F ++LDPTI+DWP+E+ L  A+L+L+C ELRK
Sbjct  588   GVLLLQLITARSPMGLSYQVEEAIEHDKFPEILDPTITDWPIEDTLGLAQLALKCCELRK  647

Query  395   KDRPDLGSVILPELNRLKELAL  330
             +DRPDL +V++PEL+RLK L L
Sbjct  648   RDRPDLRTVLMPELSRLKNLGL  669



>gb|EMS62362.1| U-box domain-containing protein 52 [Triticum urartu]
Length=686

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/667 (56%), Positives = 477/667 (72%), Gaps = 32/667 (5%)
 Frame = -3

Query  2249  LLHVRHKASPNHQNG----GPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEV  2082
             L+HVR   S   Q G    G    G  +D +   +F  +R Y AR+G+ + E  ++  ++
Sbjct  9     LVHVRINQST--QTGLALYGEAGRGVDTDAEMSQLFISYRGYCARKGMHLNEVILDGNDI  66

Query  2081  AKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSI  1902
             +KAI+ Y   H ++++V+GAS+R+   R+F   DVPT + K APD+C+V+VI KGK   +
Sbjct  67    SKAIIDYATGHAITDIVVGASTRNTFIRRFRNPDVPTCLMKMAPDYCTVHVIHKGKAIQV  126

Query  1901  RPAARP--LTNLPTH----------IWshhgsssrassrgssaasssAGDDRISACS---  1767
             + A  P   T LP             +       R  S  SS  +S    DR+S  +   
Sbjct  127   KAAKAPAPFTTLPPKQNSQPNIEPDAFPRSSREWRKFSNPSSPRTSRTSVDRLSGYAKVP  186

Query  1766  SRGEH--SGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLD  1593
             ++  H  SGR   + +  D    +  P  S  R+S ++D D   P+S   ++    ++L+
Sbjct  187   TKDRHLLSGRQAPQKDFDDYIDFIAPPRPSVTRSSFSDDVDF--PMSMELNSLDYGESLE  244

Query  1592  FTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIe  1413
              +  S A  ++ S A KD+E+EM+RL+LELKQTM+MYN+ACKEAI AK+ A +L QMK+E
Sbjct  245   LS--SYASLESLSSAGKDVEAEMRRLRLELKQTMEMYNSACKEAIDAKQKAAQLSQMKVE  302

Query  1412  esqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketae  1233
             ES+ +++ R +EE AL +VEMEKAKCKAA+EAAE AQKIAE+EAQ+   AE KAK+E  E
Sbjct  303   ESKLYQELRSSEEEALALVEMEKAKCKAALEAAEAAQKIAELEAQKRLRAEWKAKREFEE  362

Query  1232  KNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLR  1053
             + RA    S +D RYR+YSID+IE AT KF +++KIGEGGYGPVY+  LDHT VAIK+LR
Sbjct  363   RRRA----SDTDPRYRRYSIDDIEAATHKFDRALKIGEGGYGPVYKAVLDHTNVAIKILR  418

Query  1052  PDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPA  873
             PDA+QGRKQFQQE+E+LS MRHPNMVLLLGACPEYGCLVYEYM+ GSLEDRL R+GNT  
Sbjct  419   PDASQGRKQFQQEIEILSSMRHPNMVLLLGACPEYGCLVYEYMDYGSLEDRLCRRGNTKP  478

Query  872   IPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPS  693
             IPW IRF+I+A+IAT LLFLHQ+KPEPLVHRDLKP NILLD NFVSKISDVGLARLVP S
Sbjct  479   IPWNIRFRIAADIATGLLFLHQAKPEPLVHRDLKPGNILLDHNFVSKISDVGLARLVPQS  538

Query  692   VADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVE  513
             +A +VTQY MTS AGTFCYIDPEYQQTG L TKSDIYS G++LLQIITA+ PMGLTH VE
Sbjct  539   IA-EVTQYRMTSTAGTFCYIDPEYQQTGMLTTKSDIYSFGILLLQIITARSPMGLTHQVE  597

Query  512   RAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              AIEKG F ++LDPT++DWPVEEAL FA+L+L+CAELRKKDRPDLG  ILPELNRL+ L 
Sbjct  598   HAIEKGAFQEVLDPTVTDWPVEEALAFARLALKCAELRKKDRPDLGKEILPELNRLRTLG  657

Query  332   LQSLASK  312
              +  A++
Sbjct  658   QEYEAAQ  664



>gb|KDO73524.1| hypothetical protein CISIN_1g008365mg [Citrus sinensis]
Length=568

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/452 (74%), Positives = 398/452 (88%), Gaps = 2/452 (0%)
 Frame = -3

Query  1685  SSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisda-gsdassiaSKDLESEMKRLKL  1509
             S+ R+S ++++D   P++ G  + ++ +NLDF+ +  +    ++S +S+DLE+EM+RLKL
Sbjct  51    STGRDSFSDESDYSGPLAMGSLDISS-KNLDFSSVPVSPRVSSASQSSRDLEAEMRRLKL  109

Query  1508  ELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakcka  1329
             EL+QTM+MY+ ACKEA+ AKK AKEL Q KIEE+QRFE+AR AEE AL + EMEKAKC+A
Sbjct  110   ELRQTMEMYSTACKEALNAKKKAKELNQWKIEEAQRFEEARMAEETALAIAEMEKAKCRA  169

Query  1328  ameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATE  1149
             A+EAAEKAQK+A+ EAQR K AE+KAK+E  EKNRAL+ L+ +D RYRKY+I+EIE AT+
Sbjct  170   AIEAAEKAQKLADAEAQRRKQAELKAKREAEEKNRALTALANNDVRYRKYTIEEIEEATD  229

Query  1148  KFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLL  969
             KFS++MKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQG++QFQQEVEVLS +RHPNMVLL
Sbjct  230   KFSEAMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGKRQFQQEVEVLSSIRHPNMVLL  289

Query  968   LGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPL  789
             LGACP+YGCLVYEYM NGSLEDRLLR+GNTP IPW  RFKI+AEIATALLFLHQ+KPEPL
Sbjct  290   LGACPDYGCLVYEYMHNGSLEDRLLRRGNTPVIPWRKRFKIAAEIATALLFLHQAKPEPL  349

Query  788   VHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTG  609
             VHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQYHMTSAAGTFCYIDPEYQQTG
Sbjct  350   VHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYHMTSAAGTFCYIDPEYQQTG  409

Query  608   KLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFA  429
              L TKSDIYS G+MLLQIITA+ PMGLTHHV RAIEKGT A++LDP ++DWP E A  F+
Sbjct  410   MLTTKSDIYSFGIMLLQIITARSPMGLTHHVSRAIEKGTLAEMLDPAVTDWPAEAAESFS  469

Query  428   KLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             KL++QCAELRKKDRPDLG+VI+PELNRLK+L 
Sbjct  470   KLAIQCAELRKKDRPDLGTVIVPELNRLKDLG  501



>ref|XP_009801055.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Nicotiana sylvestris]
Length=788

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/742 (52%), Positives = 487/742 (66%), Gaps = 80/742 (11%)
 Frame = -3

Query  2354  TTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSD  2175
             T   +  VA+DKD+ S  A+KWTVD+LL     V+L+HV+ K S N     P     +SD
Sbjct  15    TPNKLIAVAIDKDRGSQIALKWTVDHLLARGQTVLLIHVKLKQSANSSGQSPTKSNQISD  74

Query  2174  HDGHC----------VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLG  2025
               G            +F PFR +  R+ +   +  ++DT+V KAIV Y+N   +  ++LG
Sbjct  75    EAGSGNSELDPQTKELFLPFRVFCTRKDVQCHDVVLDDTDVVKAIVEYVNRTGIEVLILG  134

Query  2024  ASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISK-GKQQSIRPAARPLTNLPTHIWshh  1848
             A++R  + R F   D+P  + K  PDFC+V+VISK GK  S R A+RP   +  H   H 
Sbjct  135   ATTRGGLLR-FKVKDIPGGILKGVPDFCTVHVISKSGKIASTRAASRPAPFV--HPLRHQ  191

Query  1847  gsssrassrgssaasssAGDDRISACSSRGEHSGRPFR----------------RSEDRD  1716
                  ++       S+       SA S+RG +SG P                  +S    
Sbjct  192   LMQPASTKFAPFEGSTP------SAASARGPYSGGPKPVCDPPPSTLQSDTMNIKSPFTH  245

Query  1715  ADGSVRRPWN-----------SSCRNSLAEDNDLFAPISDGFDNAAA------------A  1605
               G   +P+            SS R S+   +++++  SDG+D                 
Sbjct  246   RKGPNGKPYEISLPDTDISYVSSGRPSI---DNIYSSFSDGYDGGGPTPPRLSGFSDFET  302

Query  1604  QNLD---FTRisdagsdassiaSKDLES---------------EMKRLKLELKQTMDMYN  1479
             Q+ D   F R S        ++   +ES               EM+RLK ELKQTM++Y+
Sbjct  303   QSFDSTQFGRRSVDTLTPPELSLSSIESDRPSISQGPVDDMEAEMRRLKQELKQTMELYS  362

Query  1478  NACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqk  1299
              AC+EA+TAK+ A ELQ+ K EE +R E+AR AEEAAL + E EKAK +AA+E AE AQ+
Sbjct  363   TACREALTAKQKAMELQRWKQEEQRRLEEARLAEEAALALAEKEKAKSRAAIEHAEAAQR  422

Query  1298  iaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGE  1119
             +AE+EAQ+   AEMKA KE  EKN+ L+ L+ SD RYRKY+I+EIE AT+ F+++ KIGE
Sbjct  423   LAELEAQKRISAEMKALKEAEEKNKILNKLTNSDFRYRKYTIEEIESATDYFAQTRKIGE  482

Query  1118  GGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCL  939
             GGYGPVY+  LDHTPVA+KVLRPDAA GR+QFQQEVEVLS +RHPNMVLLLGACPEYGCL
Sbjct  483   GGYGPVYKCYLDHTPVAVKVLRPDAAHGRQQFQQEVEVLSCIRHPNMVLLLGACPEYGCL  542

Query  938   VYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANI  759
             VYEYM NGSLEDRL  +G TP + W+ RF+I+AEIAT LLFLHQSKPEPLVHRDLKP NI
Sbjct  543   VYEYMSNGSLEDRLFHRGKTPPLSWQQRFRIAAEIATGLLFLHQSKPEPLVHRDLKPGNI  602

Query  758   LLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYS  579
             LLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGTFCYIDPEYQQTG LG KSD+YS
Sbjct  603   LLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDVYS  662

Query  578   LGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELR  399
             LG++ LQI+TAKPPMGLTH+V+RAIEKGTF ++LDP I DWPV+EAL  AKLSLQC+ELR
Sbjct  663   LGIIFLQILTAKPPMGLTHYVDRAIEKGTFNEMLDPAIPDWPVDEALSLAKLSLQCSELR  722

Query  398   KKDRPDLGSVILPELNRLKELA  333
             +KDRPDLG V+LP+L RL+ LA
Sbjct  723   RKDRPDLGKVVLPQLERLRALA  744



>ref|XP_008462336.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Cucumis melo]
Length=789

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/682 (49%), Positives = 449/682 (66%), Gaps = 39/682 (6%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLL--ISNPFVILLHVRHKA-SPNHQNGGPDAHGGMSDHD  2169
             T++A+ +DKNS  AVKW V++L    +    IL+HVR +   P   +  P  +   ++ +
Sbjct  15    TMIAISRDKNSQYAVKWAVEHLFNRKNTGDCILIHVRSQGLHPQEADSIPKEYRPPTEAE  74

Query  2168  GHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW  1989
              H  F P+R + AR+GI+ KE  I D +V  A++ +++ H +SN+V+GAS+R+ I RKF 
Sbjct  75    LHQFFLPYRGFCARKGIVAKEIIIHDIDVPNALIDHVSKHSISNIVVGASNRNPIMRKFK  134

Query  1988  THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssa  1809
               DV T + K+AP+ CSVYVI++GK  + R   R                   +   +  
Sbjct  135   NPDVATCLLKSAPESCSVYVIARGKVHTKRLRKR-------------------NKSQTDM  175

Query  1808  asssAGDDRISACSSRGEHSGRPFRR--SEDRDADGSVRRPWNSSCRNSLAEDNDLFAPI  1635
               S  G  R+ +  S+   S        SED+  D S       +  +S++  +D   P+
Sbjct  176   NESQTGTPRVGSSLSKTRKSAYSSISGLSEDKYRDSS------GTSNDSMSGISDFSGPL  229

Query  1634  SDGFDNAAAA-QNLDFTRisdagsdassiaSK---DLESEMKRLKLELKQTMDMYNNACK  1467
             S  F +   + +NLDF+  S   S  S ++S     +ESEMKRL+ ELKQ M+MY++A K
Sbjct  230   S--FKSIETSFENLDFSPSSSETSTRSYVSSSTPPSIESEMKRLRFELKQMMEMYDSASK  287

Query  1466  EAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVem---ekakckaameaaekaqki  1296
             EA  AK+ AKEL+Q+K+E+ +  +  R               ++    AA       +  
Sbjct  288   EAAVAKQKAKELEQLKMEKEEDDKIERGKSADEALTALAEFEKQKNKAAAEATLVAQKLA  347

Query  1295  aemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEG  1116
                  ++    E KA+ E  E+ + + +  +S+  YR+YSIDEIE AT+ F++S KIGEG
Sbjct  348   ELETQKKQIITEEKARIEAEERKKTMELFERSNICYRRYSIDEIEVATDHFNESNKIGEG  407

Query  1115  GYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLV  936
             GYGPVY+  LDHT VAIK+LRPD + G++QFQQE+EVLS MRHP+MVLLLGACPEYGCLV
Sbjct  408   GYGPVYQALLDHTSVAIKILRPDRSHGQRQFQQEIEVLSRMRHPHMVLLLGACPEYGCLV  467

Query  935   YEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANIL  756
             YEYMENGSLEDRL RK NTP IPW IRF+I+ +IATALLFLHQ KPEP+VHRDLKPANIL
Sbjct  468   YEYMENGSLEDRLFRKDNTPPIPWRIRFRIACDIATALLFLHQMKPEPVVHRDLKPANIL  527

Query  755   LDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSL  576
             LD N+VSKI DVGLARLVPPSVAD VTQYHMT+AAGTFCYIDPEYQQTG LG KSDIYS 
Sbjct  528   LDHNYVSKIGDVGLARLVPPSVADSVTQYHMTAAAGTFCYIDPEYQQTGMLGVKSDIYSF  587

Query  575   GVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRK  396
             GV+LLQ+ITA+ PMGL++ VE AIE   F ++LDPTI+DWP+E+ L  A+L+L+C ELRK
Sbjct  588   GVLLLQLITARSPMGLSYQVEEAIEHDKFPEILDPTITDWPIEDTLGLAQLALKCCELRK  647

Query  395   KDRPDLGSVILPELNRLKELAL  330
             +DRPDL +V++PEL+RLK L L
Sbjct  648   RDRPDLRTVLMPELSRLKNLGL  669



>gb|KDP25035.1| hypothetical protein JCGZ_22570 [Jatropha curcas]
Length=1031

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/727 (53%), Positives = 491/727 (68%), Gaps = 52/727 (7%)
 Frame = -3

Query  2366  SDGATTGP--ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASP-NHQNGGP-  2199
             S+G+  G   I  VA+DKDK S +A+KW ++NLL     VIL+HV H+ S  N  +G P 
Sbjct  6     SNGSKKGGNGIVAVAIDKDKGSQNALKWALENLLSRGQTVILIHVLHRVSSHNSAHGHPY  65

Query  2198  DAHGGMS--DHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLG  2025
             D   G    D   + +F  F  Y  R+ +   +  +ED +V + +  Y++   + N+V+G
Sbjct  66    DFSNGKQQLDKTTNDLFISFHCYCTRKDVQCLDIVLEDHDVVRGLTEYVSYAAIENLVVG  125

Query  2024  ASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR--PLT---------  1878
             AS R    RKF   D+P+ V+K APDFC+V+VISKGK  S+R A+R  P T         
Sbjct  126   AS-RHGFIRKFKA-DIPSSVSKGAPDFCNVFVISKGKVSSVRHASRAAPFTSPLQDQIQA  183

Query  1877  -NLPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPF------------  1737
              N P    S   S    S R  +        D   +C S  E  GR F            
Sbjct  184   LNKPIDTMSETQSMHSGSMRERTLVKPRMSVD--ESCRSPLERGGRAFNVKSFAEFMDTE  241

Query  1736  ---------RRSEDRDADGSVRRPWNSSCRNS-LAEDNDL-FAPISDG--FDNAAAAQNL  1596
                      R S DR +  SV   +  SC  S L+  +D+ F  I     F++ ++    
Sbjct  242   TELSFVSSGRPSTDRTS--SVALDFTDSCLPSRLSTSSDVSFGSIRSAPKFNDLSSLHEF  299

Query  1595  D-FTR-isdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQM  1422
               F+          SS    D+E+EM+RLKLELKQTMDMY+ ACKEA+TAK+ A EL + 
Sbjct  300   STFSHDSERTSFSGSSQTMDDMEAEMRRLKLELKQTMDMYSTACKEALTAKQKATELHRW  359

Query  1421  KIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakke  1242
             ++EE ++ E+A+ AEEAAL   E EK +C+AA+EAAE A+K+AE+EAQ+    E+KA +E
Sbjct  360   RVEEERKMEEAKIAEEAALSAAEKEKIRCRAAVEAAEAAKKLAELEAQKRLNVELKALRE  419

Query  1241  taeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIK  1062
               E  + +  L+K D RYR+YSI+EIE ATE FS+S KIGEGGYGPVY+  LDHT VA+K
Sbjct  420   AEEMKKVMEALAKKDVRYRRYSIEEIEEATECFSESRKIGEGGYGPVYKCYLDHTSVAVK  479

Query  1061  VLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGN  882
             VLRPDAAQGR QFQ+EVEVLSL+RHPNMVLLLGACPEYG LVYEYM NGSLED LLR+GN
Sbjct  480   VLRPDAAQGRSQFQREVEVLSLIRHPNMVLLLGACPEYGVLVYEYMANGSLEDCLLRRGN  539

Query  881   TPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLV  702
             +P +PW++RF+I+AEIAT LLFLHQ+KPEPLVHRDLKPANILLD N+V KISDVGLARLV
Sbjct  540   SPVLPWQLRFRIAAEIATGLLFLHQTKPEPLVHRDLKPANILLDHNYVCKISDVGLARLV  599

Query  701   PPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTH  522
              P+VA++VTQYHMTS AGTFCYIDPEYQQTG LG KSD+YSLG+MLLQI+TAKPPMGLTH
Sbjct  600   -PAVAENVTQYHMTSTAGTFCYIDPEYQQTGMLGVKSDVYSLGIMLLQILTAKPPMGLTH  658

Query  521   HVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLK  342
              VE+AIEKG+  ++LDP ++DWP+EE L FAKLSL+CAELR+KDRPDLG  +L EL +L+
Sbjct  659   IVEQAIEKGSLKEVLDPAVTDWPMEETLTFAKLSLRCAELRRKDRPDLGKEVLVELQKLR  718

Query  341   ELALQSL  321
             E A +++
Sbjct  719   EFAQENM  725



>ref|XP_004954165.1| PREDICTED: U-box domain-containing protein 35-like [Setaria italica]
Length=782

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/743 (51%), Positives = 486/743 (65%), Gaps = 82/743 (11%)
 Frame = -3

Query  2363  DGATTG--PITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAH  2190
             DG T G  P+  V +DKDKNS +A+K+  + L      ++L+HV  K +     G  DA 
Sbjct  9     DGETGGSYPLVAVCIDKDKNSQNALKYATETLAHKGQTIVLVHVNTKGT---SGGVEDAA  65

Query  2189  GGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASS  2016
             G     D     +F PFR +  R+ I  K+  ++D +VAK+IV +     +  +V+GA++
Sbjct  66    GYKQPTDPQMKDLFLPFRCFCTRKDIHCKDVVLDDHDVAKSIVEFAAHAAIEKLVVGATA  125

Query  2015  RSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQ-----QSIR--PAARPLTNL-----  1872
             R    R  +  ++ + ++KTAPDFC+VYV++KG +     Q+IR  PA  PL  +     
Sbjct  126   RGGFVR--FKAEICSTISKTAPDFCTVYVVTKGGKVTSVRQAIRQAPAVSPLRTMIQGPK  183

Query  1871  PTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSG----------RPFRRSED  1722
             P H  +     +                      SSRG+ +G           PF R+  
Sbjct  184   PEHAHAAAQKWAPPPP------------------SSRGDVAGTPMMQDNPIMSPFARTTG  225

Query  1721  RDADGSVRRPW--------------NSSCRNSLAEDNDLFAPISDGFDNAA---------  1611
               A GS R+P+               S+ R S        +  SDG D  +         
Sbjct  226   LSA-GSARKPFPEFSLPESSDISFIGSAPRRSTERYPPRLSNGSDGLDQHSFEARTPSRW  284

Query  1610  --AAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAK  1437
               +  N        + S   S  + D+E+EMKRL+LELKQTMDMY+ ACKEA++AK+ A 
Sbjct  285   GDSFGNDSTAHSQTSTSSWCSQPNDDMEAEMKRLRLELKQTMDMYSTACKEALSAKQKAM  344

Query  1436  ELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaem  1257
             ELQ+ K+EE QR ++ R  EE+A+ ++E EKAK +AA+EAAE AQ++A++EAQ+   AEM
Sbjct  345   ELQRWKVEEEQRSQETRLTEESAMALIEQEKAKARAAIEAAEAAQRLADLEAQKRIGAEM  404

Query  1256  kakketaeKNRALS--VLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLD  1083
             KA KE  E+ R++     ++   RYR+Y+I+EIE  T+ F+++ K+GEGGYGPVY+G LD
Sbjct  405   KALKEAEERLRSMGSGAGARESVRYRRYTIEEIELGTDHFNEARKVGEGGYGPVYKGHLD  464

Query  1082  HTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLED  903
             HTPVAIKVLRPDAAQGR QFQQEVEVLS +RHPNMVLLLGACPEYGCLVYEYM NGSL+D
Sbjct  465   HTPVAIKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDD  524

Query  902   RLLRKGNT-----PAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFV  738
              L  +G       P IPW+ RF+I+AEIAT LLFLHQ+KPEPLVHRDLKP NILLDRN+V
Sbjct  525   CLFHRGGGGGAGGPVIPWQHRFRIAAEIATGLLFLHQTKPEPLVHRDLKPGNILLDRNYV  584

Query  737   SKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQ  558
             SKISDVGLARLVPPSVAD+VTQ HMTSAAGTFCYIDPEYQQTG LG KSD+YSLGVMLLQ
Sbjct  585   SKISDVGLARLVPPSVADNVTQCHMTSAAGTFCYIDPEYQQTGMLGVKSDVYSLGVMLLQ  644

Query  557   IITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDL  378
             I+TA+PPMGLTHHV RA+E+GTFADLLDP + DWP+EEA  FA++SL+C ELR+KDRPDL
Sbjct  645   IVTARPPMGLTHHVGRALERGTFADLLDPAVHDWPMEEAHRFAEISLRCCELRRKDRPDL  704

Query  377   GSVILPELNRLKELALQSLASKN  309
              +V+LPELNRL+ L   ++   N
Sbjct  705   ATVVLPELNRLRALGEDNMEYCN  727



>gb|KCW70920.1| hypothetical protein EUGRSUZ_F04036 [Eucalyptus grandis]
Length=694

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/684 (52%), Positives = 465/684 (68%), Gaps = 36/684 (5%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGH  2163
             +  VA+D+DK    A++W VDN+L     VIL+HV H+ S +     P  H         
Sbjct  5     LVAVAIDRDKGCQYAIRWAVDNILSKGQTVILIHV-HQNSASAPISSP--HKQELQKLNK  61

Query  2162  CVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTH  1983
              +F  F  Y  R+ I   +  +ED +VA+AI  Y++   +  +VLGAS R    R    H
Sbjct  62    DLFLTFHCYCTRKDIHCLDVILEDMDVARAITEYVSYAGIELLVLGASHRHGFIR--LKH  119

Query  1982  -DVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP-------LTNLPTHIWshhgsssras  1827
              ++P+ V+K APDFC+VYVISKGK  S+R A+RP       L  +        G      
Sbjct  120   VNIPSSVSKGAPDFCTVYVISKGKVSSVRNASRPSPHASPLLDQIQNLNEQTAGMMPEVE  179

Query  1826  srgssaasssAGDDRISACSSRGEHSGRPFRRSE--DRDADGSVRRPWNSSCRNSLAEDN  1653
             +  S  +S  +  D+ S+       S  P R S   DR +  S+++  + S    L+  +
Sbjct  180   TDISFISSGRSSTDQPSSSLYDRMDSFHPARLSASPDRSSIHSLQKYIDFSSSYELSPIS  239

Query  1652  DLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNA  1473
                A  S  +    ++QNLD                 D+E EM+RLKLELKQTM+MY+ A
Sbjct  240   QESARTSCSY----SSQNLD-----------------DVEIEMRRLKLELKQTMEMYSTA  278

Query  1472  CKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkia  1293
             C+EA+ AK+ A ELQ  + EE Q+ ++ + A+E AL + ++E+AK KAA+E AE AQ+IA
Sbjct  279   CREALVAKQKAMELQHWRFEEEQKLDEVQHAKENALSIAKIERAKYKAALEEAEAAQRIA  338

Query  1292  emeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGG  1113
             E+EAQR   AEMKA +E  E  + L  L  SD RYR+Y+I+EIE AT  F+KS K+GEGG
Sbjct  339   ELEAQRRLNAEMKALREAEEIKKVLDELQHSDARYRRYTIEEIEAATNFFAKSHKVGEGG  398

Query  1112  YGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVY  933
             YGPV++  LDHTPVA+KVLRPDA  GR QFQQEVEVLS +RHPNMVLLLGACPEYGCLVY
Sbjct  399   YGPVFKCYLDHTPVAVKVLRPDAVHGRSQFQQEVEVLSRIRHPNMVLLLGACPEYGCLVY  458

Query  932   EYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILL  753
             EYM NGSLE+RL ++G +P + W++RF+I+AEIAT LLF+HQ+KPEPLVHRDLKP NILL
Sbjct  459   EYMANGSLEERLFKRGKSPVLSWQLRFRIAAEIATGLLFIHQTKPEPLVHRDLKPGNILL  518

Query  752   DRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLG  573
             D N+VSKISDVGLARLVPPSVA+ VTQY MTS AGTFCYIDPEYQQTG LG KSD+YS G
Sbjct  519   DYNYVSKISDVGLARLVPPSVAESVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDVYSFG  578

Query  572   VMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKK  393
             ++LLQ+ITAK PMG+THHV ++IEKG F+++LDP + DWPVEEAL  A+++LQCAE+R+K
Sbjct  579   IVLLQLITAKSPMGITHHVSKSIEKGNFSEMLDPDVPDWPVEEALSLAQIALQCAEMRRK  638

Query  392   DRPDLGSVILPELNRLKELALQSL  321
             DRPDLG V+LPELN+L++ A ++L
Sbjct  639   DRPDLGKVVLPELNKLRDFADENL  662



>ref|XP_006285266.1| hypothetical protein CARUB_v10006638mg, partial [Capsella rubella]
 gb|EOA18164.1| hypothetical protein CARUB_v10006638mg, partial [Capsella rubella]
Length=1104

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/732 (52%), Positives = 492/732 (67%), Gaps = 46/732 (6%)
 Frame = -3

Query  2393  DHHHHPTISSD---------GATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLH  2241
             D+  HPT   +         G  T  +  VA+D+DKNS +A+KW VDNLL     V+L+H
Sbjct  376   DYDLHPTCVEEQEALRDRDGGFGTDGLVAVAIDRDKNSQTALKWAVDNLLQKGQTVVLVH  435

Query  2240  VRHKASPNHQNGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGY  2061
             V+ + S    N   +++    +     +F PFR   +R+ I  K+  +E+++VAKA+V Y
Sbjct  436   VKPRGSSLSSNPSINSNSSNPEGSYKQLFLPFRCLCSRKDIQCKDVLLEESDVAKALVEY  495

Query  2060  INTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPL  1881
              N   +  +V+G+SS+    R     D+P  + K+APDFC+VYVI+KGK  + + A+R  
Sbjct  496   ANQVVIEVLVVGSSSKGGFLRFNKPTDIPGTITKSAPDFCTVYVITKGKLSTKKTASRAA  555

Query  1880  TNL-PTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPF-RRSEDRDADG  1707
              ++ P  I         +        S +  + R    S   +H   P+ RR     + G
Sbjct  556   PSVSPLRI----QLQQTSLKPHPPLPSPATTNTRAERQSFESQHRRSPYNRRGLTGRSYG  611

Query  1706  SVRRP-----WNSSCRNSLA---------EDNDLFAPISDGFDNA--AAAQNLDFTRisd  1575
              +  P     +NSS R S+          +D +   P    F +    + +++ F R S 
Sbjct  612   DLSIPDSDISFNSSGRPSIERSSLSLYDNQDPNRTPPRLSNFSDVDYGSFESMTFGRRSM  671

Query  1574  agsdassiaSKDLE---------------SEMKRLKLELKQTMDMYNNACKEAITAKKSA  1440
               S  ++ ++   E               +EM+RLKLELKQTM+MY+ ACKEA+TAK  A
Sbjct  672   DISSPTAFSTGSFENERFSSASQGMDDVEAEMRRLKLELKQTMEMYSTACKEALTAKHKA  731

Query  1439  KELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyae  1260
              ELQ+ K+EE ++FE+A+ AEEAAL + E EKAK KAAMEAAE AQ+IAE+E+++   AE
Sbjct  732   TELQRWKLEEERKFEEAKIAEEAALAIAEKEKAKSKAAMEAAEAAQRIAEIESKKRVNAE  791

Query  1259  mkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDH  1080
             MKA KE+  + +A++ L+ S+ RYRKYSI+EIE ATE F +  KIGEG YGPVY+  LDH
Sbjct  792   MKALKESEARTKAVNALANSEVRYRKYSIEEIEDATEFFDEKYKIGEGSYGPVYKCYLDH  851

Query  1079  TPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDR  900
             TPVA+K LRPDAAQGR QFQQEVEVLS MRHPNMVLLLGACPE GCLVYE+M NGSLEDR
Sbjct  852   TPVAVKALRPDAAQGRSQFQQEVEVLSSMRHPNMVLLLGACPECGCLVYEFMANGSLEDR  911

Query  899   LLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDV  720
             L R+G++P + W+ RF+I+AEI T LLFLHQ+KPEPLVHRDLKPANILLDRNFVSK++DV
Sbjct  912   LFRQGDSPPLSWQTRFRIAAEIGTVLLFLHQTKPEPLVHRDLKPANILLDRNFVSKVADV  971

Query  719   GLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKP  540
             GLARLVPPSVA+ VTQY MTS AGTFCYIDPEYQQTG LG KSDIYSLG+M LQ+ITAKP
Sbjct  972   GLARLVPPSVANTVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKP  1031

Query  539   PMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILP  360
             PMGLTH+VERA+EKG   DLLDP +SDWPVE+   FAKL+L+CAE+R+KDRPDL  VILP
Sbjct  1032  PMGLTHYVERALEKGNLKDLLDPAVSDWPVEDTTEFAKLALKCAEIRRKDRPDLSKVILP  1091

Query  359   ELNRLKELALQS  324
             ELNRL+ LA +S
Sbjct  1092  ELNRLRVLAEES  1103



>ref|XP_009616384.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Nicotiana tomentosiformis]
Length=789

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/755 (52%), Positives = 489/755 (65%), Gaps = 84/755 (11%)
 Frame = -3

Query  2381  HPTISSDGATTGP---ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS----  2223
             HP     G    P   +  VA+DKD+ S  A+KWTVD+LL     V+L+HV+ K S    
Sbjct  3     HPPQGVHGERMHPPNKLIAVAIDKDRGSQIALKWTVDHLLARGQTVLLIHVKLKQSATST  62

Query  2222  ----PNHQNGGPDAHG-GMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVG  2064
                 P   N   D  G G S+ D     +F PFR +  R+ +   +  ++DT+V KAIV 
Sbjct  63    GQSTPTKSNQISDEAGSGNSELDPQTKELFLPFRVFCTRKDVQCHDVVLDDTDVVKAIVE  122

Query  2063  YINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISK-GKQQSIRPAAR  1887
             Y+N   +  ++LGA++R  + R F   D+P  + K  PDFC+V+VISK  K  S R A+R
Sbjct  123   YVNRTGIEVLILGATTRGGLLR-FKAKDIPGGILKGVPDFCTVHVISKSAKIASTRAASR  181

Query  1886  PLTNLPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFR---------  1734
             P   +  H   H      ++       S+       SA SSRG  SG P           
Sbjct  182   PAPFV--HPLRHQLMQPASTKFAPFEGSTP------SAASSRGPFSGGPKPVCDPPPSTL  233

Query  1733  -------RSEDRDADGSVRRPWN-----------SSCRNSLAEDNDLFAPISDGFDNAAA  1608
                    +S      G   +P+            SS R S+   +++++  SDG+D    
Sbjct  234   QSDTMNIKSPFTHRKGPNGKPYEISLPDTDISYVSSGRPSI---DNIYSSFSDGYDGGGP  290

Query  1607  ------------AQNLD---FTRisdagsdassiaSKDLES---------------EMKR  1518
                          Q+ D   F R S        ++   +ES               EM+R
Sbjct  291   TPPRLSGFSDFETQSFDSTQFGRRSVDTLTPPELSHSSIESDRPSVSQGPVDDMEAEMRR  350

Query  1517  LKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekak  1338
             LK ELKQTM++Y+ AC+EA+TAK+ A ELQ+ K EE +R E+AR AEEAAL + E EKAK
Sbjct  351   LKQELKQTMELYSTACREALTAKQKAMELQRWKQEEQRRLEEARLAEEAALALAEKEKAK  410

Query  1337  ckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEF  1158
              +AA+E AE AQ++AE+EAQ+   AEMKA KE  EKN+ L+ L+ SD RYRKY+I+EIE 
Sbjct  411   SRAAIEHAEAAQRLAELEAQKRISAEMKALKEAEEKNKILNKLTNSDFRYRKYTIEEIES  470

Query  1157  ATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNM  978
             AT+ F+++ KIGEGGYGPVY+  LDHTPVA+KVLRPDAA GR+QFQQEVEVLS +RHPNM
Sbjct  471   ATDYFAQTRKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAHGRQQFQQEVEVLSCIRHPNM  530

Query  977   VLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKP  798
             VLLLGACPEYGCLVYEYM NGSLEDRL  +G TP + W+ RF+I+AEIAT LLFLHQSKP
Sbjct  531   VLLLGACPEYGCLVYEYMSNGSLEDRLFHRGKTPPLSWQQRFRIAAEIATGLLFLHQSKP  590

Query  797   EPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQ  618
             EPLVHRDLKP NILLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGTFCYIDPEYQ
Sbjct  591   EPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQ  650

Query  617   QTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEAL  438
             QTG LG KSD+YSLG++ LQI+TAKPPMGLTH+V+RAIEKGTF ++LDP I DWPV EAL
Sbjct  651   QTGMLGVKSDVYSLGIIFLQILTAKPPMGLTHYVDRAIEKGTFNEMLDPAIPDWPVNEAL  710

Query  437   HFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
               AKLSLQC+ELR+KDRPDLG V+LP+L RL+ LA
Sbjct  711   SLAKLSLQCSELRRKDRPDLGKVVLPQLERLRALA  745



>ref|XP_004141807.1| PREDICTED: U-box domain-containing protein 51-like [Cucumis sativus]
 ref|XP_004155971.1| PREDICTED: U-box domain-containing protein 51-like [Cucumis sativus]
Length=724

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/694 (47%), Positives = 446/694 (64%), Gaps = 35/694 (5%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLL--ISNPFVILLHVRHKA-SPNHQNGGPDAHGGMSDHD  2169
             TV+A+ +DKNS  AVKW V++L    +    +L+HVR ++  P   +  P      ++ +
Sbjct  19    TVIAISRDKNSHYAVKWAVEHLFNRKNTGECVLIHVRTQSLHPQEVDTIPKEFRPPTEAE  78

Query  2168  GHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW  1989
              H  F P+R + AR+GI+ KE  I D +V  A++ +I+ H +SN+V+GAS+R+ I RK  
Sbjct  79    LHQFFLPYRGFCARKGIVAKEIIIHDIDVPNALIDHISKHSISNIVVGASNRNPIMRKLK  138

Query  1988  THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssa  1809
               DV T + K+AP+ CSVYVI++GK  + R   R                   +   +  
Sbjct  139   NPDVATCLLKSAPESCSVYVIARGKVHTKRLRKR-------------------NKSQTDM  179

Query  1808  asssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISD  1629
               +  G  RIS   S+ + S       +  D      R  + +  +S +  +D   P+S 
Sbjct  180   TETQTGTPRISGSLSKTQKSAYSSISGQSEDK----YRYSSGTSNDSTSGISDFSGPLS-  234

Query  1628  GFDNAAAA-QNLDFTRisdagsdassiaSKD---LESEMKRLKLELKQTMDMYNNACKEA  1461
              F +   + +N DF+  S   S  S ++S     +E EMK+L+ ELK+ M+MY++ACKEA
Sbjct  235   -FKSIETSFENQDFSLSSSETSTRSYVSSSTPPTIEYEMKKLRFELKKMMEMYDSACKEA  293

Query  1460  ITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVem---ekakckaameaaekaqkiae  1290
               AK+ AKEL+ +K+E+ +  +                  ++     A       +    
Sbjct  294   AVAKQKAKELRHLKMEKEEDNKIECGKSTYEALTTLAEFEKQKNKAEAEATLVAQKLAEL  353

Query  1289  meAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGY  1110
                ++    E KA+ E  E+ + + +  +S+  YR++SID+IE AT+ F++S KIGEGGY
Sbjct  354   ETQKKRIITEEKARIEAEERKKTMELFERSNICYRRFSIDQIEVATDHFNESNKIGEGGY  413

Query  1109  GPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYE  930
             GPVY+  L+HT VAIK+LRPD + G++QFQQE+EVLS MRHPNMVLLLGACPEYGCLVYE
Sbjct  414   GPVYQALLEHTSVAIKILRPDRSHGQRQFQQEIEVLSRMRHPNMVLLLGACPEYGCLVYE  473

Query  929   YMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLD  750
             YMENGSLEDRL RK NTP IPW IRF+I+ +IATALLFLHQ KPEP+VHRDLKPANILLD
Sbjct  474   YMENGSLEDRLFRKDNTPPIPWRIRFRIACDIATALLFLHQMKPEPVVHRDLKPANILLD  533

Query  749   RNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGV  570
              N+VSKI DVGLARLVPP+VAD VTQYHMT+AAGTFCYIDPEYQQTG LG KSDIYS GV
Sbjct  534   HNYVSKIGDVGLARLVPPTVADSVTQYHMTAAAGTFCYIDPEYQQTGMLGVKSDIYSFGV  593

Query  569   MLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKD  390
             +LLQ+ITA+ PMGL++ VE AIE G F ++LDPTI+DWP+E+ L  A+L+L+C ELRK+D
Sbjct  594   LLLQLITARSPMGLSYQVEEAIEHGKFPEILDPTITDWPIEDTLGLAQLALKCCELRKRD  653

Query  389   RPDLGSVILPELNRLKELALQSLASKNGTQTFGR  288
             RPDL +V++PEL+RLK L       K+   T  R
Sbjct  654   RPDLCTVLMPELSRLKNLGSGETPPKSKLATVSR  687



>ref|XP_006355246.1| PREDICTED: U-box domain-containing protein 35-like [Solanum tuberosum]
Length=767

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/742 (52%), Positives = 488/742 (66%), Gaps = 69/742 (9%)
 Frame = -3

Query  2378  PTISSDGAT-TGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS--PNHQN  2208
             PT  + GA     +  VA+DKD+ S  A+KW VDNLL     +IL+HV+ KAS  P  Q+
Sbjct  5     PTAMNHGAPPLNKLIAVAIDKDRGSQIALKWAVDNLLARGQTIILIHVKVKASGTPFSQS  64

Query  2207  G------GPDAHGGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINT  2052
             G      G +   GMS+ D     +F PFR +  R+ I   +  +ED +V KAI+ YIN 
Sbjct  65    GNRINQDGSNDGPGMSELDPQLKELFLPFRVFCTRKDIQCHDVVLEDADVVKAIIEYINR  124

Query  2051  HRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISK-GKQQSIRPAAR--PL  1881
               +  ++LGA+++  + R F   D+P  V K  PDFC+VYVISK GK  S R AAR  P 
Sbjct  125   TAIEVLILGAAAKGGLLR-FKIKDIPGNVLKGVPDFCTVYVISKSGKISSTRSAARLAPF  183

Query  1880  TNLPTHIWshhgsssrassrgs-------------------saasssAGDDRISACSSRG  1758
              +   H ++ + +    S   S                    +   S   +  S  + R 
Sbjct  184   IHPLRHQFTQNANVKSNSIEDSNVPPRGSISGIPKPVSDIPMSNLHSDTFNMKSPFTHRK  243

Query  1757  EHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNL----DF  1590
               +G+P+  S+  D D S    + SS R S+   +++F   +D FD+ A    L    D+
Sbjct  244   GPNGKPYEISQP-DTDIS----FVSSGRPSI---DNMFPSFADTFDSGATPPRLSGFSDY  295

Query  1589  TRisdagsdassiaSKDLESEMKRLKLE-----------------------LKQTMDMYN  1479
                S         +   + SEM  L +E                       LKQTM+MY+
Sbjct  296   EGQSFEPMPMGRRSLDIMPSEMSFLSMEGDRPSFSSTPDDVAAEMRRLKLELKQTMEMYS  355

Query  1478  NACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqk  1299
              ACKEA+TA++ A ELQ+ K EE +R E+AR AEEAAL + E EKAK +AA+E AE AQ+
Sbjct  356   TACKEALTAQQKATELQRWKAEEQRRIEEARFAEEAALALAEKEKAKSRAALEHAEAAQR  415

Query  1298  iaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGE  1119
             +AE+E+Q+   AEMKA KE  E+N+ L+ LS SD RYR+YSI+EIE AT  F++S KIGE
Sbjct  416   LAELESQKRINAEMKALKEAEERNKVLNKLSNSDFRYRRYSIEEIESATNYFAQSNKIGE  475

Query  1118  GGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCL  939
             GGYGPVY+  +DHT VA+KVLRPDAA GR+QFQQEVEVLS +RHPNMVLLLGACPEYGCL
Sbjct  476   GGYGPVYKCYMDHTHVAVKVLRPDAAHGRQQFQQEVEVLSCIRHPNMVLLLGACPEYGCL  535

Query  938   VYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANI  759
             +YE+M NGSLEDRL ++GN+PA+ W+ RF+I+AEI   LLFLHQSKPEP+VHRDLKPANI
Sbjct  536   IYEFMSNGSLEDRLFQRGNSPALSWQHRFRIAAEIGAGLLFLHQSKPEPIVHRDLKPANI  595

Query  758   LLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYS  579
             LLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGTFCYIDPEYQQTG LG KSD+YS
Sbjct  596   LLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGIKSDVYS  655

Query  578   LGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELR  399
             LG++ LQI+TAKPPMGLTHHVERAI+KGTF D+LD ++ DWP ++AL  AKLSL+C+ELR
Sbjct  656   LGIIFLQILTAKPPMGLTHHVERAIDKGTFNDMLDSSVPDWPRDDALSLAKLSLKCSELR  715

Query  398   KKDRPDLGSVILPELNRLKELA  333
             +KDRPDL  VI+PEL RL+ L 
Sbjct  716   RKDRPDLSKVIMPELERLRTLG  737



>ref|XP_004245436.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Solanum lycopersicum]
 ref|XP_010325201.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Solanum lycopersicum]
Length=767

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/735 (52%), Positives = 484/735 (66%), Gaps = 68/735 (9%)
 Frame = -3

Query  2360  GATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS--PNHQNG------  2205
             G     +  VA+DKD+ S  A+KW VDNLL     +IL+HV+ K S  P  Q+G      
Sbjct  12    GPPLNKLIAVAIDKDRGSQVALKWAVDNLLARGQTIILIHVKVKPSGTPFSQSGNRINQD  71

Query  2204  GPDAHGGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVV  2031
             G +   GM++ D     +F PFR +  R+ I   +  +ED +V KAIV YIN   +  ++
Sbjct  72    GSNDGSGMTELDPQLKELFLPFRVFCTRKDIQCHDVVLEDADVVKAIVEYINRTAIEVLI  131

Query  2030  LGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISK-GKQQSIRPAAR--PLTNLPTHI  1860
             LGA+++  + R F   D+P  V K APDFC+VYVISK GK  S R AAR  P  +   H 
Sbjct  132   LGAAAKGGLLR-FKLKDIPGNVLKGAPDFCTVYVISKSGKISSTRSAARLAPFVHPLRHQ  190

Query  1859  Wshhgsssras-------------------srgssaasssAGDDRISACSSRGEHSGRPF  1737
             ++ +G+    S                   S    +   S   +  S  + R   +G+P+
Sbjct  191   FTQNGNVKSNSFEDFNVPPRGSISGIPKPVSDMPMSNLHSDTFNMKSPFTHRKGPNGKPY  250

Query  1736  RRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNL----DFTRisdag  1569
               S+  D D S    + SS R S+   +++F   +D FD+      L    D+   S   
Sbjct  251   EISQP-DTDIS----FVSSGRPSI---DNMFPSFADSFDSGTTPPRLSGFSDYEGQSFEP  302

Query  1568  sdassiaSKDLESEMKRLKLE-----------------------LKQTMDMYNNACKEAI  1458
                   +   + SEM  L +E                       LKQTM+MY+ ACKEA+
Sbjct  303   MPMGRRSLDIMPSEMSLLSMEGDRPSFSSTPDDVAAEMRRLKLELKQTMEMYSTACKEAL  362

Query  1457  TAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQ  1278
             TA++ A ELQ+ K EE +R E+AR AEEAAL + E EKAK +AA+E AE AQ++AE+E+Q
Sbjct  363   TAQQKATELQRWKAEEQRRIEEARFAEEAALALAEKEKAKSRAALEHAEAAQRLAELESQ  422

Query  1277  RTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVY  1098
             +   AEMKA KE  E+N+ L+ LS SD RYR+YSI+EIE AT  F++S KIGEGGYGPVY
Sbjct  423   KRINAEMKALKEAEERNKVLNKLSNSDVRYRRYSIEEIESATNYFAESNKIGEGGYGPVY  482

Query  1097  RGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMEN  918
             +  +DHT VA+KVLRPDAA GR+QFQQEVEVLS +RHPNMVLLLGACPEYGCL+YE+M N
Sbjct  483   KCYMDHTHVAVKVLRPDAAHGRQQFQQEVEVLSCIRHPNMVLLLGACPEYGCLIYEFMSN  542

Query  917   GSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFV  738
             GSLEDRL +KGN+PA+ W+ RF+I+AEI   LLFLHQSKPEP+VHRDLKPANILLDRNFV
Sbjct  543   GSLEDRLFQKGNSPALSWQHRFRIAAEIGAGLLFLHQSKPEPIVHRDLKPANILLDRNFV  602

Query  737   SKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQ  558
             SKISDVGLARLVPPSVAD VTQY MTS AGTFCYIDPEYQQTG LG KSD+YSLG++ LQ
Sbjct  603   SKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGIKSDVYSLGIIFLQ  662

Query  557   IITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDL  378
             I+TAKPPMGLTHHVERAI+KGTF D+LD ++ DWP ++AL  AKLSL+C+ELR+KDRPDL
Sbjct  663   ILTAKPPMGLTHHVERAIDKGTFNDMLDSSVPDWPRDDALSLAKLSLKCSELRRKDRPDL  722

Query  377   GSVILPELNRLKELA  333
               VI+PEL RL+ L 
Sbjct  723   SKVIMPELERLRTLG  737



>ref|XP_010234042.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Brachypodium 
distachyon]
Length=689

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/661 (56%), Positives = 471/661 (71%), Gaps = 45/661 (7%)
 Frame = -3

Query  2204  GPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLG  2025
             G DA   MS      +F  +R Y AR+G+ + E  +++ +++KAIV Y  +H ++++V+G
Sbjct  17    GVDADAEMSQ-----LFISYRGYCARKGMHLNEVILDNNDISKAIVDYATSHTITDIVVG  71

Query  2024  ASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAA--RPLTNLP------  1869
             AS+R+   R+F   DVPT + K APD+C+V+VI KGK   ++ A    P T LP      
Sbjct  72    ASTRNTFIRRFRNPDVPTCLMKMAPDYCTVHVIHKGKAIQVKAAKGPAPFTTLPPKQNSQ  131

Query  1868  -----------THIWshhgsssrassrgssa-------asssAGDDRISACS---SRGEH  1752
                        +  W      S   S  SS          +    +R+SA S   ++  H
Sbjct  132   PNIESDPFARSSRDWRKFSQPSSPKSNRSSVDRNRPSVERNRPSVERLSAYSKAPTKDRH  191

Query  1751  --SGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRis  1578
               SGR   + +  D    +  P  S  R+S ++D D   P+S   ++    ++L+ +  S
Sbjct  192   LLSGRQAPQRDFDDYIDFIAPPRPSVTRSSFSDDIDF--PMSMELNSMDYGESLELS--S  247

Query  1577  dagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrf  1398
                 ++ S A KD+E+EM+RL+LELKQTM+MYN+ACKEA+ AK+ A +L QMK+EES+++
Sbjct  248   YVSIESLSSAGKDVEAEMRRLRLELKQTMEMYNSACKEAVDAKQKAAQLSQMKVEESKKY  307

Query  1397  eqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRAL  1218
             E+ R +EE AL +VEMEKAKC+AA+EAAE AQKIAE+EAQ+   AE KAK+ET E+ RA 
Sbjct  308   EELRNSEEEALALVEMEKAKCRAALEAAEAAQKIAELEAQKRLRAEWKAKRETDERRRA-  366

Query  1217  SVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQ  1038
                + +D RYR+YSID+IE AT KF +++KIGEGGYGPVY+  LDHT VAIK+LRPDA+Q
Sbjct  367   ---TDTDLRYRRYSIDDIEAATHKFDRALKIGEGGYGPVYKAVLDHTNVAIKILRPDASQ  423

Query  1037  GRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEI  858
             GR+QFQQE+E+LS MRHPNMVLLLGACPEYGCLVYEYM+ GSLEDRL R+GNT  IPW I
Sbjct  424   GRQQFQQEIEILSSMRHPNMVLLLGACPEYGCLVYEYMDYGSLEDRLCRRGNTKPIPWNI  483

Query  857   RFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDV  678
             RF+I+A+IAT LLFLHQ+KPEPLVHRDLKP NILLD NFVSKISDVGLARLVP S+A +V
Sbjct  484   RFRIAADIATGLLFLHQAKPEPLVHRDLKPGNILLDHNFVSKISDVGLARLVPQSIA-EV  542

Query  677   TQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEK  498
             TQY MTS AGTFCYIDPEYQQTG L TKSDIYS G++LLQIITA+ PMGLTH VE AIE+
Sbjct  543   TQYRMTSTAGTFCYIDPEYQQTGMLTTKSDIYSFGILLLQIITARSPMGLTHQVEDAIER  602

Query  497   GTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLA  318
             G F ++LD T++DWPVEEAL FA+L+L+CAELRKKDRPDLG  I+PELNRL+ L  +  A
Sbjct  603   GAFQEVLDQTVTDWPVEEALAFAQLALKCAELRKKDRPDLGKEIMPELNRLRNLGQEYEA  662

Query  317   S  315
             S
Sbjct  663   S  663



>gb|AAD40140.1|AF149413_21 contains similarity to protein kinase domains; Pfam PF00069, 
Score=129.3, E=7e-35, N=1 [Arabidopsis thaliana]
Length=675

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/693 (54%), Positives = 478/693 (69%), Gaps = 69/693 (10%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLL--ISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             TVVA+DK+K+S+ AV+W VD+LL  I NP +IL+HVR K S NH                
Sbjct  17    TVVAIDKEKHSSYAVRWAVDHLLNMIHNPVMILVHVRTKNS-NH----------------  59

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW-  1989
                                     D++VAK I+ Y+N + V+N+VLGAS+++  +R F  
Sbjct  60    ------------------------DSDVAKTILDYVNNNLVNNLVLGASTKNTFARSFMF  95

Query  1988  --THDVPTIVNKTAPDFCSVYVISKG-KQQSIRPAARPLTNLPTHIWshhgsssrassrg  1818
                H+V + + K+ PDFCSVYVISKG K QS    +RP     T+  +     S      
Sbjct  96    SKPHEVQSSIMKSTPDFCSVYVISKGGKVQS----SRPAQRPITNTLAPPRVPSSGFLIQ  151

Query  1817  ssaasssAGDDRIS-ACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSC-------RNSLA  1662
             S + S      R+  +  ++   +  P  R+         + P N S        + +  
Sbjct  152   SLSDSEQDLIPRVQRSARNKPNETTYPHNRAAFNTTQKGYKSPINGSMDFNNGFNQAAFQ  211

Query  1661  EDNDLFAPISDGFDNA---------AAAQNLDFTRisdagsdass-iaSKDLESEMKRLK  1512
              +  L +  SD  D           ++  ++DF   + + S+ S   ++KD+E+EM+RLK
Sbjct  212   RNPTLQSSFSDESDGGFGVMGSVDLSSQNSMDFYHGASSSSEESIPQSTKDIEAEMRRLK  271

Query  1511  LELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakck  1332
             LELKQTMDMY++ACKEA+TAK+ A EL Q KIEE+++FE+AR +EEAAL + E+EKAKC+
Sbjct  272   LELKQTMDMYSSACKEALTAKRKANELNQWKIEEARKFEKARLSEEAALAVAEIEKAKCR  331

Query  1331  aameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFAT  1152
              A+EAAEKAQ++AE+E QR K AEMKA  E  +K+RA+S L+ +D RYRKYSI+EIE AT
Sbjct  332   TAVEAAEKAQRMAELEGQRRKQAEMKAVSEEKDKDRAVSALAHNDVRYRKYSIEEIEEAT  391

Query  1151  EKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVL  972
             E+F+   KIGEGGYGPVY G+LDHTPVAIKVLRPDAAQG+KQFQQEVEVL  +RHP+MVL
Sbjct  392   ERFANHRKIGEGGYGPVYNGELDHTPVAIKVLRPDAAQGKKQFQQEVEVLCSIRHPHMVL  451

Query  971   LLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEP  792
             LLGACPEYGCLVYE+MENGSLEDRL R GN+P + W  RF+I+AEIATAL FLHQ+KPEP
Sbjct  452   LLGACPEYGCLVYEFMENGSLEDRLFRTGNSPPLSWRKRFEIAAEIATALSFLHQAKPEP  511

Query  791   LVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQT  612
             LVHRDLKPANILLD+N+VSKISDVGLARLVP S+AD VTQ+HMTSAAGTFCYIDPEYQQT
Sbjct  512   LVHRDLKPANILLDKNYVSKISDVGLARLVPASIADSVTQFHMTSAAGTFCYIDPEYQQT  571

Query  611   GKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHF  432
             G L TKSD+YSLG++LLQIIT +PPMGL H V RAI KGTF ++LDP + DWPV+EA  F
Sbjct  572   GMLTTKSDVYSLGILLLQIITGRPPMGLAHQVSRAISKGTFKEMLDPVVPDWPVQEAQSF  631

Query  431   AKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             A L+L+CAELRK+DRPDLG  ++P L RLK   
Sbjct  632   ATLALKCAELRKRDRPDLGKEVVPHLIRLKNFG  664



>ref|XP_009418576.1| PREDICTED: U-box domain-containing protein 35-like [Musa acuminata 
subsp. malaccensis]
Length=737

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/704 (49%), Positives = 454/704 (64%), Gaps = 58/704 (8%)
 Frame = -3

Query  2366  SDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHG  2187
             SDG     +  VAVD+DK+S +A +W +DN++     + L+HV  K+             
Sbjct  20    SDGQAR-QLVAVAVDRDKSSHAAFRWALDNVVTKGQTLTLIHVNTKS-------------  65

Query  2186  GMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASS-RS  2010
             G  D D   VF PFR +  R+ +  K+  +EDT+VAKAI+G++    +  +V+G+SS R 
Sbjct  66    GYGD-DARDVFVPFRCFCTRKDVYNKDVILEDTDVAKAIIGFVADAAIEKLVVGSSSSRG  124

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssra  1830
                R F   D+ T + K  PDFC+VY+I KGK  S++ A RP    P            +
Sbjct  125   GFVRSFRNSDISTNIYKGVPDFCTVYLIHKGKVSSVKNAVRPA---PAFSLLQKQIQGLS  181

Query  1829  ssrgssaasssAGD--DRISACSSRGEHSGRPFRRSEDRDADGSVRRPWN-SSCRNSLAE  1659
             S R  S   S   D  DR     S    + R  +R      D S++ P+   +C ++   
Sbjct  182   SVRPDSLDHSHKNDMKDRNFLMPSEAAFAPRNLQRE-----DESIKSPFTRGTCVSTKKS  236

Query  1658  DNDL-----------------FAPISDGFD-NAAAAQNLDFTRisdagsdassiaSKDLE  1533
             + ++                  + ISD +D N+ ++ +      S +    SS   +D+E
Sbjct  237   NGEMMIDGDKSLANARSYPPRLSNISDTYDCNSESSCSSGNEVASLSSESLSSQPKEDVE  296

Query  1532  SEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVe  1353
             +++ RL+LELKQTMDMY+ A +EA+TAK+ A ELQ+ K+E+  R E+A+  +EAA    +
Sbjct  297   AKLNRLRLELKQTMDMYSTARREALTAKQKAMELQRWKMEDEPRLEEAQLVKEAANVFAQ  356

Query  1352  mekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSI  1173
              E A+    +  ++  + I       T+  +                LS +   YRKY+I
Sbjct  357   RETAEASRKIAVSKSQKNIRGEVIAETEKND-------------FEALSHTSLSYRKYTI  403

Query  1172  DEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLM  993
             +EIE AT+ +++  KIGEGGYGPVYRG LDHTPVAIKVLRPDAAQGR QFQ+EVE+L  +
Sbjct  404   EEIEVATDHYAQDRKIGEGGYGPVYRGYLDHTPVAIKVLRPDAAQGRTQFQREVEILCCI  463

Query  992   RHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFL  813
             RHPNMVLLLGACPE+GCLVYEYM NGSLED L R+GNTP IPW+ RF+I+AEI T LLFL
Sbjct  464   RHPNMVLLLGACPEHGCLVYEYMANGSLEDCLFRRGNTPPIPWQHRFRIAAEIGTGLLFL  523

Query  812   HQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYI  633
             HQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPP+ AD  TQY MT+ AGTFCYI
Sbjct  524   HQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPTAADHTTQYCMTATAGTFCYI  583

Query  632   DPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWP  453
             DPEYQQTG LG KSDIYSLG++LLQIIT+K PMGL H++ERAIE+GTF ++LD ++ DWP
Sbjct  584   DPEYQQTGMLGVKSDIYSLGIILLQIITSKSPMGLAHYMERAIERGTFTEMLDQSVPDWP  643

Query  452   VEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             VEEAL  AKL+L+CAELR+KDRPDL  VILPEL+RL++LA +++
Sbjct  644   VEEALRLAKLALKCAELRRKDRPDLAMVILPELDRLRDLAEENM  687



>ref|XP_010669507.1| PREDICTED: U-box domain-containing protein 52 [Beta vulgaris 
subsp. vulgaris]
Length=784

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/744 (49%), Positives = 467/744 (63%), Gaps = 87/744 (12%)
 Frame = -3

Query  2354  TTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAH----G  2187
             T+  +  VA+D+DK S  A+KW +DNLL     V+L+HV  K  P++   G + H    G
Sbjct  13    TSNQLVAVAIDRDKGSQHALKWAIDNLLQRGQTVVLVHV--KVKPSY---GSNPHVVING  67

Query  2186  GMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSA  2007
                D     +F PFR +  R+ I  ++  +ED+EV KA+  ++    V  +++GA+S+  
Sbjct  68    RQWDQQTKDLFLPFRCFCTRKDIQCRDIVLEDSEVQKALTEFVTQSAVEVLIIGAASKGN  127

Query  2006  ISRKFWTHDVPTIVNKTAPDFCSVYVISK-GKQQSIRPAARP----------LTNLPTHI  1860
             +  +F   D+P+ V+K  P+FC+VY+ISK GK  + R A RP          +   PT  
Sbjct  128   LFTRFGKTDIPSAVSKGVPEFCTVYIISKGGKIANTRSACRPAPLNSQLRSQIMQQPTTT  187

Query  1859  WshhgsssrassrgssaasssAGDDRI---SACSSRGEH-------------------SG  1746
                   S   S + + + S  +G D +   S  +  G H                   SG
Sbjct  188   SLSPPHSRIGSEKTTPSGSPFSGSDDLDFKSPFTRGGRHPHMRSYGDILGDTDISFVSSG  247

Query  1745  RPFRRSEDR-------DADGSVRRPWNSSCRNSLAEDNDLFAPISD--------------  1629
             RP   S DR       DA    RR  N+  R S + DND     S               
Sbjct  248   RP---SVDRMPLPLASDAVPEERRSTNN--RLSTSSDNDFLYDTSHRRSSVDTPLSSPPP  302

Query  1628  ------GFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACK  1467
                    FD+     N++++       D      K L+ E+K       QTM+MY+NACK
Sbjct  303   PSSSNISFDDMT---NVNWSNTQSQSMDDVEAHMKRLQMELK-------QTMNMYSNACK  352

Query  1466  EAITAKKSAKELQQMKIeesqrf--eqarqaeeaalRMVemekakckaameaaekaqkia  1293
             EA+TAK+ A ELQ+ K+EE ++         E     M + +     A   + +  +++A
Sbjct  353   EALTAKQKALELQRWKVEEERKVDDNVRYSEEPTRSFMEKEKAKSMAAMEASDQAHRRLA  412

Query  1292  emeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGG  1113
             E+EAQ+    EMKA KE  E N+ +  +S S  RYR+Y+I+EIE ATE F+++ KIGEGG
Sbjct  413   ELEAQKRVSVEMKALKEAEENNKDMDSIS-SAVRYRRYTIEEIENATEFFAEARKIGEGG  471

Query  1112  YGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVY  933
             YGPV+R +LDHT VA+KVLRPDAAQGR QFQQEVEVLS +RHPNMVLLLGACPEYGCLVY
Sbjct  472   YGPVFRCQLDHTLVAVKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVY  531

Query  932   EYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILL  753
             EYM NGSLEDRL  +G +P + W+ RF+I+AEIAT LLFLHQ+KPEPLVHRDLKP NILL
Sbjct  532   EYMHNGSLEDRLFCRGGSPPLSWQHRFRIAAEIATGLLFLHQTKPEPLVHRDLKPGNILL  591

Query  752   DRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLG  573
             DRN V+KISDVGLARLVPPSVAD+VTQY MTS AGTFCYIDPEYQQTG LG KSD+YSLG
Sbjct  592   DRNLVAKISDVGLARLVPPSVADEVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDVYSLG  651

Query  572   VMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKK  393
             +MLLQ++TA+ PMGL HHVERAIEKG+FA+ LDPT+SDWPVEEA+ FAKLSLQCAELR++
Sbjct  652   IMLLQLLTARSPMGLAHHVERAIEKGSFAEFLDPTVSDWPVEEAIKFAKLSLQCAELRRR  711

Query  392   DRPDLGSVILPELNRLKELALQSL  321
             DRPDLG+++LPEL RL+ +A  SL
Sbjct  712   DRPDLGTILLPELCRLRNIAEDSL  735



>ref|XP_009801054.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Nicotiana sylvestris]
Length=810

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/764 (51%), Positives = 489/764 (64%), Gaps = 102/764 (13%)
 Frame = -3

Query  2354  TTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGP--------  2199
             T   +  VA+DKD+ S  A+KWTVD+LL     V+L+HV+ K S N     P        
Sbjct  15    TPNKLIAVAIDKDRGSQIALKWTVDHLLARGQTVLLIHVKLKQSANSSGQSPTTCLDLDY  74

Query  2198  ----------------------DAHGGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIED  2091
                                   +A  G S+ D     +F PFR +  R+ +   +  ++D
Sbjct  75    PMDYLLSDLTETCDTESNQISDEAGSGNSELDPQTKELFLPFRVFCTRKDVQCHDVVLDD  134

Query  2090  TEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISK-GK  1914
             T+V KAIV Y+N   +  ++LGA++R  + R F   D+P  + K  PDFC+V+VISK GK
Sbjct  135   TDVVKAIVEYVNRTGIEVLILGATTRGGLLR-FKVKDIPGGILKGVPDFCTVHVISKSGK  193

Query  1913  QQSIRPAARPLTNLPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFR  1734
               S R A+RP   +  H   H      ++       S+       SA S+RG +SG P  
Sbjct  194   IASTRAASRPAPFV--HPLRHQLMQPASTKFAPFEGSTP------SAASARGPYSGGPKP  245

Query  1733  ----------------RSEDRDADGSVRRPWN-----------SSCRNSLAEDNDLFAPI  1635
                             +S      G   +P+            SS R S+   +++++  
Sbjct  246   VCDPPPSTLQSDTMNIKSPFTHRKGPNGKPYEISLPDTDISYVSSGRPSI---DNIYSSF  302

Query  1634  SDGFDNAAA------------AQNLD---FTRisdagsdassiaSKDLES----------  1530
             SDG+D                 Q+ D   F R S        ++   +ES          
Sbjct  303   SDGYDGGGPTPPRLSGFSDFETQSFDSTQFGRRSVDTLTPPELSLSSIESDRPSISQGPV  362

Query  1529  -----EMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
                  EM+RLK ELKQTM++Y+ AC+EA+TAK+ A ELQ+ K EE +R E+AR AEEAAL
Sbjct  363   DDMEAEMRRLKQELKQTMELYSTACREALTAKQKAMELQRWKQEEQRRLEEARLAEEAAL  422

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKAK +AA+E AE AQ++AE+EAQ+   AEMKA KE  EKN+ L+ L+ SD RYR
Sbjct  423   ALAEKEKAKSRAAIEHAEAAQRLAELEAQKRISAEMKALKEAEEKNKILNKLTNSDFRYR  482

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE AT+ F+++ KIGEGGYGPVY+  LDHTPVA+KVLRPDAA GR+QFQQEVEV
Sbjct  483   KYTIEEIESATDYFAQTRKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAHGRQQFQQEVEV  542

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL  +G TP + W+ RF+I+AEIAT 
Sbjct  543   LSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDRLFHRGKTPPLSWQQRFRIAAEIATG  602

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQSKPEPLVHRDLKP NILLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGT
Sbjct  603   LLFLHQSKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGT  662

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLG++ LQI+TAKPPMGLTH+V+RAIEKGTF ++LDP I
Sbjct  663   FCYIDPEYQQTGMLGVKSDVYSLGIIFLQILTAKPPMGLTHYVDRAIEKGTFNEMLDPAI  722

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              DWPV+EAL  AKLSLQC+ELR+KDRPDLG V+LP+L RL+ LA
Sbjct  723   PDWPVDEALSLAKLSLQCSELRRKDRPDLGKVVLPQLERLRALA  766



>ref|XP_009590270.1| PREDICTED: U-box domain-containing protein 52 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590271.1| PREDICTED: U-box domain-containing protein 52 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590272.1| PREDICTED: U-box domain-containing protein 52 isoform X1 [Nicotiana 
tomentosiformis]
Length=771

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/767 (50%), Positives = 497/767 (65%), Gaps = 80/767 (10%)
 Frame = -3

Query  2378  PTISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS----PNHQ  2211
             PT  + G     +  VA+DKD+ S  A+KW +DNLL     VIL+HV+ K S    P+H 
Sbjct  5     PTAGNHGPPLNKLIAVAIDKDRGSQVALKWAIDNLLARGQTVILIHVKVKPSASQPPSHT  64

Query  2210  ----NGGPDAH---GGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYI  2058
                 N   DA     GMS+ D     +F PFR +  R+ I   +  +ED +V KAIV Y+
Sbjct  65    TSRLNQMSDASTDGSGMSELDPQLKELFLPFRVFCTRKDIQCYDVVLEDVDVVKAIVEYV  124

Query  2057  NTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISK-GKQQSIRPAAR--  1887
             N   +  ++LGA+++  + R+F   D+P  V K  PDFC+VYVISK GK  + R A+R  
Sbjct  125   NRTAIEVLILGAAAKGGLLRRFKVKDIPGNVVKGVPDFCTVYVISKNGKISATRSASRLA  184

Query  1886  PLTNLPTHIWshhgsssrassrgssaasssAGDDRI--------------------SACS  1767
             P  +   H +   G++   ++  S    S      I                    S  +
Sbjct  185   PFIHPLRHQFMQQGNAKSNTTEDSLNTPSRGSLSGIPKPVSDLPMSNLQSDTLNMKSPFT  244

Query  1766  SRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNL---  1596
              R   +G+P+  S+  D D S    + SS R S+   +++F   +D +D+ A    L   
Sbjct  245   HRKGPNGKPYEISQP-DTDIS----FVSSGRPSI---DNMFPSFADNYDSGATPPRLSGF  296

Query  1595  -DFTRisdagsdassiaSKDLESEMKRLKL-----------------------ELKQTMD  1488
              DF   +         +   + SE+  L +                       ELKQTM+
Sbjct  297   SDFEAQNFEPIPLGRRSLDIMPSELSFLSMEGDRASFSSTPDDVAAEMRRLKLELKQTME  356

Query  1487  MYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaek  1308
             MY+ ACKEA+TA++ A ELQ+ K EE +R E+AR AEEAAL + E EKAK +AA+E AE 
Sbjct  357   MYSTACKEALTAQQKAMELQRWKTEEQRRLEEARFAEEAALALAEKEKAKSRAALEHAEA  416

Query  1307  aqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMK  1128
             AQ++AE+EAQ+   AEMKA KE  E+N+ L+ LS SD RYR+Y+I+EIE AT+ F+++ K
Sbjct  417   AQRLAELEAQKRINAEMKALKEAEERNKVLNKLSNSDFRYRRYTIEEIETATDYFAQANK  476

Query  1127  IGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEY  948
             IGEGGYGPVY+  +DHTPVA+KVLRPDAA GR+QFQQEVEVLS +RHPNMVLLLGACPEY
Sbjct  477   IGEGGYGPVYKCYMDHTPVAVKVLRPDAAHGRQQFQQEVEVLSCIRHPNMVLLLGACPEY  536

Query  947   GCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKP  768
             GCLVYE+M NGSLEDRL ++G TP + W+ RF+I+AEI   LLFLHQSKPEP+VHRDLKP
Sbjct  537   GCLVYEFMSNGSLEDRLFQRGKTPPLSWQQRFRIAAEIGAGLLFLHQSKPEPIVHRDLKP  596

Query  767   ANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSD  588
             ANILLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGTFCYIDPEYQQTG LG KSD
Sbjct  597   ANILLDRNFVSKISDVGLARLVPPSVADCVTQYRMTSTAGTFCYIDPEYQQTGMLGIKSD  656

Query  587   IYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCA  408
             +YSLG++ LQI+TAKPPMGLTHHVERAIEKGTF ++LD ++ DWP++EAL+ AKLSL+C+
Sbjct  657   VYSLGIIFLQILTAKPPMGLTHHVERAIEKGTFNEMLDSSVPDWPLDEALNLAKLSLKCS  716

Query  407   ELRKKDRPDLGSVILPELNRLKELALQ---------SLASKNGTQTF  294
             ELR+KDRPDL  VI+PEL RL+ L  +         S +S N +Q F
Sbjct  717   ELRRKDRPDLSKVIMPELERLRTLGEENPCQSPLYSSGSSTNHSQAF  763



>gb|KGN45512.1| hypothetical protein Csa_7G450690 [Cucumis sativus]
Length=791

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/694 (47%), Positives = 446/694 (64%), Gaps = 35/694 (5%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLL--ISNPFVILLHVRHKA-SPNHQNGGPDAHGGMSDHD  2169
             TV+A+ +DKNS  AVKW V++L    +    +L+HVR ++  P   +  P      ++ +
Sbjct  19    TVIAISRDKNSHYAVKWAVEHLFNRKNTGECVLIHVRTQSLHPQEVDTIPKEFRPPTEAE  78

Query  2168  GHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW  1989
              H  F P+R + AR+GI+ KE  I D +V  A++ +I+ H +SN+V+GAS+R+ I RK  
Sbjct  79    LHQFFLPYRGFCARKGIVAKEIIIHDIDVPNALIDHISKHSISNIVVGASNRNPIMRKLK  138

Query  1988  THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssrassrgssa  1809
               DV T + K+AP+ CSVYVI++GK  + R   R                   +   +  
Sbjct  139   NPDVATCLLKSAPESCSVYVIARGKVHTKRLRKR-------------------NKSQTDM  179

Query  1808  asssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISD  1629
               +  G  RIS   S+ + S       +  D      R  + +  +S +  +D   P+S 
Sbjct  180   TETQTGTPRISGSLSKTQKSAYSSISGQSEDK----YRYSSGTSNDSTSGISDFSGPLS-  234

Query  1628  GFDNAAAA-QNLDFTRisdagsdassiaSKD---LESEMKRLKLELKQTMDMYNNACKEA  1461
              F +   + +N DF+  S   S  S ++S     +E EMK+L+ ELK+ M+MY++ACKEA
Sbjct  235   -FKSIETSFENQDFSLSSSETSTRSYVSSSTPPTIEYEMKKLRFELKKMMEMYDSACKEA  293

Query  1460  ITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVem---ekakckaameaaekaqkiae  1290
               AK+ AKEL+ +K+E+ +  +                  ++     A       +    
Sbjct  294   AVAKQKAKELRHLKMEKEEDNKIECGKSTYEALTTLAEFEKQKNKAEAEATLVAQKLAEL  353

Query  1289  meAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGY  1110
                ++    E KA+ E  E+ + + +  +S+  YR++SID+IE AT+ F++S KIGEGGY
Sbjct  354   ETQKKRIITEEKARIEAEERKKTMELFERSNICYRRFSIDQIEVATDHFNESNKIGEGGY  413

Query  1109  GPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYE  930
             GPVY+  L+HT VAIK+LRPD + G++QFQQE+EVLS MRHPNMVLLLGACPEYGCLVYE
Sbjct  414   GPVYQALLEHTSVAIKILRPDRSHGQRQFQQEIEVLSRMRHPNMVLLLGACPEYGCLVYE  473

Query  929   YMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLD  750
             YMENGSLEDRL RK NTP IPW IRF+I+ +IATALLFLHQ KPEP+VHRDLKPANILLD
Sbjct  474   YMENGSLEDRLFRKDNTPPIPWRIRFRIACDIATALLFLHQMKPEPVVHRDLKPANILLD  533

Query  749   RNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGV  570
              N+VSKI DVGLARLVPP+VAD VTQYHMT+AAGTFCYIDPEYQQTG LG KSDIYS GV
Sbjct  534   HNYVSKIGDVGLARLVPPTVADSVTQYHMTAAAGTFCYIDPEYQQTGMLGVKSDIYSFGV  593

Query  569   MLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKD  390
             +LLQ+ITA+ PMGL++ VE AIE G F ++LDPTI+DWP+E+ L  A+L+L+C ELRK+D
Sbjct  594   LLLQLITARSPMGLSYQVEEAIEHGKFPEILDPTITDWPIEDTLGLAQLALKCCELRKRD  653

Query  389   RPDLGSVILPELNRLKELALQSLASKNGTQTFGR  288
             RPDL +V++PEL+RLK L       K+   T  R
Sbjct  654   RPDLCTVLMPELSRLKNLGSGETPPKSKLATVSR  687



>gb|AES73422.2| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=705

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/699 (53%), Positives = 486/699 (70%), Gaps = 39/699 (6%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGH  2163
             +T+VAVDK K+SA A +W +    I NP +I +HV++K   N  N G + +    D    
Sbjct  14    VTMVAVDKGKSSAYAFRWAIR--CIDNPIIIAVHVKNK---NLLNQGTNVYPPDEDEVAQ  68

Query  2162  CVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAIS--RKF-  1992
              +F   RA    + + MKE  ++D +V K ++ + N + V ++V+GAS+++ +   +KF 
Sbjct  69    -IFNNLRALCPSKMVTMKEVVVDDQDVVKGLLDFANRNLVHSLVIGASTKNLMPSLKKFK  127

Query  1991  WTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN--LPTH---IWshhgsssras  1827
              + D+PT + K+AP +CSVY+ISK K  S RPA R + N  +PT    +       S   
Sbjct  128   ASQDIPTSIIKSAPGYCSVYIISKLKIVSTRPAVREIGNQIIPTKQLAVQVSPEFESGIR  187

Query  1826  srgssaasssAGDDRIS---ACSSRGEHSGRPFRRSEDRDAD-----GSVRRPWNSSCRN  1671
             S     + ++ G +  S     + +G    RP     ++  D     G   R W S    
Sbjct  188   SIQPRTSGTNEGSESRSFDSISTVKGPARDRPRSAGSNQSMDNIDPSGGRGRHWASMDER  247

Query  1670  SLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTM  1491
              +A       PI D           +   I   G+  +S  SK+LE+EMKRL+LELKQTM
Sbjct  248   EIAA----LGPIVD-------VNRHELYLIDSFGTHPTSHTSKELEAEMKRLRLELKQTM  296

Query  1490  DMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaae  1311
             DMY++ACK+AI+AK  A+++++ K EE ++  + R ++EAAL + E EKAK KAA+EAAE
Sbjct  297   DMYSSACKQAISAKNQAEQIRRWKEEEGRKVVEVRLSQEAALAIAEREKAKAKAALEAAE  356

Query  1310  kaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSM  1131
             +A++ AE EAQR K AEMKA+KE  E+N+ L+ L+++D RYRKY++ EIE ATE+FS S 
Sbjct  357   EAKRKAEQEAQRRKEAEMKARKEAEERNKVLNALAQNDNRYRKYTMMEIEVATERFSPSK  416

Query  1130  KIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPE  951
             K+GEGGYGPV++G L HTPVA+K+L P+AAQGRKQF QEVEVLS +RHPNMVLLLGACPE
Sbjct  417   KLGEGGYGPVFKGHLHHTPVAVKLLNPEAAQGRKQFNQEVEVLSSIRHPNMVLLLGACPE  476

Query  950   YGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLK  771
             + CLVYEYMENG+LEDRL RK N+  + W+ RFKI+AEIATALLFLHQ+KPEP+VHRDLK
Sbjct  477   HCCLVYEYMENGTLEDRLFRKNNSKPLSWQKRFKIAAEIATALLFLHQTKPEPIVHRDLK  536

Query  770   PANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKS  591
             P+NILLD+N+VSK++DVGLARLVPPSVAD VTQY+MTSAAGTFCYIDPEYQQTG L  KS
Sbjct  537   PSNILLDKNYVSKVADVGLARLVPPSVADSVTQYYMTSAAGTFCYIDPEYQQTGMLTPKS  596

Query  590   DIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQC  411
             DIYSLG+MLLQIITA+PPMGL+HHV+RAIEK  F+++LD  ++DWPVEEAL FAKL+L C
Sbjct  597   DIYSLGIMLLQIITARPPMGLSHHVKRAIEKDQFSEILDSAVTDWPVEEALSFAKLALNC  656

Query  410   AELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQTF  294
             AEL KKDRP+L SV+LPELNRL+ L        N  Q F
Sbjct  657   AELCKKDRPNLASVVLPELNRLRGLGF------NDNQVF  689



>ref|XP_004501456.1| PREDICTED: U-box domain-containing protein 35-like isoform X3 
[Cicer arietinum]
Length=677

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/634 (55%), Positives = 452/634 (71%), Gaps = 36/634 (6%)
 Frame = -3

Query  2177  DHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAIS-  2001
             + D   +F   RA   R+ + MKE  I+D +V K ++ + N + + ++V+GAS+++ ++ 
Sbjct  38    EEDVALIFNNLRAMCQRKAVTMKEAVIDDHDVVKGLLDFANRNSIHSIVIGASNKNHLTS  97

Query  2000  -RKFWT-HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN--------LPTHIWsh  1851
              +KF   HD+P  + K+APD+CSVY+ISK K  S R A R + N        LP  +  H
Sbjct  98    LKKFKVYHDIPAAIIKSAPDYCSVYIISKLKIASARSAVRSMGNGNQSIPSKLPVQVGQH  157

Query  1850  hgsssrassrgssaasssAGDDRIS---ACSSRGEHSGRPFRRSEDRDAD-----GSVRR  1695
                 +   S    ++ ++ G +  S     +++G+   RP     +   D     G   R
Sbjct  158   AEFETGIRSVLPRSSVTNEGSESRSFDSITATKGQTRERPRSAGSNLSMDKIDIPGGRGR  217

Query  1694  PWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRL  1515
              W S     +A    +   + D     +A+                   SKDLE+EMKRL
Sbjct  218   HWASMDERDMAALGPIDLDVPDSLGTPSASHT-----------------SKDLEAEMKRL  260

Query  1514  KLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakc  1335
             + ELKQTMDMY++ACK+AI+AK  A+++++ K+EE ++ E+ R ++EAAL M E EKA+ 
Sbjct  261   RRELKQTMDMYSSACKQAISAKNQAEQIRRWKVEEERKVEEVRMSQEAALAMAEREKARA  320

Query  1334  kaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFA  1155
             KAAMEAAE A++ AE EAQR + AEMKA+KE  E++R L+ L+++D RYRKY+++EIE A
Sbjct  321   KAAMEAAEDAKRKAEQEAQRRREAEMKARKEAEERDRVLTALAQNDNRYRKYTMEEIEVA  380

Query  1154  TEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMV  975
             TEKFS S K+GEGGYGPVY+G LDHT VAIK+L P+A+QGRKQFQQEVEVLS +RHPNMV
Sbjct  381   TEKFSPSKKLGEGGYGPVYKGHLDHTAVAIKLLNPEASQGRKQFQQEVEVLSCIRHPNMV  440

Query  974   LLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPE  795
             LLLGACPE+GCLVYE+M+NGSLEDRL RK N+  + W+ RF+ISAEIATALLFLHQ+KPE
Sbjct  441   LLLGACPEHGCLVYEFMDNGSLEDRLFRKNNSRPLTWQKRFQISAEIATALLFLHQTKPE  500

Query  794   PLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQ  615
             P+VHRDLKP+NILLDRN+VSKISDVGLARLVP SV D+VTQY+MTSAAGTFCYIDPEYQQ
Sbjct  501   PIVHRDLKPSNILLDRNYVSKISDVGLARLVPSSVVDNVTQYYMTSAAGTFCYIDPEYQQ  560

Query  614   TGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALH  435
             TG L TKSDIYSLGVMLLQ+ITAKPPMGL HHV+RA+EK    ++LDP ++DWPVE AL 
Sbjct  561   TGILTTKSDIYSLGVMLLQVITAKPPMGLAHHVKRAVEKDRIVEILDPAVTDWPVEAALS  620

Query  434   FAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             FAKL+L C EL KKDRP+L +V+LPELNRL++L 
Sbjct  621   FAKLALGCVELSKKDRPNLATVVLPELNRLRDLG  654



>ref|XP_009590275.1| PREDICTED: U-box domain-containing protein 52 isoform X2 [Nicotiana 
tomentosiformis]
Length=770

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/767 (50%), Positives = 496/767 (65%), Gaps = 81/767 (11%)
 Frame = -3

Query  2378  PTISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS----PNHQ  2211
             PT  + G     +  VA+DKD+ S  A+KW +DNLL     VIL+HV+ K S    P+H 
Sbjct  5     PTAGNHGPPLNKLIAVAIDKDRGSQVALKWAIDNLLARGQTVILIHVKVKPSASQPPSHT  64

Query  2210  ----NGGPDAH---GGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYI  2058
                 N   DA     GMS+ D     +F PFR +  R+ I   +  +ED +V KAIV Y+
Sbjct  65    TSRLNQMSDASTDGSGMSELDPQLKELFLPFRVFCTRKDIQCYDVVLEDVDVVKAIVEYV  124

Query  2057  NTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISK-GKQQSIRPAAR--  1887
             N   +  ++LGA+++  + R F   D+P  V K  PDFC+VYVISK GK  + R A+R  
Sbjct  125   NRTAIEVLILGAAAKGGLLR-FKVKDIPGNVVKGVPDFCTVYVISKNGKISATRSASRLA  183

Query  1886  PLTNLPTHIWshhgsssrassrgssaasssAGDDRI--------------------SACS  1767
             P  +   H +   G++   ++  S    S      I                    S  +
Sbjct  184   PFIHPLRHQFMQQGNAKSNTTEDSLNTPSRGSLSGIPKPVSDLPMSNLQSDTLNMKSPFT  243

Query  1766  SRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNL---  1596
              R   +G+P+  S+  D D S    + SS R S+   +++F   +D +D+ A    L   
Sbjct  244   HRKGPNGKPYEISQP-DTDIS----FVSSGRPSI---DNMFPSFADNYDSGATPPRLSGF  295

Query  1595  -DFTRisdagsdassiaSKDLESEMKRLKL-----------------------ELKQTMD  1488
              DF   +         +   + SE+  L +                       ELKQTM+
Sbjct  296   SDFEAQNFEPIPLGRRSLDIMPSELSFLSMEGDRASFSSTPDDVAAEMRRLKLELKQTME  355

Query  1487  MYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaek  1308
             MY+ ACKEA+TA++ A ELQ+ K EE +R E+AR AEEAAL + E EKAK +AA+E AE 
Sbjct  356   MYSTACKEALTAQQKAMELQRWKTEEQRRLEEARFAEEAALALAEKEKAKSRAALEHAEA  415

Query  1307  aqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMK  1128
             AQ++AE+EAQ+   AEMKA KE  E+N+ L+ LS SD RYR+Y+I+EIE AT+ F+++ K
Sbjct  416   AQRLAELEAQKRINAEMKALKEAEERNKVLNKLSNSDFRYRRYTIEEIETATDYFAQANK  475

Query  1127  IGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEY  948
             IGEGGYGPVY+  +DHTPVA+KVLRPDAA GR+QFQQEVEVLS +RHPNMVLLLGACPEY
Sbjct  476   IGEGGYGPVYKCYMDHTPVAVKVLRPDAAHGRQQFQQEVEVLSCIRHPNMVLLLGACPEY  535

Query  947   GCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKP  768
             GCLVYE+M NGSLEDRL ++G TP + W+ RF+I+AEI   LLFLHQSKPEP+VHRDLKP
Sbjct  536   GCLVYEFMSNGSLEDRLFQRGKTPPLSWQQRFRIAAEIGAGLLFLHQSKPEPIVHRDLKP  595

Query  767   ANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSD  588
             ANILLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGTFCYIDPEYQQTG LG KSD
Sbjct  596   ANILLDRNFVSKISDVGLARLVPPSVADCVTQYRMTSTAGTFCYIDPEYQQTGMLGIKSD  655

Query  587   IYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCA  408
             +YSLG++ LQI+TAKPPMGLTHHVERAIEKGTF ++LD ++ DWP++EAL+ AKLSL+C+
Sbjct  656   VYSLGIIFLQILTAKPPMGLTHHVERAIEKGTFNEMLDSSVPDWPLDEALNLAKLSLKCS  715

Query  407   ELRKKDRPDLGSVILPELNRLKELALQ---------SLASKNGTQTF  294
             ELR+KDRPDL  VI+PEL RL+ L  +         S +S N +Q F
Sbjct  716   ELRRKDRPDLSKVIMPELERLRTLGEENPCQSPLYSSGSSTNHSQAF  762



>ref|XP_003603171.1| U-box domain-containing protein [Medicago truncatula]
Length=720

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/710 (52%), Positives = 487/710 (69%), Gaps = 46/710 (6%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGH  2163
             +T+VAVDK K+SA A +W +    I NP +I +HV++K   N +         + + +G 
Sbjct  14    VTMVAVDKGKSSAYAFRWAIR--CIDNPIIIAVHVKNKNLLNRRLQYKTEIVTLLNAEGT  71

Query  2162  CVFTP-----------FRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASS  2016
              V+ P            RA    + + MKE  ++D +V K ++ + N + V ++V+GAS+
Sbjct  72    NVYPPDEDEVAQIFNNLRALCPSKMVTMKEVVVDDQDVVKGLLDFANRNLVHSLVIGAST  131

Query  2015  RSAIS--RKF-WTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN--LPTH---I  1860
             ++ +   +KF  + D+PT + K+AP +CSVY+ISK K  S RPA R + N  +PT    +
Sbjct  132   KNLMPSLKKFKASQDIPTSIIKSAPGYCSVYIISKLKIVSTRPAVREIGNQIIPTKQLAV  191

Query  1859  WshhgsssrassrgssaasssAGDDRIS---ACSSRGEHSGRPFRRSEDRDAD-----GS  1704
                    S   S     + ++ G +  S     + +G    RP     ++  D     G 
Sbjct  192   QVSPEFESGIRSIQPRTSGTNEGSESRSFDSISTVKGPARDRPRSAGSNQSMDNIDPSGG  251

Query  1703  VRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKDLESEM  1524
               R W S     +A       PI D           +   I   G+  +S  SK+LE+EM
Sbjct  252   RGRHWASMDEREIAA----LGPIVD-------VNRHELYLIDSFGTHPTSHTSKELEAEM  300

Query  1523  KRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemek  1344
             KRL+LELKQTMDMY++ACK+AI+AK  A+++++ K EE ++  + R ++EAAL + E EK
Sbjct  301   KRLRLELKQTMDMYSSACKQAISAKNQAEQIRRWKEEEGRKVVEVRLSQEAALAIAEREK  360

Query  1343  akckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEI  1164
             AK KAA+EAAE+A++ AE EAQR K AEMKA+KE  E+N+ L+ L+++D RYRKY++ EI
Sbjct  361   AKAKAALEAAEEAKRKAEQEAQRRKEAEMKARKEAEERNKVLNALAQNDNRYRKYTMMEI  420

Query  1163  EFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHP  984
             E ATE+FS S K+GEGGYGPV++G L HTPVA+K+L P+AAQGRKQF QEVEVLS +RHP
Sbjct  421   EVATERFSPSKKLGEGGYGPVFKGHLHHTPVAVKLLNPEAAQGRKQFNQEVEVLSSIRHP  480

Query  983   NMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQS  804
             NMVLLLGACPE+ CLVYEYMENG+LEDRL RK N+  + W+ RFKI+AEIATALLFLHQ+
Sbjct  481   NMVLLLGACPEHCCLVYEYMENGTLEDRLFRKNNSKPLSWQKRFKIAAEIATALLFLHQT  540

Query  803   KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPE  624
             KPEP+VHRDLKP+NILLD+N+VSK++DVGLARLVPPSVAD VTQY+MTSAAGTFCYIDPE
Sbjct  541   KPEPIVHRDLKPSNILLDKNYVSKVADVGLARLVPPSVADSVTQYYMTSAAGTFCYIDPE  600

Query  623   YQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEE  444
             YQQTG L  KSDIYSLG+MLLQIITA+PPMGL+HHV+RAIEK  F+++LD  ++DWPVEE
Sbjct  601   YQQTGMLTPKSDIYSLGIMLLQIITARPPMGLSHHVKRAIEKDQFSEILDSAVTDWPVEE  660

Query  443   ALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQTF  294
             AL FAKL+L CAEL KKDRP+L SV+LPELNRL+ L        N  Q F
Sbjct  661   ALSFAKLALNCAELCKKDRPNLASVVLPELNRLRGLGF------NDNQVF  704



>ref|XP_009616383.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Nicotiana tomentosiformis]
Length=811

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/777 (50%), Positives = 487/777 (63%), Gaps = 106/777 (14%)
 Frame = -3

Query  2381  HPTISSDGATTGP---ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQ  2211
             HP     G    P   +  VA+DKD+ S  A+KWTVD+LL     V+L+HV+ K S    
Sbjct  3     HPPQGVHGERMHPPNKLIAVAIDKDRGSQIALKWTVDHLLARGQTVLLIHVKLKQSATST  62

Query  2210  NGGP-------------------------------DAHGGMSDHDGHC--VFTPFRAYSA  2130
                                                +A  G S+ D     +F PFR +  
Sbjct  63    GQSTPTTCLDLDCPMDYLLSDLTETCDTESNQISDEAGSGNSELDPQTKELFLPFRVFCT  122

Query  2129  RRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAP  1950
             R+ +   +  ++DT+V KAIV Y+N   +  ++LGA++R  + R F   D+P  + K  P
Sbjct  123   RKDVQCHDVVLDDTDVVKAIVEYVNRTGIEVLILGATTRGGLLR-FKAKDIPGGILKGVP  181

Query  1949  DFCSVYVISK-GKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaasssAGDDRISA  1773
             DFC+V+VISK  K  S R A+RP   +  H   H      ++       S+       SA
Sbjct  182   DFCTVHVISKSAKIASTRAASRPAPFV--HPLRHQLMQPASTKFAPFEGSTP------SA  233

Query  1772  CSSRGEHSGRPFR----------------RSEDRDADGSVRRPWN-----------SSCR  1674
              SSRG  SG P                  +S      G   +P+            SS R
Sbjct  234   ASSRGPFSGGPKPVCDPPPSTLQSDTMNIKSPFTHRKGPNGKPYEISLPDTDISYVSSGR  293

Query  1673  NSLAEDNDLFAPISDGFDNAAA------------AQNLD---FTRisdagsdassiaSKD  1539
              S+   +++++  SDG+D                 Q+ D   F R S        ++   
Sbjct  294   PSI---DNIYSSFSDGYDGGGPTPPRLSGFSDFETQSFDSTQFGRRSVDTLTPPELSHSS  350

Query  1538  LESE---------------MKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesq  1404
             +ES+               M+RLK ELKQTM++Y+ AC+EA+TAK+ A ELQ+ K EE +
Sbjct  351   IESDRPSVSQGPVDDMEAEMRRLKQELKQTMELYSTACREALTAKQKAMELQRWKQEEQR  410

Query  1403  rfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNR  1224
             R E+AR AEEAAL + E EKAK +AA+E AE AQ++AE+EAQ+   AEMKA KE  EKN+
Sbjct  411   RLEEARLAEEAALALAEKEKAKSRAAIEHAEAAQRLAELEAQKRISAEMKALKEAEEKNK  470

Query  1223  ALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDA  1044
              L+ L+ SD RYRKY+I+EIE AT+ F+++ KIGEGGYGPVY+  LDHTPVA+KVLRPDA
Sbjct  471   ILNKLTNSDFRYRKYTIEEIESATDYFAQTRKIGEGGYGPVYKCYLDHTPVAVKVLRPDA  530

Query  1043  AQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPW  864
             A GR+QFQQEVEVLS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL  +G TP + W
Sbjct  531   AHGRQQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDRLFHRGKTPPLSW  590

Query  863   EIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD  684
             + RF+I+AEIAT LLFLHQSKPEPLVHRDLKP NILLDRNFVSKISDVGLARLVPPSVAD
Sbjct  591   QQRFRIAAEIATGLLFLHQSKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVAD  650

Query  683   DVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAI  504
              VTQY MTS AGTFCYIDPEYQQTG LG KSD+YSLG++ LQI+TAKPPMGLTH+V+RAI
Sbjct  651   TVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDVYSLGIIFLQILTAKPPMGLTHYVDRAI  710

Query  503   EKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             EKGTF ++LDP I DWPV EAL  AKLSLQC+ELR+KDRPDLG V+LP+L RL+ LA
Sbjct  711   EKGTFNEMLDPAIPDWPVNEALSLAKLSLQCSELRRKDRPDLGKVVLPQLERLRALA  767



>ref|XP_011081656.1| PREDICTED: U-box domain-containing protein 51 [Sesamum indicum]
Length=676

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/402 (81%), Positives = 364/402 (91%), Gaps = 0/402 (0%)
 Frame = -3

Query  1532  SEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVe  1353
             SE+ RLK E+K+TM+MYN ACKEA++A++ A ELQ+MK++E  R EQAR AEEAAL +VE
Sbjct  264   SEVLRLKQEMKETMNMYNAACKEAVSAQQRADELQKMKLDEKNRLEQARLAEEAALALVE  323

Query  1352  mekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSI  1173
             +EKAKC+AA+EAAEKAQKIAE E QR K AEMKAK+E  EK RAL VLS +D RYRKY+I
Sbjct  324   IEKAKCRAAIEAAEKAQKIAEKEMQRRKQAEMKAKREAEEKYRALDVLSNNDVRYRKYTI  383

Query  1172  DEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLM  993
             DEI+ AT+KF+KSMKIGEGGYGPV++GKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS +
Sbjct  384   DEIQAATDKFAKSMKIGEGGYGPVFKGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSCI  443

Query  992   RHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFL  813
             RHPNMVLL+GACPEYGCLVYE+M+NGSLEDRL RKGNTP IPW IRFKI+A+IAT LLFL
Sbjct  444   RHPNMVLLMGACPEYGCLVYEFMDNGSLEDRLFRKGNTPPIPWGIRFKIAADIATGLLFL  503

Query  812   HQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYI  633
             HQ+KPEPLVHRDLKPAN+LLD N   KISDVGLARLVPPSVAD VTQYHMTSAAGTFCYI
Sbjct  504   HQTKPEPLVHRDLKPANVLLDHNNTCKISDVGLARLVPPSVADSVTQYHMTSAAGTFCYI  563

Query  632   DPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWP  453
             DPEYQQTG+LGTKSDIYSLGVMLLQIITA+PPMGLTHHVERAI+  TFADLLDPT+ DWP
Sbjct  564   DPEYQQTGELGTKSDIYSLGVMLLQIITARPPMGLTHHVERAIQNETFADLLDPTVPDWP  623

Query  452   VEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQ  327
             VEEAL FAKL+L+CAELRKKDRPDL  VILPELNRLK+L +Q
Sbjct  624   VEEALSFAKLALKCAELRKKDRPDLAKVILPELNRLKDLGMQ  665


 Score =   190 bits (483),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 121/151 (80%), Gaps = 11/151 (7%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
             TVVA+DKDKNS+ AV+W +DNLLI N  +IL+HVR +      NGG DA+GG+++     
Sbjct  27    TVVAIDKDKNSSLAVRWAIDNLLIFNRTLILIHVRTR------NGGGDANGGLAEE----  76

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAIS-RKFWTH  1983
             VF PFRA+SARRGII+KE  +E  +V   ++ YI++H+V+N+VLGA+SR+A++ RKFWTH
Sbjct  77    VFKPFRAFSARRGIIVKEVVLEGIDVHTTLLDYISSHQVTNIVLGAASRNALTLRKFWTH  136

Query  1982  DVPTIVNKTAPDFCSVYVISKGKQQSIRPAA  1890
             D+PT++NK APDFCSVYVISKGK QSIRPAA
Sbjct  137   DLPTLINKAAPDFCSVYVISKGKAQSIRPAA  167



>ref|XP_007161130.1| hypothetical protein PHAVU_001G045100g [Phaseolus vulgaris]
 gb|ESW33124.1| hypothetical protein PHAVU_001G045100g [Phaseolus vulgaris]
Length=627

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/627 (54%), Positives = 438/627 (70%), Gaps = 42/627 (7%)
 Frame = -3

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA--SSRSAISRKFWT  1986
             VF P R       + +KE  I+D+EV + IV Y   +RV+ +V+GA  S+++ ++R  + 
Sbjct  26    VFNPIRQLCQNNNVKLKEAVIDDSEVVRGIVEYAKKNRVNTIVIGAAHSNKNTLARTLYL  85

Query  1985  HD--------VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssra  1830
                       VPT V K+APD  SVYVISKGK    RPA RP+ N+ T            
Sbjct  86    RSGSKKLKGLVPTGVMKSAPDHSSVYVISKGKILGARPAIRPMVNMVT------------  133

Query  1829  ssrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDND  1650
                          ++ IS   +    +G    RSE       +  P +SS   S   D  
Sbjct  134   ----------PPSENGISENRANAHRTGSTNGRSERSPL---LEMPRSSSVGQST--DRR  178

Query  1649  LFAPISDGFDNAAAAQNL----DFTRisdagsd-assiaSKDLESEMKRLKLELKQTMDM  1485
             L    S G  +++ +  L    D T+        + S  + ++ESEMKRL+L+LKQTMD+
Sbjct  179   LLFCRSTGESDSSRSHKLGSAADGTKKEYDSDSPSDSQFTAEMESEMKRLRLKLKQTMDL  238

Query  1484  YNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaeka  1305
             YN+ACKE ++ +   KE+ Q K++E +  E A+ ++EAAL M E EK K +AA+EAAE+A
Sbjct  239   YNSACKETVSTQSKDKEINQRKLDEERIAEVAKLSKEAALAMAEKEKFKARAALEAAEEA  298

Query  1304  qkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKI  1125
              K+ E EAQR  +AEMKA++E  EK+RAL+ L+  D R RKY+I+++E AT KF +++KI
Sbjct  299   IKMVEKEAQRRFHAEMKARREAHEKDRALNQLACRDIRCRKYTINDVEGATRKFCQTLKI  358

Query  1124  GEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYG  945
             GEGGYGPV++G+LDHT VAIK+L PDA  GR+QFQQEVEVL  +RHPNMVLL+GACPEYG
Sbjct  359   GEGGYGPVFKGQLDHTQVAIKILNPDATHGRRQFQQEVEVLCSIRHPNMVLLIGACPEYG  418

Query  944   CLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPA  765
             CLVYEY+ENGSLEDRLL K ++P IPW  RF+I+AEIATALLFLHQ+KPEP+VHRDLKPA
Sbjct  419   CLVYEYLENGSLEDRLLMKNDSPPIPWWKRFEIAAEIATALLFLHQTKPEPIVHRDLKPA  478

Query  764   NILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDI  585
             NILLD+NFVSKISDVGLARLVP SVAD VTQYH+T+AAGTFCYIDPEYQQ+G L TKSD+
Sbjct  479   NILLDKNFVSKISDVGLARLVPASVADSVTQYHLTAAAGTFCYIDPEYQQSGMLTTKSDV  538

Query  584   YSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAE  405
             YSLG+MLLQIITAKPPMGL HHV RAI++GTF+++LDP I++WP+EE L F KLSL CAE
Sbjct  539   YSLGIMLLQIITAKPPMGLAHHVMRAIQEGTFSEMLDPVITNWPLEETLEFGKLSLSCAE  598

Query  404   LRKKDRPDLGSVILPELNRLKELALQS  324
             L K+DRPDL + I+P+LN L++  L S
Sbjct  599   LSKRDRPDLATEIVPKLNHLRDFGLAS  625



>gb|AES59157.2| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=712

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/707 (51%), Positives = 459/707 (65%), Gaps = 68/707 (10%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGG---PDAHGGMSDH  2172
             + +VAV K KNS  A +WT +N  I NP +I +HV+HK +P HQ      PD      + 
Sbjct  13    LVMVAVGKHKNSGHAFRWTTNN--IDNPIIIAVHVKHKGTP-HQGTNVFPPD------EK  63

Query  2171  DGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASS--RSAISR  1998
             D   VF+P R     + + +KE  I DT++++ I+ Y   + +  +++GA +  +   S 
Sbjct  64    DIANVFSPLRQMCNEKVVKLKEAIIIDTDISRGILDYAKRNHIQTIIVGAPTGYKKNSSF  123

Query  1997  KFWTH----------DVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshh  1848
             K   H          D+ T + K+APD+ SVYVISK K    RPA  PL  +        
Sbjct  124   KVSKHEDYKQVKGQDDLATAIMKSAPDYSSVYVISKDKVVESRPAIVPLGTV--------  175

Query  1847  gsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRS--------------------  1728
                    ++    A   + +D+ S    RG  + R  R S                    
Sbjct  176   ------VAQSHGIAPCKSENDKWSQLYRRGSTNSRSGRSSIHEFIKSFSSNNNNNNHNNE  229

Query  1727  --EDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdass  1554
               E  D     +R    S  +SL E+       S G +   +       R S   SD+  
Sbjct  230   SLESIDLSSRSQRTPPLSHNSSLNENG------SSGSNKFGSLNVAKLERNSSLQSDSQL  283

Query  1553  iaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaee  1374
             +   + E +  RLK  L+QTM MY +ACKEAI+A+  A E+ Q K+EE +  E+   ++E
Sbjct  284   VGEMEAEMKELRLK--LRQTMTMYKSACKEAISAQNKANEITQWKMEEERMVEEVIMSKE  341

Query  1373  aalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDC  1194
             AAL + E EKAK KAA++AA++A +IAE EAQR    E  AKK+  E+++AL+VL++ D 
Sbjct  342   AALALAEKEKAKAKAAIKAADEAMRIAEKEAQRRMQVEKTAKKDIEERDQALNVLARKDI  401

Query  1193  RYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQE  1014
             RYR+Y++DEIE AT+ FS SMKIGEGGYGPV++G+LDHT VAIK+LRPDA QGRKQF QE
Sbjct  402   RYRQYTLDEIEKATQNFSLSMKIGEGGYGPVFKGQLDHTNVAIKILRPDANQGRKQFLQE  461

Query  1013  VEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEI  834
             VEVL  +RHPNMVLLLGAC EYGCLVYEYM+NGSLEDRLLRK NTP IPW  RF+I+ EI
Sbjct  462   VEVLCNIRHPNMVLLLGACQEYGCLVYEYMDNGSLEDRLLRKRNTPPIPWRKRFEIAYEI  521

Query  833   ATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSA  654
             ATALLFLHQ+KPE +VHRDLKPANILLD+NFVSKISDVGLARLVPPSVAD VTQYHMT A
Sbjct  522   ATALLFLHQTKPEAIVHRDLKPANILLDKNFVSKISDVGLARLVPPSVADSVTQYHMTEA  581

Query  653   AGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLD  474
             AGT CYIDPEYQ TGKL TKSDIYSLG+M LQIITAKPPMGL+HHV+RAIE   F D+LD
Sbjct  582   AGTLCYIDPEYQNTGKLTTKSDIYSLGIMFLQIITAKPPMGLSHHVKRAIENENFFDMLD  641

Query  473   PTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             P ++DWPV+EAL FAK+SL+CAEL KKDRPDL   ++PELNRLK+  
Sbjct  642   PDVTDWPVDEALAFAKISLRCAELSKKDRPDLALEVIPELNRLKDFG  688



>ref|XP_003588906.1| U-box domain-containing protein [Medicago truncatula]
Length=712

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/707 (51%), Positives = 459/707 (65%), Gaps = 68/707 (10%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGG---PDAHGGMSDH  2172
             + +VAV K KNS  A +WT +N  I NP +I +HV+HK +P HQ      PD      + 
Sbjct  13    LVMVAVGKHKNSGHAFRWTTNN--IDNPIIIAVHVKHKGTP-HQGTNVFPPD------EK  63

Query  2171  DGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS---------  2019
             D   VF+P R     + + +KE  I DT++++ I+ Y   + +  +++GA          
Sbjct  64    DIANVFSPLRQMCNEKVVKLKEAIIIDTDISRGILDYAKRNHIQTIIVGAPTGYKKNSSF  123

Query  2018  --SRSAISRKFWTHD-VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshh  1848
               S+    +KF   D + T + K+APD+ SVYVISK K    RPA  PL  +        
Sbjct  124   KVSKHEDYKKFRGQDDLATAIMKSAPDYSSVYVISKDKVVESRPAIVPLGTV--------  175

Query  1847  gsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRS--------------------  1728
                    ++    A   + +D+ S    RG  + R  R S                    
Sbjct  176   ------VAQSHGIAPCKSENDKWSQLYRRGSTNSRSGRSSIHEFIKSFSSNNNNNNHNNE  229

Query  1727  --EDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdass  1554
               E  D     +R    S  +SL E+       S G +   +       R S   SD+  
Sbjct  230   SLESIDLSSRSQRTPPLSHNSSLNENG------SSGSNKFGSLNVAKLERNSSLQSDSQL  283

Query  1553  iaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaee  1374
             +   + E +  RLK  L+QTM MY +ACKEAI+A+  A E+ Q K+EE +  E+   ++E
Sbjct  284   VGEMEAEMKELRLK--LRQTMTMYKSACKEAISAQNKANEITQWKMEEERMVEEVIMSKE  341

Query  1373  aalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDC  1194
             AAL + E EKAK KAA++AA++A +IAE EAQR    E  AKK+  E+++AL+VL++ D 
Sbjct  342   AALALAEKEKAKAKAAIKAADEAMRIAEKEAQRRMQVEKTAKKDIEERDQALNVLARKDI  401

Query  1193  RYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQE  1014
             RYR+Y++DEIE AT+ FS SMKIGEGGYGPV++G+LDHT VAIK+LRPDA QGRKQF QE
Sbjct  402   RYRQYTLDEIEKATQNFSLSMKIGEGGYGPVFKGQLDHTNVAIKILRPDANQGRKQFLQE  461

Query  1013  VEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEI  834
             VEVL  +RHPNMVLLLGAC EYGCLVYEYM+NGSLEDRLLRK NTP IPW  RF+I+ EI
Sbjct  462   VEVLCNIRHPNMVLLLGACQEYGCLVYEYMDNGSLEDRLLRKRNTPPIPWRKRFEIAYEI  521

Query  833   ATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSA  654
             ATALLFLHQ+KPE +VHRDLKPANILLD+NFVSKISDVGLARLVPPSVAD VTQYHMT A
Sbjct  522   ATALLFLHQTKPEAIVHRDLKPANILLDKNFVSKISDVGLARLVPPSVADSVTQYHMTEA  581

Query  653   AGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLD  474
             AGT CYIDPEYQ TGKL TKSDIYSLG+M LQIITAKPPMGL+HHV+RAIE   F D+LD
Sbjct  582   AGTLCYIDPEYQNTGKLTTKSDIYSLGIMFLQIITAKPPMGLSHHVKRAIENENFFDMLD  641

Query  473   PTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             P ++DWPV+EAL FAK+SL+CAEL KKDRPDL   ++PELNRLK+  
Sbjct  642   PDVTDWPVDEALAFAKISLRCAELSKKDRPDLALEVIPELNRLKDFG  688



>emb|CDY67812.1| BnaAnng25230D, partial [Brassica napus]
Length=601

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/605 (60%), Positives = 442/605 (73%), Gaps = 31/605 (5%)
 Frame = -3

Query  2087  EVAKAIVGYINTHRVSNVVLGASSRS---AISRKFW-THDVPTIVNKTAPDFCSVYVISK  1920
             +V  AI+ Y N + V+N+VLG +S     A S KF  +HDV   V K+ P+FCSVYVISK
Sbjct  2     DVPNAILDYANNNLVNNIVLGTTSSKNPFARSLKFTKSHDVAASVLKSTPEFCSVYVISK  61

Query  1919  GKQQSIRPAARPLTNLPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGR-  1743
             GK QS R A RP+TN            +    R  +    +  D        RG+ +GR 
Sbjct  62    GKVQSSRAAQRPITN------------TLVPPRAPTFHLQNLPDPDHDHHLPRGQRNGRN  109

Query  1742  --PFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISD-GFDNA-----------AAA  1605
               P R     +    VR    S+    L  + D   P+    FD              +A
Sbjct  110   ITPERYRPHENGFNPVRERHKSAANGPLDFNYDFNQPMGQRNFDEPDFGTRMMGSIDHSA  169

Query  1604  QNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQ  1425
              N D    S +  ++ S ++KD+E+EM+RLK+ELKQTMDMY++ACKEA+ AK+ A EL +
Sbjct  170   HNFDTIGSSSSSDESVSQSNKDVEAEMRRLKIELKQTMDMYSSACKEALDAKQKANELNK  229

Query  1424  MKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakk  1245
              K+EE+ RFE+AR AEEAAL + E EKAKC+AAMEAAEK+Q++A++E QR K AEMKA++
Sbjct  230   WKLEETLRFEEARSAEEAALAVAETEKAKCRAAMEAAEKSQRMADLEGQRRKQAEMKARR  289

Query  1244  etaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAI  1065
             E+ EK+RA+S L ++D RYR+YSI+EIE AT +F+ + +IGEGGYGPV+ G LDHTPVAI
Sbjct  290   ESQEKDRAISALVQNDVRYRRYSIEEIEEATNRFASNRQIGEGGYGPVFEGTLDHTPVAI  349

Query  1064  KVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKG  885
             KVLR DAAQG+KQF QEVEVLS +RHP+MVLLLGACPEYGCLVYE+MENGSLEDRL R+G
Sbjct  350   KVLRADAAQGKKQFNQEVEVLSCIRHPHMVLLLGACPEYGCLVYEFMENGSLEDRLFRRG  409

Query  884   NTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARL  705
             N+P + W  RF+I+AEIATAL FLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARL
Sbjct  410   NSPPLSWRKRFQIAAEIATALSFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARL  469

Query  704   VPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLT  525
             VP SVAD VTQYHMTSAAGTFCYIDPEYQQTGKL TKSD+YSLG+MLLQIITAK PMGL 
Sbjct  470   VPASVADTVTQYHMTSAAGTFCYIDPEYQQTGKLTTKSDVYSLGIMLLQIITAKSPMGLA  529

Query  524   HHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRL  345
             HHV RAI KGTF D+LDP ++DWPVEEA+ FAKL L+CAELRKKDRP+LG  I+PEL RL
Sbjct  530   HHVSRAISKGTFKDMLDPVVTDWPVEEAMAFAKLCLKCAELRKKDRPNLGKDIVPELVRL  589

Query  344   KELAL  330
             +   +
Sbjct  590   RNFGM  594



>ref|XP_007024548.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 2 [Theobroma cacao]
 gb|EOY27170.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 2 [Theobroma cacao]
Length=784

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/745 (50%), Positives = 482/745 (65%), Gaps = 95/745 (13%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPF--VILLHVRHKASPNHQ------NGGPDAHG  2187
             IT VA+D+D+NS  AVKW VDNLL +N     IL+HVR ++   H       N    +  
Sbjct  17    ITAVAIDRDRNSQLAVKWAVDNLLNNNTGSQCILVHVRSQSLHPHSRTDVAMNSSIGSIM  76

Query  2186  GM--------------------------------SDHDGHCVFTPFRAYSARRGIIMKED  2103
             G+                                ++ +    F P+R Y AR+GI  KE 
Sbjct  77    GIFINYLRFLLHLTWARLVFTEDFEAVPKEGRPPTEAELQQFFLPYRGYCARKGIQSKEV  136

Query  2102  FIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVIS  1923
              + D +V  A+V YIN + + N+V+GASSR+ ++RK    DVPT + K+AP+ C+VYVIS
Sbjct  137   VLHDIDVPSALVDYINNNNIGNIVVGASSRNVLTRKLRNPDVPTSLLKSAPESCAVYVIS  196

Query  1922  KGKQQSIRPAARPLT-------NLPTHIWshhgsssrassrgssaasssAGDDRISACSS  1764
             KGK Q  R A+ P T       N   HI +     +  S +          ++     SS
Sbjct  197   KGKVQFSRLASGPRTDEDNASVNRAPHIKALLSKLTFDSPKI---------EEFSRTVSS  247

Query  1763  RGEHSGRPFRRSEDRDADGSVRRPWN---------------------SSCRNSLAEDNDL  1647
             R    G  +R + DR +D     P +                     S  R S++E+++ 
Sbjct  248   R---EGSKYRITSDRISDSFKLTPRDKLKTNNGVKSSTPSTGSQTPESPNRISISENSNF  304

Query  1646  FAPIS------DGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDM  1485
               P S       G ++   A++ +           +S+  + LE+EM+RL+ ELK++M+M
Sbjct  305   SGPPSFRSTDMSGSNSECTAEDFN---------SLNSLTPRGLETEMRRLRQELKKSMEM  355

Query  1484  YNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaeka  1305
             +N+ CKE + AK+ A+ LQ+ K  E ++ E+AR AEEAA+ + E E+ K KAAMEAA+ A
Sbjct  356   FNSVCKETVAAKEKARMLQEWKAAEERKLEEARLAEEAAMAVAEAERQKTKAAMEAAQMA  415

Query  1304  qkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKI  1125
             Q +A+MEAQ+ K AE+KA +E   K RAL  L+ +   YRKY+IDEIE AT  F+ S KI
Sbjct  416   QLLADMEAQKRKLAELKAIREAEAKKRALDQLANNKAVYRKYTIDEIEAATGYFASSHKI  475

Query  1124  GEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYG  945
             GEGGYGPV+R  LDHT VAIKVLRP  +QG+KQFQQEVEVLS MRHP+MVLL+GACPEYG
Sbjct  476   GEGGYGPVFRATLDHTAVAIKVLRPGISQGQKQFQQEVEVLSCMRHPHMVLLIGACPEYG  535

Query  944   CLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPA  765
             CLVYEYMENGSLEDRL RK NTP+IPW+ RF+I+AEIAT LLFLHQ+KPEPLVHRDLKPA
Sbjct  536   CLVYEYMENGSLEDRLFRKDNTPSIPWKTRFRIAAEIATGLLFLHQTKPEPLVHRDLKPA  595

Query  764   NILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDI  585
             NILLDRN+VSKISDVGLARLVP S AD+ T Y +T+A GTFCYIDPEYQQTG LG KSD+
Sbjct  596   NILLDRNYVSKISDVGLARLVPQSFADNATDYRLTAARGTFCYIDPEYQQTGMLGVKSDL  655

Query  584   YSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAE  405
             YS GV+LLQ+IT++PP+GLT  V+ AIEK TF+++LDPT+ DWPVEE L  AKL+LQC E
Sbjct  656   YSFGVVLLQLITSRPPVGLTTQVQVAIEKRTFSEILDPTVPDWPVEEVLSLAKLALQCCE  715

Query  404   LRKKDRPDLGSVILPELNRLKELAL  330
             LRK+DRPDL SV+LPELNRL++L L
Sbjct  716   LRKRDRPDLASVVLPELNRLRDLGL  740



>ref|XP_004305505.1| PREDICTED: U-box domain-containing protein 35-like [Fragaria 
vesca subsp. vesca]
Length=1116

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/705 (52%), Positives = 460/705 (65%), Gaps = 39/705 (6%)
 Frame = -3

Query  2348  GPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS--PNHQNGG---------  2202
             G    VAVDKDK S  A +W V++L+     + LLHV+  A   PN +            
Sbjct  12    GDAVAVAVDKDKGSQYAFRWVVNHLVKPGQTLTLLHVKQPAPRVPNQRRMALGSEVSEEV  71

Query  2201  PDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
                +    D          R    ++ I   E  +ED++++KA++ Y+  + +  +VLG 
Sbjct  72    AKMYKNQPDAQAKEWLLSMRCICIKKKINCNEVILEDSDISKALINYVAANSIEVLVLGI  131

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAA-----------RPLTN  1875
             +S+S I R F T DVP+ V K APDFC+VYVIS+ K  S+R A             P T 
Sbjct  132   TSKSGIFR-FRTRDVPSTVLKGAPDFCTVYVISREKISSVRSATGALPQKPEGLPYPCTQ  190

Query  1874  LPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRR  1695
                H WS      + S    +    SA    I+A SS+ +  GR F  S++        R
Sbjct  191   NEQHHWSEMTQYPQCSLPNDNDQLESAN---IAARSSKKQSLGRTFAFSDNMAGP----R  243

Query  1694  PWNSSC--RNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsdassiaSKD-----L  1536
               NSS   R+S++         S G    +  + +D T   +  S  S  + +      +
Sbjct  244   LSNSSEFDRSSISTSYSGTTSYS-GATTYSGTEFIDMTYQQNEFSFTSMESERSSNIDGM  302

Query  1535  ESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMV  1356
             E+E++RL+LELKQTMDMY+ ACKEA+  K  AKEL Q K+E+  + ++A  AEE AL++ 
Sbjct  303   EAELRRLQLELKQTMDMYSLACKEAVKEKNKAKELNQWKLEKEHQLKEALLAEEMALKLA  362

Query  1355  emekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYS  1176
             E EK KC+AA++ AE AQ++A++EAQ+ + AEM+   +  E  R +S     D RYRKY+
Sbjct  363   EKEKEKCRAAIKEAEAAQRVAKLEAQKARIAEMQDLNQADE-GREVSESMTYDLRYRKYT  421

Query  1175  IDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSL  996
             I+E+E AT  FS++ KIGEG YGPVY G++DHT VAIKVLRPDAAQGR QFQ+EVE+LS 
Sbjct  422   IEELEAATNDFSQANKIGEGSYGPVYVGEIDHTRVAIKVLRPDAAQGRLQFQREVEILSC  481

Query  995   MRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLF  816
             +RHPNMVLLLGACPEYGCLVYEYM NGSLED L ++ NT  IPW++RFKI+AEI T L F
Sbjct  482   IRHPNMVLLLGACPEYGCLVYEYMANGSLEDCLFQRCNTQVIPWQLRFKIAAEICTGLYF  541

Query  815   LHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCY  636
             LHQ+KPEPLVHRDLKP NILLD N+VSKISDVGL RLVP SVAD VTQY MTS AGTFCY
Sbjct  542   LHQNKPEPLVHRDLKPGNILLDHNYVSKISDVGLGRLVPQSVADSVTQYRMTSTAGTFCY  601

Query  635   IDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDW  456
             IDPEYQQTG L TKSD+YSLGVMLLQ+ITAKPPMGLTHHV  AIE G FA +LDP + DW
Sbjct  602   IDPEYQQTGMLATKSDVYSLGVMLLQLITAKPPMGLTHHVMEAIEIGNFAQILDPAVPDW  661

Query  455   PVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             PVEEAL FAKL LQCAE+R+KDRPDLG V+LPELNRL  LA +S+
Sbjct  662   PVEEALKFAKLGLQCAEMRRKDRPDLGKVVLPELNRLSALAEESM  706



>tpg|DAA58697.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=449

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/418 (74%), Positives = 363/418 (87%), Gaps = 2/418 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E EM+RL+LELKQTMDMYN ACKEAI AK+ AKE+Q MK+EE +R E+AR AEE AL
Sbjct  7     RDIEVEMRRLRLELKQTMDMYNAACKEAINAKQRAKEMQLMKLEEERRLEEARHAEETAL  66

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + EMEKAKC+AAMEAAE AQ++A++EAQR + AE++A++E  EK RAL  +S  D RYR
Sbjct  67    ALAEMEKAKCRAAMEAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAISNHDFRYR  126

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY IDEIE ATE+FS  +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQFQQEVEV
Sbjct  127   KYHIDEIEMATERFSDELKIGEGGYGPVYRASLDHTPVAIKVLRPDAHQGRKQFQQEVEV  186

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYME+GSLEDRL R+G TP IPW  RF+I+AEIATA
Sbjct  187   LSCIRHPNMVLLLGACPEYGCLVYEYMEHGSLEDRLFRRGGTPPIPWAQRFRIAAEIATA  246

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY +T+ AGT
Sbjct  247   LLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYRLTATAGT  306

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTGKLG KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTFA +LD T+
Sbjct  307   FCYIDPEYQQTGKLGVKSDIYSLGVLLLQVVTARPPMGLTHHVEKAIDAGTFAQMLDITV  366

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKEL--ALQSLASKNGTQT  297
              DWPVEEAL +AKL+L+C E+R++DRPDL +V+LPELNRL+ L  A ++  S  GT +
Sbjct  367   KDWPVEEALGYAKLALKCTEMRRRDRPDLATVVLPELNRLRNLGHAYEARMSAVGTNS  424



>ref|XP_007217395.1| hypothetical protein PRUPE_ppa025268mg [Prunus persica]
 gb|EMJ18594.1| hypothetical protein PRUPE_ppa025268mg [Prunus persica]
Length=776

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/721 (48%), Positives = 474/721 (66%), Gaps = 42/721 (6%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDA----------  2193
             +  VA+D  K S +A++W  +N++     V+LLHV  K+S      G +A          
Sbjct  24    LVAVAIDNQKGSQNALRWAAENVITRGQTVVLLHVVQKSSSTSSLAGNNALICDVSNPSQ  83

Query  2192  --HGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
                    +     +F  F  Y  R+ I   +  +EDT++AKA+  Y++   + N+VLGA 
Sbjct  84    SPRKQQLEKMTKDLFLTFHCYCTRKDINCLDIVLEDTDIAKAVTEYVSYAAIENLVLGAP  143

Query  2018  SRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR------PLTNLPTHIW  1857
             ++    R F T  +P+ V+K APDFC+VYVISKGK  S+R A+R      PL N    + 
Sbjct  144   AKHGFIR-FKTSSIPSSVSKGAPDFCTVYVISKGKISSVRNASRAAPYSSPLVNQIDSLN  202

Query  1856  shhgsssrassrgssaasssAG--DDRISACSSRGEHSGRPFRRSEDRDAD--GSVRRPW  1689
                          +    +  G  + RIS   S  E S   F  SE    D   SV   +
Sbjct  203   KQSFKPPETPRYNNILGLTRGGFSNGRISGGFSESE-SDISFISSERASTDRASSVTYDF  261

Query  1688  NSSCRNSLAEDNDL----------FAPISDGFDNAAAAQNLDFTRisdagsdassiaSKD  1539
               + R  ++  +D           FA +S   D ++ +   + T      S  SS   ++
Sbjct  262   MDTNRGRISTSSDQSFGSMHQGPKFADLSSLHDFSSVSHESNLT-----SSSWSSQNLEE  316

Query  1538  LESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRM  1359
             +ESEM+RLKLELKQTMDMY+ AC+EA++AK+   EL   ++ E Q+ E+AR  +EAA+ +
Sbjct  317   VESEMRRLKLELKQTMDMYSTACREALSAKQKEMELHNWRVVEEQKLEEARLGQEAAIAV  376

Query  1358  VemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKY  1179
              E E+ +C+AAMEAA+ A++IA++E+Q+    E+KA +E  +  + L  L+++D +YR+Y
Sbjct  377   AEKERVRCRAAMEAADAAKRIAQLESQKRANTEIKALREAEDMRKLLDNLAQTDDKYRRY  436

Query  1178  SIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS  999
             +I+EIE ATE F+ S KIGEGGYGPV++  LDHTPVA+KVLRPDAAQGR QFQ+E+++LS
Sbjct  437   AIEEIEQATEHFAPSRKIGEGGYGPVFKCYLDHTPVAVKVLRPDAAQGRTQFQKEIDILS  496

Query  998   LMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALL  819
              +RHPNMVLLLGACPEYG LVYEYM NGSLED L+++GN PA+ W++RF+I+AEI T LL
Sbjct  497   CIRHPNMVLLLGACPEYGVLVYEYMANGSLEDCLIKRGNNPALSWQLRFRIAAEIGTGLL  556

Query  818   FLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFC  639
             FLHQ+KPEPLVHRDLKP NILLD N+VSKISDVGLARLV P+VA+++TQ  MT+ AGTFC
Sbjct  557   FLHQTKPEPLVHRDLKPGNILLDHNYVSKISDVGLARLV-PAVAENMTQCLMTATAGTFC  615

Query  638   YIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISD  459
             YIDPEYQQTG LG KSD+YSLG++LLQ++T + PMGL HHV++AIEK TF ++LDP + D
Sbjct  616   YIDPEYQQTGMLGVKSDVYSLGIILLQLLTGRSPMGLAHHVDKAIEKDTFEEMLDPAVPD  675

Query  458   WPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASK--NGTQTFGRH  285
             WPVEEAL  AKL++QCAELR+KDRPDLG+V+LP LN+ +ELA   +  K  +G      H
Sbjct  676   WPVEEALSLAKLAIQCAELRRKDRPDLGTVVLPSLNKWRELAEDKMNHKLIDGNNGLSPH  735

Query  284   Y  282
             +
Sbjct  736   H  736



>ref|XP_007024547.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOY27169.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
Length=831

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/745 (50%), Positives = 480/745 (64%), Gaps = 95/745 (13%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPF--VILLHVRHKASPNHQ------NGGPDAHG  2187
             IT VA+D+D+NS  AVKW VDNLL +N     IL+HVR ++   H       N    +  
Sbjct  17    ITAVAIDRDRNSQLAVKWAVDNLLNNNTGSQCILVHVRSQSLHPHSRTDVAMNSSIGSIM  76

Query  2186  GM--------------------------------SDHDGHCVFTPFRAYSARRGIIMKED  2103
             G+                                ++ +    F P+R Y AR+GI  KE 
Sbjct  77    GIFINYLRFLLHLTWARLVFTEDFEAVPKEGRPPTEAELQQFFLPYRGYCARKGIQSKEV  136

Query  2102  FIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVIS  1923
              + D +V  A+V YIN + + N+V+GASSR+ ++RK    DVPT + K+AP+ C+VYVIS
Sbjct  137   VLHDIDVPSALVDYINNNNIGNIVVGASSRNVLTRKLRNPDVPTSLLKSAPESCAVYVIS  196

Query  1922  KGKQQSIRPAARPLT-------NLPTHIWshhgsssrassrgssaasssAGDDRISACSS  1764
             KGK Q  R A+ P T       N   HI          +        S   ++     SS
Sbjct  197   KGKVQFSRLASGPRTDEDNASVNRAPHI---------KALLSKLTFDSPKIEEFSRTVSS  247

Query  1763  RGEHSGRPFRRSEDRDADGSVRRPWN---------------------SSCRNSLAEDNDL  1647
             R    G  +R + DR +D     P +                     S  R S++E+++ 
Sbjct  248   R---EGSKYRITSDRISDSFKLTPRDKLKTNNGVKSSTPSTGSQTPESPNRISISENSNF  304

Query  1646  FAPIS------DGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDM  1485
               P S       G ++   A++ +           +S+  + LE+EM+RL+ ELK++M+M
Sbjct  305   SGPPSFRSTDMSGSNSECTAEDFN---------SLNSLTPRGLETEMRRLRQELKKSMEM  355

Query  1484  YNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaeka  1305
             +N+ CKE + AK+ A+ LQ+ K  E ++ E+AR AEEAA+ + E E+ K KAAMEAA+ A
Sbjct  356   FNSVCKETVAAKEKARMLQEWKAAEERKLEEARLAEEAAMAVAEAERQKTKAAMEAAQMA  415

Query  1304  qkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKI  1125
             Q +A+MEAQ+ K AE+KA +E   K RAL  L+ +   YRKY+IDEIE AT  F+ S KI
Sbjct  416   QLLADMEAQKRKLAELKAIREAEAKKRALDQLANNKAVYRKYTIDEIEAATGYFASSHKI  475

Query  1124  GEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYG  945
             GEGGYGPV+R  LDHT VAIKVLRP  +QG+KQFQQEVEVLS MRHP+MVLL+GACPEYG
Sbjct  476   GEGGYGPVFRATLDHTAVAIKVLRPGISQGQKQFQQEVEVLSCMRHPHMVLLIGACPEYG  535

Query  944   CLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPA  765
             CLVYEYMENGSLEDRL RK NTP+IPW+ RF+I+AEIAT LLFLHQ+KPEPLVHRDLKPA
Sbjct  536   CLVYEYMENGSLEDRLFRKDNTPSIPWKTRFRIAAEIATGLLFLHQTKPEPLVHRDLKPA  595

Query  764   NILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDI  585
             NILLDRN+VSKISDVGLARLVP S AD+ T Y +T+A GTFCYIDPEYQQTG LG KSD+
Sbjct  596   NILLDRNYVSKISDVGLARLVPQSFADNATDYRLTAARGTFCYIDPEYQQTGMLGVKSDL  655

Query  584   YSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAE  405
             YS GV+LLQ+IT++PP+GLT  V+ AIEK TF+++LDPT+ DWPVEE L  AKL+LQC E
Sbjct  656   YSFGVVLLQLITSRPPVGLTTQVQVAIEKRTFSEILDPTVPDWPVEEVLSLAKLALQCCE  715

Query  404   LRKKDRPDLGSVILPELNRLKELAL  330
             LRK+DRPDL SV+LPELNRL++L L
Sbjct  716   LRKRDRPDLASVVLPELNRLRDLGL  740



>ref|XP_006843202.1| hypothetical protein AMTR_s00146p00101680 [Amborella trichopoda]
 gb|ERN04877.1| hypothetical protein AMTR_s00146p00101680 [Amborella trichopoda]
Length=759

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/404 (77%), Positives = 362/404 (90%), Gaps = 0/404 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             KD+E+E++RLKLELKQTMDMY++ACKEAITAK+ A+EL Q K+EE+++FE AR AEE AL
Sbjct  286   KDVEAEVRRLKLELKQTMDMYSSACKEAITAKQKARELNQWKLEEARKFEDARHAEETAL  345

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + EMEKAKC+AA+EAA  AQ++AE EAQ+   AEMKAK+E  EK +AL  L+ SD RYR
Sbjct  346   AIAEMEKAKCRAALEAAGAAQRLAEKEAQKRMSAEMKAKREAEEKKKALDALAHSDVRYR  405

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE ATE FS+S+KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVEV
Sbjct  406   KYTIEEIELATEYFSESLKIGEGGYGPVYKSTLDHTPVAIKVLRPDAAQGRMQFQQEVEV  465

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSL+DRL R+GN+P++PW +RFKI+AE+AT 
Sbjct  466   LSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDRLFRRGNSPSLPWPLRFKIAAEVATG  525

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+ SKISDVGLARLVPPSVAD VTQY MTS AGT
Sbjct  526   LLFLHQTKPEPLVHRDLKPANILLDRNYNSKISDVGLARLVPPSVADSVTQYRMTSTAGT  585

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSDIYSLGVMLLQ+ITAKPPMGLTHHVERAI++GTF+++LD T+
Sbjct  586   FCYIDPEYQQTGMLGIKSDIYSLGVMLLQVITAKPPMGLTHHVERAIDRGTFSEMLDQTV  645

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              DWPVEEAL FAKL+L+CAELR+KDRPDLG+VILPELNRL+ L 
Sbjct  646   PDWPVEEALSFAKLALRCAELRRKDRPDLGTVILPELNRLRNLG  689


 Score =   102 bits (253),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -3

Query  2198  DAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
             D H    + D   +F P+R + +RR +  KE  +ED EV+K+I+ Y+    + ++V+G+S
Sbjct  16    DTHLEQVEADMQQLFLPYRGFCSRRQMQHKEVVLEDYEVSKSIIEYLTNSCIDSIVVGSS  75

Query  2018  SRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             SR+A+++KF   DVP+ + K AP+FC+VYVI KGK QS+R A+RP
Sbjct  76    SRNALTKKFKPPDVPSCLTKGAPEFCTVYVICKGKVQSLRSASRP  120



>ref|XP_006374811.1| hypothetical protein POPTR_0014s01190g [Populus trichocarpa]
 gb|ERP52608.1| hypothetical protein POPTR_0014s01190g [Populus trichocarpa]
Length=705

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/679 (53%), Positives = 461/679 (68%), Gaps = 22/679 (3%)
 Frame = -3

Query  2360  GATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS-------PNHQNGG  2202
             G     +  VAVDKDK S +A+KWTV+NLL     +IL+HV +K+S        +H + G
Sbjct  12    GGEGNGLVAVAVDKDKGSQNALKWTVENLLTKGQNLILIHVFNKSSSSSSSFVTSHGSPG  71

Query  2201  PDAHGGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVL  2028
               +  G    +     +F  FR Y  R+ +   +  +E T++AKAI  Y++   +  +VL
Sbjct  72    DYSSPGKQQLEKMAKDLFLTFRCYCTRKDVHCLDVALESTDIAKAITEYVSHAAIETLVL  131

Query  2027  GASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshh  1848
             G  SRS   R F    VP+ V++ APDFC VYV+SKGK  ++R A+RP       +    
Sbjct  132   GTPSRSGFMRYFC--HVPSTVSRGAPDFCIVYVVSKGKVSTMRNASRPAPFASPLL--DQ  187

Query  1847  gsssrassrgssaasssAGDDRISACSSRGEHSGRPFR--RSEDRDADGSVRRPWNSSCR  1674
               + +  +   +  ++  G++R         HS + F    SE   +  S  RP      
Sbjct  188   IQNQQNQNSPRAEHNTIVGNNRSPFGREGQGHSVKSFADLMSETDISFVSSSRPSTDRIN  247

Query  1673  NSLAEDNDL-FAPISDGFDNAAAAQNLDFTRisd----agsdassiaSKDLESEMKRLKL  1509
              S++  +D  FA I  G    +   +  F+ IS          S+ +  D+ESEM+R KL
Sbjct  248   PSVSTSSDTSFASIQSGPKFFSPNYHQGFSSISQDSGRTSFTGSTHSLDDMESEMRRRKL  307

Query  1508  ELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakcka  1329
             ELKQTMD+YN AC+EA+TAK+ A EL + +IEE +R E++R +EEAAL ++E EKA+C+ 
Sbjct  308   ELKQTMDLYNAACREALTAKRKATELDRWRIEEERRLEESRFSEEAALSIIEQEKARCRE  367

Query  1328  ameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATE  1149
             A++AAE+A+K A +EAQR +    K  KE A+  RA   LS    RYR+YSI+EIE AT+
Sbjct  368   AIDAAEEAEKRAAIEAQR-RLNIEKTLKEAAKTKRAKDNLSYHGIRYRRYSIEEIEVATQ  426

Query  1148  KFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLL  969
              FS+S KIG GGYGPVY   LDHTPVA+KVLRPDAAQGR QFQ+EVEVLSL+RHPNMVLL
Sbjct  427   YFSESKKIGGGGYGPVYNCYLDHTPVAVKVLRPDAAQGRSQFQREVEVLSLIRHPNMVLL  486

Query  968   LGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPL  789
             LGACPEYG LVYEYM  GSLED L ++GNTPA+ W+IRF+I+AEIAT LLFLHQ+KPEPL
Sbjct  487   LGACPEYGILVYEYMAKGSLEDCLFKRGNTPALSWQIRFRIAAEIATGLLFLHQTKPEPL  546

Query  788   VHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTG  609
             VHRDLKP NILLD N+ SKISDVGLARLV P+ +++VTQYHMTSAAGTFCYIDPEYQQTG
Sbjct  547   VHRDLKPGNILLDNNYTSKISDVGLARLV-PTTSENVTQYHMTSAAGTFCYIDPEYQQTG  605

Query  608   KLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFA  429
              LG KSD+YSLG++LLQ+ITAKPPMGLTH VE+AIE  T  ++LD  + DWP+EE L FA
Sbjct  606   MLGVKSDVYSLGILLLQVITAKPPMGLTHIVEQAIENETLKEVLDSDVPDWPIEETLCFA  665

Query  428   KLSLQCAELRKKDRPDLGS  372
             KL+LQCAELR+KDRPDLG+
Sbjct  666   KLALQCAELRRKDRPDLGT  684



>ref|NP_001136486.1| uncharacterized protein LOC100216601 [Zea mays]
 gb|ACF82032.1| unknown [Zea mays]
 gb|AFW83077.1| lycopene epsilon cyclase1 [Zea mays]
Length=641

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/594 (59%), Positives = 430/594 (72%), Gaps = 28/594 (5%)
 Frame = -3

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPTHIWshhgsssra  1830
             A  RKF   DVP+ + K APD+C++YV++KGK  ++R A   +  + T       + S  
Sbjct  25    ASGRKFKNADVPSTLMKCAPDYCNIYVVAKGKSVNVRLAKCGVPPMHTGADIASDTDSLR  84

Query  1829  ssrgssaasssAGDDRISACSSRG-------EHSGRPFRRSEDRDADGSVRR--------  1695
              S       S     R++  + R        E S RP  R     +  + +         
Sbjct  85    ESVLYMRRGSRGHLPRVTPDAWRSIDGRTPPELSTRPLFRERLLSSSATTKNFVVLPGKD  144

Query  1694  PWNSSCR----NSLAEDNDLFAPISDGFDNAAAAQNLDF--TRisdagsdassiaSKDLE  1533
              + +S R    +SL  D D F P S  F      +NLD   T  +      ++ A +D E
Sbjct  145   NFETSSRSARHDSLGGDLD-FGP-STRFSYIDLGENLDMSTTLPALEPMSPATGAQRDTE  202

Query  1532  SEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVe  1353
             +EM+RL+LELKQTMDMYN ACKEAI AK+ AKE+  MK+EE++R E+AR AEEAAL + E
Sbjct  203   AEMRRLRLELKQTMDMYNAACKEAINAKQRAKEMHMMKLEEARRLEEARNAEEAALAVAE  262

Query  1352  mekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSI  1173
             MEKAKC+AAMEAAE AQ++A++EAQR + AE++A++E  EK RAL  +S  D RYRKY I
Sbjct  263   MEKAKCRAAMEAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAISNHDFRYRKYHI  322

Query  1172  DEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLM  993
             DEIE ATE+FS  +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQF QEVEVLS +
Sbjct  323   DEIEMATERFSDELKIGEGGYGPVYRASLDHTPVAIKVLRPDAHQGRKQFLQEVEVLSCI  382

Query  992   RHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFL  813
             RHPNMVLLLGACPEYGCLVYEYM++GSLEDRL R+G TP + W  RF+I+AEIATALLFL
Sbjct  383   RHPNMVLLLGACPEYGCLVYEYMDHGSLEDRLFRRGGTPPLAWAQRFRIAAEIATALLFL  442

Query  812   HQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYI  633
             HQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY +T+ AGTFCYI
Sbjct  443   HQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRLTATAGTFCYI  502

Query  632   DPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWP  453
             DPEYQQTGKLG KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTF  +LD T+ DWP
Sbjct  503   DPEYQQTGKLGVKSDIYSLGVLLLQVVTARPPMGLTHHVEKAIDAGTFEQMLDITVKDWP  562

Query  452   VEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKEL-----ALQSLASKNG  306
             VEEAL +AKL+L+C E+R++DRPDL +VILPELNRL+ L     A  S A  NG
Sbjct  563   VEEALGYAKLALKCTEMRRRDRPDLATVILPELNRLRNLGHAYEARMSAARANG  616



>ref|XP_006374752.1| kinase family protein, partial [Populus trichocarpa]
 gb|ERP52549.1| kinase family protein, partial [Populus trichocarpa]
Length=722

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/699 (51%), Positives = 461/699 (66%), Gaps = 38/699 (5%)
 Frame = -3

Query  2360  GATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGM  2181
             G     +  VAVDKDK S +A+KWTV+NLL     +IL+HV +K+S +            
Sbjct  12    GGEGNGLVAVAVDKDKGSQNALKWTVENLLSKGQNLILIHVFYKSSSSFVTRKQQLEKMA  71

Query  2180  SDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAIS  2001
              D     +F  FR Y  R+ +   +  +E T++AKAI  Y++   +  +VLG  SRS   
Sbjct  72    KD-----LFLTFRCYCTRKDVHCLDVAVESTDIAKAITEYVSHAAIETLVLGTPSRSGFM  126

Query  2000  RKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR--PLTNLPTH--IWshhgsssr  1833
             RKF   DVP+ V++ APDFC+VYV+SKGK  ++R A+R  P  +   H      + +   
Sbjct  127   RKF-KADVPSTVSRGAPDFCTVYVVSKGKVSTMRNASRPAPFASPLLHQIQNQQNQNRRG  185

Query  1832  assrgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDN  1653
                    + +    +  IS  SS    + R    + D    G+  R +++S   S A   
Sbjct  186   GQGHSVKSFADLMSETDISFVSSSRPSTDRMSSVTYDFMDSGATPR-FSTSSDTSFASIQ  244

Query  1652  D---LFAP-ISDGFDNAAA-AQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMD  1488
                  F+P    GF + +  +    FT         S+ +  D+ESEM+RLKLELKQTMD
Sbjct  245   SGPKFFSPNYHQGFSSISQDSGRTSFT--------GSTHSLDDMESEMRRLKLELKQTMD  296

Query  1487  MYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaek  1308
             +YN AC+EA+TAK+ A EL + +IEE +R E++R +EEAAL ++E EKA+C+ A++AAE+
Sbjct  297   LYNAACREALTAKRKATELNRWRIEEERRLEESRFSEEAALSIIEQEKARCREAIDAAEE  356

Query  1307  aqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMK  1128
             A+K A +EAQR +    K  KE A+  RA   LS    RYR+YSI+EIE AT+ FS+S K
Sbjct  357   AEKRAAIEAQR-RLNIEKTLKEAAKTKRAKDNLSYHGIRYRRYSIEEIEVATQYFSESKK  415

Query  1127  IGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEY  948
             IGEGGYGPVY   LD TPVA+KVLRPDA QGR QF++EVEVLSL+RHPNMVLLLGACPEY
Sbjct  416   IGEGGYGPVYNCYLDQTPVAVKVLRPDATQGRSQFRREVEVLSLIRHPNMVLLLGACPEY  475

Query  947   GCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKP  768
             G LVYEYM  GSLED L ++GNT A+ W+IRF+I+AEIAT LLFLHQ+KPEP+VHRDLKP
Sbjct  476   GILVYEYMAKGSLEDCLFKRGNTAALSWQIRFRIAAEIATGLLFLHQTKPEPVVHRDLKP  535

Query  767   ANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSD  588
              NILLD N+ SKIS             D+VTQYHMTSAAGTFCYIDPEYQQTG LG KSD
Sbjct  536   GNILLDNNYTSKIS-------------DNVTQYHMTSAAGTFCYIDPEYQQTGMLGVKSD  582

Query  587   IYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCA  408
             +YSLG++LLQ+ITAKPPMGLTH VE+AIE  T  ++LD  + DWP+EE L FAKL+LQCA
Sbjct  583   VYSLGILLLQVITAKPPMGLTHIVEQAIENETLKEVLDSDVPDWPIEETLWFAKLALQCA  642

Query  407   ELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQTFG  291
             ELR+KDRPDLG+ +LPELNRL++ A + +      + FG
Sbjct  643   ELRRKDRPDLGTEVLPELNRLRDYAEEKMNYLFLAKAFG  681



>ref|XP_011019963.1| PREDICTED: U-box domain-containing protein 34-like [Populus euphratica]
Length=673

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/409 (74%), Positives = 362/409 (89%), Gaps = 0/409 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RL+LELKQTMDMY++AC+EA+TAK+ A+EL   K+EE QR E AR AEEAAL+
Sbjct  210   DMEAEMRRLRLELKQTMDMYSSACREALTAKQKARELHHWKLEEQQRSEGARLAEEAALQ  269

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             +V  E+ KCKAA+EAAE +Q+IAE+E Q+   AEM A+KE  E+N+AL+ ++ SD RYRK
Sbjct  270   LVAKERFKCKAAIEAAESSQRIAELELQKRLNAEMIAQKEFQERNKALASIANSDLRYRK  329

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE AT++FS S+KIGEGGYGPVY+  LDHTPVAIKVLRPDAA GR QFQQEVEVL
Sbjct  330   YTIEEIEAATDEFSNSLKIGEGGYGPVYKSYLDHTPVAIKVLRPDAAHGRSQFQQEVEVL  389

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPEYGCLVYEYM NGSLED L  +GN+P + W++RF+I+AEI T L
Sbjct  390   SCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDCLFHRGNSPPLSWQLRFRIAAEIGTGL  449

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPPS+A+ VTQY MTS AGTF
Sbjct  450   LFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPSIANTVTQYRMTSTAGTF  509

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG++LLQIITAKPPMGLTHHVERAIEKGTFA++LDP + 
Sbjct  510   CYIDPEYQQTGMLGIKSDIYSLGILLLQIITAKPPMGLTHHVERAIEKGTFAEMLDPAVL  569

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
             DWP+EEA++FAKLSL+CAELR+KDRPDLG+VILPELNRL+ELA +++ S
Sbjct  570   DWPIEEAMNFAKLSLRCAELRRKDRPDLGAVILPELNRLRELAEENMPS  618


 Score = 53.9 bits (128),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  2000  RKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             RKF T DVP  V+K AP FCSVYVISKGK  S+R A+ P
Sbjct  9     RKFKTTDVPGNVSKGAPGFCSVYVISKGKISSVRSASGP  47



>ref|XP_010656707.1| PREDICTED: U-box domain-containing protein 52-like isoform X3 
[Vitis vinifera]
Length=806

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/410 (76%), Positives = 363/410 (89%), Gaps = 0/410 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTMDMY+ ACKEA++AK++A+EL + K+EE+QR  +AR AEEAAL
Sbjct  348   EDVEAEMRRLKLELKQTMDMYSTACKEALSAKQTARELHRWKMEEAQRLGEARLAEEAAL  407

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
                E EKAK KAA+EAAE +Q+IA++EAQ+   AEM A KE  E+ + L+ L+++D RYR
Sbjct  408   ATAEREKAKAKAALEAAEASQRIAKLEAQKRINAEMVAIKEAEERKKMLNTLAQTDLRYR  467

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE ATE FS+S KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVEV
Sbjct  468   KYTIEEIEAATELFSESRKIGEGGYGPVYKSYLDHTPVAIKVLRPDAAQGRSQFQQEVEV  527

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSL+D L R+GNTP +PW++RF+I+AEI T 
Sbjct  528   LSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDHLFRRGNTPVLPWQLRFQIAAEIGTG  587

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKP NILLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGT
Sbjct  588   LLFLHQTKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADSVTQYLMTSTAGT  647

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSDIYSLG+MLLQIITAKPPMGLTH+VERAIEKGTFA++LDP +
Sbjct  648   FCYIDPEYQQTGMLGIKSDIYSLGIMLLQIITAKPPMGLTHYVERAIEKGTFAEVLDPAV  707

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
              DWPVEEAL FAKL+LQCAELR+KDRPDLG+V+LPELNRL+ LA ++++S
Sbjct  708   HDWPVEEALKFAKLALQCAELRRKDRPDLGNVVLPELNRLRTLAEENMSS  757


 Score =   124 bits (312),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 94/161 (58%), Gaps = 12/161 (7%)
 Frame = -3

Query  2333  VAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS--PN---HQNGGPD-------AH  2190
             VA+DKDK S  A+KW VD+LL     V LLH++ KAS  PN   +Q    D       A+
Sbjct  15    VAIDKDKGSQYALKWAVDHLLSKGQSVTLLHIKQKASSIPNPLGNQVAISDVNEDVARAY  74

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
                 D+    +F PFR +  R+ I   E  +E T++ KAI+ ++    +  +V+GA SRS
Sbjct  75    KQQLDNQARELFLPFRCFCMRKDIQCNEVILEGTDITKAIIDFVTASSIEILVVGAPSRS  134

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
                R+F T DVP+ V K APDFC+VYVISKGK  S+R A R
Sbjct  135   GFIRRFKTTDVPSSVLKAAPDFCTVYVISKGKITSVRSATR  175



>ref|XP_002309024.1| kinase family protein [Populus trichocarpa]
 gb|EEE92547.1| kinase family protein [Populus trichocarpa]
Length=687

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/439 (71%), Positives = 371/439 (85%), Gaps = 9/439 (2%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+ESEM+RL+LELKQTMDMY++AC+EA+TAK+ A+EL   K+EE QR E AR AEEAAL+
Sbjct  235   DMESEMRRLRLELKQTMDMYSSACREALTAKQKARELHHWKLEEQQRSEGARLAEEAALQ  294

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             +V  E+AKCKAA+EAAE +Q+IAE+E Q+   AEM A+KE  EKN+AL+ ++ SD RYRK
Sbjct  295   LVAKERAKCKAAIEAAESSQRIAELELQKRLNAEMIAQKEFQEKNKALASIANSDLRYRK  354

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE AT++FS S+KIGEGGYGPVYR  LDHTPVAIKVLRPDAA GR QFQQEVEVL
Sbjct  355   YTIEEIEAATDEFSNSLKIGEGGYGPVYRSYLDHTPVAIKVLRPDAAHGRSQFQQEVEVL  414

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPEYGCLVYEYM NGSLED L  +GN+P + W++RF+I+AEI T L
Sbjct  415   SCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDCLFHRGNSPPLSWQLRFRIAAEIGTGL  474

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPPS+A+ VTQY MTS AGTF
Sbjct  475   LFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPSIANTVTQYRMTSTAGTF  534

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG++LLQIITAKPPMGLTHHVERAIEKGTFA++LDP + 
Sbjct  535   CYIDPEYQQTGMLGIKSDIYSLGILLLQIITAKPPMGLTHHVERAIEKGTFAEMLDPAVL  594

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS-----KNGTQT  297
             DWP+EEA++FAKLSL CAELR+KDRPDLG+VILPEL RL+ELA +++ S       G+  
Sbjct  595   DWPIEEAMNFAKLSLCCAELRRKDRPDLGAVILPELKRLRELAEENMPSVMPGGSTGSSP  654

Query  296   FGRHYC*IKSIF----FFN  252
             +   +  ++  F    FFN
Sbjct  655   YHSQFSSVQVSFTCFHFFN  673


 Score =   119 bits (297),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 92/160 (58%), Gaps = 10/160 (6%)
 Frame = -3

Query  2333  VAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS--PN-------HQNGG-PDAHGG  2184
             VA+DKDK+S  A+KWTVD+LL     + LLH++   S  P        H N    + +  
Sbjct  15    VAIDKDKSSQHALKWTVDHLLTRGQALTLLHIKQNLSSIPTPCVPPLLHVNDDVANMYSK  74

Query  2183  MSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAI  2004
                     +F PFR +  R+ I   E  +E  +VAK I+ Y+ T+ +  ++LG+SS+  +
Sbjct  75    QITSQAKSLFLPFRCFCTRKEIKCNEVVVEKMDVAKGIIEYVTTNAIEILILGSSSKGGL  134

Query  2003  SRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
              RKF T D+P  V+K AP FCSVYVISKGK  S+R A+ P
Sbjct  135   VRKFKTTDIPGNVSKGAPGFCSVYVISKGKISSVRSASGP  174



>ref|XP_010656706.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Vitis vinifera]
Length=825

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/410 (76%), Positives = 363/410 (89%), Gaps = 0/410 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTMDMY+ ACKEA++AK++A+EL + K+EE+QR  +AR AEEAAL
Sbjct  367   EDVEAEMRRLKLELKQTMDMYSTACKEALSAKQTARELHRWKMEEAQRLGEARLAEEAAL  426

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
                E EKAK KAA+EAAE +Q+IA++EAQ+   AEM A KE  E+ + L+ L+++D RYR
Sbjct  427   ATAEREKAKAKAALEAAEASQRIAKLEAQKRINAEMVAIKEAEERKKMLNTLAQTDLRYR  486

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE ATE FS+S KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVEV
Sbjct  487   KYTIEEIEAATELFSESRKIGEGGYGPVYKSYLDHTPVAIKVLRPDAAQGRSQFQQEVEV  546

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSL+D L R+GNTP +PW++RF+I+AEI T 
Sbjct  547   LSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDHLFRRGNTPVLPWQLRFQIAAEIGTG  606

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKP NILLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGT
Sbjct  607   LLFLHQTKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADSVTQYLMTSTAGT  666

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSDIYSLG+MLLQIITAKPPMGLTH+VERAIEKGTFA++LDP +
Sbjct  667   FCYIDPEYQQTGMLGIKSDIYSLGIMLLQIITAKPPMGLTHYVERAIEKGTFAEVLDPAV  726

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
              DWPVEEAL FAKL+LQCAELR+KDRPDLG+V+LPELNRL+ LA ++++S
Sbjct  727   HDWPVEEALKFAKLALQCAELRRKDRPDLGNVVLPELNRLRTLAEENMSS  776


 Score =   119 bits (298),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 93/161 (58%), Gaps = 13/161 (8%)
 Frame = -3

Query  2333  VAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS--PN---HQNGGPD-------AH  2190
             VA+DKDK S  A+KW VD+LL     V LLH++ KAS  PN   +Q    D       A+
Sbjct  15    VAIDKDKGSQYALKWAVDHLLSKGQSVTLLHIKQKASSIPNPLGNQVAISDVNEDVARAY  74

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
                 D+    +F PFR +  R+ I   E  +E T++ KAI+ ++    +  +V+GA SRS
Sbjct  75    KQQLDNQARELFLPFRCFCMRKDIQCNEVILEGTDITKAIIDFVTASSIEILVVGAPSRS  134

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
                R F T DVP+ V K APDFC+VYVISKGK  S+R A R
Sbjct  135   GFIR-FKTTDVPSSVLKAAPDFCTVYVISKGKITSVRSATR  174



>ref|XP_010656705.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Vitis vinifera]
 emb|CAN79719.1| hypothetical protein VITISV_012742 [Vitis vinifera]
Length=826

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/410 (76%), Positives = 363/410 (89%), Gaps = 0/410 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTMDMY+ ACKEA++AK++A+EL + K+EE+QR  +AR AEEAAL
Sbjct  368   EDVEAEMRRLKLELKQTMDMYSTACKEALSAKQTARELHRWKMEEAQRLGEARLAEEAAL  427

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
                E EKAK KAA+EAAE +Q+IA++EAQ+   AEM A KE  E+ + L+ L+++D RYR
Sbjct  428   ATAEREKAKAKAALEAAEASQRIAKLEAQKRINAEMVAIKEAEERKKMLNTLAQTDLRYR  487

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE ATE FS+S KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVEV
Sbjct  488   KYTIEEIEAATELFSESRKIGEGGYGPVYKSYLDHTPVAIKVLRPDAAQGRSQFQQEVEV  547

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSL+D L R+GNTP +PW++RF+I+AEI T 
Sbjct  548   LSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDHLFRRGNTPVLPWQLRFQIAAEIGTG  607

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKP NILLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGT
Sbjct  608   LLFLHQTKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADSVTQYLMTSTAGT  667

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSDIYSLG+MLLQIITAKPPMGLTH+VERAIEKGTFA++LDP +
Sbjct  668   FCYIDPEYQQTGMLGIKSDIYSLGIMLLQIITAKPPMGLTHYVERAIEKGTFAEVLDPAV  727

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
              DWPVEEAL FAKL+LQCAELR+KDRPDLG+V+LPELNRL+ LA ++++S
Sbjct  728   HDWPVEEALKFAKLALQCAELRRKDRPDLGNVVLPELNRLRTLAEENMSS  777


 Score =   124 bits (312),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 94/161 (58%), Gaps = 12/161 (7%)
 Frame = -3

Query  2333  VAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS--PN---HQNGGPD-------AH  2190
             VA+DKDK S  A+KW VD+LL     V LLH++ KAS  PN   +Q    D       A+
Sbjct  15    VAIDKDKGSQYALKWAVDHLLSKGQSVTLLHIKQKASSIPNPLGNQVAISDVNEDVARAY  74

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
                 D+    +F PFR +  R+ I   E  +E T++ KAI+ ++    +  +V+GA SRS
Sbjct  75    KQQLDNQARELFLPFRCFCMRKDIQCNEVILEGTDITKAIIDFVTASSIEILVVGAPSRS  134

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
                R+F T DVP+ V K APDFC+VYVISKGK  S+R A R
Sbjct  135   GFIRRFKTTDVPSSVLKAAPDFCTVYVISKGKITSVRSATR  175



>ref|NP_198388.1| protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
 gb|AED93961.1| protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
Length=731

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/692 (52%), Positives = 462/692 (67%), Gaps = 36/692 (5%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
              +A+D+DK S +A+KW V NLL     + LLHV+ K   +    G  ++      D   +
Sbjct  13    TLAIDRDKESQNALKWAVSNLLSRGQTLTLLHVKLKQPSSLPYSG--SNFSKPGDDPSEL  70

Query  2156  FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDV  1977
             F PFR Y AR+ I  ++  +ED   AK IV Y+  + +  ++LG+S  + +  +F   DV
Sbjct  71    FLPFRCYCARKDINCQDVVVEDVSAAKGIVDYVQQNAIETLILGSSKMTLL--RFKAADV  128

Query  1976  PTIVNKTAPDFCSVYVISKGKQQSIRPAAR--PLTNLPTHIWshhgsssrassrgssaas  1803
              + V K AP FC+VYVISKGK   +R A    P +N+P+ +  H  + +   +      +
Sbjct  129   SSTVMKKAPSFCTVYVISKGKISFLRSATSSPPHSNMPS-MRHHSHAQTSNMNVERRQQT  187

Query  1802  ssAGDDRISACSSRGEHSGRPFRRSEDRDADG-SVRRPWNSSCRNSLAEDNDL-------  1647
                  D I     RG + G       D D    S  RP       SL +D D+       
Sbjct  188   MQRTHDEIKIEIKRG-YEGVYQPSITDSDISFVSSGRPSVDQMFPSLYDDVDVPRLSVTS  246

Query  1646  -FAPISDGFDNAAAAQNLDF---------TRisdagsdassiaSKDLESEMKRLKLELKQ  1497
              +      F    + Q++D          T         S     +LE+EM+RLK+ELK 
Sbjct  247   EYGENRLSFATTYSKQSIDLGSPYAPNSSTSFESGRQSFSLQGQDELETEMRRLKMELKH  306

Query  1496  TMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakckaamea  1317
             TM+MYN+ACKEAI+AKK+A EL + K E+  + E+ R ++EAA+ M E EK K +AAMEA
Sbjct  307   TMEMYNSACKEAISAKKAANELLKWKAEKEHKLEEVRLSKEAAMAMAEREKEKSRAAMEA  366

Query  1316  aekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSK  1137
             A  AQK++++EA++      K  +   EK RA+S L     RYRKY+I+EIE ATE FS 
Sbjct  367   AVAAQKLSDLEAEK-----RKHIETVDEKKRAVSSL-----RYRKYTIEEIEEATEDFSP  416

Query  1136  SMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGAC  957
             S K+GEGGYGPVY+G LD+T VAIKVLRPDAAQGR QFQ+EVEVL+ MRHPNMVLLLGAC
Sbjct  417   SRKVGEGGYGPVYKGTLDYTKVAIKVLRPDAAQGRSQFQREVEVLTCMRHPNMVLLLGAC  476

Query  956   PEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRD  777
             PEYGCLVYEYM NGSL+D L R+GN+P + W++RF+I++EIAT L FLHQ KPEPLVHRD
Sbjct  477   PEYGCLVYEYMANGSLDDCLFRRGNSPILSWQLRFRIASEIATGLHFLHQMKPEPLVHRD  536

Query  776   LKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGT  597
             LKP NILLD++FVSKISDVGLARLVPPSVAD  TQY MTS AGTF YIDPEYQQTG LGT
Sbjct  537   LKPGNILLDQHFVSKISDVGLARLVPPSVADTATQYRMTSTAGTFFYIDPEYQQTGMLGT  596

Query  596   KSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSL  417
             KSDIYS G+MLLQI+TAKPPMGLTHHVE+AIEKGTFA++LDP + DWP EEAL  AKL+L
Sbjct  597   KSDIYSFGIMLLQILTAKPPMGLTHHVEKAIEKGTFAEMLDPAVPDWPFEEALAAAKLAL  656

Query  416   QCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             QCA+LR+KDRPDLG+++LPEL +L++LA +S+
Sbjct  657   QCAKLRRKDRPDLGNIVLPELKKLRDLAEESI  688



>ref|XP_009779108.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
Length=794

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/489 (67%), Positives = 385/489 (79%), Gaps = 5/489 (1%)
 Frame = -3

Query  1787  DRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAA  1608
             DR    SS     G P R S   D D     P     R S + + D        F     
Sbjct  266   DRTFPISSDSYDLGLPPRLSNSSDTDNRFSAP-----RLSNSSETDSRLSFGSSFSATRL  320

Query  1607  AQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQ  1428
             ++   F+  S   ++ S+   +D+E+EM+RLK ELKQTMDMY+ ACKEA++AK  A EL 
Sbjct  321   SEVNAFSSNSFDSANGSTNNLEDIEAEMRRLKQELKQTMDMYSTACKEALSAKHKALELH  380

Query  1427  QMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkak  1248
             + K+EE QR E+AR AEEAAL + E EKAKCKAA+EAAE+AQ+IAE EAQR   AE +A 
Sbjct  381   RWKVEEEQRLEEARLAEEAALAIAEKEKAKCKAALEAAEEAQRIAEREAQRRITAERRAL  440

Query  1247  ketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVA  1068
             KE  EK + L  L++SDCRYRKY+I+EIE ATE F+ S KIGEGGYGPVY+  LDHT VA
Sbjct  441   KEAEEKKKVLDALAQSDCRYRKYTIEEIEAATENFAASRKIGEGGYGPVYKCYLDHTQVA  500

Query  1067  IKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRK  888
             IKVLRPDAAQGR QFQQEVEVLS +RHPNMVLLLGACPE+GCLVYEYM NGSL+DRL R+
Sbjct  501   IKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDRLFRR  560

Query  887   GNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLAR  708
             GNTP +PW++RF+I+AE+ T+LLFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLAR
Sbjct  561   GNTPVLPWQLRFRIAAEVGTSLLFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLAR  620

Query  707   LVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGL  528
             LVPPSVAD VTQY MTS AGTFCYIDPEYQQTG LGTKSDIYS G+MLLQIITA+PPMGL
Sbjct  621   LVPPSVADSVTQYRMTSTAGTFCYIDPEYQQTGMLGTKSDIYSFGIMLLQIITARPPMGL  680

Query  527   THHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNR  348
             THHVERAIEKGTFA++LDP + DWPVEEAL FAKL+L+CAELR+KDRPDLG+V+LPELNR
Sbjct  681   THHVERAIEKGTFAEMLDPVVPDWPVEEALTFAKLALKCAELRRKDRPDLGTVVLPELNR  740

Query  347   LKELALQSL  321
             L+ LA +++
Sbjct  741   LRLLAEEAM  749


 Score =   133 bits (335),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 102/174 (59%), Gaps = 7/174 (4%)
 Frame = -3

Query  2369  SSDGATTG--PITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS---PNH--Q  2211
             SS G   G    TVVA+DKDK S  A+KW VDNLL     V LLHVR + S   PN    
Sbjct  7     SSSGEKKGEEKATVVAIDKDKGSQHALKWAVDNLLGKGKTVTLLHVRLRPSNSLPNADVN  66

Query  2210  NGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVV  2031
             +G P  +    D     +F PFR +  R+ I + E  IE  ++A +I  Y+  +   N+V
Sbjct  67    DGTPRVYRSDPDSQAKELFLPFRCFCNRKNIHVNEVVIEGIDIANSISDYVAANITENLV  126

Query  2030  LGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLP  1869
             +GA+SR+    +F T DVP+ V+KTAP FC+VYVI+KGK  SIR A+ P+ N P
Sbjct  127   MGAASRNGFVSRFKTMDVPSSVSKTAPGFCTVYVIAKGKVLSIRNASAPVPNPP  180



>ref|XP_002521369.1| kinase, putative [Ricinus communis]
 gb|EEF41037.1| kinase, putative [Ricinus communis]
Length=803

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/707 (49%), Positives = 465/707 (66%), Gaps = 46/707 (7%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISN-PFVILLHVRHKA-SPNH--QNGGPDAHGGMSDH  2172
             TV+A+D DKNS  AVKW +DNL+ +  P  IL+HV+ K   P H  + G P     +   
Sbjct  17    TVIAIDCDKNSKCAVKWAIDNLVNNKKPNCILVHVQCKTLHPGHIPKEGRPPTQQELQQ-  75

Query  2171  DGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKF  1992
                  F P+R Y ARRGI  K   + D +V  A+  Y+  ++ SN+VLGAS R+A++RKF
Sbjct  76    ----FFLPYRGYCARRGIETKNVVLHDIDVPSALTNYVVLNKASNIVLGASRRNALTRKF  131

Query  1991  WTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPL-----------------------  1881
                D P+ + K+AP+ C+VYVISKGK Q++RPA+RPL                       
Sbjct  132   KNPDAPSTLLKSAPESCAVYVISKGKLQTLRPASRPLTASDSTSSNISSDSSQQHHSPPA  191

Query  1880  -TNLPTHIWshhgsssrassrgssaasssAGD----DRISACSSRGEHSGRPFRRSEDRD  1716
              TN  +    H+      SS    +      D    DR S    R EH    F       
Sbjct  192   TTNNASSTRQHNHLEVPQSSSIPPSELHRKSDETFPDRGSDSMHRAEHEYYEFSSKTHSP  251

Query  1715  ADGSVRRPWNSSCRNSLAEDNDLFA-PISDGFDNAAAAQNLDFTRisdagsdassiaSKD  1539
             A        +   R+S+++ N++ + PIS    + +  +N+DF+  S +  + +S     
Sbjct  252   APSIDDHSSDLLHRDSISDGNEISSGPISIRSADMSY-ENVDFSPKSGSLKNPNSSQLA-  309

Query  1538  LESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRM  1359
             + +EM+RLKLEL+ +M ++     E + AK+   EL +++  ESQ+ E+++ AE AAL +
Sbjct  310   VNAEMRRLKLELQHSMQLFRTVTNETVLAKQMVMELHRLESLESQKSEESKLAERAALTL  369

Query  1358  VemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKY  1179
              EMEK K K A EA +  +K+A++EAQ+      +  +  A++ + +  ++  D R R+Y
Sbjct  370   AEMEKHKKKVASEAVQAVKKLADLEAQK------RNAEMRAQRKKNMETMANDDFRCRRY  423

Query  1178  SIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS  999
             +IDEIE AT+ F+ S KIGEG YGPV+RG L+H  VAIK+LRPD +QG KQF+QEV+VLS
Sbjct  424   TIDEIEVATQHFAPSHKIGEGAYGPVFRGMLNHIAVAIKILRPDLSQGLKQFRQEVDVLS  483

Query  998   LMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALL  819
              +RHP+MV+LLGACPEYGCLVYEYMENG+LEDRL RK NT  IPW  RFKI+ EIA ALL
Sbjct  484   SLRHPHMVILLGACPEYGCLVYEYMENGNLEDRLFRKDNTLPIPWRTRFKIAYEIAAALL  543

Query  818   FLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFC  639
             FLH++KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPS A++V+QY MT+AAGTF 
Sbjct  544   FLHETKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSAANNVSQYRMTAAAGTFY  603

Query  638   YIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISD  459
             YIDPEYQQTG LG KSD+YS GV+LLQ++TAKPPMGL+  VE +I+ GTF+D+LDP ++D
Sbjct  604   YIDPEYQQTGLLGVKSDLYSFGVVLLQLLTAKPPMGLSCQVEDSIQNGTFSDVLDPALTD  663

Query  458   WPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLA  318
             WPVE+ L  AK+ ++C ELRKKDRP+L +VILPEL RL +LA+ + A
Sbjct  664   WPVEDCLSLAKIGVKCCELRKKDRPNLANVILPELERLTDLAMANEA  710



>ref|XP_008672352.1| PREDICTED: uncharacterized LOC100272561 isoform X1 [Zea mays]
 tpg|DAA58695.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=754

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/469 (69%), Positives = 383/469 (82%), Gaps = 5/469 (1%)
 Frame = -3

Query  1694  PWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsda-ssiaSKDLESEMKR  1518
             P  S+  +S   D D F P S  F +     NLD T        + ++ A +D+E EM+R
Sbjct  263   PSRSARHDSFGGDLD-FGP-STRFSSMDFGDNLDLTASPAREPMSPATGAQRDIEVEMRR  320

Query  1517  LKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekak  1338
             L+LELKQTMDMYN ACKEAI AK+ AKE+Q MK+EE +R E+AR AEE AL + EMEKAK
Sbjct  321   LRLELKQTMDMYNAACKEAINAKQRAKEMQLMKLEEERRLEEARHAEETALALAEMEKAK  380

Query  1337  ckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEF  1158
             C+AAMEAAE AQ++A++EAQR + AE++A++E  EK RAL  +S  D RYRKY IDEIE 
Sbjct  381   CRAAMEAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAISNHDFRYRKYHIDEIEM  440

Query  1157  ATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNM  978
             ATE+FS  +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQFQQEVEVLS +RHPNM
Sbjct  441   ATERFSDELKIGEGGYGPVYRASLDHTPVAIKVLRPDAHQGRKQFQQEVEVLSCIRHPNM  500

Query  977   VLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKP  798
             VLLLGACPEYGCLVYEYME+GSLEDRL R+G TP IPW  RF+I+AEIATALLFLHQ+KP
Sbjct  501   VLLLGACPEYGCLVYEYMEHGSLEDRLFRRGGTPPIPWAQRFRIAAEIATALLFLHQTKP  560

Query  797   EPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQ  618
             EPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY +T+ AGTFCYIDPEYQ
Sbjct  561   EPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYRLTATAGTFCYIDPEYQ  620

Query  617   QTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEAL  438
             QTGKLG KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTFA +LD T+ DWPVEEAL
Sbjct  621   QTGKLGVKSDIYSLGVLLLQVVTARPPMGLTHHVEKAIDAGTFAQMLDITVKDWPVEEAL  680

Query  437   HFAKLSLQCAELRKKDRPDLGSVILPELNRLKEL--ALQSLASKNGTQT  297
              +AKL+L+C E+R++DRPDL +V+LPELNRL+ L  A ++  S  GT +
Sbjct  681   GYAKLALKCTEMRRRDRPDLATVVLPELNRLRNLGHAYEARMSAVGTNS  729


 Score =   125 bits (315),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 95/152 (63%), Gaps = 0/152 (0%)
 Frame = -3

Query  2348  GPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHD  2169
              P+ VVA+D+D+NS  A KW VD+LL     ++LLHV      NH     +      + +
Sbjct  24    APVIVVAIDRDRNSQLAAKWVVDHLLSGASQIVLLHVAAHYPANHGFAMAETTQSALEAE  83

Query  2168  GHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW  1989
                +F P+R +  R G+ + E  +E+ +V+KAI+GYI  +++ ++ LG +SR+A ++KF 
Sbjct  84    MKEIFVPYRGFFNRNGVDVFEVVLEEADVSKAILGYITANKIQSIALGGASRNAFTKKFK  143

Query  1988  THDVPTIVNKTAPDFCSVYVISKGKQQSIRPA  1893
               DVP+ + K APD+C++YV++KGK  ++R A
Sbjct  144   NADVPSTLMKCAPDYCNIYVVAKGKSVNVRLA  175



>ref|NP_001140500.1| uncharacterized LOC100272561 [Zea mays]
 gb|ACN33953.1| unknown [Zea mays]
 tpg|DAA58696.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=756

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/469 (69%), Positives = 383/469 (82%), Gaps = 5/469 (1%)
 Frame = -3

Query  1694  PWNSSCRNSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsda-ssiaSKDLESEMKR  1518
             P  S+  +S   D D F P S  F +     NLD T        + ++ A +D+E EM+R
Sbjct  265   PSRSARHDSFGGDLD-FGP-STRFSSMDFGDNLDLTASPAREPMSPATGAQRDIEVEMRR  322

Query  1517  LKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekak  1338
             L+LELKQTMDMYN ACKEAI AK+ AKE+Q MK+EE +R E+AR AEE AL + EMEKAK
Sbjct  323   LRLELKQTMDMYNAACKEAINAKQRAKEMQLMKLEEERRLEEARHAEETALALAEMEKAK  382

Query  1337  ckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEF  1158
             C+AAMEAAE AQ++A++EAQR + AE++A++E  EK RAL  +S  D RYRKY IDEIE 
Sbjct  383   CRAAMEAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAISNHDFRYRKYHIDEIEM  442

Query  1157  ATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNM  978
             ATE+FS  +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQFQQEVEVLS +RHPNM
Sbjct  443   ATERFSDELKIGEGGYGPVYRASLDHTPVAIKVLRPDAHQGRKQFQQEVEVLSCIRHPNM  502

Query  977   VLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKP  798
             VLLLGACPEYGCLVYEYME+GSLEDRL R+G TP IPW  RF+I+AEIATALLFLHQ+KP
Sbjct  503   VLLLGACPEYGCLVYEYMEHGSLEDRLFRRGGTPPIPWAQRFRIAAEIATALLFLHQTKP  562

Query  797   EPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQ  618
             EPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY +T+ AGTFCYIDPEYQ
Sbjct  563   EPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYRLTATAGTFCYIDPEYQ  622

Query  617   QTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEAL  438
             QTGKLG KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTFA +LD T+ DWPVEEAL
Sbjct  623   QTGKLGVKSDIYSLGVLLLQVVTARPPMGLTHHVEKAIDAGTFAQMLDITVKDWPVEEAL  682

Query  437   HFAKLSLQCAELRKKDRPDLGSVILPELNRLKEL--ALQSLASKNGTQT  297
              +AKL+L+C E+R++DRPDL +V+LPELNRL+ L  A ++  S  GT +
Sbjct  683   GYAKLALKCTEMRRRDRPDLATVVLPELNRLRNLGHAYEARMSAVGTNS  731


 Score =   121 bits (304),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 95/154 (62%), Gaps = 2/154 (1%)
 Frame = -3

Query  2348  GPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHD  2169
              P+ VVA+D+D+NS  A KW VD+LL     ++LLHV      NH     +      + +
Sbjct  24    APVIVVAIDRDRNSQLAAKWVVDHLLSGASQIVLLHVAAHYPANHGFAMAETTQSALEAE  83

Query  2168  GHCVFTPFRAYSARRGIIMK--EDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRK  1995
                +F P+R +  R G+ +   E  +E+ +V+KAI+GYI  +++ ++ LG +SR+A ++K
Sbjct  84    MKEIFVPYRGFFNRNGVNVDVFEVVLEEADVSKAILGYITANKIQSIALGGASRNAFTKK  143

Query  1994  FWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPA  1893
             F   DVP+ + K APD+C++YV++KGK  ++R A
Sbjct  144   FKNADVPSTLMKCAPDYCNIYVVAKGKSVNVRLA  177



>gb|KCW69804.1| hypothetical protein EUGRSUZ_F03165 [Eucalyptus grandis]
Length=779

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/695 (49%), Positives = 444/695 (64%), Gaps = 47/695 (7%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPF-VILLHVRHKASPNHQ---------------  2211
             +T +A+D+DKNS SAVKW V+NL+       ILLHVR     + +               
Sbjct  24    VTAIAIDRDKNSQSAVKWAVENLIKKTASQCILLHVRTHGDYSGKLLLFISSSTVFSSDK  83

Query  2210  ---------------NGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAK  2076
                               P      ++ +    F P+R + ARRGI  KE  + D +V  
Sbjct  84    IISLTWTLFDCCGEAEWVPSGGRTPTEAELQQFFLPYRGFCARRGIAAKEIILPDIDVPS  143

Query  2075  AIVGYINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRP  1896
             A++ Y+  + +SN+V+G SSR+AI+RKF T DVPT + K+AP  CSVYVISK K Q++R 
Sbjct  144   ALLHYVANNSISNIVVGVSSRNAITRKFKTPDVPTSLMKSAPPTCSVYVISKDKLQTVRA  203

Query  1895  AARPL--TNLPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRPFRRSED  1722
             A R L  ++ PT I      SS   ++ +  + +    D   +  S G        RS+ 
Sbjct  204   ATRRLIISSAPTCIKDTPNKSSPRGNQPNIQSKTPDSFDIDRSTYSVGSL------RSQS  257

Query  1721  RDADGS-----VRRPWNSSCR-NSLAEDNDLFAPISDGFDNAAAAQNLDFTRisdagsda  1560
              D+  S     VR+    S R N L     L A I +   + +++   D T  S   S  
Sbjct  258   SDSACSEKSTDVRQMNLDSWRANRLPSVRPLEAYIMENLSSESSSS--DATDFSGQLSYR  315

Query  1559  ssiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqa  1380
             SS  ++ LE+E+++LKLE KQ++  YN AC+E   A+  AKELQ+MK  E  +F + +  
Sbjct  316   SSSENRGLEAEIEKLKLEFKQSLSTYNVACEEVSAAEAKAKELQRMKTAEVIKFVEPKLH  375

Query  1379  eeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKS  1200
              E A     +EK +   A E  +  ++    EA++   A      E+  + RA+  L++ 
Sbjct  376   REVAWTSPTVEKLETPVAKEVTKIREQRQLFEAKKGHNAGDTTNGESGMRKRAIDALAQE  435

Query  1199  DCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQ  1020
             +  YRKY+I EIE AT+ FS+S+KIGEGGYGPV++  LDHTPVAIKVLRPD +QG +QF+
Sbjct  436   NVWYRKYTIREIEEATDYFSRSLKIGEGGYGPVFKAYLDHTPVAIKVLRPDVSQGLQQFK  495

Query  1019  QEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISA  840
             QEVEVLS MRHPNMVLL+GACPEYGCLVYEYM+NGSLEDR+  K NTP I W  RFKI+A
Sbjct  496   QEVEVLSRMRHPNMVLLVGACPEYGCLVYEYMDNGSLEDRIFCKNNTPPISWRSRFKIAA  555

Query  839   EIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMT  660
             EIAT LLFLHQ+KPEPLVHRD+KP+NILLD ++VSKISDVGLARLVPPS+A+ +T+YHMT
Sbjct  556   EIATGLLFLHQTKPEPLVHRDIKPSNILLDCHYVSKISDVGLARLVPPSIANRLTEYHMT  615

Query  659   SAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADL  480
             +AAGTFCYIDPEYQQTG LG KSD+YS GVMLLQIITAKPPMGL   VE AIE GTF  +
Sbjct  616   AAAGTFCYIDPEYQQTGMLGVKSDVYSFGVMLLQIITAKPPMGLAMQVEDAIEGGTFPQV  675

Query  479   LDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLG  375
             LDP I+DWPVEE L  AK++L+C ELR++DRPDLG
Sbjct  676   LDPAINDWPVEETLSMAKMALRCCELRRRDRPDLG  710



>ref|XP_002455839.1| hypothetical protein SORBIDRAFT_03g026030 [Sorghum bicolor]
 gb|EES00959.1| hypothetical protein SORBIDRAFT_03g026030 [Sorghum bicolor]
Length=756

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/418 (75%), Positives = 363/418 (87%), Gaps = 5/418 (1%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E EM+RL+LELKQTMDMYN ACKEAI AK+ AKE+Q MK+EE++R E+AR AEEAAL
Sbjct  314   RDIEVEMRRLRLELKQTMDMYNAACKEAINAKQRAKEMQMMKLEEARRLEEARHAEEAAL  373

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + EMEKAKC+AAMEAAE AQ++A++EAQR + AE++A++E  EK RAL  +S  D RYR
Sbjct  374   ALAEMEKAKCRAAMEAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAISNHDFRYR  433

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY IDEIE ATE+FS  +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQFQQEVEV
Sbjct  434   KYHIDEIEMATERFSDELKIGEGGYGPVYRASLDHTPVAIKVLRPDAHQGRKQFQQEVEV  493

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYME+GSLEDRL R+G TP IPW  RF+I+AEIATA
Sbjct  494   LSCIRHPNMVLLLGACPEYGCLVYEYMEHGSLEDRLFRRGGTPTIPWPQRFRIAAEIATA  553

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY +T+ AGT
Sbjct  554   LLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYRLTATAGT  613

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTGKLG KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTFA +LD T+
Sbjct  614   FCYIDPEYQQTGKLGVKSDIYSLGVLLLQVVTARPPMGLTHHVEKAIDAGTFAQMLDITV  673

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKEL-----ALQSLASKNG  306
              DWPVEEAL +AKL+L+C E+R++DRPDL +VILPELNRL+ L     A  S A  NG
Sbjct  674   KDWPVEEALGYAKLALKCTEMRRRDRPDLATVILPELNRLRNLGHAYEARMSTAGANG  731


 Score =   114 bits (285),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 96/150 (64%), Gaps = 0/150 (0%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGH  2163
             + VVA+D+D++S  AVKW +D+LL     ++LLHV    + NH     +   G  + +  
Sbjct  26    LIVVAIDRDRHSQLAVKWVMDHLLSGASQIVLLHVAAHYATNHGFAMAETTQGALEAEMK  85

Query  2162  CVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTH  1983
              +F P+R +  R  + + E  +E+ +V+KAI+GYI  +++ ++ LG +SR+A ++KF   
Sbjct  86    EIFVPYRGFFNRNLVEVSEVVLEEADVSKAILGYITANKIQSIALGGASRNAFTKKFKNA  145

Query  1982  DVPTIVNKTAPDFCSVYVISKGKQQSIRPA  1893
             DVP+ + K APD+C++YV++KGK  ++R A
Sbjct  146   DVPSTLMKCAPDYCNIYVVAKGKSVNVRLA  175



>ref|XP_010913853.1| PREDICTED: U-box domain-containing protein 35-like [Elaeis guineensis]
Length=765

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/419 (74%), Positives = 361/419 (86%), Gaps = 3/419 (1%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EMKRL+LELKQTMDMY+ ACKEA+TAK+ A EL + K+EE +R E+AR AEEAAL
Sbjct  309   EDVEAEMKRLRLELKQTMDMYSTACKEALTAKQKAMELHRWKMEEERRLEEARMAEEAAL  368

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              +VE EKA+CKAA+EAAE +++IAE+EAQ+   AEMKA KE  EK RAL  L+ +D RYR
Sbjct  369   ALVEREKARCKAAIEAAEASKRIAELEAQKRINAEMKALKEAEEKKRALDALANTDVRYR  428

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE ATE FS+   IGEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVE+
Sbjct  429   KYTIEEIEVATEYFSEKRNIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQEVEI  488

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL R+GNTP IPW+ RF+I+AEI T 
Sbjct  489   LSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTPPIPWQYRFRIAAEIGTG  548

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVA++VTQY MTS AGT
Sbjct  549   LLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVAENVTQYRMTSTAGT  608

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSDIYSLG+MLLQIITAKPPMGLTHHVERAIEKGTF ++LDP++
Sbjct  609   FCYIDPEYQQTGMLGVKSDIYSLGIMLLQIITAKPPMGLTHHVERAIEKGTFTEMLDPSV  668

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA---LQSLASKNGTQT  297
             +DWPVEEAL  AK++L CAELR+KDRPDL +V+LPEL RL+ L    +Q  AS   + T
Sbjct  669   TDWPVEEALSLAKIALSCAELRRKDRPDLATVVLPELERLRNLGEENMQHCASFGSSHT  727


 Score =   129 bits (324),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 101/161 (63%), Gaps = 6/161 (4%)
 Frame = -3

Query  2366  SDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHG  2187
             ++GAT  P+  VAVDKDK S SA+KW +DN++     + L+HV +K +P  Q   P + G
Sbjct  4     TEGATF-PLVAVAVDKDKASQSALKWALDNIVTRGHTITLIHVINKHAPPGQQDDPASAG  62

Query  2186  GMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSA  2007
               +      +F PFR +  R+ +  K+  +EDT++AKAI+ +++   +  +V+GA S+  
Sbjct  63    SHAKD----LFVPFRCFCTRKNVQCKDIILEDTDIAKAIIEFVSHAAIEKLVVGAPSKGG  118

Query  2006  ISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
               R F T DV T V+K APDFC+VY+ISKGK  S+R A RP
Sbjct  119   FVR-FRTTDVSTSVSKGAPDFCTVYIISKGKVSSMRNAVRP  158



>ref|XP_008381640.1| PREDICTED: U-box domain-containing protein 52-like [Malus domestica]
Length=833

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/723 (50%), Positives = 469/723 (65%), Gaps = 49/723 (7%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASP-------------NHQNGG  2202
             +  VA+D  K S +A++W  ++LL     VILLHV  K S              N  N  
Sbjct  60    LVAVAIDNQKGSQNALRWAAEHLLTKGQTVILLHVVQKTSSVCSSIXGNNAIVCNINNLS  119

Query  2201  PDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
                     +     +F  F  Y AR+ I   +  +ED+++AKA+  Y +   + N+VLGA
Sbjct  120   QSPRKQQLEKMTKDLFLTFHCYCARKDINCIDIILEDSDIAKAVTEYASYAAIENLVLGA  179

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGK------------------------  1914
              ++    R F +  +P+ V+K APDFC+VYVISKGK                        
Sbjct  180   PTKHGFIR-FKSSSIPSSVSKGAPDFCTVYVISKGKIHSERHASRPAAYSSPLLAQIEAL  238

Query  1913  -QQSIRPAARPLTNLPTHIWshhgsssrassrgssaasssAG---DDRISACSSRGEHSG  1746
              QQS + A  P  N+                  S  A +  G   + RIS   S  E S 
Sbjct  239   NQQSAKAAETPRQNMYLKAARPSFRPRNLPDEASRYAYTRGGGFSNGRISGGFSESE-SE  297

Query  1745  RPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDL-FAPISDGFDNAAAAQNLDFT----Ri  1581
             R F  S+    D +    +    R  L+  +D  F  +  G   A      DF+      
Sbjct  298   RSFISSDRASTDRASSVMYEYMDRGRLSTSSDQSFGSMRLGPKFAELNFPQDFSSISHES  357

Query  1580  sdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqr  1401
             +   S  SS   +++ESEM+RLKLELKQTMDMY+ AC+EA+TAK+   EL   + EE Q+
Sbjct  358   NQTSSSWSSENLEEVESEMRRLKLELKQTMDMYSTACREALTAKQKEMELHSWRAEEEQK  417

Query  1400  feqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRA  1221
              E+AR A+EAA  + E EKA+CKAA+EAA+ A++IAE+E+ +   AE+KA +E  +  + 
Sbjct  418   LEEARLAQEAAQAVAEREKARCKAAIEAADAAKRIAELESNKRANAEIKALREAEDMRKL  477

Query  1220  LSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAA  1041
             LS L+ +D +YR+YSI+EIE ATE F  S KIGEGGYGPVY+  LDHTPVA+KVLRPDAA
Sbjct  478   LSNLAHTDDKYRRYSIEEIEEATEHFLPSRKIGEGGYGPVYKCYLDHTPVAVKVLRPDAA  537

Query  1040  QGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWE  861
             QGR QFQ+E+++LS +RHPNMVLLLGACPEYG LVYEYM NGSL+D L RKGNTPA+ W+
Sbjct  538   QGRSQFQKEIDILSCIRHPNMVLLLGACPEYGILVYEYMANGSLDDCLSRKGNTPALSWQ  597

Query  860   IRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADD  681
             +RF+I+AE+AT LLFLHQ+KPEPLVHRDLKP NILLD+N+VSKISDVGLARLV P+VA++
Sbjct  598   LRFQIAAEVATGLLFLHQTKPEPLVHRDLKPGNILLDQNYVSKISDVGLARLV-PAVAEN  656

Query  680   VTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIE  501
             VTQ  MT+ AGTFCYIDPEYQQTG LG KSD+YSLG+MLLQ++T++PPMGLTH VE AIE
Sbjct  657   VTQCLMTATAGTFCYIDPEYQQTGMLGVKSDVYSLGIMLLQLVTSRPPMGLTHQVETAIE  716

Query  500   KGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             KGTFA +LDP + DWP EEAL FAKL++QCAELR+KDRPDLG+VILP LN+L+E A + +
Sbjct  717   KGTFAGMLDPAVPDWPYEEALSFAKLAIQCAELRRKDRPDLGTVILPALNKLREFADEKM  776

Query  320   ASK  312
               K
Sbjct  777   NHK  779



>gb|EMS65140.1| U-box domain-containing protein 34 [Triticum urartu]
Length=805

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/405 (76%), Positives = 359/405 (89%), Gaps = 0/405 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +++E EM+RLKLELKQTMDMYN ACKEAI AK+ AKE+  +K+EE++R E+ARQ+EEAAL
Sbjct  364   REVEVEMRRLKLELKQTMDMYNAACKEAINAKQRAKEMHLLKMEEARRLEEARQSEEAAL  423

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + EMEK KC+AAMEAAE AQ++A++EAQR + AE++A++E  EK RAL  ++  D RYR
Sbjct  424   ALAEMEKVKCRAAMEAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAIANHDFRYR  483

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KYSIDEIE ATE FS S+KIGEGGYGPVY   LDHTPVA+KVLRPDA QGRKQFQQEVEV
Sbjct  484   KYSIDEIEIATEGFSDSLKIGEGGYGPVYSASLDHTPVAVKVLRPDAQQGRKQFQQEVEV  543

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYMENGSLEDRL R+G TP +PW  RF+ISAEIATA
Sbjct  544   LSCIRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLYRRGGTPTLPWSQRFRISAEIATA  603

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPP+VAD VTQY +T+ AGT
Sbjct  604   LLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPAVADSVTQYRLTATAGT  663

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTGKLG KSDIYSLGV+LLQ+ITA+PPMGLTHHVE+AIE GTFA +LD T+
Sbjct  664   FCYIDPEYQQTGKLGVKSDIYSLGVLLLQVITARPPMGLTHHVEKAIESGTFAQMLDITV  723

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
              DWPVE+AL FAKLSL+C E+R++DRPDLG+VILPELNRL+ L +
Sbjct  724   KDWPVEDALGFAKLSLKCTEMRRRDRPDLGTVILPELNRLRNLGI  768


 Score = 95.5 bits (236),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 85/148 (57%), Gaps = 26/148 (18%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCV  2157
             VVA+D+D+NS  A+KW VD+LL     +ILLHV   A P   N              +C+
Sbjct  112   VVAIDRDRNSQLAMKWVVDHLLSGASHIILLHV--AAHPPAAN-------------PYCL  156

Query  2156  FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDV  1977
                         +   E  +E+ +V KAI+ YI  +++ ++ LGAS+R+A ++K+   DV
Sbjct  157   -----------QVQESEVILEEADVPKAIIDYITANKIQSIALGASNRNAFTKKWKNPDV  205

Query  1976  PTIVNKTAPDFCSVYVISKGKQQSIRPA  1893
             P+ + K APD+C++YV++KGK  ++R A
Sbjct  206   PSSLMKGAPDYCNIYVVAKGKPVNVRLA  233



>ref|XP_007011461.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Theobroma cacao]
 gb|EOY29080.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Theobroma cacao]
Length=765

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/403 (77%), Positives = 357/403 (89%), Gaps = 0/403 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RLKLELKQTM+MY++ACKEA+TAK+ A+ELQ  K+EE +R ++AR AEEAAL 
Sbjct  315   DVEAEMRRLKLELKQTMEMYSSACKEALTAKQKARELQLWKLEEERRLDEARLAEEAALA  374

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK KAA+EAAE AQ+IAE+EAQ+   AEMKA KE+ EK +AL  L+ SD RYRK
Sbjct  375   IAEKEKAKSKAAIEAAEAAQRIAELEAQKRVNAEMKALKESEEKRKALDALAHSDSRYRK  434

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE ATE FS+ +KIGEGGYGPVY+G+LDHTPVAIKVLRPDAAQGR QFQQEVEVL
Sbjct  435   YTIEEIEAATEFFSEVLKIGEGGYGPVYKGRLDHTPVAIKVLRPDAAQGRSQFQQEVEVL  494

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPEYGCLVYE+M NGSLEDRL R+GNTP + W++RF+I+AEI T L
Sbjct  495   SCIRHPNMVLLLGACPEYGCLVYEFMSNGSLEDRLFRRGNTPPLSWQLRFRIAAEIGTGL  554

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEP+VHRDLKPANILLDRNFVSKISDVGLARLVPPSV D+VTQY MTS AGTF
Sbjct  555   LFLHQTKPEPIVHRDLKPANILLDRNFVSKISDVGLARLVPPSVTDNVTQYRMTSTAGTF  614

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG+MLLQIITAKPPMGLTHHVERAIEKG F  +LDP I 
Sbjct  615   CYIDPEYQQTGMLGIKSDIYSLGIMLLQIITAKPPMGLTHHVERAIEKGNFEQMLDPVIP  674

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             DWPVEEA+ FA ++L+CAELR+KDRPDLG V+LPELNRL+ LA
Sbjct  675   DWPVEEAMGFANIALKCAELRRKDRPDLGKVVLPELNRLRALA  717


 Score =   117 bits (293),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 94/153 (61%), Gaps = 9/153 (6%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGH  2163
             +  VA+DKDKNS +A+KW +D+LL     V+L+HV+ K      +  P     +      
Sbjct  17    LVAVAIDKDKNSQNALKWAIDHLLQKGHTVVLIHVKVKPFSLSTSPLPTPRTEL------  70

Query  2162  CVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTH  1983
               F PFR +  R+ I  K+  +E+T+VAKA++ Y+    +  +V+GAS+++   R F   
Sbjct  71    --FLPFRCFCTRKDIHCKDVVLEETDVAKALIEYVTQAAIEVLVVGASTKTGFLR-FKAA  127

Query  1982  DVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             D+P +V+K APDFCSVYVISKGK  S+R ++RP
Sbjct  128   DIPGMVSKGAPDFCSVYVISKGKISSMRSSSRP  160



>ref|XP_010325202.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Solanum lycopersicum]
Length=689

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/670 (53%), Positives = 450/670 (67%), Gaps = 63/670 (9%)
 Frame = -3

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F PFR +  R+ I   +  +ED +V KAIV YIN   +  ++LGA+++  + R F   D
Sbjct  11    LFLPFRVFCTRKDIQCHDVVLEDADVVKAIVEYINRTAIEVLILGAAAKGGLLR-FKLKD  69

Query  1979  VPTIVNKTAPDFCSVYVISK-GKQQSIRPAAR--PLTNLPTHIWshhgsssras------  1827
             +P  V K APDFC+VYVISK GK  S R AAR  P  +   H ++ +G+    S      
Sbjct  70    IPGNVLKGAPDFCTVYVISKSGKISSTRSAARLAPFVHPLRHQFTQNGNVKSNSFEDFNV  129

Query  1826  -------------srgssaasssAGDDRISACSSRGEHSGRPFRRSEDRDADGSVRRPWN  1686
                          S    +   S   +  S  + R   +G+P+  S+  D D S    + 
Sbjct  130   PPRGSISGIPKPVSDMPMSNLHSDTFNMKSPFTHRKGPNGKPYEISQP-DTDIS----FV  184

Query  1685  SSCRNSLAEDNDLFAPISDGFDNAAAAQNL----DFTRisdagsdassiaSKDLESEMKR  1518
             SS R S+   +++F   +D FD+      L    D+   S         +   + SEM  
Sbjct  185   SSGRPSI---DNMFPSFADSFDSGTTPPRLSGFSDYEGQSFEPMPMGRRSLDIMPSEMSL  241

Query  1517  LKLE-----------------------LKQTMDMYNNACKEAITAKKSAKELQQMKIees  1407
             L +E                       LKQTM+MY+ ACKEA+TA++ A ELQ+ K EE 
Sbjct  242   LSMEGDRPSFSSTPDDVAAEMRRLKLELKQTMEMYSTACKEALTAQQKATELQRWKAEEQ  301

Query  1406  qrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKN  1227
             +R E+AR AEEAAL + E EKAK +AA+E AE AQ++AE+E+Q+   AEMKA KE  E+N
Sbjct  302   RRIEEARFAEEAALALAEKEKAKSRAALEHAEAAQRLAELESQKRINAEMKALKEAEERN  361

Query  1226  RALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPD  1047
             + L+ LS SD RYR+YSI+EIE AT  F++S KIGEGGYGPVY+  +DHT VA+KVLRPD
Sbjct  362   KVLNKLSNSDVRYRRYSIEEIESATNYFAESNKIGEGGYGPVYKCYMDHTHVAVKVLRPD  421

Query  1046  AAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIP  867
             AA GR+QFQQEVEVLS +RHPNMVLLLGACPEYGCL+YE+M NGSLEDRL +KGN+PA+ 
Sbjct  422   AAHGRQQFQQEVEVLSCIRHPNMVLLLGACPEYGCLIYEFMSNGSLEDRLFQKGNSPALS  481

Query  866   WEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVA  687
             W+ RF+I+AEI   LLFLHQSKPEP+VHRDLKPANILLDRNFVSKISDVGLARLVPPSVA
Sbjct  482   WQHRFRIAAEIGAGLLFLHQSKPEPIVHRDLKPANILLDRNFVSKISDVGLARLVPPSVA  541

Query  686   DDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERA  507
             D VTQY MTS AGTFCYIDPEYQQTG LG KSD+YSLG++ LQI+TAKPPMGLTHHVERA
Sbjct  542   DTVTQYRMTSTAGTFCYIDPEYQQTGMLGIKSDVYSLGIIFLQILTAKPPMGLTHHVERA  601

Query  506   IEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQ  327
             I+KGTF D+LD ++ DWP ++AL  AKLSL+C+ELR+KDRPDL  VI+PEL RL+     
Sbjct  602   IDKGTFNDMLDSSVPDWPRDDALSLAKLSLKCSELRRKDRPDLSKVIMPELERLR-----  656

Query  326   SLASKNGTQT  297
             +L  +N  QT
Sbjct  657   TLGEENPCQT  666



>ref|XP_009354312.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
Length=752

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/493 (68%), Positives = 386/493 (78%), Gaps = 24/493 (5%)
 Frame = -3

Query  1787  DRISACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPIS----DGFD  1620
             DR+S     G  SG   R S   D D   R   +S  R+   +   L   +S    DG  
Sbjct  229   DRMSPRCDFGVESGMNSRLSIGSDGDN--RSSTSSYSRHKFLDMGSLQYEMSSCSTDGGK  286

Query  1619  NAAAAQNLDFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSA  1440
             + +++QN+D                 D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK   
Sbjct  287   SWSSSQNMD-----------------DVEAEMRRLKLELKQTMEMYSTACKEALTAKDKE  329

Query  1439  KELQQMKIeesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyae  1260
             KE+ + K+E+ QR E AR AEEAAL +VE EKAKCKAA+EAA+ AQ+IAE+EAQ+ K AE
Sbjct  330   KEINRWKLEDEQRLEVARHAEEAALALVEREKAKCKAAIEAAKAAQRIAELEAQKRKVAE  389

Query  1259  mkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDH  1080
             MKA KE+ EKN+AL   S  D RYRKY+I+EIE AT  FS++ KIGEGGYGPVYRG+LDH
Sbjct  390   MKAHKESEEKNKALQARS-YDPRYRKYTIEEIESATNDFSQARKIGEGGYGPVYRGELDH  448

Query  1079  TPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDR  900
             T VAIKVLRPDAAQG+ QF+QEVEVLS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDR
Sbjct  449   TRVAIKVLRPDAAQGQSQFKQEVEVLSSIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDR  508

Query  899   LLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDV  720
             L  +GNTP IPW+IRF+I+AEI T LLF HQ+KPEPLVHRDLKP NILLD N+VSKISDV
Sbjct  509   LFCRGNTPVIPWQIRFRIAAEIGTGLLFFHQAKPEPLVHRDLKPGNILLDHNYVSKISDV  568

Query  719   GLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKP  540
             GLARLVPPSVA+ VTQYHMTS AGTFCYIDPEYQQTG LGTKSDIYSLGVMLLQ+ITAKP
Sbjct  569   GLARLVPPSVANSVTQYHMTSTAGTFCYIDPEYQQTGMLGTKSDIYSLGVMLLQLITAKP  628

Query  539   PMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILP  360
             PMGLTHHVERAIE GTFA++LDP + DWPVEEAL FAKL LQCAE+R+KDRPDLG V+LP
Sbjct  629   PMGLTHHVERAIETGTFAEILDPAVPDWPVEEALKFAKLCLQCAEMRRKDRPDLGKVVLP  688

Query  359   ELNRLKELALQSL  321
             ELNRLK LA +S 
Sbjct  689   ELNRLKALADESF  701


 Score =   107 bits (267),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 82/149 (55%), Gaps = 15/149 (10%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHC  2160
               VA+DKDK S  A+KW VD+LL     + LLHV    S   Q  G              
Sbjct  16    VAVAIDKDKGSEHAIKWAVDHLLTRGQPLTLLHVNQTGSDPQQTQG--------------  61

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F  FR+  +++ I   E  I+DT++  AI+ Y+  + V  +VLGA S+S + R F   D
Sbjct  62    LFLSFRSLCSKKNIKCNEVVIKDTDIPNAIIDYVTANTVEILVLGAPSKSGLFR-FKLTD  120

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPA  1893
             VP+ V+K APDFCSVYVI KGK   +R A
Sbjct  121   VPSTVSKGAPDFCSVYVIGKGKVSYMRCA  149



>gb|KDP33410.1| hypothetical protein JCGZ_06981 [Jatropha curcas]
Length=771

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/446 (71%), Positives = 372/446 (83%), Gaps = 13/446 (3%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK+ A+ELQ  K+EE +R E+AR AEEAAL
Sbjct  323   EDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKARELQIWKMEEERRLEEARLAEEAAL  382

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKAK +AA+EAAE +Q+IAE+EAQ+   AEMKA KE  EK +AL  L+ SD RYR
Sbjct  383   AIAEREKAKSRAAIEAAEASQRIAEIEAQKRVSAEMKALKEAEEKRKALDALANSDIRYR  442

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE ATE F++S KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVEV
Sbjct  443   KYTIEEIEAATEFFAESRKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQEVEV  502

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL R+GNTP + W++RF+I+AEI T 
Sbjct  503   LSCIRHPNMVLLLGACPEYGCLVYEYMGNGSLEDRLFRRGNTPVLSWQLRFRIAAEIGTG  562

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQSKPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY MTS AGT
Sbjct  563   LLFLHQSKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRMTSTAGT  622

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSDIYSLG+M LQI+TAKPPMGLTHHVER++EK  FA +LDP +
Sbjct  623   FCYIDPEYQQTGMLGIKSDIYSLGIMFLQILTAKPPMGLTHHVERSLEKDAFAQMLDPAV  682

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQTFGRH  285
              DWP+EEA +FAKL+L+CAELR+KDRPDLG V+LPELNRL+ LA +++     T + G  
Sbjct  683   PDWPIEEAKNFAKLALKCAELRRKDRPDLGKVVLPELNRLRALAEETMHLAMPTASPG--  740

Query  284   YC*IKSIFFFNHPKSPSRITLQRCEA  207
                        H  SPS++++Q  +A
Sbjct  741   -----------HSPSPSQVSVQLSDA  755


 Score =   104 bits (259),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 89/166 (54%), Gaps = 22/166 (13%)
 Frame = -3

Query  2363  DGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGG  2184
             +G   G +  VA+DKDKNS +A+KW +D++L     VIL+HV+ K+S    N   D +G 
Sbjct  12    EGTGNG-LVAVAIDKDKNSQNALKWAIDHILQRGTSVILIHVKIKSSSMRGNQIADPNGD  70

Query  2183  M------SDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
                     D     +F PFR +  R+ +              +I+ Y     +  +VLGA
Sbjct  71    CILVCKNPDPQTKDLFLPFRCFCTRKDV--------------SIIEYTTHTAIETLVLGA  116

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             S+++   R F   DVP  V K APDF +VYVISKGK QS RPA+RP
Sbjct  117   SNKTGFLR-FKITDVPGTVLKGAPDFTTVYVISKGKIQSTRPASRP  161



>ref|XP_010263442.1| PREDICTED: U-box domain-containing protein 35-like [Nelumbo nucifera]
Length=793

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/410 (76%), Positives = 363/410 (89%), Gaps = 0/410 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTMDMY+ ACKEA+TAK+ A+EL + K+EE QR E+AR AEEAAL
Sbjct  332   EDVEAEMRRLKLELKQTMDMYSTACKEALTAKQKARELHRWKMEEEQRLEEARMAEEAAL  391

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKAKCKAA+EAAE AQ+IAE+EAQ+   AEMKA KET E+ + +  +S+ D RYR
Sbjct  392   AIAEREKAKCKAAIEAAEAAQRIAELEAQKRINAEMKALKETEERKKVVESMSQGDIRYR  451

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE ATE F+++ KIGEGGYGPVY+  LDHT VAIKVLRPDAAQGR QFQQEVE+
Sbjct  452   KYTIEEIEAATEYFAENRKIGEGGYGPVYKSYLDHTAVAIKVLRPDAAQGRSQFQQEVEI  511

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL RKGNTP + W++RF+I+AEIAT 
Sbjct  512   LSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRKGNTPVLSWQVRFRIAAEIATG  571

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPP++AD+VTQY MTS AGT
Sbjct  572   LLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPNIADNVTQYRMTSTAGT  631

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTF ++LDP +
Sbjct  632   FCYIDPEYQQTGMLGIKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFTEMLDPAV  691

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
              DWPVEEAL FAKLSL+CAELR+KDRPDLG+ +LPELNRL+ LA +++ S
Sbjct  692   PDWPVEEALIFAKLSLRCAELRRKDRPDLGTEVLPELNRLRNLAEENMPS  741


 Score =   135 bits (340),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 101/165 (61%), Gaps = 12/165 (7%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS--PNHQNGG----------P  2199
             +  VA+DKDK S  A+KW V+++L     VIL+HV  KAS  PN                
Sbjct  18    LVAVAIDKDKGSQYALKWAVEHILGKGQTVILIHVNQKASSIPNPMGSHVSITDVREDVA  77

Query  2198  DAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
              A+    D     +F PFR +  R+ I  K+  IED++VAKA++ Y+  + + N+V+GAS
Sbjct  78    SAYRREQDSQTKELFLPFRCFCTRKDIQCKDVVIEDSDVAKALIEYVTNYSIENLVVGAS  137

Query  2018  SRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             SR++  R+F + DVPT V+K APDFC+VYVISKGK  S+R A+RP
Sbjct  138   SRNSFLRRFRSADVPTSVSKGAPDFCTVYVISKGKISSVRSASRP  182



>ref|XP_009353332.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
Length=776

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/408 (75%), Positives = 358/408 (88%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTM+MY+ ACKEA++AK+ A ELQ+ K+EE +R E+AR AEE A+
Sbjct  335   EDMEAEMRRLKLELKQTMEMYSTACKEALSAKQKAVELQRWKLEEERRLEEARLAEETAM  394

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              +VE E+AK +AA+EAAE A++IAE+EAQ+   AEMKA KE  EK +ALS L +SD RYR
Sbjct  395   AIVEKERAKSRAAIEAAEAAKRIAELEAQKRINAEMKALKEHEEKKKALSALQQSDVRYR  454

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KYSI+EIE ATE F++S KIGEGGYGPVYR  LDHTPVAIKVLRPDAAQGR QF QEVEV
Sbjct  455   KYSIEEIEAATEFFTESRKIGEGGYGPVYRCNLDHTPVAIKVLRPDAAQGRSQFNQEVEV  514

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRLLR+GN+P + W++RFKI+AEI T 
Sbjct  515   LSSIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNSPILSWQLRFKIAAEIGTG  574

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY MTS AGT
Sbjct  575   LLFLHQAKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADTVTQYRMTSTAGT  634

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLG+M LQ+ITAKP MGLTHHVERAIEKGTF D+LDP++
Sbjct  635   FCYIDPEYQQTGMLGVKSDVYSLGIMFLQMITAKPAMGLTHHVERAIEKGTFEDMLDPSV  694

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWPV++ L FAKL+LQCAELR+KDRPDL  VILPELNRL+ +A +++
Sbjct  695   PDWPVQDTLKFAKLALQCAELRRKDRPDLRKVILPELNRLRGIAEETM  742


 Score =   111 bits (277),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 96/166 (58%), Gaps = 14/166 (8%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQ-----NGGP------D  2196
             I  VA+D+DKNS  A+KW +D+L+     V+L+HV+ K S   Q     N  P      D
Sbjct  17    IVAVAIDRDKNSQCALKWAIDSLIKPGQSVLLIHVKVKHSIISQSHSLSNSTPRSNPNWD  76

Query  2195  AHGGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
                   D D     +F PFR +  R+ I  ++  +ED++V KA+V Y+    + ++V+GA
Sbjct  77    QQLVCKDPDPQTRELFLPFRVFCTRKNIQCRDLVLEDSDVTKALVEYVTQTAIEHLVVGA  136

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             S+++   R F   D+P  ++K APDFC+VYV+SK K QS R A+RP
Sbjct  137   SAKTGFLR-FKASDIPGNLSKAAPDFCNVYVVSKQKLQSRRAASRP  181



>ref|XP_006483740.1| PREDICTED: U-box domain-containing protein 52-like [Citrus sinensis]
Length=802

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/407 (75%), Positives = 358/407 (88%), Gaps = 0/407 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RL+LELKQTM+MY+ ACKEA+TAK+ A ELQ+ K+EE QR E+AR AEEAA+ 
Sbjct  346   DVEAEMRRLRLELKQTMEMYSTACKEALTAKQKATELQRWKLEEQQRLEEARLAEEAAMA  405

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EK K +AA+EAAE AQ+IAE+E+Q+   AEMKA KE  EK +AL  L+ SD RYRK
Sbjct  406   IAEKEKVKSRAAIEAAEAAQRIAELESQKRISAEMKALKEAEEKKKALDALANSDVRYRK  465

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE ATE F+ + KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVE+L
Sbjct  466   YSIEEIEAATEFFTDTRKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQEVEIL  525

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPEYGCLVYE+M NGSLEDRL+R+G +P + W++RFKI+AEI TAL
Sbjct  526   SCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLMRRGQSPPLSWQLRFKIAAEIGTAL  585

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD+VTQY MTS AGTF
Sbjct  586   LFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADNVTQYRMTSTAGTF  645

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSD+YSLG+M LQIIT KPPMGLTHHVERAIEKGTF ++LDPT+ 
Sbjct  646   CYIDPEYQQTGMLGIKSDVYSLGIMFLQIITGKPPMGLTHHVERAIEKGTFEEMLDPTVP  705

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             DWPVE+AL FA+L+L+CAELR+KDRPDLG V+LPELNRL+ LA +++
Sbjct  706   DWPVEDALSFAQLALKCAELRRKDRPDLGKVVLPELNRLRALAEETV  752


 Score =   125 bits (314),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 105/186 (56%), Gaps = 15/186 (8%)
 Frame = -3

Query  2396  MDHHHHPTISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPN  2217
             M  H + +     A +  +T VA+D+DK S +A+KW +DN+L     ++L+HV+ +++  
Sbjct  1     MWMHRNNSGEKKEAKSCGLTAVAIDRDKGSQNAIKWAIDNILTKGQTLVLIHVKIRSASL  60

Query  2216  ---------HQNGGPDAHGGMS------DHDGHCVFTPFRAYSARRGIIMKEDFIEDTEV  2082
                        N   D  G  S      D     +F PFR +  R+ I  K+  +EDT+V
Sbjct  61    SPSPSLISPRMNQICDVSGDGSLVCKDPDPQTREIFLPFRCFCTRKDIQCKDVVLEDTDV  120

Query  2081  AKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSI  1902
             AKA++ Y++   +  +V+GAS+     R+F T DVP  V+K APDFC+VYVISKGK  S+
Sbjct  121   AKALIEYVSQTAIETLVVGASNNKGFLRRFKTTDVPGNVSKGAPDFCTVYVISKGKISSM  180

Query  1901  RPAARP  1884
             R A+RP
Sbjct  181   RSASRP  186



>ref|XP_006360651.1| PREDICTED: U-box domain-containing protein 35-like [Solanum tuberosum]
Length=794

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/408 (75%), Positives = 360/408 (88%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLK ELKQTMDMY++ACKEA++AK  A EL + K+EE Q+ E+AR AEEAAL
Sbjct  341   EDIEAEMRRLKQELKQTMDMYSSACKEALSAKHKAMELHRWKVEEEQKLEEARLAEEAAL  400

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKAKC+AA+EAAE+AQ+IAE EAQR   AE KA KE+ EK + L  L++SDCRYR
Sbjct  401   AVAEKEKAKCRAALEAAEEAQRIAEREAQRRISAERKALKESEEKKKVLDALAQSDCRYR  460

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE AT+ F+ + KIGEGGYGPVY+  LDHT VAIKVLRPDAAQGR QFQQEVEV
Sbjct  461   KYTIEEIETATDNFAATRKIGEGGYGPVYKCYLDHTQVAIKVLRPDAAQGRSQFQQEVEV  520

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPE+GCLVYEYM NGSL+DRL R+G+T  +PW++RF+I+AE+ T+
Sbjct  521   LSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDRLFRRGSTQVLPWQLRFRIAAEVGTS  580

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPPS+AD VTQY MTS AGT
Sbjct  581   LLFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPSIADSVTQYRMTSTAGT  640

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LGTKSDIYS G+MLLQIITA+PPMGLTHHVER+IEKGTFAD+LDP +
Sbjct  641   FCYIDPEYQQTGMLGTKSDIYSFGIMLLQIITARPPMGLTHHVERSIEKGTFADMLDPAV  700

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWP+EEAL FAKL+L+CAELR+KDRPDLG+VILPELNRL+ LA +++
Sbjct  701   PDWPMEEALTFAKLALKCAELRRKDRPDLGTVILPELNRLRVLAEEAM  748


 Score =   116 bits (291),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 90/154 (58%), Gaps = 5/154 (3%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS---PNH--QNGGPDAHGGMSD  2175
             TVVA+DKDK S  A+KW VD L+     V LLHV+ + S   PN    +G P  +    D
Sbjct  14    TVVAIDKDKGSQYALKWAVDTLIGKGKNVTLLHVKVRPSVSLPNADVSDGTPRVYRSDPD  73

Query  2174  HDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRK  1995
                  +F PFR +  R+ I + E  IE  ++A +I  Y+  + +  +V+GA+SR+    +
Sbjct  74    SQAKELFLPFRCFCNRKNIQVNEVVIEGIDIATSISDYVTANVIEILVVGAASRNGFVSR  133

Query  1994  FWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPA  1893
             F T DVPT V+K  P FC+VYVI+KGK QS + A
Sbjct  134   FKTMDVPTAVSKVIPGFCTVYVIAKGKVQSTKNA  167



>ref|XP_008219968.1| PREDICTED: U-box domain-containing protein 52 [Prunus mume]
Length=773

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/408 (75%), Positives = 358/408 (88%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK+ A ELQ+ K+EE +R E+A  AEEAA+
Sbjct  333   EDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAVELQRWKLEEERRLEEAHLAEEAAM  392

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              +VE E+AK +AA+EAAE A++IAE+EAQ+   AEMKA KE+ EK +AL+ L  SD RYR
Sbjct  393   AIVEKERAKSRAAIEAAEAAKRIAELEAQKRINAEMKALKESEEKRKALNALQHSDVRYR  452

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+IDEIE ATE F++S KIGEGGYGPVYR  LDHTPVAIKVLRPDAAQGR QF QEVEV
Sbjct  453   KYTIDEIEAATEFFAESRKIGEGGYGPVYRCYLDHTPVAIKVLRPDAAQGRSQFNQEVEV  512

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRLLR+GN+P + W++RF+I+AEI T 
Sbjct  513   LSSIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNSPPLSWQLRFRIAAEIGTG  572

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKP NIL+DRNFVSKISDVGLARLVPP+VAD+VTQY MTS AGT
Sbjct  573   LLFLHQAKPEPLVHRDLKPGNILIDRNFVSKISDVGLARLVPPAVADNVTQYRMTSTAGT  632

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLG+M LQ+ITAKP MGLTHHVERAIEKGTF D+LDP +
Sbjct  633   FCYIDPEYQQTGMLGVKSDVYSLGIMFLQMITAKPAMGLTHHVERAIEKGTFKDMLDPCV  692

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWPVEEA+ FAKL+LQC+ELR+KDRPDLG VILPELNRLK +A  ++
Sbjct  693   PDWPVEEAMKFAKLALQCSELRRKDRPDLGKVILPELNRLKGIAEDTM  740


 Score =   121 bits (303),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 101/168 (60%), Gaps = 12/168 (7%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHK-----ASPN----HQNGGPDAH  2190
             I  +A+DKDKNS SA+KW +D+L+     V+L+HV+ K      SP+      N   D H
Sbjct  17    IVALAIDKDKNSQSALKWCIDSLVKQGQTVLLIHVKIKPPVFSQSPSLSNPRSNPNWDQH  76

Query  2189  GGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASS  2016
                 D D     +F PFR Y  R+ I  K+  +ED++VAKA+  Y+    + ++V+GAS+
Sbjct  77    LVCKDPDPQTKELFLPFRVYCTRKNIQCKDIVLEDSDVAKALNEYVTQSAIEHLVVGASA  136

Query  2015  RSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL  1872
             ++   R F   DVP  V+K APDFC+VYV+SKGK QS R A+RP  ++
Sbjct  137   KTGFLR-FKISDVPGNVSKGAPDFCNVYVVSKGKLQSRRSASRPAPSI  183



>ref|XP_009353318.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
Length=776

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/408 (75%), Positives = 358/408 (88%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTM+MY+ ACKEA++AK+ A ELQ+ K+EE +R E+AR AEE A+
Sbjct  335   EDMEAEMRRLKLELKQTMEMYSTACKEALSAKQKAVELQRWKLEEERRLEEARLAEETAM  394

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              +VE E+AK +AA+EAAE A++IAE+EAQ+   AEMKA KE  EK +ALS L +SD RYR
Sbjct  395   AIVEKERAKSRAAIEAAEAAKRIAELEAQKRINAEMKALKEHEEKKKALSALQQSDVRYR  454

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KYSI+EIE ATE F++S KIGEGGYGPVYR  LDHTPVAIKVLRPDAAQGR QF QEVEV
Sbjct  455   KYSIEEIEAATEFFTESRKIGEGGYGPVYRCNLDHTPVAIKVLRPDAAQGRSQFNQEVEV  514

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRLLR+GN+P + W++RFKI+AEI T 
Sbjct  515   LSSIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNSPILSWKLRFKIAAEIGTG  574

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY MTS AGT
Sbjct  575   LLFLHQAKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADTVTQYRMTSTAGT  634

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLG+M LQ+ITAKP MGLTHHVERAIEKGTF D+LDP++
Sbjct  635   FCYIDPEYQQTGMLGVKSDVYSLGIMFLQMITAKPAMGLTHHVERAIEKGTFEDMLDPSV  694

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWPV++ L FAKL+LQCAELR+KDRPDL  VILPELNRL+ +A +++
Sbjct  695   PDWPVQDTLKFAKLALQCAELRRKDRPDLRKVILPELNRLRGIAEETM  742


 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 96/166 (58%), Gaps = 14/166 (8%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQ-----NGGP------D  2196
             I  VA+D+DKNS  A+KW +D+L+     V+L+HV+ K S   Q     N  P      D
Sbjct  17    IVAVAIDRDKNSQCALKWAIDSLIKPGQSVLLIHVKVKHSIISQSHSLSNSTPRSNPNWD  76

Query  2195  AHGGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
                   D D     +F PFR +  R+ I  ++  +ED++V KA+V Y+    + ++V+GA
Sbjct  77    QQLVCKDPDPQTRELFLPFRVFCTRKNIQCRDLVLEDSDVTKALVEYVTQTAIEHLVVGA  136

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             S+++   R F   D+P  ++K APDFC+VYV+SK K QS R A+RP
Sbjct  137   SAKTGFLR-FKASDIPGNLSKAAPDFCNVYVVSKQKLQSRRAASRP  181



>ref|XP_008357473.1| PREDICTED: U-box domain-containing protein 35-like [Malus domestica]
Length=778

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/408 (75%), Positives = 357/408 (88%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTM+MY+ ACKEA++AK+ A ELQ+ K+EE +R E+AR AEE A+
Sbjct  335   EDMEAEMRRLKLELKQTMEMYSTACKEALSAKQKAVELQRWKLEEERRLEEARLAEETAM  394

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              +VE E+AK +AA+EAAE A++IAE+EAQ+   AEMKA  E  EK +ALS L +SD RYR
Sbjct  395   AIVEKERAKSRAAIEAAEAAKRIAELEAQKRINAEMKALXEHEEKKKALSALQQSDVRYR  454

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KYSI+EIE ATE F++S KIGEGGYGPVYR  LDHTPVAIKVLRPDAAQGR QF QEVEV
Sbjct  455   KYSIEEIEAATEFFTESRKIGEGGYGPVYRCXLDHTPVAIKVLRPDAAQGRSQFNQEVEV  514

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRLLR+GN+P + W++RFKI+AEI T 
Sbjct  515   LSSIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNSPILSWQLRFKIAAEIGTG  574

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY MTS AGT
Sbjct  575   LLFLHQAKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADTVTQYRMTSTAGT  634

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLG+M LQ+ITAKP MGLTHHVERAIEKGTF D+LDP++
Sbjct  635   FCYIDPEYQQTGMLGVKSDVYSLGIMFLQMITAKPAMGLTHHVERAIEKGTFEDMLDPSV  694

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWPV++ L FAKL+LQCAELR+KDRPDL  VILPELNRL+ +A +++
Sbjct  695   PDWPVQDTLKFAKLALQCAELRRKDRPDLRKVILPELNRLRGIAEETM  742


 Score =   112 bits (279),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 96/166 (58%), Gaps = 14/166 (8%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQ-----NGGP------D  2196
             I  VA+D+DKNS  A+KW +D+L+     V+L+HV+ K S   Q     N  P      D
Sbjct  17    IVAVAIDRDKNSQCALKWAIDSLIKPGQSVLLIHVKVKHSIISQSHSLSNSTPRSNPNWD  76

Query  2195  AHGGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
                   D D     +F PFR +  R+ I  ++  +ED++V KA+V Y+    + ++V+GA
Sbjct  77    QQLVCKDPDPQTRELFLPFRVFCTRKNIQCRDLVLEDSDVTKALVEYVTQTAIEHLVVGA  136

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             S+++   R F   D+P  ++K APDFC+VYV+SK K QS R A+RP
Sbjct  137   SAKTGFLR-FKASDIPGNISKXAPDFCNVYVVSKQKLQSRRAASRP  181



>gb|EYU25756.1| hypothetical protein MIMGU_mgv1a001768mg [Erythranthe guttata]
Length=761

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/409 (74%), Positives = 353/409 (86%), Gaps = 0/409 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RLK ELKQTMDMY+ AC+EA+TAK+ A EL + K+EE QR E+AR AEEAAL 
Sbjct  341   DVEAEMRRLKQELKQTMDMYSTACREALTAKQKALELHRWKVEEQQRLEEARLAEEAALA  400

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EK KC+ A+E AE AQK+AE+EAQ+   AE KA KE  EK + L  L+++D RYRK
Sbjct  401   IAEKEKEKCRVAIEKAEAAQKVAELEAQKRISAERKALKEAEEKKKVLDKLAQTDLRYRK  460

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE ATE F++S KIGEGGYGPVY+  LDHT VA+KVLRPDAAQGR QFQQEVEVL
Sbjct  461   YSIEEIETATEYFTESRKIGEGGYGPVYKCNLDHTQVAVKVLRPDAAQGRSQFQQEVEVL  520

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPEYGCLVYEYM NGSL+DRL R+GNTP +PW++RF+I+AEI T L
Sbjct  521   SCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDRLFRRGNTPVLPWQLRFRIAAEIGTGL  580

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKP NILLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGTF
Sbjct  581   LFLHQTKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTF  640

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSD+YSLGVMLLQIITAK PMGLTHHVER+IEKGTFA++LDP ++
Sbjct  641   CYIDPEYQQTGMLGIKSDVYSLGVMLLQIITAKSPMGLTHHVERSIEKGTFAEMLDPEVT  700

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
             DWPVEEAL FAK++L+C ELR+KDRPDLG  +LPELNRL+ LA +++ S
Sbjct  701   DWPVEEALVFAKMALKCTELRRKDRPDLGLTVLPELNRLRALAEETMPS  749


 Score =   123 bits (309),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 98/169 (58%), Gaps = 12/169 (7%)
 Frame = -3

Query  2363  DGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGG  2184
             +G     +  VA+DKDK S +A+KW VD+LL     V LLHV+ + S    +    +H  
Sbjct  7     NGEKKQDMVAVAIDKDKGSQAALKWAVDHLLGKGKTVALLHVKQRTS----SAPLGSHVA  62

Query  2183  MSDHDGHC-------VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLG  2025
              SD+DG         +F PFR +  R+ I + E  IEDT++A+AI  Y+  + +  +V+G
Sbjct  63    FSDNDGKVAADQFKELFLPFRCFCTRKDIQVNEVVIEDTDIARAICDYVKNNTIETLVVG  122

Query  2024  ASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLT  1878
             ++ ++   R F T DVP  V K APDFC+VYVISKGK  ++R A   L+
Sbjct  123   STVKNGFVR-FKTVDVPGSVTKGAPDFCTVYVISKGKVSTVRSAVSSLS  170



>ref|XP_008378145.1| PREDICTED: U-box domain-containing protein 35 [Malus domestica]
Length=776

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/408 (75%), Positives = 357/408 (88%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTM+MY+ ACKEA++AK+ A ELQ+ K+EE +R E+AR AEE A+
Sbjct  335   EDMEAEMRRLKLELKQTMEMYSTACKEALSAKQKAVELQRWKLEEERRLEEARLAEETAM  394

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              +VE E+AK +AA+EAAE A++IAE+EAQ+   AEMKA  E  EK +ALS L +SD RYR
Sbjct  395   AIVEKERAKSRAAIEAAEAAKRIAELEAQKRINAEMKALXEHEEKKKALSALQQSDVRYR  454

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KYSI+EIE ATE F++S KIGEGGYGPVYR  LDHTPVAIKVLRPDAAQGR QF QEVEV
Sbjct  455   KYSIEEIEAATEFFTESRKIGEGGYGPVYRCXLDHTPVAIKVLRPDAAQGRSQFNQEVEV  514

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRLLR+GN+P + W++RFKI+AEI T 
Sbjct  515   LSSIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNSPILSWQLRFKIAAEIGTG  574

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY MTS AGT
Sbjct  575   LLFLHQAKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADTVTQYRMTSTAGT  634

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLG+M LQ+ITAKP MGLTHHVERAIEKGTF D+LDP++
Sbjct  635   FCYIDPEYQQTGMLGVKSDVYSLGIMFLQMITAKPAMGLTHHVERAIEKGTFEDMLDPSV  694

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWPV++ L FAKL+LQCAELR+KDRPDL  VILPELNRL+ +A +++
Sbjct  695   PDWPVQDTLKFAKLALQCAELRRKDRPDLRKVILPELNRLRGIAEETM  742


 Score =   112 bits (279),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 96/166 (58%), Gaps = 14/166 (8%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQ-----NGGP------D  2196
             I  VA+D+DKNS  A+KW +D+L+     V+L+HV+ K S   Q     N  P      D
Sbjct  17    IVAVAIDRDKNSQCALKWAIDSLIKPGQSVLLIHVKVKHSIISQSHSLSNSTPRSNPNWD  76

Query  2195  AHGGMSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
                   D D     +F PFR +  R+ I  ++  +ED++V KA+V Y+    + ++V+GA
Sbjct  77    QQLVCKDPDPQTRELFLPFRVFCTRKNIQCRDLVLEDSDVTKALVEYVTQTAIEHLVVGA  136

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             S+++   R F   D+P  ++K APDFC+VYV+SK K QS R A+RP
Sbjct  137   SAKTGFLR-FKASDIPGNISKXAPDFCNVYVVSKQKLQSRRAASRP  181



>ref|XP_010321639.1| PREDICTED: U-box domain-containing protein 35-like [Solanum lycopersicum]
Length=826

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/408 (75%), Positives = 359/408 (88%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLK ELKQTMDMY++ACKEA++AK  A EL + K+EE Q+ E+AR AEEAAL
Sbjct  390   EDIEAEMRRLKQELKQTMDMYSSACKEALSAKHKAMELHRWKVEEEQKLEEARLAEEAAL  449

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKAKC+AA+EAAE+AQ+IAE EAQR   AE KA KE+ EK + L  L++SDCRYR
Sbjct  450   AVAEKEKAKCRAALEAAEEAQRIAEREAQRRISAERKALKESEEKKKVLDALAQSDCRYR  509

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE AT+ F+   KIGEGGYGPVY+  LDHT VAIKVLRPDAAQGR QFQQEVEV
Sbjct  510   KYTIEEIETATDNFAAIRKIGEGGYGPVYKCYLDHTQVAIKVLRPDAAQGRSQFQQEVEV  569

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPE+GCLVYEYM NGSL+DRL R+G+T  +PW++RF+I+AE+ T+
Sbjct  570   LSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDRLFRRGSTQVLPWQLRFRIAAEVGTS  629

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPPS+AD VTQY MTS AGT
Sbjct  630   LLFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPSIADSVTQYRMTSTAGT  689

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LGTKSDIYS G+MLLQIITA+PPMGLTHHVERAIEKGTFAD+LDP +
Sbjct  690   FCYIDPEYQQTGMLGTKSDIYSFGIMLLQIITARPPMGLTHHVERAIEKGTFADMLDPAV  749

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWPVEEAL FAKL+L+CAELR+KDRPDLG+VILPELNRL+ LA +++
Sbjct  750   PDWPVEEALTFAKLALKCAELRRKDRPDLGTVILPELNRLRLLAEEAM  797


 Score =   112 bits (281),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 91/172 (53%), Gaps = 23/172 (13%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS---PNH---------------  2214
             TVVA+DKDK S  A+KW VD L+     V LLHV+ + S   PN                
Sbjct  14    TVVAIDKDKGSQYALKWAVDTLIGRGKNVTLLHVKVRPSVSLPNAGSFFSKLHIYYLNNV  73

Query  2213  -----QNGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTH  2049
                   +G P  +    D     +F PFR +  R+ I + E  IE  ++A +I  Y+  +
Sbjct  74    SFSDVSDGTPRVYRSDPDSQAKELFLPFRCFCTRKNIQVNEVVIEGIDIATSISDYVTAN  133

Query  2048  RVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPA  1893
              + N+V+GA+SR+    +F   DVPT V+K  PDFC+V+VI+KGK QS + A
Sbjct  134   VIENLVVGAASRNGFVSRFKMTDVPTAVSKIVPDFCTVFVIAKGKIQSTKNA  185



>ref|XP_008466286.1| PREDICTED: U-box domain-containing protein 52 isoform X2 [Cucumis 
melo]
Length=720

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/405 (76%), Positives = 354/405 (87%), Gaps = 1/405 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK+ A ELQ+ K+EE QR E+AR A EAAL
Sbjct  271   EDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAVELQRWKLEEEQRLEEARLAGEAAL  330

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSD-CRY  1188
              + E EKAK KAA+EAAE A++IAE+EAQ+   AEMKA KE  EK +A   L+++D  RY
Sbjct  331   ALAEQEKAKSKAAVEAAEAARRIAELEAQKRMKAEMKALKEAEEKKKAFDALAQTDNIRY  390

Query  1187  RKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVE  1008
             RKY+I+EIE ATE FS+S +IGEGGYGPVY+  LDHTPVAIKVLRPDA QGR QF+QEVE
Sbjct  391   RKYTIEEIEAATEFFSESRRIGEGGYGPVYKCDLDHTPVAIKVLRPDATQGRSQFKQEVE  450

Query  1007  VLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIAT  828
             VLS +RHPNMVLLLGACPEYGCLVYE+M NGSLEDRLLR+GNTP + W++RFKI+AEI T
Sbjct  451   VLSCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLLRRGNTPPLSWQLRFKIAAEIGT  510

Query  827   ALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAG  648
             ALLFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPS+AD VTQY MTS AG
Sbjct  511   ALLFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSIADSVTQYRMTSTAG  570

Query  647   TFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPT  468
             TFCYIDPEYQQTG LG KSDIYSLG+M LQ+IT++PPMGLTHHVERAIEKG F  +LDP 
Sbjct  571   TFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITSRPPMGLTHHVERAIEKGMFETILDPA  630

Query  467   ISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             I+DWPVEEAL FAKLSL+CAELR+KDRPDLG  ILPELNRL+ +A
Sbjct  631   ITDWPVEEALSFAKLSLKCAELRRKDRPDLGKAILPELNRLRAMA  675


 Score = 96.7 bits (239),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 70/116 (60%), Gaps = 6/116 (5%)
 Frame = -3

Query  2231  KASPNHQNGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINT  2052
             KA P      PD    + D     +F PFR +  R+ I  K+  +EDT+VAKAI+ Y   
Sbjct  3     KALPLGAEMKPDPEASVKD-----LFLPFRCFCTRKDIQCKDVVLEDTDVAKAIIEYAAN  57

Query  2051  HRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
               + N+V+GAS++S   R F   DVP  + K APDFC+V+VISKGK QS+R A+RP
Sbjct  58    TTIENIVVGASAKSGFLR-FKATDVPGSIVKGAPDFCNVFVISKGKIQSMRSASRP  112



>ref|XP_008361051.1| PREDICTED: U-box domain-containing protein 35-like [Malus domestica]
Length=778

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/408 (75%), Positives = 358/408 (88%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +++E+EM+RLKLELKQTM+MY+ ACKEA++AK+ A ELQ+ K+EE +R E+AR AEEAA+
Sbjct  337   EEVEAEMRRLKLELKQTMEMYSTACKEALSAKQKAVELQRWKLEEERRLEEARLAEEAAM  396

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              +VE E+AK +AA+EAAE A++IAE+EAQ+   AEMKA KE  EK +AL  L  SD RYR
Sbjct  397   AIVEKERAKSRAAIEAAEAAKRIAELEAQKRINAEMKALKEQEEKKKALDALQHSDVRYR  456

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             +YSI+EIE ATE F++S KIGEGGYGPVYR  LDHTPVA+KVLRPDAAQGR QF QEVEV
Sbjct  457   RYSIEEIEAATEFFTESRKIGEGGYGPVYRCYLDHTPVAVKVLRPDAAQGRSQFNQEVEV  516

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRLLR+GN+P + W++RFKI+AEI T 
Sbjct  517   LSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNSPPLSWQLRFKIAAEIGTG  576

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY MTS AGT
Sbjct  577   LLFLHQAKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADTVTQYRMTSTAGT  636

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLG+M LQ+ITAKP MGLTHHVERAIEKGTFAD+LDP++
Sbjct  637   FCYIDPEYQQTGMLGVKSDVYSLGIMFLQMITAKPAMGLTHHVERAIEKGTFADMLDPSV  696

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWPVE+ L FAKL+LQCAELR+KDRPDLG VI PELNRL+ +A +++
Sbjct  697   PDWPVEDTLKFAKLALQCAELRRKDRPDLGKVIQPELNRLRGIAEETM  744


 Score =   117 bits (293),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 96/166 (58%), Gaps = 14/166 (8%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHK-----ASPNHQNGGPDAHGGMS  2178
             I  VA+DKDKNS  A+KW +DNL+     V+L+HV+ K      SP+  N  P ++    
Sbjct  17    IVAVAIDKDKNSQCALKWAIDNLIKPGQSVLLIHVKIKPPLFSQSPSLSNSTPRSNPNWD  76

Query  2177  --------DHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
                     D     +  PFR + AR+ I  ++  +ED++V KA+V Y     + ++V+GA
Sbjct  77    QQFVCKEPDSQTRELIRPFRVFCARKNIQCRDIVLEDSDVTKALVEYJTQSSIEHLVVGA  136

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             S+++   R F   D+P  ++K APDFC+VYV++K K QS R A+RP
Sbjct  137   SAKTGFLR-FKASDIPGSISKAAPDFCNVYVVAKQKLQSRRAASRP  181



>ref|XP_008228017.1| PREDICTED: U-box domain-containing protein 34-like [Prunus mume]
Length=798

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/740 (47%), Positives = 466/740 (63%), Gaps = 61/740 (8%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGH  2163
             +  VA+D  K S +A++W  +N++     VILLHV  K+S         +          
Sbjct  24    LVAVAIDNQKGSQNALRWAAENVITRGQTVILLHVVQKSSSTSSCNLSLSLSLSLSLSLS  83

Query  2162  CV-----------FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASS  2016
              V           F  F  Y  R+ I   +  +ED ++AKA+  Y++   + N+VLGA +
Sbjct  84    QVTRRLEKMTKDLFLTFHCYCTRKDINCLDIVLEDADIAKAVTEYVSYAAIENLVLGAPA  143

Query  2015  RSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGK-------------------------Q  1911
             +    R F T  +P+ V+K APDFC+VYVISKGK                         +
Sbjct  144   KHGFIR-FKTSSIPSSVSKGAPDFCTVYVISKGKISSVRNASRAAPYSSPLVNQIDSLNK  202

Query  1910  QSIRPAARPLTN---LPTHIWshhgsssrassrgssaasssAGDDRISACSSRGEHSGRP  1740
             QS +P   P  N   L     S    + +  +           + RIS   S  E S   
Sbjct  203   QSFKPPETPRYNNMYLKAARPSFKPRNLQDEANRLGLTRGGFSNGRISGGFSESE-SDIS  261

Query  1739  FRRSEDRDAD--GSVRRPWNSSCRNSLAEDNDL----------FAPISDGFDNAAAAQNL  1596
             F  SE    D   SV   +  + R  L+  +D           FA +S   D ++ +   
Sbjct  262   FISSERASTDRASSVTYDFMDTNRGRLSTSSDQSVGSMRQGPKFADLSSLHDFSSVSHES  321

Query  1595  DFTRisdagsdassiaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKI  1416
             + T      S  SS    ++ESEM+RLKLELKQTMDMY+ AC+EA++AK+   EL   ++
Sbjct  322   NLT-----SSSWSSQNLDEVESEMRRLKLELKQTMDMYSTACREALSAKQKEMELHNWRV  376

Query  1415  eesqrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketa  1236
              E Q+ E+AR  +E A+ + E E+ +C+AAMEAA+ A++IA++E+Q+    E+KA +E  
Sbjct  377   VEEQKLEEARLGQETAIAVAEKERVRCRAAMEAADAAKRIAQLESQKRANTEIKALREAE  436

Query  1235  eKNRALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVL  1056
             +  + L  L+++D +YR+Y+I+EIE ATE F+ S KIGEGGYGPV++  LDHTPVA+KVL
Sbjct  437   DMRKLLDNLAQTDDKYRRYAIEEIEQATEHFAPSRKIGEGGYGPVFKCYLDHTPVAVKVL  496

Query  1055  RPDAAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTP  876
             RPDAAQGR QFQ+E+++LS +RHPNMVLLLGACPEYG LVYEYM NGSLED L+++GN P
Sbjct  497   RPDAAQGRTQFQKEIDILSCIRHPNMVLLLGACPEYGVLVYEYMANGSLEDCLIKRGNNP  556

Query  875   AIPWEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPP  696
             A+ W++RF+I+AEIAT LLFLHQ+KPEPLVHRDLKP NILLD N+VSKISDVGLARLV P
Sbjct  557   ALSWQLRFRIAAEIATGLLFLHQTKPEPLVHRDLKPGNILLDHNYVSKISDVGLARLV-P  615

Query  695   SVADDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHV  516
             +VA++VTQ  MT+ AGTFCYIDPEYQQTG LG KSD+YS G++LLQ++T + PMGL HHV
Sbjct  616   AVAENVTQCLMTATAGTFCYIDPEYQQTGMLGVKSDVYSFGIILLQLLTGRSPMGLAHHV  675

Query  515   ERAIEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKEL  336
             ++AIEK TF  +LDP + DWPVEEAL  AKL++QCAELR+KDRPDLG+V+LP LN+ +EL
Sbjct  676   DKAIEKDTFEKMLDPAVPDWPVEEALSLAKLAIQCAELRRKDRPDLGTVVLPSLNKWREL  735

Query  335   ALQSLASK--NGTQTFGRHY  282
             A   +  K  +G      H+
Sbjct  736   AEDKMNHKLLDGNNGLSPHH  755



>ref|XP_007225224.1| hypothetical protein PRUPE_ppa001920mg [Prunus persica]
 gb|EMJ26423.1| hypothetical protein PRUPE_ppa001920mg [Prunus persica]
Length=741

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/404 (75%), Positives = 356/404 (88%), Gaps = 0/404 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK+ A ELQ+ K+EE +R E+A  AEEAA+
Sbjct  301   EDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAVELQRWKLEEERRLEEAHLAEEAAM  360

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              +VE E+AK +AA+EAAE A++IAE+EAQ+   AEMKA KE+ EK +AL+ L  SD RYR
Sbjct  361   AIVERERAKSRAAIEAAEAAKRIAELEAQKRINAEMKALKESEEKRKALNALQHSDVRYR  420

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+IDEIE ATE F++S KIGEGGYGPVYR  LDHTPVAIKVLRPDAAQGR QF QEVEV
Sbjct  421   KYTIDEIEAATEFFTESRKIGEGGYGPVYRCYLDHTPVAIKVLRPDAAQGRSQFNQEVEV  480

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLED LLR+GN+P + W++RF+I+AEI T 
Sbjct  481   LSSIRHPNMVLLLGACPEYGCLVYEYMANGSLEDCLLRRGNSPPLSWQLRFRIAAEIGTG  540

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKP NIL+DRNFVSKISDVGLARLVPP+VAD+VTQY MTS AGT
Sbjct  541   LLFLHQAKPEPLVHRDLKPGNILIDRNFVSKISDVGLARLVPPAVADNVTQYRMTSTAGT  600

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLG+M LQ+ITAKP MGLTHHVERAIEKGTF D+LDP++
Sbjct  601   FCYIDPEYQQTGMLGVKSDVYSLGIMFLQMITAKPAMGLTHHVERAIEKGTFEDMLDPSV  660

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              DWPV+EA+ FAKL+LQC+ELR+KDRPDLG VILPELNRL+ +A
Sbjct  661   PDWPVKEAMKFAKLALQCSELRRKDRPDLGKVILPELNRLRGIA  704


 Score =   121 bits (303),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 95/153 (62%), Gaps = 3/153 (2%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGH  2163
             I  +A+DKDKNS SA+KW +D+L+     V+L+HV+ K  P   +  P       D    
Sbjct  17    IVALAIDKDKNSQSALKWCIDSLVKQGQTVLLIHVKIK--PPVFSQSPSLSTPNPDPQTK  74

Query  2162  CVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTH  1983
              +F PFR Y  R+ I  K+  +ED+++AKA+  Y+    + ++V+GAS+++   R F   
Sbjct  75    ELFLPFRVYCTRKNIQCKDIVLEDSDIAKALNEYVTQSAIEHLVVGASAKTGFLR-FKIS  133

Query  1982  DVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             DVP  V+K APDFC+VYV+SKGK QS R A+RP
Sbjct  134   DVPGNVSKGAPDFCNVYVVSKGKLQSRRSASRP  166



>gb|KEH39700.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=786

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/718 (49%), Positives = 465/718 (65%), Gaps = 52/718 (7%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGG-------------  2202
             +  VA+DKDK S +A++W  D LL     VIL+HV H  S     G              
Sbjct  17    LIAVAIDKDKGSQNAIRWAADTLLTRGQTVILIHVSHALSSRGSEGAIVCNAANSTSSAA  76

Query  2201  --PDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVL  2028
               P  H  + D+    +F  F  Y  R+ I   +  +EDT+V KAI  Y++   + N+++
Sbjct  77    SSPQRH--LIDNVAKDLFVTFHCYCRRKDIQCLDVLLEDTDVVKAITEYVSYAAIENLIV  134

Query  2027  GASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR--PLTN-LPTHIW  1857
             GA SR    R F + + P+ ++K APDFC+VYVISKGK  S+R A+R  P T+ L  HI 
Sbjct  135   GAPSRHGFIRSFKSSNTPSGISKGAPDFCTVYVISKGKISSVRNASRAAPHTSPLLNHIH  194

Query  1856  shhgsssrassrgssaasssAGDDRISA--CSSRGEHSGRPFRRS------------EDR  1719
             ++  S     +     +      DR S    S + E    PF R              D 
Sbjct  195   NNLTSEDVNQTAQQICSRRMNMRDRTSMKPNSWQDESMKSPFGRRARGTSGMLCVDFTDS  254

Query  1718  DADGSV---RRPWNSSCRNSLAE--DNDLFAPISDGFDNAAAAQNL--DFTRisdagsda  1560
             D D S     RP +S+C +S+ +  D+   + IS   D ++ +  L   FT  S   +  
Sbjct  255   DTDISFVSSGRP-SSACSSSIYDYMDSGRTSRISTSTDRSSGSHRLGIKFTEPSSPDTSF  313

Query  1559  ssiaSK---------DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIees  1407
             S  +S+         + E++M+RL+LELKQTMDMYN AC+EA+ A+    E+   KIEE 
Sbjct  314   SLDSSRTSCSYSNMDETEADMRRLQLELKQTMDMYNTACREALAAQHKLMEMSHWKIEEE  373

Query  1406  qrfeqarqaeeaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKN  1227
             ++ E+AR A+EAAL + E EKA+ KAAME AE A+KIA +E  +    E+K+ KET E  
Sbjct  374   KKLEEARLAQEAALAIAEREKARSKAAMETAEAARKIANVELNKRSGVEVKSLKETEELR  433

Query  1226  RALSVLSKSDCRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPD  1047
             + L  L+++D RYR+Y+I+EIE AT  FS+  KIGEGGYGPVY+  LDHT VA+KVLRPD
Sbjct  434   KLLDNLAQTDLRYRRYNIEEIEAATNMFSEKQKIGEGGYGPVYKCYLDHTSVAVKVLRPD  493

Query  1046  AAQGRKQFQQEVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIP  867
             AAQG+ QFQQEV++LS +RHPN+VLLLGACPEYG LVYEYM NGSLED L RK N   + 
Sbjct  494   AAQGKSQFQQEVDILSCIRHPNLVLLLGACPEYGILVYEYMANGSLEDCLTRKKNDRVLC  553

Query  866   WEIRFKISAEIATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVA  687
             W++RF+I+AEIAT LLFLHQ+KPEPLVHRDLKP NILLDRN+V KISDVGLARLV P VA
Sbjct  554   WQLRFRIAAEIATGLLFLHQTKPEPLVHRDLKPGNILLDRNYVCKISDVGLARLV-PVVA  612

Query  686   DDVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERA  507
             ++VTQ  MTSAAGTFCYIDPEYQQTG LG KSD+YSLG++ LQ++T + PMGL HH E++
Sbjct  613   ENVTQCCMTSAAGTFCYIDPEYQQTGMLGVKSDVYSLGIIFLQLLTGRHPMGLAHHAEQS  672

Query  506   IEKGTFADLLDPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             IE GTF ++LDP++S+WP+++A+  A +++ CA+LR+KDRPDL   +LPEL +L E A
Sbjct  673   IENGTFQEMLDPSLSEWPLQQAISLANIAVNCAQLRRKDRPDLAKEVLPELVKLTEFA  730



>gb|KHM99859.1| U-box domain-containing protein 35 [Glycine soja]
Length=774

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/403 (73%), Positives = 347/403 (86%), Gaps = 6/403 (1%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             ++E+EM+RLKLELKQTM++Y++ACKEA+TAK+ A ELQ+ K+EE ++ E AR AE  AL 
Sbjct  318   EVEAEMRRLKLELKQTMELYSSACKEAMTAKQKALELQRWKVEEQRKLEDARLAEGTALA  377

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             M E EK KC AAMEAAE ++KIAE+EAQ+      +   E+A K +   +LS S  RYRK
Sbjct  378   MAEREKVKCMAAMEAAETSRKIAELEAQK------RMSVESAHKKKNADILSHSPARYRK  431

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE AT+ FS S+KIGEGGYGPVYR +LDHTPVAIKVL+PDAAQGR QFQQEVEVL
Sbjct  432   YTIEEIEEATKFFSNSLKIGEGGYGPVYRSELDHTPVAIKVLKPDAAQGRSQFQQEVEVL  491

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPE+GCLVYEYM NGSL+D L R+GN PA+PW++RF+I+AEIAT L
Sbjct  492   SCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDCLFRRGNKPALPWQLRFRIAAEIATGL  551

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPP+VAD VTQY MTS AGTF
Sbjct  552   LFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPTVADTVTQYRMTSTAGTF  611

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG+MLLQ+ITAKPPMGLTHHV RAIEKGTFAD+LDP + 
Sbjct  612   CYIDPEYQQTGMLGIKSDIYSLGIMLLQMITAKPPMGLTHHVGRAIEKGTFADMLDPAVE  671

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             DWPVE ALHFAKL+L CAE+R+KDRPDLG V+LPELN+L++ A
Sbjct  672   DWPVEHALHFAKLALACAEMRRKDRPDLGKVVLPELNKLRDFA  714


 Score =   125 bits (314),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 98/164 (60%), Gaps = 12/164 (7%)
 Frame = -3

Query  2348  GPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS----PNHQNGGPDAHGGM  2181
             G +  VA++ +K S  A KW VDNLL  +  ++LLHVR + S    P +           
Sbjct  13    GRVVAVAIENNKTSQYAAKWAVDNLLPKDQALLLLHVRQRVSSIPTPTYMQ--------Q  64

Query  2180  SDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAIS  2001
              D++   +F  FR +  R+ I  KE  +ED +++K ++  I+ + V  +VLGA+SRS + 
Sbjct  65    MDNESKELFASFRVFCNRKSIQCKEILLEDMDISKGLIEGISKYSVELLVLGAASRSGLV  124

Query  2000  RKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLP  1869
             R+F T DVP++V+K AP FC+VY+I+KGK  S++ A  PLT  P
Sbjct  125   RRFRTSDVPSLVSKGAPPFCTVYIIAKGKISSVKTATAPLTAKP  168



>ref|XP_006580498.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Glycine max]
Length=789

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/403 (73%), Positives = 347/403 (86%), Gaps = 6/403 (1%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             ++E+EM+RLKLELKQTM++Y++ACKEA+TAK+ A ELQ+ K+EE ++ E AR AE  AL 
Sbjct  333   EVEAEMRRLKLELKQTMELYSSACKEAMTAKQKALELQRWKVEEQRKLEDARLAEGTALA  392

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             M E EK KC AAMEAAE ++KIAE+EAQ+      +   E+A K +   +LS S  RYRK
Sbjct  393   MAEREKVKCMAAMEAAETSRKIAELEAQK------RMSVESAHKKKNADILSHSPARYRK  446

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE AT+ FS S+KIGEGGYGPVYR +LDHTPVAIKVL+PDAAQGR QFQQEVEVL
Sbjct  447   YTIEEIEEATKFFSNSLKIGEGGYGPVYRSELDHTPVAIKVLKPDAAQGRSQFQQEVEVL  506

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPE+GCLVYEYM NGSL+D L R+GN PA+PW++RF+I+AEIAT L
Sbjct  507   SCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDCLFRRGNKPALPWQLRFRIAAEIATGL  566

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPP+VAD VTQY MTS AGTF
Sbjct  567   LFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPTVADTVTQYRMTSTAGTF  626

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG+MLLQ+ITAKPPMGLTHHV RAIEKGTFAD+LDP + 
Sbjct  627   CYIDPEYQQTGMLGIKSDIYSLGIMLLQMITAKPPMGLTHHVGRAIEKGTFADMLDPAVE  686

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             DWPVE ALHFAKL+L CAE+R+KDRPDLG V+LPELN+L++ A
Sbjct  687   DWPVEHALHFAKLALACAEMRRKDRPDLGKVVLPELNKLRDFA  729


 Score =   124 bits (312),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 101/171 (59%), Gaps = 11/171 (6%)
 Frame = -3

Query  2348  GPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS----PNHQ----NGGPD-  2196
             G +  VA++ +K S  A KW VDNLL  +  ++LLHVR + S    P        G  D 
Sbjct  13    GRVVAVAIENNKTSQYAAKWAVDNLLPKDQALLLLHVRQRVSSIPTPTGNLVSLEGNDDV  72

Query  2195  --AHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
               A+    D++   +F  FR +  R+ I  KE  +ED +++K ++  I+ + V  +VLGA
Sbjct  73    ARAYMQQMDNESKELFASFRVFCNRKSIQCKEILLEDMDISKGLIEGISKYSVELLVLGA  132

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLP  1869
             +SRS + R+F T DVP++V+K AP FC+VY+I+KGK  S++ A  PLT  P
Sbjct  133   ASRSGLVRRFRTSDVPSLVSKGAPPFCTVYIIAKGKISSVKTATAPLTAKP  183



>ref|XP_008466285.1| PREDICTED: U-box domain-containing protein 52 isoform X1 [Cucumis 
melo]
Length=774

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/405 (76%), Positives = 354/405 (87%), Gaps = 1/405 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK+ A ELQ+ K+EE QR E+AR A EAAL
Sbjct  325   EDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAVELQRWKLEEEQRLEEARLAGEAAL  384

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSD-CRY  1188
              + E EKAK KAA+EAAE A++IAE+EAQ+   AEMKA KE  EK +A   L+++D  RY
Sbjct  385   ALAEQEKAKSKAAVEAAEAARRIAELEAQKRMKAEMKALKEAEEKKKAFDALAQTDNIRY  444

Query  1187  RKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVE  1008
             RKY+I+EIE ATE FS+S +IGEGGYGPVY+  LDHTPVAIKVLRPDA QGR QF+QEVE
Sbjct  445   RKYTIEEIEAATEFFSESRRIGEGGYGPVYKCDLDHTPVAIKVLRPDATQGRSQFKQEVE  504

Query  1007  VLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIAT  828
             VLS +RHPNMVLLLGACPEYGCLVYE+M NGSLEDRLLR+GNTP + W++RFKI+AEI T
Sbjct  505   VLSCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLLRRGNTPPLSWQLRFKIAAEIGT  564

Query  827   ALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAG  648
             ALLFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPS+AD VTQY MTS AG
Sbjct  565   ALLFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSIADSVTQYRMTSTAG  624

Query  647   TFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPT  468
             TFCYIDPEYQQTG LG KSDIYSLG+M LQ+IT++PPMGLTHHVERAIEKG F  +LDP 
Sbjct  625   TFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITSRPPMGLTHHVERAIEKGMFETILDPA  684

Query  467   ISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             I+DWPVEEAL FAKLSL+CAELR+KDRPDLG  ILPELNRL+ +A
Sbjct  685   ITDWPVEEALSFAKLSLKCAELRRKDRPDLGKAILPELNRLRAMA  729


 Score =   129 bits (323),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 94/154 (61%), Gaps = 7/154 (5%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNH-QNGGPDAHGGMSDHDG  2166
                VA+DKDK S  A+KW +D+LL     V L+HV+ K+  N  Q   PD    + D   
Sbjct  19    FVAVAIDKDKGSQGALKWAIDHLLQRGHTVFLIHVKLKSPSNSTQKMKPDPEASVKD---  75

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
               +F PFR +  R+ I  K+  +EDT+VAKAI+ Y     + N+V+GAS++S   R F  
Sbjct  76    --LFLPFRCFCTRKDIQCKDVVLEDTDVAKAIIEYAANTTIENIVVGASAKSGFLR-FKA  132

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
              DVP  + K APDFC+V+VISKGK QS+R A+RP
Sbjct  133   TDVPGSIVKGAPDFCNVFVISKGKIQSMRSASRP  166



>gb|KGN60182.1| hypothetical protein Csa_3G882930 [Cucumis sativus]
Length=775

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/405 (76%), Positives = 356/405 (88%), Gaps = 1/405 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK+ A ELQ+ K+EE QR E+AR A EAAL
Sbjct  326   EDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAVELQRWKLEEEQRLEEARLAGEAAL  385

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSD-CRY  1188
              + E EKAK KAA+EAAE A++IAE+EAQ+   AEMKA KE  EK +A   L+++D  RY
Sbjct  386   ALAEQEKAKSKAAVEAAEAARRIAELEAQKRMKAEMKALKEAEEKKKAYDALAQTDNIRY  445

Query  1187  RKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVE  1008
             RKY+I+EIE ATE FS+S +IGEGGYGPVY+  LDHTPVAIKVLRPDA QGR QF+QEVE
Sbjct  446   RKYTIEEIEAATEFFSESRRIGEGGYGPVYKCDLDHTPVAIKVLRPDATQGRSQFKQEVE  505

Query  1007  VLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIAT  828
             VLS +RHPNMVLLLGACPEYGCLVYE+M NGSLEDRLLR+GNTPA+ W++RFKI+AEI T
Sbjct  506   VLSCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLLRRGNTPALSWQLRFKIAAEIGT  565

Query  827   ALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAG  648
             ALLFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPS+AD VTQY MTS AG
Sbjct  566   ALLFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSIADSVTQYRMTSTAG  625

Query  647   TFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPT  468
             TFCYIDPEYQQTG LG KSDIYSLG+M LQ+IT++PPMGLTHHVER+IEKG F  +LDP 
Sbjct  626   TFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITSRPPMGLTHHVERSIEKGMFDTILDPI  685

Query  467   ISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             I+DWP+EEAL FAKLSL+CAELR+KDRPDLG VILPELNRL+ +A
Sbjct  686   ITDWPIEEALSFAKLSLKCAELRRKDRPDLGKVILPELNRLRAIA  730


 Score =   127 bits (318),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 94/154 (61%), Gaps = 7/154 (5%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNH-QNGGPDAHGGMSDHDG  2166
             I  VA+DKDK S  A+KW +D+LL     V L+HV+ K+  N  Q    D    + D   
Sbjct  19    IVAVAIDKDKGSQGALKWAIDHLLQRGHTVFLMHVKLKSPSNSTQKMKSDPEANVKD---  75

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
               +F PFR +  R+ I  K+  +EDT+VAKAI+ Y     + N+V+GAS+RS   R F  
Sbjct  76    --LFLPFRCFCTRKDIQCKDIVLEDTDVAKAIIEYAANTTIENIVVGASARSGFLR-FKV  132

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
              D+P  + K APDFC+V+VISKGK Q++R A+RP
Sbjct  133   TDIPGSIVKGAPDFCNVFVISKGKIQTMRSASRP  166



>gb|EAZ12456.1| hypothetical protein OsJ_02353 [Oryza sativa Japonica Group]
Length=739

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/404 (75%), Positives = 357/404 (88%), Gaps = 0/404 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +++E EM+RL+LELKQTMDMYN AC+EAI AK+  KELQ +K+EE++R E+AR AEEAAL
Sbjct  299   REVEVEMRRLRLELKQTMDMYNAACREAINAKQRTKELQLLKLEEARRLEEARHAEEAAL  358

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              M EMEK KC+AAMEAAE AQ++A++EAQR + AE++A++E  EK RAL  +S  D RYR
Sbjct  359   AMAEMEKTKCRAAMEAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAISSHDFRYR  418

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             +Y+ID+IE ATE+FS  +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQFQQEVEV
Sbjct  419   RYNIDDIELATERFSDELKIGEGGYGPVYRASLDHTPVAIKVLRPDAQQGRKQFQQEVEV  478

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACP+YGCLVYEYM+NGSLEDRL R+G TP IPW  RF+ISAEIATA
Sbjct  479   LSCIRHPNMVLLLGACPDYGCLVYEYMDNGSLEDRLFRRGGTPPIPWSQRFRISAEIATA  538

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPP+VAD VTQY +T+ AGT
Sbjct  539   LLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPAVADSVTQYRLTATAGT  598

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTGKLG KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTFA +LD T+
Sbjct  599   FCYIDPEYQQTGKLGVKSDIYSLGVLLLQVLTARPPMGLTHHVEKAIDAGTFAQMLDVTV  658

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              DWPV++A+ FAKL+L+C E+R++DRPDL +VILPELNRL+ L 
Sbjct  659   KDWPVDDAIGFAKLALKCTEMRRRDRPDLATVILPELNRLRNLG  702


 Score =   128 bits (322),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 98/149 (66%), Gaps = 1/149 (1%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVR-HKASPNHQNGGPDAHGGMSDHDGHC  2160
             VVAVD+D+NS  AVKW VD+LL     +ILLH+  H  + NH     +A  G  + +   
Sbjct  4     VVAVDRDRNSQLAVKWVVDHLLTGASNIILLHIAVHPPAANHGFAMAEATHGALEAEMRE  63

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F PFR +  R G+ + E  +E+ +V+KA++ +I  +++ ++ LGAS+R+A ++KF   D
Sbjct  64    IFVPFRGFCTRNGVHVSELVLEEADVSKALIEFITVNKIQSIALGASNRNAFTKKFKNAD  123

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPA  1893
             VP+ + K APD+C++YV++KGK  ++R A
Sbjct  124   VPSSLMKGAPDYCNIYVVAKGKSVNVRLA  152



>ref|XP_011002967.1| PREDICTED: U-box domain-containing protein 35-like [Populus euphratica]
Length=756

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/408 (75%), Positives = 357/408 (88%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTM+MY++ACKEA+TAK+ AKELQ+ K+EE QR E+AR AEEAAL
Sbjct  321   EDVEAEMRRLKLELKQTMEMYSSACKEALTAKQKAKELQRWKMEEEQRLEEARLAEEAAL  380

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKAK KAA+EAAE AQ+IAE+E+Q+   AEMKA +E  EK +AL  L+ SD RYR
Sbjct  381   AIAEREKAKSKAAIEAAEAAQRIAELESQKRINAEMKAHREAEEKRKALDALANSDVRYR  440

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             +Y I+EIE AT+ FS+S KIGEGGYGPVY+G LDHT VAIKVLRPDAAQGR QFQQEVEV
Sbjct  441   RYPIEEIEAATDYFSESRKIGEGGYGPVYKGYLDHTSVAIKVLRPDAAQGRSQFQQEVEV  500

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             L  +RHPNMVLLLGACPEYGCLVYE+M NGSLEDRL  +GNTP + W++RF+I+AEI T 
Sbjct  501   LCCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFCRGNTPPLSWQLRFRIAAEIGTG  560

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD+VTQY MTS AGT
Sbjct  561   LLFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADNVTQYRMTSTAGT  620

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSDIYSLG+M LQI+TAKP MGLTHHVERA+EKGTFA +LDP +
Sbjct  621   FCYIDPEYQQTGMLGIKSDIYSLGIMFLQILTAKPAMGLTHHVERALEKGTFAQMLDPAV  680

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWP+EEA +FAKLSL+CAELR+KDRPDLG V+LPEL RL+ +A +++
Sbjct  681   PDWPIEEATYFAKLSLKCAELRRKDRPDLGKVVLPELKRLRAIAEETM  728


 Score =   126 bits (316),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 97/155 (63%), Gaps = 3/155 (2%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGM--SDHD  2169
             +  VA+DKDK+S  A+KW +DNLL+    VIL+HV  K+S +  +  P  +  +   D D
Sbjct  17    LVAVAIDKDKSSQIALKWAIDNLLVKGQTVILIHVNLKSSLSSHSSSPKMNQFVDSKDPD  76

Query  2168  GHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW  1989
                +F PFR +  R+ I  K+  +EDT+VAKA++ Y+    +  +++G S++    R F 
Sbjct  77    SKDLFLPFRCFCTRKDISCKDVMLEDTDVAKALIEYVTQTLIETLIVGGSTKGGFLR-FK  135

Query  1988  THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
               D+   V+K APDFC+VYVISKGK QS+RPA RP
Sbjct  136   AADIAGNVSKGAPDFCTVYVISKGKIQSMRPAFRP  170



>ref|XP_002518240.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF44126.1| ATP binding protein, putative [Ricinus communis]
Length=802

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/407 (75%), Positives = 357/407 (88%), Gaps = 0/407 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK+  +ELQ  K+EE QR E+AR AEE AL 
Sbjct  353   DVEAEMRRLKLELKQTMEMYSTACKEALTAKEKTRELQLWKLEEEQRLEEARLAEETALA  412

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK KAA+EAAE AQ+IAE+EAQ+   AEMKA +E+ EK +AL  L+ SD RYRK
Sbjct  413   IAEKEKAKSKAAIEAAEAAQRIAELEAQKRVSAEMKALRESQEKKKALDALAHSDIRYRK  472

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE ATE FS+S KIGEGGYGPVY+  LDHT VAIKVLRPDAAQGR QFQQEVEVL
Sbjct  473   YSIEEIEAATEFFSESRKIGEGGYGPVYKCYLDHTSVAIKVLRPDAAQGRSQFQQEVEVL  532

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPEYGCLVYEYM NGSL+DRL R+GNTP + W++RF+I+AEI T+L
Sbjct  533   SCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDRLFRRGNTPPLSWQLRFRIAAEIGTSL  592

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY MTS AGTF
Sbjct  593   LFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRMTSTAGTF  652

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG+M LQI+TAKPPMGLTHHVER++EK TF ++LDP + 
Sbjct  653   CYIDPEYQQTGMLGIKSDIYSLGIMFLQILTAKPPMGLTHHVERSLEKDTFEEMLDPAVP  712

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             DWPVEEA  FA+L+L+C+ELR+KDRPDLG+V+LPELNRL+ LA +++
Sbjct  713   DWPVEEAKCFARLALKCSELRRKDRPDLGNVVLPELNRLRSLAEENM  759


 Score =   120 bits (302),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 107/185 (58%), Gaps = 18/185 (10%)
 Frame = -3

Query  2369  SSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKA---------SPN  2217
             SS G+  G +  VA+DKDK+S SA+KW +D++L     V+L+HV+ K+         S  
Sbjct  12    SSQGSGNG-LVAVAIDKDKSSQSALKWAIDHILHKGQTVLLIHVKLKSISMSSAYSLSTP  70

Query  2216  HQNGGPDAHGG----MSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYIN  2055
               N   DA+G       D D     +F PFR +  R+ I  K+  +E+T++AKA+V Y  
Sbjct  71    RMNQIADANGESMLVCRDPDSLTKELFLPFRCFCTRKDIQCKDVVLEETDIAKALVEYAT  130

Query  2054  THRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN  1875
                +  +V+GAS++S + R F   D P  V K APDFC+VYVISKGK QS R A+RP  +
Sbjct  131   RTAIETLVVGASNKSGLFR-FKATDTPGSVLKGAPDFCTVYVISKGKIQSTRSASRPPPS  189

Query  1874  L-PTH  1863
             L P H
Sbjct  190   LSPMH  194



>ref|XP_006371832.1| hypothetical protein POPTR_0018s04050g, partial [Populus trichocarpa]
 gb|ERP49629.1| hypothetical protein POPTR_0018s04050g, partial [Populus trichocarpa]
Length=737

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/407 (75%), Positives = 356/407 (87%), Gaps = 0/407 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTM+MY++ACKEA+TAK+ AKELQ+ K+EE QR E+AR AEEAAL
Sbjct  321   EDVEAEMRRLKLELKQTMEMYSSACKEALTAKQKAKELQRWKMEEEQRLEEARLAEEAAL  380

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKAK KAA+EAAE AQ+IAE+E+Q+   AEMKA +E  EK +AL  L+ SD RYR
Sbjct  381   AIAEREKAKSKAAIEAAEAAQRIAELESQKRINAEMKAHREAEEKRKALDALANSDVRYR  440

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             +Y I+EIE AT+ FS+S KIGEGGYGPVY+G LDHT VAIKVLRPDAAQGR QFQQEVEV
Sbjct  441   RYPIEEIEAATDYFSESRKIGEGGYGPVYKGYLDHTSVAIKVLRPDAAQGRSQFQQEVEV  500

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             L  +RHPNMVLLLGACPEYGCLVYE+M NGSLEDRL  +GNTP + W++RF+I+AEI T 
Sbjct  501   LCCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFCRGNTPPLSWQLRFRIAAEIGTG  560

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD+VTQY MTS AGT
Sbjct  561   LLFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADNVTQYRMTSTAGT  620

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSDIYSLG+M LQI+TAKP MGLTHHVERA+EKGTFA +LDP +
Sbjct  621   FCYIDPEYQQTGMLGIKSDIYSLGIMFLQILTAKPAMGLTHHVERALEKGTFAQMLDPAV  680

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQS  324
              DWP+EEA +FAKLSL+CAELR+KDRPDLG V+LPEL RL+ +A ++
Sbjct  681   PDWPIEEATYFAKLSLKCAELRRKDRPDLGKVVLPELKRLRAIAEET  727


 Score =   129 bits (323),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 98/155 (63%), Gaps = 3/155 (2%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHG--GMSDHD  2169
             +  VA+DKDK+S  A+KW +DNLL+    VIL+HV  K+S +  +  P  +   G  D D
Sbjct  17    LIAVAIDKDKSSQIALKWAIDNLLVKGQTVILIHVNLKSSLSSHSSSPKKNQFVGSKDPD  76

Query  2168  GHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW  1989
                +F PFR +  R+ I  K+  +EDT+VAKA++ Y+    +  +++G S++    R F 
Sbjct  77    SKDLFLPFRCFCTRKDISCKDVMLEDTDVAKALIEYVTQTLIETLIVGGSTKGGFLR-FK  135

Query  1988  THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
               D+   V++ APDFC+VYVISKGK QS+RPA+RP
Sbjct  136   AADIAGSVSRGAPDFCTVYVISKGKIQSMRPASRP  170



>emb|CDP12490.1| unnamed protein product [Coffea canephora]
Length=800

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/409 (75%), Positives = 357/409 (87%), Gaps = 0/409 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLK ELKQTM+MY+ ACKEA+ AK+ A ELQ+ K+EE Q+ E+AR AEEAAL
Sbjct  367   EDVEAEMRRLKQELKQTMEMYSTACKEALLAKQKALELQRWKMEEQQKLEEARLAEEAAL  426

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKAKCK A+EAAE AQ+IAE+EAQ+ K AEMKA +E  E+ R L  L+  D RYR
Sbjct  427   AIAEKEKAKCKVAIEAAEAAQRIAELEAQKRKNAEMKALREEEERKRVLHTLAHGDVRYR  486

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             +Y+IDEIE AT+ FS+S KIGEGGYGPVY+  LDHTPVAIKVLRPDA+QGR QFQQEVEV
Sbjct  487   RYTIDEIETATDHFSESRKIGEGGYGPVYKCNLDHTPVAIKVLRPDASQGRAQFQQEVEV  546

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSL+DRL R+G TP +PW++RF+I+AEI T 
Sbjct  547   LSCIRHPNMVLLLGACPEYGCLVYEYMPNGSLDDRLFRRGQTPVLPWQLRFRIAAEIGTC  606

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKI DVGLARLVPPSVAD VTQY MTS AGT
Sbjct  607   LLFLHQTKPEPLVHRDLKPANILLDRNYVSKIGDVGLARLVPPSVADTVTQYLMTSTAGT  666

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSDIYSLGVMLLQIITAKPPMGLTHHV+RAIEKG FAD+LDP +
Sbjct  667   FCYIDPEYQQTGMLGIKSDIYSLGVMLLQIITAKPPMGLTHHVQRAIEKGKFADMLDPAV  726

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLA  318
              DWPVEEAL+FAKL+L+CAELR+KDRPDL +V+LPEL+RL+ LA + ++
Sbjct  727   PDWPVEEALNFAKLALKCAELRRKDRPDLRTVVLPELDRLRTLAEERMS  775


 Score =   132 bits (333),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 101/168 (60%), Gaps = 10/168 (6%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHK----ASPNHQNGGPDAHGGMS-  2178
             +  VA+DKDK S  A+KW VDNL+    +V L+HV+ K    AS        DA+  +  
Sbjct  50    MVCVAIDKDKGSQYALKWAVDNLVGKGKYVTLIHVKQKQPSSASLVSHIALADANDSIQR  109

Query  2177  ---DHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSR  2013
                D DG    +F PFR +  R+ I + E  IED ++AK I  Y+  + V N+VLGA S+
Sbjct  110   SYKDADGQSKELFLPFRCFCTRKDIRVNEVMIEDLDIAKGICDYVRANFVENLVLGAPSK  169

Query  2012  SAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLP  1869
             SA  R+F T+DV + V+K APDFC+V+ ISKGK  S+R A+ P+ N P
Sbjct  170   SAFVRRFKTNDVASTVSKVAPDFCNVFTISKGKLSSVRAASCPVPNPP  217



>ref|XP_006580497.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Glycine max]
Length=808

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/403 (73%), Positives = 347/403 (86%), Gaps = 6/403 (1%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             ++E+EM+RLKLELKQTM++Y++ACKEA+TAK+ A ELQ+ K+EE ++ E AR AE  AL 
Sbjct  352   EVEAEMRRLKLELKQTMELYSSACKEAMTAKQKALELQRWKVEEQRKLEDARLAEGTALA  411

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             M E EK KC AAMEAAE ++KIAE+EAQ+      +   E+A K +   +LS S  RYRK
Sbjct  412   MAEREKVKCMAAMEAAETSRKIAELEAQK------RMSVESAHKKKNADILSHSPARYRK  465

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE AT+ FS S+KIGEGGYGPVYR +LDHTPVAIKVL+PDAAQGR QFQQEVEVL
Sbjct  466   YTIEEIEEATKFFSNSLKIGEGGYGPVYRSELDHTPVAIKVLKPDAAQGRSQFQQEVEVL  525

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPE+GCLVYEYM NGSL+D L R+GN PA+PW++RF+I+AEIAT L
Sbjct  526   SCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDCLFRRGNKPALPWQLRFRIAAEIATGL  585

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPP+VAD VTQY MTS AGTF
Sbjct  586   LFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPTVADTVTQYRMTSTAGTF  645

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG+MLLQ+ITAKPPMGLTHHV RAIEKGTFAD+LDP + 
Sbjct  646   CYIDPEYQQTGMLGIKSDIYSLGIMLLQMITAKPPMGLTHHVGRAIEKGTFADMLDPAVE  705

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             DWPVE ALHFAKL+L CAE+R+KDRPDLG V+LPELN+L++ A
Sbjct  706   DWPVEHALHFAKLALACAEMRRKDRPDLGKVVLPELNKLRDFA  748


 Score = 78.6 bits (192),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = -3

Query  2120  IIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFC  1941
             I  KE  +ED +++K ++  I+ + V  +VLGA+SRS + R F T DVP++V+K AP FC
Sbjct  120   IQCKEILLEDMDISKGLIEGISKYSVELLVLGAASRSGLVR-FRTSDVPSLVSKGAPPFC  178

Query  1940  SVYVISKGKQQSIRPAARPLTNLP  1869
             +VY+I+KGK  S++ A  PLT  P
Sbjct  179   TVYIIAKGKISSVKTATAPLTAKP  202



>ref|NP_001043411.1| Os01g0581400 [Oryza sativa Japonica Group]
 dbj|BAD53152.1| serine threonine kinase 1-like [Oryza sativa Japonica Group]
 dbj|BAF05325.1| Os01g0581400 [Oryza sativa Japonica Group]
Length=765

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/404 (75%), Positives = 357/404 (88%), Gaps = 0/404 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +++E EM+RL+LELKQTMDMYN AC+EAI AK+  KELQ +K+EE++R E+AR AEEAAL
Sbjct  325   REVEVEMRRLRLELKQTMDMYNAACREAINAKQRTKELQLLKLEEARRLEEARHAEEAAL  384

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              M EMEK KC+AAMEAAE AQ++A++EAQR + AE++A++E  EK RAL  +S  D RYR
Sbjct  385   AMAEMEKTKCRAAMEAAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAISSHDFRYR  444

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             +Y+ID+IE ATE+FS  +KIGEGGYGPVYR  LDHTPVAIKVLRPDA QGRKQFQQEVEV
Sbjct  445   RYNIDDIELATERFSDELKIGEGGYGPVYRASLDHTPVAIKVLRPDAQQGRKQFQQEVEV  504

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACP+YGCLVYEYM+NGSLEDRL R+G TP IPW  RF+ISAEIATA
Sbjct  505   LSCIRHPNMVLLLGACPDYGCLVYEYMDNGSLEDRLFRRGGTPPIPWSQRFRISAEIATA  564

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPP+VAD VTQY +T+ AGT
Sbjct  565   LLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPAVADSVTQYRLTATAGT  624

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTGKLG KSDIYSLGV+LLQ++TA+PPMGLTHHVE+AI+ GTFA +LD T+
Sbjct  625   FCYIDPEYQQTGKLGVKSDIYSLGVLLLQVLTARPPMGLTHHVEKAIDAGTFAQMLDVTV  684

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              DWPV++A+ FAKL+L+C E+R++DRPDL +VILPELNRL+ L 
Sbjct  685   KDWPVDDAIGFAKLALKCTEMRRRDRPDLATVILPELNRLRNLG  728


 Score =   131 bits (329),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 106/175 (61%), Gaps = 10/175 (6%)
 Frame = -3

Query  2414  RSDHPKMDHHHHPTISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVR  2235
             R+  P    HH P ++          VVAVD+D+NS  AVKW VD+LL     +ILLH+ 
Sbjct  13    RATSPPGIMHHQPAMT---------IVVAVDRDRNSQLAVKWVVDHLLTGASNIILLHIA  63

Query  2234  -HKASPNHQNGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYI  2058
              H  + NH     +A  G  + +   +F PFR +  R G+ + E  +E+ +V+KA++ +I
Sbjct  64    VHPPAANHGFAMAEATHGALEAEMREIFVPFRGFCTRNGVHVSELVLEEADVSKALIEFI  123

Query  2057  NTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPA  1893
               +++ ++ LGAS+R+A ++KF   DVP+ + K APD+C++YV++KGK  ++R A
Sbjct  124   TVNKIQSIALGASNRNAFTKKFKNADVPSSLMKGAPDYCNIYVVAKGKSVNVRLA  178



>ref|XP_010106940.1| U-box domain-containing protein 35 [Morus notabilis]
 gb|EXC12822.1| U-box domain-containing protein 35 [Morus notabilis]
Length=769

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/403 (76%), Positives = 356/403 (88%), Gaps = 1/403 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+++EMKRL+LELKQTMDMY++ACKEA+TAKK+A EL + K+EE QR E+A+ AEEAAL 
Sbjct  316   DVDAEMKRLRLELKQTMDMYSSACKEALTAKKTAIELHRWKLEEEQRLEEAQLAEEAALA  375

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAKCK A+EAAE AQ+IAE+EAQ+   AEMKA+KE  E+ +AL  LS  + RYRK
Sbjct  376   LAEKEKAKCKVAIEAAEAAQRIAELEAQKRVQAEMKAQKEAEERKKALGSLSH-EIRYRK  434

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE ATE FS+S KIGEGGYGPVYR +L HTPVAIKVLRPDAAQGR QFQQEVEVL
Sbjct  435   YTIEEIEMATEDFSESRKIGEGGYGPVYRCELGHTPVAIKVLRPDAAQGRSQFQQEVEVL  494

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPE+GCLVYEYM +GSLEDRL R+GNTP +PW++RF+ISAEI T L
Sbjct  495   SCIRHPNMVLLLGACPEFGCLVYEYMAHGSLEDRLFRRGNTPVLPWQLRFRISAEIGTGL  554

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY MT+ AGTF
Sbjct  555   LFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADAVTQYRMTATAGTF  614

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLGV+LLQ+ITAKPPMGLTHH+ERAI+KG F ++LDP ++
Sbjct  615   CYIDPEYQQTGMLGIKSDIYSLGVLLLQLITAKPPMGLTHHMERAIDKGGFTEMLDPAVT  674

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             DWP+EE   F KL+LQCAE+R+KDRPDLG V+LPELNRL+E+A
Sbjct  675   DWPLEETFKFTKLALQCAEMRRKDRPDLGKVVLPELNRLREIA  717


 Score =   123 bits (308),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 101/161 (63%), Gaps = 12/161 (7%)
 Frame = -3

Query  2330  AVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS--PNHQNGGPDAHGGMSD------  2175
             A+DKDK+S  A+KWTVD+L+     V+LLH++++AS  PN        +    D      
Sbjct  20    AIDKDKSSQYALKWTVDHLITRGQTVVLLHIKNRASSVPNPFGNFVSVNEVSEDVARTYK  79

Query  2174  ----HDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSA  2007
                 +    +F PFR +  R+ I   E  +ED +++KAI+ Y++ + +  +VLGA+SR++
Sbjct  80    QQLENQAKDLFLPFRCFCTRKDIKCDEVILEDLDISKAIINYVSANSIETLVLGAASRNS  139

Query  2006  ISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             + ++F T DVP+ V++ AP+FC+VYVI+KGK  S+R A+ P
Sbjct  140   LVKRFKTTDVPSSVSRGAPEFCTVYVIAKGKISSVRSASSP  180



>ref|XP_008228827.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
52-like [Prunus mume]
Length=758

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/402 (77%), Positives = 351/402 (87%), Gaps = 1/402 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK   +EL + K+E+ QR E AR AEEAAL 
Sbjct  308   DVEAEMRRLKLELKQTMEMYSMACKEALTAKHKERELNRWKLEDEQRLEAARHAEEAALA  367

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             +VE EKAKCKAA+EAAE + +IAE+EA + + AEMKA KE+ EK +AL   +  D RYRK
Sbjct  368   LVEREKAKCKAAIEAAEVSHRIAELEAHKRRAAEMKAFKESEEKKKALQSRA-YDPRYRK  426

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE AT  FS++ KIGEGGYGPVYRG+LDHTPVAIKVLRPDAAQG+ QF QEVEVL
Sbjct  427   YTIEEIEKATNDFSQARKIGEGGYGPVYRGELDHTPVAIKVLRPDAAQGKSQFNQEVEVL  486

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPEYGCLVYEYM NGSL+D L R+GNTP IPW++RF+I+AEIAT L
Sbjct  487   SCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDCLFRRGNTPVIPWQLRFRIAAEIATGL  546

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKP NILLD N+VSKISDVGLARLVPPSVAD VTQYHMTS AGTF
Sbjct  547   LFLHQAKPEPLVHRDLKPGNILLDHNYVSKISDVGLARLVPPSVADSVTQYHMTSTAGTF  606

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LGTKSDIYSLGVMLLQ+ITAKPPMGLTHHVERAIE GTFA++LDP + 
Sbjct  607   CYIDPEYQQTGMLGTKSDIYSLGVMLLQLITAKPPMGLTHHVERAIEMGTFAEMLDPAVP  666

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKEL  336
             DWPVEEAL FAKL LQCAE+R+KDRPDL  V+LPELNRL+ L
Sbjct  667   DWPVEEALKFAKLCLQCAEMRRKDRPDLAKVVLPELNRLRAL  708


 Score =   117 bits (294),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 92/147 (63%), Gaps = 7/147 (5%)
 Frame = -3

Query  2333  VAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGHCVF  2154
             VA+DKDK S +A+KW VD+LL     + LLHV+H +S    + G D+ GG +      +F
Sbjct  18    VAIDKDKGSENAIKWAVDHLLTRGQPLTLLHVKHTSS----SEGADSQGGGA--QAQSLF  71

Query  2153  TPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVP  1974
               +R++ +++ I   E  +EDT++ KAI+ Y+ T  V  +VLG  ++S + R F   DVP
Sbjct  72    LSYRSFCSKKNIKCHEVVLEDTDIPKAIINYVVTSSVEILVLGTPTKSGLFR-FKLTDVP  130

Query  1973  TIVNKTAPDFCSVYVISKGKQQSIRPA  1893
             + V+K APDFCSVYVI KGK   +R A
Sbjct  131   STVSKGAPDFCSVYVIGKGKVSYMRCA  157



>ref|XP_010648456.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
52 [Vitis vinifera]
Length=810

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/408 (75%), Positives = 357/408 (88%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EM+RLKLELKQTMDMY+ ACKEA++AK+ A+ELQ+ K+EE QR E+AR AEEAAL
Sbjct  349   EDVEAEMRRLKLELKQTMDMYSTACKEALSAKQKARELQRWKLEEEQRLEEARLAEEAAL  408

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKAK +AA+E AE AQ+IAE+EAQ+   AEMKA KE  EK + L  L+++D RYR
Sbjct  409   AIAEREKAKSRAAIEHAEAAQRIAELEAQKRINAEMKAIKEAEEKKKVLDSLAQTDVRYR  468

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE ATE FS+S KIGEGGYGPVY+  LDHT VAIKVLRPDAAQGR QFQQEVEV
Sbjct  469   KYTIEEIESATEFFSESRKIGEGGYGPVYKCNLDHTQVAIKVLRPDAAQGRSQFQQEVEV  528

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL R+G++P + W++RF+I+AEI T 
Sbjct  529   LSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGDSPPLSWQLRFRIAAEIGTG  588

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY MTS AGT
Sbjct  589   LLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRMTSTAGT  648

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLG+MLLQIITAKPPMGLTH VERAIEK TF ++LDP +
Sbjct  649   FCYIDPEYQQTGMLGIKSDVYSLGIMLLQIITAKPPMGLTHLVERAIEKDTFEEMLDPVV  708

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWP+EEAL FAK++LQCAELR+KDRPDLG  +LPELNRL+EL+ + L
Sbjct  709   PDWPLEEALSFAKIALQCAELRRKDRPDLGKAVLPELNRLRELSEEHL  756


 Score =   123 bits (308),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 93/153 (61%), Gaps = 2/153 (1%)
 Frame = -3

Query  2345  PITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDG  2166
             P+  VA+DKDK S SA+KW +DN+L     V+L+HV+ K S +H     D    + DH  
Sbjct  16    PLVAVAIDKDKGSQSALKWAIDNILNRGQTVVLIHVKLKQSHSHSYPTGDEVAKL-DHYT  74

Query  2165  HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWT  1986
               +F PFR +  R+ I  K+  +EDT+V KA++ Y++   +  +V+GA ++    R F  
Sbjct  75    KELFLPFRCFCTRKDIQCKDVILEDTDVVKALIEYVSHSAIEVLVVGAPAKGGFLR-FKA  133

Query  1985  HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
              D+P  + K APDFC+VYVISKGK  S R A+R
Sbjct  134   IDIPGSITKGAPDFCTVYVISKGKISSTRSASR  166



>ref|XP_008781718.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008781719.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Phoenix 
dactylifera]
Length=749

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/419 (72%), Positives = 357/419 (85%), Gaps = 3/419 (1%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EMKRL+LELKQTMDMY+ ACKEA+TAK+ AKEL   K+EE +R E+A  AEEAAL
Sbjct  294   EDVEAEMKRLRLELKQTMDMYSTACKEALTAKQKAKELHHWKMEEERRLEEAHMAEEAAL  353

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKA+CKAA+EAAE +++IA++EA +   AEMKA KE  EK RAL  L+ +D RYR
Sbjct  354   ALAEKEKARCKAAIEAAEASKRIAKLEAHKRINAEMKALKEAEEKKRALDALAHTDVRYR  413

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE ATE FS+  KIGEGGYGPVY+  L+HTPVAIKVLRPDAAQGR QFQQEVE+
Sbjct  414   KYTIEEIEVATEYFSEKRKIGEGGYGPVYKCYLEHTPVAIKVLRPDAAQGRSQFQQEVEI  473

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS MRHPNMVLLLGACPEYGCLVYEYM NGSLEDRL ++GNTP IPW+ RF+I+AEI T 
Sbjct  474   LSCMRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFQQGNTPPIPWQHRFRIAAEIGTG  533

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVA++VTQY MTS AGT
Sbjct  534   LLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVAENVTQYRMTSTAGT  593

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQ+G LG KSDIYSLG++LLQ+ITA+PPMGLTHHVE AIEKGTF ++LDP++
Sbjct  594   FCYIDPEYQQSGMLGVKSDIYSLGIVLLQLITARPPMGLTHHVEHAIEKGTFTEVLDPSV  653

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA---LQSLASKNGTQT  297
              DWPVEEAL  A ++L CAELR+KDRPDL +++LPEL RL+ LA   +Q  AS   + T
Sbjct  654   IDWPVEEALSLANIALNCAELRRKDRPDLATIVLPELERLRNLAEENMQHCASFGSSHT  712


 Score =   124 bits (311),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 8/161 (5%)
 Frame = -3

Query  2366  SDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHK-ASPNHQNGGPDAH  2190
             ++GAT  P+  VA+DKDK S +A+KW +DN++     + L+HV  K  +P HQ   P   
Sbjct  4     TEGATF-PLVAVAIDKDKGSQNALKWALDNIVDRGQTITLIHVNTKHPAPGHQED-PTFA  61

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
             G  S      +F PFR +  R+ +  K+  +EDTE+AKAI+ +++   +  +V+GA S+S
Sbjct  62    GSHSKD----LFVPFRCFCTRKNVQCKDIILEDTEIAKAIIEFVSHAAIEKLVVGAPSKS  117

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
                R F T DV T ++K APDFC+VY+ISKGK  S+R A R
Sbjct  118   GFGR-FRTTDVSTSISKGAPDFCTVYIISKGKVSSMRNAVR  157



>ref|XP_010927278.1| PREDICTED: U-box domain-containing protein 52-like [Elaeis guineensis]
Length=764

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/408 (73%), Positives = 353/408 (87%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EMKRL+LELKQTM+MYN AC+EAITAK+ A EL + K EE QR  +A+ AEE+AL
Sbjct  309   EDVEAEMKRLRLELKQTMEMYNTACREAITAKQKAMELHRWKTEEEQRLVEAKMAEESAL  368

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              +VE EKA C+AA+EAA+ +Q+IAE+EAQ+  +AEMKA KE  E+ RA  ++ +   RYR
Sbjct  369   ALVEREKANCRAALEAAQASQRIAELEAQKRAHAEMKALKEAEERKRAADIIPRPVVRYR  428

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             +Y+I++IE ATE F++  KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVEV
Sbjct  429   RYAIEDIEAATEYFAEHRKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQEVEV  488

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSL+DRL R+GNTP IPW+ RF+I+AEIA+ 
Sbjct  489   LSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDRLFRRGNTPVIPWQHRFRIAAEIASG  548

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPPSVAD+VTQY MTS AGT
Sbjct  549   LLFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPSVADNVTQYRMTSTAGT  608

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLG++LLQIITAKPPMGLTHHV RAIEKGT AD+LDP +
Sbjct  609   FCYIDPEYQQTGMLGVKSDVYSLGILLLQIITAKPPMGLTHHVGRAIEKGTLADILDPAV  668

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             +DWP+E A   A++SLQCAELR+KDRPDL +V+LPEL RL+EL  +++
Sbjct  669   TDWPMEAAQRLAEMSLQCAELRRKDRPDLATVVLPELERLRELGEETM  716


 Score =   117 bits (294),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 101/170 (59%), Gaps = 6/170 (4%)
 Frame = -3

Query  2363  DGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHK--ASPNHQNGGPDAH  2190
             DG     +  VA+DKDK+S +A+KW VDNL+ S   +IL+HV  K  ++ NH +G     
Sbjct  9     DGDAARHLVAVAIDKDKSSQNALKWAVDNLVASGETLILVHVNTKSPSAGNHDDGA--CF  66

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
                +D     +F PFR +  R+ I  ++  +E+ +VAKAIV +++   +  +V+G  +R 
Sbjct  67    KEPTDPQMKELFLPFRCFCTRKDIRCRDVVLEEQDVAKAIVEFVSNASIEKLVVGYPTRG  126

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNL-PTH  1863
                R F + D P+ +++ APDFC+VYVISKGK  S+R A RP   + P H
Sbjct  127   GFMR-FRSTDTPSNISRGAPDFCTVYVISKGKVLSMRNAIRPAPGISPLH  175



>ref|XP_011006664.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Populus 
euphratica]
Length=720

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/407 (74%), Positives = 355/407 (87%), Gaps = 0/407 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RLKLELKQTM+MY++ACKEA+TAK+  +ELQ+ KIEE Q+ E+AR AEEAAL 
Sbjct  272   DVEAEMRRLKLELKQTMEMYSSACKEALTAKQKTRELQRWKIEEGQKLEEARLAEEAALA  331

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK KAA+EAAE AQ+IAE+E+Q+   AEMKA KE  EK +AL  L+ SD RYR+
Sbjct  332   IAEKEKAKSKAAIEAAEAAQRIAELESQKRINAEMKACKEAEEKRKALDALANSDVRYRR  391

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE AT+ FS+++KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVEVL
Sbjct  392   YSIEEIEAATDYFSQALKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQEVEVL  451

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
               +RHPNMVLLLGACPEYGCLVYE+M NGSLEDRL  +GNTP + W++RF+I+AEI T L
Sbjct  452   CCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFCRGNTPPLSWQLRFRIAAEIGTGL  511

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD+VTQY MTS AGTF
Sbjct  512   LFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADNVTQYRMTSTAGTF  571

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG++ LQ++TAKP MGLTHHV+RA+EKGTFA +LDP + 
Sbjct  572   CYIDPEYQQTGMLGIKSDIYSLGIVFLQVLTAKPAMGLTHHVDRALEKGTFAQMLDPAVP  631

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             DWP+EEA  FAKL+L+CAELR+KDRPDLG V+LPEL R++  A +++
Sbjct  632   DWPIEEATLFAKLALKCAELRRKDRPDLGKVVLPELKRMRAFAEETM  678


 Score = 89.0 bits (219),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = -3

Query  2186  GMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSA  2007
             G S  D   +F PFR +  R+ I  K+  +EDT+VAKA++ Y+    +  +++GAS++  
Sbjct  20    GTSSPDSKDLFLPFRCFCTRKDINCKDVVLEDTDVAKALIEYVTQTAIETLIVGASAKGG  79

Query  2006  ISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
               R F   DV   V+K APDFC+VYVI+KGK QS+R A+R
Sbjct  80    FLR-FKAADVAGSVSKGAPDFCTVYVIAKGKIQSMRAASR  118



>ref|XP_011006665.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Populus 
euphratica]
Length=719

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/407 (74%), Positives = 355/407 (87%), Gaps = 0/407 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RLKLELKQTM+MY++ACKEA+TAK+  +ELQ+ KIEE Q+ E+AR AEEAAL 
Sbjct  271   DVEAEMRRLKLELKQTMEMYSSACKEALTAKQKTRELQRWKIEEGQKLEEARLAEEAALA  330

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK KAA+EAAE AQ+IAE+E+Q+   AEMKA KE  EK +AL  L+ SD RYR+
Sbjct  331   IAEKEKAKSKAAIEAAEAAQRIAELESQKRINAEMKACKEAEEKRKALDALANSDVRYRR  390

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE AT+ FS+++KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVEVL
Sbjct  391   YSIEEIEAATDYFSQALKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQEVEVL  450

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
               +RHPNMVLLLGACPEYGCLVYE+M NGSLEDRL  +GNTP + W++RF+I+AEI T L
Sbjct  451   CCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFCRGNTPPLSWQLRFRIAAEIGTGL  510

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD+VTQY MTS AGTF
Sbjct  511   LFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADNVTQYRMTSTAGTF  570

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG++ LQ++TAKP MGLTHHV+RA+EKGTFA +LDP + 
Sbjct  571   CYIDPEYQQTGMLGIKSDIYSLGIVFLQVLTAKPAMGLTHHVDRALEKGTFAQMLDPAVP  630

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             DWP+EEA  FAKL+L+CAELR+KDRPDLG V+LPEL R++  A +++
Sbjct  631   DWPIEEATLFAKLALKCAELRRKDRPDLGKVVLPELKRMRAFAEETM  677


 Score = 89.0 bits (219),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = -3

Query  2186  GMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSA  2007
             G S  D   +F PFR +  R+ I  K+  +EDT+VAKA++ Y+    +  +++GAS++  
Sbjct  20    GTSSPDSKDLFLPFRCFCTRKDINCKDVVLEDTDVAKALIEYVTQTAIETLIVGASAKGG  79

Query  2006  ISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
               R F   DV   V+K APDFC+VYVI+KGK QS+R A+R
Sbjct  80    FLR-FKAADVAGSVSKGAPDFCTVYVIAKGKIQSMRAASR  118



>ref|XP_011082098.1| PREDICTED: U-box domain-containing protein 34-like isoform X3 
[Sesamum indicum]
Length=634

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/415 (72%), Positives = 357/415 (86%), Gaps = 0/415 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             ++E+EM+RLK ELKQTMDMY+ ACKEA++A++ AKELQ+ K+EE +R E+AR AEEAAL 
Sbjct  192   EVEAEMRRLKQELKQTMDMYSTACKEALSAREKAKELQRWKMEEQKRLEEARLAEEAALA  251

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK +AA+E AE AQ+IAE+EAQ+   AEMKA KE  EK R LS LS+ DCRYRK
Sbjct  252   LAEKEKAKSRAALEHAEAAQRIAELEAQKRINAEMKALKEAEEKTRVLSSLSQPDCRYRK  311

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE ATE F++S KIGEGGYGPVY+  LDHTPVA+KVLRPDA  GR QFQQEVE+L
Sbjct  312   YTIEEIEVATEYFAQSRKIGEGGYGPVYKCYLDHTPVAVKVLRPDATHGRSQFQQEVEIL  371

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPEYGCLVYEYM NGSLED L+++G TP + W+ RF+I+AEI T L
Sbjct  372   SCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDCLVQRGKTPPLSWQHRFRIAAEIGTGL  431

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY MTS AGTF
Sbjct  432   LFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRMTSTAGTF  491

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG++ LQI+T KPPMGLTHHVERAIE+G F ++LDP++ 
Sbjct  492   CYIDPEYQQTGMLGVKSDIYSLGIIFLQILTGKPPMGLTHHVERAIERGAFREMLDPSVP  551

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQT  297
             DWP+EEAL FAKL+L+C+ELR+KDRPDLG V+LP LN+L+E A +SL + + + T
Sbjct  552   DWPLEEALEFAKLALKCSELRRKDRPDLGKVVLPYLNKLREQAEESLYNSSQSCT  606



>ref|XP_008781717.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Phoenix 
dactylifera]
Length=770

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/419 (72%), Positives = 357/419 (85%), Gaps = 3/419 (1%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EMKRL+LELKQTMDMY+ ACKEA+TAK+ AKEL   K+EE +R E+A  AEEAAL
Sbjct  315   EDVEAEMKRLRLELKQTMDMYSTACKEALTAKQKAKELHHWKMEEERRLEEAHMAEEAAL  374

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKA+CKAA+EAAE +++IA++EA +   AEMKA KE  EK RAL  L+ +D RYR
Sbjct  375   ALAEKEKARCKAAIEAAEASKRIAKLEAHKRINAEMKALKEAEEKKRALDALAHTDVRYR  434

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE ATE FS+  KIGEGGYGPVY+  L+HTPVAIKVLRPDAAQGR QFQQEVE+
Sbjct  435   KYTIEEIEVATEYFSEKRKIGEGGYGPVYKCYLEHTPVAIKVLRPDAAQGRSQFQQEVEI  494

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS MRHPNMVLLLGACPEYGCLVYEYM NGSLEDRL ++GNTP IPW+ RF+I+AEI T 
Sbjct  495   LSCMRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFQQGNTPPIPWQHRFRIAAEIGTG  554

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVA++VTQY MTS AGT
Sbjct  555   LLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVAENVTQYRMTSTAGT  614

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQ+G LG KSDIYSLG++LLQ+ITA+PPMGLTHHVE AIEKGTF ++LDP++
Sbjct  615   FCYIDPEYQQSGMLGVKSDIYSLGIVLLQLITARPPMGLTHHVEHAIEKGTFTEVLDPSV  674

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA---LQSLASKNGTQT  297
              DWPVEEAL  A ++L CAELR+KDRPDL +++LPEL RL+ LA   +Q  AS   + T
Sbjct  675   IDWPVEEALSLANIALNCAELRRKDRPDLATIVLPELERLRNLAEENMQHCASFGSSHT  733


 Score =   124 bits (310),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 8/161 (5%)
 Frame = -3

Query  2366  SDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHK-ASPNHQNGGPDAH  2190
             ++GAT  P+  VA+DKDK S +A+KW +DN++     + L+HV  K  +P HQ   P   
Sbjct  25    TEGATF-PLVAVAIDKDKGSQNALKWALDNIVDRGQTITLIHVNTKHPAPGHQED-PTFA  82

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
             G  S      +F PFR +  R+ +  K+  +EDTE+AKAI+ +++   +  +V+GA S+S
Sbjct  83    GSHSKD----LFVPFRCFCTRKNVQCKDIILEDTEIAKAIIEFVSHAAIEKLVVGAPSKS  138

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
                R F T DV T ++K APDFC+VY+ISKGK  S+R A R
Sbjct  139   GFGR-FRTTDVSTSISKGAPDFCTVYIISKGKVSSMRNAVR  178



>ref|XP_011006666.1| PREDICTED: U-box domain-containing protein 35 isoform X3 [Populus 
euphratica]
Length=718

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/407 (74%), Positives = 355/407 (87%), Gaps = 0/407 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RLKLELKQTM+MY++ACKEA+TAK+  +ELQ+ KIEE Q+ E+AR AEEAAL 
Sbjct  270   DVEAEMRRLKLELKQTMEMYSSACKEALTAKQKTRELQRWKIEEGQKLEEARLAEEAALA  329

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK KAA+EAAE AQ+IAE+E+Q+   AEMKA KE  EK +AL  L+ SD RYR+
Sbjct  330   IAEKEKAKSKAAIEAAEAAQRIAELESQKRINAEMKACKEAEEKRKALDALANSDVRYRR  389

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE AT+ FS+++KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVEVL
Sbjct  390   YSIEEIEAATDYFSQALKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQEVEVL  449

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
               +RHPNMVLLLGACPEYGCLVYE+M NGSLEDRL  +GNTP + W++RF+I+AEI T L
Sbjct  450   CCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFCRGNTPPLSWQLRFRIAAEIGTGL  509

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD+VTQY MTS AGTF
Sbjct  510   LFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADNVTQYRMTSTAGTF  569

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG++ LQ++TAKP MGLTHHV+RA+EKGTFA +LDP + 
Sbjct  570   CYIDPEYQQTGMLGIKSDIYSLGIVFLQVLTAKPAMGLTHHVDRALEKGTFAQMLDPAVP  629

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             DWP+EEA  FAKL+L+CAELR+KDRPDLG V+LPEL R++  A +++
Sbjct  630   DWPIEEATLFAKLALKCAELRRKDRPDLGKVVLPELKRMRAFAEETM  676


 Score = 89.0 bits (219),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = -3

Query  2186  GMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSA  2007
             G S  D   +F PFR +  R+ I  K+  +EDT+VAKA++ Y+    +  +++GAS++  
Sbjct  18    GTSSPDSKDLFLPFRCFCTRKDINCKDVVLEDTDVAKALIEYVTQTAIETLIVGASAKGG  77

Query  2006  ISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
               R F   DV   V+K APDFC+VYVI+KGK QS+R A+R
Sbjct  78    FLR-FKAADVAGSVSKGAPDFCTVYVIAKGKIQSMRAASR  116



>ref|XP_009590276.1| PREDICTED: U-box domain-containing protein 52 isoform X3 [Nicotiana 
tomentosiformis]
Length=685

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/654 (53%), Positives = 440/654 (67%), Gaps = 67/654 (10%)
 Frame = -3

Query  2078  KAIVGYINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISK-GKQQSI  1902
             KAIV Y+N   +  ++LGA+++  + R+F   D+P  V K  PDFC+VYVISK GK  + 
Sbjct  32    KAIVEYVNRTAIEVLILGAAAKGGLLRRFKVKDIPGNVVKGVPDFCTVYVISKNGKISAT  91

Query  1901  RPAAR--PLTNLPTHIWshhgsssrassrgssaasssAGDDRI-----------------  1779
             R A+R  P  +   H +   G++   ++  S    S      I                 
Sbjct  92    RSASRLAPFIHPLRHQFMQQGNAKSNTTEDSLNTPSRGSLSGIPKPVSDLPMSNLQSDTL  151

Query  1778  ---SACSSRGEHSGRPFRRSEDRDADGSVRRPWNSSCRNSLAEDNDLFAPISDGFDNAAA  1608
                S  + R   +G+P+  S+  D D S    + SS R S+   +++F   +D +D+ A 
Sbjct  152   NMKSPFTHRKGPNGKPYEISQP-DTDIS----FVSSGRPSI---DNMFPSFADNYDSGAT  203

Query  1607  AQNL----DFTRisdagsdassiaSKDLESEMKRLKL-----------------------  1509
                L    DF   +         +   + SE+  L +                       
Sbjct  204   PPRLSGFSDFEAQNFEPIPLGRRSLDIMPSELSFLSMEGDRASFSSTPDDVAAEMRRLKL  263

Query  1508  ELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakcka  1329
             ELKQTM+MY+ ACKEA+TA++ A ELQ+ K EE +R E+AR AEEAAL + E EKAK +A
Sbjct  264   ELKQTMEMYSTACKEALTAQQKAMELQRWKTEEQRRLEEARFAEEAALALAEKEKAKSRA  323

Query  1328  ameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFATE  1149
             A+E AE AQ++AE+EAQ+   AEMKA KE  E+N+ L+ LS SD RYR+Y+I+EIE AT+
Sbjct  324   ALEHAEAAQRLAELEAQKRINAEMKALKEAEERNKVLNKLSNSDFRYRRYTIEEIETATD  383

Query  1148  KFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMVLL  969
              F+++ KIGEGGYGPVY+  +DHTPVA+KVLRPDAA GR+QFQQEVEVLS +RHPNMVLL
Sbjct  384   YFAQANKIGEGGYGPVYKCYMDHTPVAVKVLRPDAAHGRQQFQQEVEVLSCIRHPNMVLL  443

Query  968   LGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPEPL  789
             LGACPEYGCLVYE+M NGSLEDRL ++G TP + W+ RF+I+AEI   LLFLHQSKPEP+
Sbjct  444   LGACPEYGCLVYEFMSNGSLEDRLFQRGKTPPLSWQQRFRIAAEIGAGLLFLHQSKPEPI  503

Query  788   VHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQTG  609
             VHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGTFCYIDPEYQQTG
Sbjct  504   VHRDLKPANILLDRNFVSKISDVGLARLVPPSVADCVTQYRMTSTAGTFCYIDPEYQQTG  563

Query  608   KLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALHFA  429
              LG KSD+YSLG++ LQI+TAKPPMGLTHHVERAIEKGTF ++LD ++ DWP++EAL+ A
Sbjct  564   MLGIKSDVYSLGIIFLQILTAKPPMGLTHHVERAIEKGTFNEMLDSSVPDWPLDEALNLA  623

Query  428   KLSLQCAELRKKDRPDLGSVILPELNRLKELALQ---------SLASKNGTQTF  294
             KLSL+C+ELR+KDRPDL  VI+PEL RL+ L  +         S +S N +Q F
Sbjct  624   KLSLKCSELRRKDRPDLSKVIMPELERLRTLGEENPCQSPLYSSGSSTNHSQAF  677



>ref|XP_007014562.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 2 [Theobroma cacao]
 gb|EOY32181.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 2 [Theobroma cacao]
Length=563

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/407 (74%), Positives = 348/407 (86%), Gaps = 1/407 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RL+ ELKQTMDMY+ ACKEA+TAK+ AKEL   K++E Q+ E+AR +EEAAL 
Sbjct  105   DVEAEMRRLRQELKQTMDMYSAACKEALTAKQRAKELHSWKLQEEQKIEEARLSEEAALS  164

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAKCKAA+EAA+ AQ+IAE+EAQ+   AE KA KE  E+  A   L   D RYR+
Sbjct  165   LAEKEKAKCKAAIEAAQAAQRIAELEAQKRINAEKKASKEADERKMAKKSLGH-DLRYRR  223

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE ATE FS S KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQG  QF QEVEVL
Sbjct  224   YTIEEIEAATEHFSPSRKIGEGGYGPVYKCNLDHTPVAIKVLRPDAAQGESQFHQEVEVL  283

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPEYGCLVYEYM NG+LEDRL R+ NTP +PW++RF+I+AEIAT L
Sbjct  284   SCIRHPNMVLLLGACPEYGCLVYEYMANGNLEDRLFRRNNTPVLPWQVRFRIAAEIATGL  343

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVA+ VTQYHMTS AGTF
Sbjct  344   LFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVANSVTQYHMTSTAGTF  403

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LGTKSDIYSLG++LLQIITAKPPMGLTHHVE AIE G+F  +LDP + 
Sbjct  404   CYIDPEYQQTGMLGTKSDIYSLGILLLQIITAKPPMGLTHHVEHAIENGSFTGILDPAVL  463

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             DWPVEEAL FAKL+L+C+ELR+KDRPDLG V+LPE NRL+ L  +++
Sbjct  464   DWPVEEALIFAKLALKCSELRRKDRPDLGQVVLPEFNRLRALGEENM  510



>ref|XP_010527112.1| PREDICTED: U-box domain-containing protein 52-like [Tarenaya 
hassleriana]
Length=782

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/409 (75%), Positives = 354/409 (87%), Gaps = 0/409 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK+ A ELQ+ K+EE ++ E+AR AEEAAL 
Sbjct  342   DVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAMELQRWKLEEGRKLEEARHAEEAALA  401

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK KAA+EAAE AQ+IAE+EAQ+   AEMKA KE  EK +AL+ L+ SD RYRK
Sbjct  402   IAEKEKAKSKAAIEAAEAAQRIAELEAQKRVNAEMKALKEAEEKTKALNALAHSDVRYRK  461

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE ATE F++  KIGEGGYGPV++  LDHTPVA+KVLRPDAAQGR QFQQEVEVL
Sbjct  462   YSIEEIERATEFFAEKYKIGEGGYGPVFKCFLDHTPVAVKVLRPDAAQGRSQFQQEVEVL  521

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPE GCLVYE+M NGSLEDRL R+GN+P + W+ RF+ISAEI T L
Sbjct  522   SCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRRGNSPPLSWQTRFRISAEIGTGL  581

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKPANILLDRNFVSKI+DVGLARLVPPSVAD+VTQY MTS AGTF
Sbjct  582   LFLHQTKPEPLVHRDLKPANILLDRNFVSKIADVGLARLVPPSVADNVTQYRMTSTAGTF  641

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG+M LQ++TAK PMGLTH+VERAIEKGTF D+LDP + 
Sbjct  642   CYIDPEYQQTGMLGVKSDIYSLGIMFLQLLTAKSPMGLTHYVERAIEKGTFRDMLDPAVP  701

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
             DWPVEEA  FAK++L+CAELR+KDRPDL  VILPELNRL+ LA +S  S
Sbjct  702   DWPVEEATEFAKMALKCAELRRKDRPDLAKVILPELNRLRLLAEESTQS  750


 Score =   117 bits (292),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 99/172 (58%), Gaps = 14/172 (8%)
 Frame = -3

Query  2363  DGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGG  2184
             +G   G +  VA+DKDKNS +A+KW VD+LL     V+L+HV+ + S    +   ++   
Sbjct  22    EGGANG-LVAVAIDKDKNSQNALKWAVDHLLQRGQSVVLIHVKIQPSSLSPSPSLNSTSK  80

Query  2183  MS--DHDGHCV-----------FTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRV  2043
             +S  D D   V           F PFR +  R+ I  KE  +E+++VAKA+V Y+N   +
Sbjct  81    LSHIDDDASLVCKEPEGPFRELFLPFRCFCTRKDIQCKEVLVEESDVAKALVEYVNQAGI  140

Query  2042  SNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
               +V+G SS+S   R     D+P  + + APDFC+VYVISKGK  ++R A+R
Sbjct  141   EVLVIGTSSKSGFLRFSKPTDIPGTITRAAPDFCTVYVISKGKISTMRSASR  192



>ref|XP_006584790.1| PREDICTED: U-box domain-containing protein 35-like [Glycine max]
Length=789

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/408 (71%), Positives = 346/408 (85%), Gaps = 6/408 (1%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +++E+E++RLKLELKQTM+MY++ CKEA TAK+ A ELQ+ K+EE ++ E  R AE  AL
Sbjct  332   EEVEAEVRRLKLELKQTMEMYSSVCKEATTAKQKALELQRWKVEEQRKLEDTRLAEGTAL  391

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              M E EK KC AAM++AE ++KIAE+EAQ+      +   E+  K + + +LS S  RYR
Sbjct  392   AMAEREKVKCMAAMKSAETSRKIAELEAQK------RISVESEHKKKNVDILSHSPVRYR  445

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE AT+ FS S+KIGEGGYGPVYR +LDHTPVAIKVL+PDAAQGR QFQQEVEV
Sbjct  446   KYTIEEIEEATKFFSNSLKIGEGGYGPVYRSELDHTPVAIKVLKPDAAQGRSQFQQEVEV  505

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPE+GCLVYEYM NGSL+D L R+GN PA+PW++RF+I+AEIAT 
Sbjct  506   LSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDCLFRRGNKPALPWQLRFRIAAEIATG  565

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPP VAD VTQY MTS AGT
Sbjct  566   LLFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPKVADTVTQYRMTSTAGT  625

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLG+MLLQ+ITAKPPMGLTHHV R+IE GTFAD+LDP +
Sbjct  626   FCYIDPEYQQTGMLGIKSDVYSLGIMLLQMITAKPPMGLTHHVGRSIENGTFADMLDPAV  685

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWPVE ALHFAKLSL CAE+R+KDRPDLG V+LPELN+L++ A +++
Sbjct  686   EDWPVEHALHFAKLSLACAEMRRKDRPDLGKVVLPELNKLRDFADENM  733


 Score =   122 bits (305),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 102/172 (59%), Gaps = 11/172 (6%)
 Frame = -3

Query  2348  GPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS----PNHQ----NGGPD-  2196
             G +  VA++ +K S  A KW VDNLL  +  ++L+HVR KAS    P       +G  D 
Sbjct  13    GRVVAVAIENNKTSQYAAKWAVDNLLPKDQALLLVHVRQKASSIPTPTGNLVSLDGNDDV  72

Query  2195  --AHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
               A+    D++   +F  FR +  R+ I  KE  +ED +++K ++  I+ + V  +VLGA
Sbjct  73    TRAYMQQMDNESKELFASFRVFCNRKSIQCKEILLEDMDISKGLIEGISKYSVELLVLGA  132

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPT  1866
             +SRS + R+F   D+P+ V+K AP FC+VY+I+KGK  S++ +  PLT  P+
Sbjct  133   ASRSGLVRRFRISDIPSAVSKGAPPFCTVYIIAKGKISSVKTSTAPLTAKPS  184



>gb|KHN16699.1| U-box domain-containing protein 35 [Glycine soja]
Length=789

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/408 (71%), Positives = 346/408 (85%), Gaps = 6/408 (1%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +++E+E++RLKLELKQTM+MY++ CKEA TAK+ A ELQ+ K+EE ++ E  R AE  AL
Sbjct  332   EEVEAEVRRLKLELKQTMEMYSSVCKEATTAKQKALELQRWKVEEQRKLEDTRLAEGTAL  391

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              M E EK KC AAM++AE ++KIAE+EAQ+      +   E+  K + + +LS S  RYR
Sbjct  392   AMAEREKVKCMAAMKSAETSRKIAELEAQK------RISVESEHKKKNVDILSHSPVRYR  445

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+I+EIE AT+ FS S+KIGEGGYGPVYR +LDHTPVAIKVL+PDAAQGR QFQQEVEV
Sbjct  446   KYTIEEIEEATKFFSNSLKIGEGGYGPVYRSELDHTPVAIKVLKPDAAQGRSQFQQEVEV  505

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPE+GCLVYEYM NGSL+D L R+GN PA+PW++RF+I+AEIAT 
Sbjct  506   LSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDCLFRRGNKPALPWQLRFRIAAEIATG  565

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPP VAD VTQY MTS AGT
Sbjct  566   LLFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPKVADTVTQYRMTSTAGT  625

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLG+MLLQ+ITAKPPMGLTHHV R+IE GTFAD+LDP +
Sbjct  626   FCYIDPEYQQTGMLGIKSDVYSLGIMLLQMITAKPPMGLTHHVGRSIENGTFADMLDPAV  685

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWPVE ALHFAKLSL CAE+R+KDRPDLG V+LPELN+L++ A +++
Sbjct  686   EDWPVEHALHFAKLSLACAEMRRKDRPDLGKVVLPELNKLRDFADENM  733


 Score =   123 bits (308),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 102/172 (59%), Gaps = 11/172 (6%)
 Frame = -3

Query  2348  GPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKAS----PNHQ----NGGPD-  2196
             G +  VA++ +K S  A KW VDNLL  +  ++L+HVR KAS    P       +G  D 
Sbjct  13    GRVVAVAIENNKTSQYAAKWAVDNLLPKDQALLLVHVRQKASSIPTPTGNLVSLDGNDDV  72

Query  2195  --AHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGA  2022
               A+    D++   +F  FR +  R+ I  KE  +ED +++K ++  I+ + V  +VLGA
Sbjct  73    TRAYMQQMDNESKELFASFRVFCNRKSIQCKEILLEDMDISKGLIEGISKYSVELLVLGA  132

Query  2021  SSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTNLPT  1866
             +SRS + R+F   D+P+ V+K AP FC+VY+I+KGK  S++ A  PLT  P+
Sbjct  133   ASRSGLVRRFRISDIPSAVSKGAPPFCTVYIIAKGKISSVKTATAPLTAKPS  184



>ref|XP_009396581.1| PREDICTED: U-box domain-containing protein 35-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/418 (70%), Positives = 354/418 (85%), Gaps = 1/418 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+E++RLKLELKQTMDMY+ ACKEA+TAK+   ELQ+ K++E +R + AR AEE AL
Sbjct  296   EDVEAEIRRLKLELKQTMDMYSTACKEALTAKQKTMELQRWKMDEEKRIKDARLAEEEAL  355

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKA+C AA++ AE +++IAE EA +   AEMKA K+  +K +A   LS ++ RYR
Sbjct  356   ALAESEKARCVAAIQTAEASKRIAENEAHKRISAEMKAFKDAEDKKKAFDALSHTNLRYR  415

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             +Y+I+EIE AT+ F++  KIGEGGYGPVYR  LDHTPVAIKVLRPDAAQGR QFQQEVE+
Sbjct  416   RYTIEEIEVATDYFAEERKIGEGGYGPVYRCTLDHTPVAIKVLRPDAAQGRSQFQQEVEI  475

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             L  +RHPNMVLLLGACPEYGCLVYEYM NGSL+DRL R+GNTP IPW+ RF+I+AEI T 
Sbjct  476   LCCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDRLFRRGNTPPIPWQHRFRIAAEIGTG  535

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ++PEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY MT+ AGT
Sbjct  536   LLFLHQTRPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADTVTQYRMTATAGT  595

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSDIYSLG+MLLQIIT KPPMGLTHHVER+IEKGTF ++LD ++
Sbjct  596   FCYIDPEYQQTGMLGIKSDIYSLGIMLLQIITGKPPMGLTHHVERSIEKGTFIEMLDHSV  655

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLA-SKNGTQTF  294
              DWPVEEAL  AK+SL+CAELR+KDRPDL + ILPELNRL++LA +++  S  GT ++
Sbjct  656   PDWPVEEALSLAKMSLKCAELRRKDRPDLATAILPELNRLRDLAEENMQFSPFGTGSY  713


 Score =   131 bits (330),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 96/160 (60%), Gaps = 6/160 (4%)
 Frame = -3

Query  2363  DGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGG  2184
             DGA + P+  VA+DKDKNS SA KW +DN++     + L+HV  K S  +++        
Sbjct  8     DGAAS-PLVAVAIDKDKNSQSAFKWALDNVVTKGQTLTLVHVNTKPSSGYEDDAAAVANT  66

Query  2183  MSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAI  2004
             + +     +F PFR +  R+ +  K+  +EDT+VAKAI  ++    V  +V+G+SSRS  
Sbjct  67    IRE-----IFVPFRCFCTRKNVQCKDVVLEDTDVAKAITEFVTNAAVEKLVIGSSSRSGF  121

Query  2003  SRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
              R F + D+ T + K  PDFCSVY+ISKGK  S+R A RP
Sbjct  122   VRSFRSTDLSTTICKGVPDFCSVYIISKGKVSSMRNAVRP  161



>ref|XP_006382208.1| hypothetical protein POPTR_0006s29380g, partial [Populus trichocarpa]
 gb|ERP60005.1| hypothetical protein POPTR_0006s29380g, partial [Populus trichocarpa]
Length=784

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/407 (74%), Positives = 355/407 (87%), Gaps = 0/407 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RLKLELKQTM+MY++AC+EA+TAK+  +ELQ+ KIEE Q+ E+AR AEEAAL 
Sbjct  354   DVEAEMRRLKLELKQTMEMYSSACREALTAKQKTRELQRWKIEEEQKLEEARLAEEAALA  413

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK KAA+EAAE AQ+IAE+E+Q+   AEMKA+KE  EK +AL  L+ SD RYR+
Sbjct  414   IAEKEKAKSKAAIEAAEAAQRIAELESQKRINAEMKARKEAEEKRKALDALANSDVRYRR  473

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE AT+ FS+S+KIGEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVEVL
Sbjct  474   YSIEEIEAATDYFSQSLKIGEGGYGPVYKSYLDHTPVAIKVLRPDAAQGRSQFQQEVEVL  533

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
               +RHPNMVLLLGACPEYGCLVYE+M NGSLEDRL  +GN+P + W++RF+I+AEI T L
Sbjct  534   CCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFCRGNSPPLSWQLRFRIAAEIGTGL  593

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVAD+VTQY MTS AGTF
Sbjct  594   LFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADNVTQYRMTSTAGTF  653

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG+M LQ++TAKP MGLTHHV+RA+EKGTFA +LDP + 
Sbjct  654   CYIDPEYQQTGMLGIKSDIYSLGIMFLQVLTAKPAMGLTHHVDRALEKGTFAQMLDPAVP  713

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             DWP+EEA  F KL+L+CAELR+KDRPDLG V+LPEL R++  A +S+
Sbjct  714   DWPIEEATLFGKLALKCAELRRKDRPDLGKVVLPELKRMRAFAEESM  760


 Score =   131 bits (330),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 96/157 (61%), Gaps = 5/157 (3%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAH-----GGMS  2178
             +  VA+DKDK S  A+KWT+DNLL+    VIL+HV  K+S +     P  +      G S
Sbjct  17    LIAVAIDKDKGSQIALKWTIDNLLVKGQTVILIHVNLKSSLSSYYASPRLNQISDSNGTS  76

Query  2177  DHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISR  1998
               D   +F PFR +  R+ I  K+  +EDT+VAKA+  Y+    +  +++GAS++    R
Sbjct  77    SPDSKDLFLPFRCFCTRKDINCKDVVLEDTDVAKALTEYVTQTAIETLIVGASAKGGFLR  136

Query  1997  KFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
             +F   DV   V+K APDFC+VYVI+KGK QS+R A+R
Sbjct  137   RFKAADVAGSVSKGAPDFCTVYVIAKGKIQSMRAASR  173



>gb|EMT25251.1| Lycopene epsilon cyclase, chloroplastic [Aegilops tauschii]
Length=1224

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/405 (76%), Positives = 359/405 (89%), Gaps = 0/405 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +++E+EM+RLKLELKQTMDMYN ACKEAI AK+ AKE+  +K+EE++R E+ARQ+EEAAL
Sbjct  783   REVEAEMRRLKLELKQTMDMYNAACKEAINAKQRAKEMHLLKMEEARRLEEARQSEEAAL  842

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + EMEK KC+AAME AE AQ++A++EAQR + AE++A++E  EK RAL  ++  D RYR
Sbjct  843   ALAEMEKVKCRAAMETAEAAQRLADLEAQRRRNAEVRARREADEKVRALDAIANHDFRYR  902

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KY+IDEIE ATE FS+S+KIGEGGYGPVY   LDHTPVAIKVLRPDA QGRKQFQQEVEV
Sbjct  903   KYTIDEIEIATEGFSESLKIGEGGYGPVYSASLDHTPVAIKVLRPDAQQGRKQFQQEVEV  962

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYMENGSLEDRL R+G TP +PW  R +ISAEIATA
Sbjct  963   LSCIRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLYRRGGTPTLPWSQRVRISAEIATA  1022

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDR++VSKISDVGLARLVPP+VAD VTQY +T+ AGT
Sbjct  1023  LLFLHQTKPEPLVHRDLKPANILLDRHYVSKISDVGLARLVPPAVADSVTQYRLTATAGT  1082

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTGKLG KSDIYSLGV+LLQ+ITA+PPMGLTHHVE+AIE GTFA +LD T+
Sbjct  1083  FCYIDPEYQQTGKLGVKSDIYSLGVLLLQVITARPPMGLTHHVEKAIESGTFAQMLDITV  1142

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
              DWPVE+AL FAKLSLQC E+R++DRPDLG+VILPELNRL+ L +
Sbjct  1143  KDWPVEDALGFAKLSLQCTEMRRRDRPDLGTVILPELNRLRNLGI  1187


 Score =   121 bits (303),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 96/149 (64%), Gaps = 1/149 (1%)
 Frame = -3

Query  2336  VVAVDKDKNSASAVKWTVDNLLISNPFVILLHVR-HKASPNHQNGGPDAHGGMSDHDGHC  2160
             VVA+D+D+NS  A+KW VD+LL     +ILLHV  H  + NH     +      + +   
Sbjct  535   VVAIDRDRNSQLAMKWVVDHLLSGASHIILLHVAAHPPAANHGFAMAETTQDALEAEMME  594

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F PFR + +R G+   E  +E+ +V KAI+ YI+ +++ ++ LGAS+R+A ++K+   D
Sbjct  595   IFVPFRGFCSRNGVQESEVILEEADVPKAIIDYISANKIQSIALGASNRNAFTKKWKNPD  654

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPA  1893
             VP+ + K APD+C++YV++KGK  ++R A
Sbjct  655   VPSSLMKGAPDYCNIYVVAKGKPVNVRLA  683



>ref|XP_011082097.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Sesamum indicum]
Length=722

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/415 (72%), Positives = 357/415 (86%), Gaps = 0/415 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             ++E+EM+RLK ELKQTMDMY+ ACKEA++A++ AKELQ+ K+EE +R E+AR AEEAAL 
Sbjct  280   EVEAEMRRLKQELKQTMDMYSTACKEALSAREKAKELQRWKMEEQKRLEEARLAEEAALA  339

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK +AA+E AE AQ+IAE+EAQ+   AEMKA KE  EK R LS LS+ DCRYRK
Sbjct  340   LAEKEKAKSRAALEHAEAAQRIAELEAQKRINAEMKALKEAEEKTRVLSSLSQPDCRYRK  399

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE ATE F++S KIGEGGYGPVY+  LDHTPVA+KVLRPDA  GR QFQQEVE+L
Sbjct  400   YTIEEIEVATEYFAQSRKIGEGGYGPVYKCYLDHTPVAVKVLRPDATHGRSQFQQEVEIL  459

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPEYGCLVYEYM NGSLED L+++G TP + W+ RF+I+AEI T L
Sbjct  460   SCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDCLVQRGKTPPLSWQHRFRIAAEIGTGL  519

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY MTS AGTF
Sbjct  520   LFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRMTSTAGTF  579

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG++ LQI+T KPPMGLTHHVERAIE+G F ++LDP++ 
Sbjct  580   CYIDPEYQQTGMLGVKSDIYSLGIIFLQILTGKPPMGLTHHVERAIERGAFREMLDPSVP  639

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQT  297
             DWP+EEAL FAKL+L+C+ELR+KDRPDLG V+LP LN+L+E A +SL + + + T
Sbjct  640   DWPLEEALEFAKLALKCSELRRKDRPDLGKVVLPYLNKLREQAEESLYNSSQSCT  694


 Score = 75.5 bits (184),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 64/112 (57%), Gaps = 6/112 (5%)
 Frame = -3

Query  2204  GPDAHGGMSDHDG-----HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVS  2040
             GP  +  ++D  G       +F PFR Y  R+ I   +  ++DT+VA++++ ++    + 
Sbjct  13    GPSNNSDITDEIGDDAQLKELFLPFRVYCTRKDIQCYDVVLDDTDVARSLIEFVKQSAID  72

Query  2039  NVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
              +V+GA+++ +I R F   D+   V K  PDFC+VYVI KGK  S + A RP
Sbjct  73    MLVVGATAKGSIFR-FKMKDIAGTVLKGVPDFCTVYVIHKGKISSTKAACRP  123



>ref|XP_009362073.1| PREDICTED: U-box domain-containing protein 35 [Pyrus x bretschneideri]
Length=728

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/402 (76%), Positives = 347/402 (86%), Gaps = 1/402 (0%)
 Frame = -3

Query  1538  LESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRM  1359
             +E+EM+RL+LELKQTMDMY+ ACKEA+TAK+ A EL + K+EE QR EQ R A+EAAL +
Sbjct  269   MEAEMRRLRLELKQTMDMYSTACKEALTAKQKATELHRWKLEEEQRLEQVRLAQEAALAL  328

Query  1358  VemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKY  1179
              E EK KC AAMEAAE AQ+IA MEAQ+ + AEMKA KE  EK +A+   +  D  +RKY
Sbjct  329   AENEKLKCMAAMEAAEAAQRIAVMEAQKRRNAEMKAFKEAEEKKKAIEAKT-YDFMFRKY  387

Query  1178  SIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS  999
             +I+EIE AT  FS   KIGEGGYGPVYRG+LDHTPVAIKVLRPDAAQG+ QFQQEV+VL 
Sbjct  388   TIEEIEAATNNFSSVHKIGEGGYGPVYRGELDHTPVAIKVLRPDAAQGQSQFQQEVQVLC  447

Query  998   LMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALL  819
              +RHPNMVLLLGAC EYGCLVYEYM NGSLEDRLL++GNTP IPW++RF+I+AEI T LL
Sbjct  448   CIRHPNMVLLLGACAEYGCLVYEYMANGSLEDRLLQRGNTPVIPWQLRFQIAAEIGTGLL  507

Query  818   FLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFC  639
             FLHQ+KPEP+VHRDLKPANILLD N+VSKISDVGLARLVPPSVAD VTQYHMTS AGT C
Sbjct  508   FLHQTKPEPIVHRDLKPANILLDHNYVSKISDVGLARLVPPSVADSVTQYHMTSTAGTLC  567

Query  638   YIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISD  459
             YIDPEYQQTG LG KSDIYSLGVM LQ+ITAKPPMGLTHHV+RAIEKGTFA++LDP + D
Sbjct  568   YIDPEYQQTGMLGVKSDIYSLGVMFLQLITAKPPMGLTHHVQRAIEKGTFAEMLDPAVPD  627

Query  458   WPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             WPVEEAL FAKL+LQCAELR+KDRPDLG V+LPELNRL+ LA
Sbjct  628   WPVEEALKFAKLALQCAELRRKDRPDLGKVVLPELNRLRALA  669


 Score = 82.8 bits (203),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F PFR +  ++ +   E  IED  +AKA+V Y+  + +  +VLGA SRS + R F T D
Sbjct  16    LFLPFRCFCTKKLLKCNEVIIEDKNIAKALVNYVVNNSIDILVLGAPSRSGLLR-FKTTD  74

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN  1875
             VP  V+K AP FC+VYVI KGK   +R A   L+ 
Sbjct  75    VPNTVSKEAPSFCTVYVIGKGKISYMRAATTSLSQ  109



>ref|XP_009396685.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata 
subsp. malaccensis]
Length=756

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/408 (72%), Positives = 353/408 (87%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+E++RL+L+LKQTMDMY+ ACKEA+TAK+ A ELQ+ K+EE QR ++ARQAEEAAL
Sbjct  295   EDVEAEIRRLRLQLKQTMDMYSTACKEALTAKQKAMELQRWKVEEGQRLKEARQAEEAAL  354

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              +VE E+AKC AA++ AE +++IAE EAQ+   AEM+A KE  E+ +A+  LS +  RYR
Sbjct  355   ALVERERAKCMAAIQTAEASKRIAESEAQKRISAEMQALKEEEERRKAIDSLSHTSLRYR  414

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             +Y+I+EIE ATE F+   KIGEGGYGPVYR  LDHTPVA+KVLRPDAAQGR QFQQEVE+
Sbjct  415   RYTIEEIEVATEYFANERKIGEGGYGPVYRCYLDHTPVAVKVLRPDAAQGRSQFQQEVEI  474

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             L  +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRLLR+GNTP IPW+ RF+I+AEI   
Sbjct  475   LCCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNTPPIPWQHRFRITAEIGMC  534

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD VTQY +T+ AGT
Sbjct  535   LLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYRLTATAGT  594

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSDIYSLG+MLLQII+ +PPMGLTH+VERAIE GTF ++LD T+
Sbjct  595   FCYIDPEYQQTGMLGIKSDIYSLGIMLLQIISGRPPMGLTHYVERAIETGTFVEMLDYTV  654

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
              DWP++EAL  AKL+L+CAELR++DRPDL +VILPELNRL++ A +++
Sbjct  655   PDWPMDEALSLAKLALKCAELRRRDRPDLATVILPELNRLRDFAEENM  702


 Score =   119 bits (299),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 91/153 (59%), Gaps = 6/153 (4%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGGMSDHDGH  2163
             +  VA+DKDK+S SA+KW +DN++     + L+HV  + S  +++   DA       D  
Sbjct  18    LVAVAIDKDKSSQSALKWALDNVVTRGQTLTLIHVNTRPSSGYRD---DASSAAISRD--  72

Query  2162  CVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTH  1983
              VF PFR +  R+ +  K+  +EDT+VA+AI  +I    +  +V+G+SSR    R F T 
Sbjct  73    -VFIPFRCFCTRKDVQCKDVILEDTDVAEAISDFITHAAIEKLVVGSSSRGGFVRSFRTI  131

Query  1982  DVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             D+   + K  PDFC+VY+ISKGK  S+R A RP
Sbjct  132   DLSASICKGVPDFCTVYIISKGKVSSMRNAVRP  164



>ref|XP_010669606.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=835

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/404 (75%), Positives = 345/404 (85%), Gaps = 1/404 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D E+EM+RL+LELKQTMDMYN ACKEA+ AK+   ELQ+   EE QR E AR +EE A 
Sbjct  368   EDFETEMRRLRLELKQTMDMYNAACKEALNAKQKTSELQRSMKEEDQRLEDARLSEENAR  427

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKAKCKAA+EAAE AQ++AE+EAQ+  +AE KA KE  EK +AL  L+ +D RYR
Sbjct  428   AIAEQEKAKCKAAIEAAEAAQRLAELEAQKRHHAERKALKEAEEKKKALEALNHNDVRYR  487

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KYSI EIE AT  FS+S+KIGEGGYGPVY+  LDHT VAIKVLRPDAAQG+ QFQQEVE+
Sbjct  488   KYSIQEIEVATNYFSESLKIGEGGYGPVYKSTLDHTRVAIKVLRPDAAQGQSQFQQEVEI  547

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL   GNT  +PW++RF+I+AEI T 
Sbjct  548   LSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDRLFCSGNTRPLPWQLRFRIAAEIGTG  607

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPS+AD VTQY MT AAGT
Sbjct  608   LLFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSIADTVTQYRMTQAAGT  667

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LGTKSDIYSLG+M LQ+ITAKP MGLTHHV+RAIE+GTF ++LDP+I
Sbjct  668   FCYIDPEYQQTGMLGTKSDIYSLGIMYLQMITAKPAMGLTHHVQRAIERGTFEEMLDPSI  727

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              DWP EEALHFAKLSLQCAELRKKDRPDL + ILPELNRL+E A
Sbjct  728   QDWPYEEALHFAKLSLQCAELRKKDRPDL-TQILPELNRLREFA  770


 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 99/183 (54%), Gaps = 13/183 (7%)
 Frame = -3

Query  2393  DHHHHPTISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNH  2214
             +    P I+ +    G +  VA+DKDK S  A+KW VDN+L     V LLHVR K S N 
Sbjct  3     NQQQQPQINVEIKKEGAV-AVAIDKDKGSQYALKWAVDNVLNKGQTVTLLHVRQKQSANS  61

Query  2213  QNGG-----PDAHGGMS-------DHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAI  2070
                       D +  ++       +     +F PFR + +R+ +   E  IED +++KA+
Sbjct  62    SLSSTSIPLSDVNEDVARSVRSYAETQAREIFLPFRCFCSRKDVKCNEVIIEDNDISKAL  121

Query  2069  VGYINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAA  1890
               Y + + +  +V+ AS+++ + R+F   DV T + K  P+FCSVYVISKGK  S+R A 
Sbjct  122   TDYCHINVIEIMVVSASTKNGLLRRFKGPDVATNLIKGCPEFCSVYVISKGKMLSVRSAT  181

Query  1889  RPL  1881
             RP+
Sbjct  182   RPI  184



>ref|XP_008391475.1| PREDICTED: U-box domain-containing protein 35-like [Malus domestica]
Length=760

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/461 (66%), Positives = 371/461 (80%), Gaps = 15/461 (3%)
 Frame = -3

Query  1685  SSCRNSLAEDNDLFAPIS---DGFDNAAAAQNLDFTRisdagsdassiaSKDLESEMKRL  1515
             SS RNS +  +DL  P S   +G DN  +  + +            S     L++EM+RL
Sbjct  271   SSHRNSASGCSDLSGPFSFQSNGSDNEGSGNSSN------------SQTPSGLDAEMRRL  318

Query  1514  KLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRMVemekakc  1335
             ++ELKQTMDMY +ACKEA TAK++A E+Q+ +  E ++ E+A+ AEEAAL M +ME+ K 
Sbjct  319   RVELKQTMDMYTSACKEATTAKQNAWEMQKWRTSEERKLEEAKLAEEAALAMADMERQKS  378

Query  1334  kaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKYSIDEIEFA  1155
             KAA EAA  AQ++A++E Q+ K AE KAK+E  E  RA+  L  +  RYR+Y+I+EIE A
Sbjct  379   KAATEAARMAQRLADLETQKRKIAERKAKQEAEESRRAIDALVNNQVRYRRYTIEEIEIA  438

Query  1154  TEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSLMRHPNMV  975
             T+ F+ S KIGEGGYGPVYR  LDHTPVAIKVLRPD +QG++QFQQEVEVLS +RHP+MV
Sbjct  439   TDYFNNSNKIGEGGYGPVYRAILDHTPVAIKVLRPDISQGQRQFQQEVEVLSCIRHPHMV  498

Query  974   LLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALLFLHQSKPE  795
             +L+GACPEYGCLVYEYMENGSLEDRL  K NTP I W IRFKISAEIATALLFLHQ+KPE
Sbjct  499   ILVGACPEYGCLVYEYMENGSLEDRLFCKNNTPPISWAIRFKISAEIATALLFLHQTKPE  558

Query  794   PLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFCYIDPEYQQ  615
             PLVHRDLKP NIL++RN+VSKI+DVGLARLVPPS+AD VTQY MT+AAGTFCYIDPEYQQ
Sbjct  559   PLVHRDLKPGNILVNRNYVSKIADVGLARLVPPSIADSVTQYRMTAAAGTFCYIDPEYQQ  618

Query  614   TGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISDWPVEEALH  435
             TG LG KSDIYSLGVMLLQIITA+P MGL+H VE+AIEKGTFA++LDP +++WPVEEAL 
Sbjct  619   TGMLGVKSDIYSLGVMLLQIITARPAMGLSHQVEKAIEKGTFAEMLDPAVTNWPVEEALS  678

Query  434   FAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASK  312
             FAKL+L+C ELRKKDRPDL +VILPELNRL++L +++ A++
Sbjct  679   FAKLALKCCELRKKDRPDLSTVILPELNRLRDLGMKNEATE  719


 Score =   134 bits (336),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 105/157 (67%), Gaps = 4/157 (3%)
 Frame = -3

Query  2339  TVVAVDKDKNSASAVKWTVDNLLIS-NPFVILLHVRHKASPNHQNGGPDAHGGM--SDHD  2169
             TVVA+D+DKNS  AVKW VDNLL +     IL+HVR++ S + Q+ G  +  G   ++ +
Sbjct  16    TVVAIDRDKNSQLAVKWAVDNLLSNRTSHCILIHVRNR-SLHPQDVGLVSKDGRPPTEDE  74

Query  2168  GHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFW  1989
                 F P+R + AR+GI+ KE  I D +V  A++ YI  + + N+V+GASSR+AI+RKF 
Sbjct  75    LQQFFLPYRGFCARKGIVAKEVIIHDIDVPSALIDYIVNNSICNIVVGASSRNAITRKFK  134

Query  1988  THDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLT  1878
               DVPT + K+ P+ C+VYVISKG+ Q+   A+RP T
Sbjct  135   DSDVPTCLFKSVPETCAVYVISKGRIQTSGSASRPQT  171



>ref|XP_010669604.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=838

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/404 (75%), Positives = 345/404 (85%), Gaps = 1/404 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D E+EM+RL+LELKQTMDMYN ACKEA+ AK+   ELQ+   EE QR E AR +EE A 
Sbjct  368   EDFETEMRRLRLELKQTMDMYNAACKEALNAKQKTSELQRSMKEEDQRLEDARLSEENAR  427

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + E EKAKCKAA+EAAE AQ++AE+EAQ+  +AE KA KE  EK +AL  L+ +D RYR
Sbjct  428   AIAEQEKAKCKAAIEAAEAAQRLAELEAQKRHHAERKALKEAEEKKKALEALNHNDVRYR  487

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             KYSI EIE AT  FS+S+KIGEGGYGPVY+  LDHT VAIKVLRPDAAQG+ QFQQEVE+
Sbjct  488   KYSIQEIEVATNYFSESLKIGEGGYGPVYKSTLDHTRVAIKVLRPDAAQGQSQFQQEVEI  547

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL   GNT  +PW++RF+I+AEI T 
Sbjct  548   LSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDRLFCSGNTRPLPWQLRFRIAAEIGTG  607

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPS+AD VTQY MT AAGT
Sbjct  608   LLFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSIADTVTQYRMTQAAGT  667

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LGTKSDIYSLG+M LQ+ITAKP MGLTHHV+RAIE+GTF ++LDP+I
Sbjct  668   FCYIDPEYQQTGMLGTKSDIYSLGIMYLQMITAKPAMGLTHHVQRAIERGTFEEMLDPSI  727

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              DWP EEALHFAKLSLQCAELRKKDRPDL + ILPELNRL+E A
Sbjct  728   QDWPYEEALHFAKLSLQCAELRKKDRPDL-TQILPELNRLREFA  770


 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 99/183 (54%), Gaps = 13/183 (7%)
 Frame = -3

Query  2393  DHHHHPTISSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNH  2214
             +    P I+ +    G +  VA+DKDK S  A+KW VDN+L     V LLHVR K S N 
Sbjct  3     NQQQQPQINVEIKKEGAV-AVAIDKDKGSQYALKWAVDNVLNKGQTVTLLHVRQKQSANS  61

Query  2213  ---------QNGGPDAHGGM---SDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAI  2070
                       +   D    +   ++     +F PFR + +R+ +   E  IED +++KA+
Sbjct  62    SLSSTSIPLSDVNEDVARSVRSYAETQAREIFLPFRCFCSRKDVKCNEVIIEDNDISKAL  121

Query  2069  VGYINTHRVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAA  1890
               Y + + +  +V+ AS+++ + R+F   DV T + K  P+FCSVYVISKGK  S+R A 
Sbjct  122   TDYCHINVIEIMVVSASTKNGLLRRFKGPDVATNLIKGCPEFCSVYVISKGKMLSVRSAT  181

Query  1889  RPL  1881
             RP+
Sbjct  182   RPI  184



>ref|XP_008798198.1| PREDICTED: U-box domain-containing protein 52 [Phoenix dactylifera]
Length=788

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/408 (72%), Positives = 347/408 (85%), Gaps = 0/408 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             +D+E+EMKRL+LELKQTMDMYN AC+EAITAK+ A EL + K EE QR  +A+ AEE+A+
Sbjct  311   EDVEAEMKRLRLELKQTMDMYNTACREAITAKQKAMELHRWKTEEEQRLAEAKMAEESAM  370

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              +VE E+A  +AA+EAA  +Q+IAE+EAQ+  +AEMKA KE  E+ RA   +  +  RYR
Sbjct  371   ALVERERANSRAALEAARASQRIAELEAQKRIHAEMKALKEAEERKRAADSIPHAVVRYR  430

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             +Y I++IE ATE F++  K+GEGGYGPVY+  LDHTPVAIKVLRPDAAQGR QFQQEVEV
Sbjct  431   RYMIEDIEAATEYFAEHRKVGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQEVEV  490

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHPNMVLLLGACPEYGCLVYEYM NGSL+DRL R+GNTP IPW+ RF+I+AEIA  
Sbjct  491   LSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDRLFRRGNTPIIPWQHRFRIAAEIARG  550

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             LLFLHQ+KPEPLVHRDLKP NILLDRN+VSKISDVGLARLVPPSVAD VTQY MTS AGT
Sbjct  551   LLFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPSVADTVTQYRMTSTAGT  610

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG LG KSD+YSLGV+LLQIITAKPPMGLTHHV RAIEKGTFAD+LDP +
Sbjct  611   FCYIDPEYQQTGMLGVKSDVYSLGVLLLQIITAKPPMGLTHHVGRAIEKGTFADILDPAV  670

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             +DWPVE A   A+++L+CAELR+KDRPDL +V+LPEL RL+EL  + +
Sbjct  671   TDWPVEAAQFLAEIALKCAELRRKDRPDLATVVLPELERLRELGEEKM  718


 Score =   130 bits (327),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 99/161 (61%), Gaps = 4/161 (2%)
 Frame = -3

Query  2363  DGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASP--NHQNGGPDAH  2190
             DG    P+  VA+DKDK S +A+KW VDNL+ S   +IL+HV  K+ P  NH++G     
Sbjct  9     DGDAAHPLVAVAIDKDKGSQNALKWAVDNLVTSGETLILVHVNTKSPPAGNHEDGA--CF  66

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
                +D     +F PFR +  R+ I  K+  +E+ +VAKAIV +++   +  +V+G  S+ 
Sbjct  67    KEPTDPQMKELFLPFRCFCTRKDIRSKDVLLEEHDVAKAIVEFVSHAAIEKLVVGYPSKG  126

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
                R+F + D PT ++K APDFC+VYVISKGK  S+R A R
Sbjct  127   GFMRRFKSADTPTNISKGAPDFCTVYVISKGKVLSMRNAVR  167



>ref|XP_006404968.1| hypothetical protein EUTSA_v10000051mg [Eutrema salsugineum]
 gb|ESQ46421.1| hypothetical protein EUTSA_v10000051mg [Eutrema salsugineum]
Length=801

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/409 (75%), Positives = 354/409 (87%), Gaps = 0/409 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+ESEM+RLKLELKQT++MY+ ACKEA+TAK+ A ELQ+ K+EE ++ E+AR AEEAAL 
Sbjct  361   DVESEMRRLKLELKQTIEMYSTACKEALTAKQKATELQRWKLEEERKLEEARLAEEAALA  420

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK KAAMEAAE AQ+IAE+EA++   AEMKA KE+ EK +AL+ L+ SD RYRK
Sbjct  421   IAEKEKAKSKAAMEAAEAAQRIAELEAKKRVNAEMKALKESEEKTKALTALANSDVRYRK  480

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE ATE F++  KIGEGGYGPVY+  LDHTPVA+KVLRPDAAQGR QFQQEVEVL
Sbjct  481   YSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVL  540

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPE GCLVYE+M NGSLEDRL R GN+P + W++RF+I+AEI T L
Sbjct  541   SCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAEIGTGL  600

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKP NILLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGTF
Sbjct  601   LFLHQAKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTF  660

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG+M LQ+ITAKPPMGLTH+VERA+EKGT ADLLDP +S
Sbjct  661   CYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKPPMGLTHYVERALEKGTLADLLDPAVS  720

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
             DWP+E+   FAKL+L+CAELR+KDRPDL  VILPELNRL+ LA +S  S
Sbjct  721   DWPLEDTAEFAKLALKCAELRRKDRPDLAKVILPELNRLRTLAEESTQS  769


 Score =   115 bits (289),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 97/172 (56%), Gaps = 15/172 (9%)
 Frame = -3

Query  2363  DGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGG  2184
             +G  +  +  VA+DKDK+S  A+KW VD+LL     VIL+HV+ + SP      P  H  
Sbjct  13    EGGGSSGVVAVAIDKDKSSQHALKWAVDHLLQRGQSVILVHVKLRPSP--LTNSPSLHAS  70

Query  2183  MS-----------DHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRV  2043
              +           D +G    +F PFR +  R+ I  ++  +E+ +VAKA+V Y N   +
Sbjct  71    SAKLSQDSSLVCRDPEGASKEIFLPFRCFCTRKDIQCQDVLLEEYDVAKALVEYANQAAI  130

Query  2042  SNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
               +V+G+S++    R     D+P  + KTAPDFC+VYVISKGK  ++R A+R
Sbjct  131   EVLVVGSSNKGGFLRFNKPTDIPGTIAKTAPDFCTVYVISKGKISTMRSASR  182



>ref|XP_010112125.1| U-box domain-containing protein 35 [Morus notabilis]
 gb|EXC32750.1| U-box domain-containing protein 35 [Morus notabilis]
Length=801

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/468 (66%), Positives = 366/468 (78%), Gaps = 25/468 (5%)
 Frame = -3

Query  1724  DRDADGS---VRRPWNSSCRNSLAEDNDLFAPISDGFDN-AAAAQNLDFTRisdagsdas  1557
             D D +GS   ++  W S    SL+E    F+  S   DN + ++Q +D            
Sbjct  289   DVDLNGSFESMQFGWRSVDNYSLSE----FSSFSQDSDNLSCSSQAID------------  332

Query  1556  siaSKDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqae  1377
                  D+E+EM+RLKLELKQTM+MY+ ACKEA+ A K A ELQ+ K EE +R E+AR +E
Sbjct  333   -----DVEAEMRRLKLELKQTMEMYSTACKEALAANKKAVELQRWKKEEERRLEEARLSE  387

Query  1376  eaalRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSD  1197
             EAA+ +VE E+AK K A+EAAE A++IA++E Q+   AE KA KE  E+ +A   L+K+D
Sbjct  388   EAAIMLVEKERAKSKVAIEAAEAAKRIADLEVQKRISAEKKALKEAEERRKAFDALAKTD  447

Query  1196  CRYRKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQ  1017
              RYRKYSIDEIE AT  F +S KIGEGGYGPVY+G LDHTPVAIKVLRPDAAQGR QFQQ
Sbjct  448   IRYRKYSIDEIEAATGSFQESRKIGEGGYGPVYKGYLDHTPVAIKVLRPDAAQGRSQFQQ  507

Query  1016  EVEVLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAE  837
             EVE+LS MRHPNMVLLLGACPEYGCLVYE+M NGSLEDRL R+GNT  + W++RF+I+AE
Sbjct  508   EVEILSCMRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFRQGNTRPLSWQLRFRIAAE  567

Query  836   IATALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTS  657
             I T LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVP S+AD+ TQY MTS
Sbjct  568   IGTGLLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPSSIADNATQYRMTS  627

Query  656   AAGTFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLL  477
              AGTFCYIDPEYQQTG LG KSDIYSLG+M LQ+ITA+  MGLTHHVERA+EKGT A +L
Sbjct  628   TAGTFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITARSAMGLTHHVERALEKGTLAQML  687

Query  476   DPTISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             DP + DWP+EEAL FAKL+L+CAELR+KDRPDL +VILPELN L+  A
Sbjct  688   DPGVPDWPIEEALDFAKLALKCAELRRKDRPDLDTVILPELNTLRAFA  735


 Score =   119 bits (298),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 96/162 (59%), Gaps = 10/162 (6%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVR-----HKASPN--HQNGGPDAHGG  2184
             +  VA+D+DKNS +A+ W +DNLL     VIL+HV      H ++ N  + N   ++   
Sbjct  16    LVAVAIDRDKNSQNALIWAIDNLLQRGRTVILIHVEIKHVSHSSASNVCNYNAREESLVL  75

Query  2183  MSDHDGHC--VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
               + D     +  PFR +  R+ I  K+  +ED +VAKA+  Y++   + N+VLGAS+R+
Sbjct  76    CKEPDAQTKKLLLPFRCFCTRKDIQCKDIMLEDIDVAKALTEYVSQAAIENLVLGASARN  135

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
                R F   D+P+ V K APDFC+VYVISKGK QS R A RP
Sbjct  136   GFLR-FKVTDIPSSVTKGAPDFCNVYVISKGKVQSQRSALRP  176



>ref|XP_011082095.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Sesamum indicum]
Length=780

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/415 (72%), Positives = 357/415 (86%), Gaps = 0/415 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             ++E+EM+RLK ELKQTMDMY+ ACKEA++A++ AKELQ+ K+EE +R E+AR AEEAAL 
Sbjct  338   EVEAEMRRLKQELKQTMDMYSTACKEALSAREKAKELQRWKMEEQKRLEEARLAEEAALA  397

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK +AA+E AE AQ+IAE+EAQ+   AEMKA KE  EK R LS LS+ DCRYRK
Sbjct  398   LAEKEKAKSRAALEHAEAAQRIAELEAQKRINAEMKALKEAEEKTRVLSSLSQPDCRYRK  457

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE ATE F++S KIGEGGYGPVY+  LDHTPVA+KVLRPDA  GR QFQQEVE+L
Sbjct  458   YTIEEIEVATEYFAQSRKIGEGGYGPVYKCYLDHTPVAVKVLRPDATHGRSQFQQEVEIL  517

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPEYGCLVYEYM NGSLED L+++G TP + W+ RF+I+AEI T L
Sbjct  518   SCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDCLVQRGKTPPLSWQHRFRIAAEIGTGL  577

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKPANILLDRN+VSKISDVGLARLVPPSVAD+VTQY MTS AGTF
Sbjct  578   LFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADNVTQYRMTSTAGTF  637

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG++ LQI+T KPPMGLTHHVERAIE+G F ++LDP++ 
Sbjct  638   CYIDPEYQQTGMLGVKSDIYSLGIIFLQILTGKPPMGLTHHVERAIERGAFREMLDPSVP  697

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQT  297
             DWP+EEAL FAKL+L+C+ELR+KDRPDLG V+LP LN+L+E A +SL + + + T
Sbjct  698   DWPLEEALEFAKLALKCSELRRKDRPDLGKVVLPYLNKLREQAEESLYNSSQSCT  752


 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 92/165 (56%), Gaps = 13/165 (8%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHV--RHK-----ASPNHQNGGPDAHGG  2184
             +  VA+DKDK S  A+KW V+NLL     VIL+HV  RH       SP+     P  +  
Sbjct  18    LVAVAIDKDKGSQVALKWAVENLLGKGQTVILVHVKLRHSMTGLTTSPSLPGSWPSNNSD  77

Query  2183  MSDHDG-----HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGAS  2019
             ++D  G       +F PFR Y  R+ I   +  ++DT+VA++++ ++    +  +V+GA+
Sbjct  78    ITDEIGDDAQLKELFLPFRVYCTRKDIQCYDVVLDDTDVARSLIEFVKQSAIDMLVVGAT  137

Query  2018  SRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARP  1884
             ++ +I R F   D+   V K  PDFC+VYVI KGK  S + A RP
Sbjct  138   AKGSIFR-FKMKDIAGTVLKGVPDFCTVYVIHKGKISSTKAACRP  181



>gb|EPS65707.1| hypothetical protein M569_09070, partial [Genlisea aurea]
Length=726

 Score =   549 bits (1415),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 295/409 (72%), Positives = 350/409 (86%), Gaps = 0/409 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RLK EL+QTM MY+ ACKEA++A++ A EL + K+EE Q+ E+AR AEEAA  
Sbjct  317   DVEAEMRRLKNELRQTMHMYSTACKEALSAQQKAMELHRWKVEEEQKLEEARLAEEAAKA  376

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E E+AKC+AA++ AE AQ+IAE+EAQ+   AEMKA KE  E+ + L  L+ +  RYR+
Sbjct  377   IAEQERAKCRAALDRAEAAQRIAELEAQKRVNAEMKAFKEKEERKKMLDKLANTGVRYRR  436

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE ATE FS S KIGEGGYGPVY+  LDHT VA+KVLRPDAAQGR QFQQEVEVL
Sbjct  437   YTIEEIEMATEYFSSSRKIGEGGYGPVYKCYLDHTQVAVKVLRPDAAQGRSQFQQEVEVL  496

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL R+GNTP + W++RFKI+AEIAT L
Sbjct  497   SCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTPVLSWQLRFKIAAEIATGL  556

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKP NILLD NFVSKISDVGLARLVPPSVAD VTQY +TS AGTF
Sbjct  557   LFLHQTKPEPLVHRDLKPGNILLDGNFVSKISDVGLARLVPPSVADSVTQYRLTSTAGTF  616

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSD++SLGVMLLQIITAKPPMGL+HHVERAIE+GTF+D+LDP + 
Sbjct  617   CYIDPEYQQTGMLGIKSDVFSLGVMLLQIITAKPPMGLSHHVERAIERGTFSDMLDPEVH  676

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
             DWPVEEAL FAK++L+C ELR+KDRPDL  V+LPELNRL+ L+ +++ S
Sbjct  677   DWPVEEALSFAKMALKCTELRRKDRPDLAKVVLPELNRLRALSEETMPS  725


 Score =   114 bits (284),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 90/158 (57%), Gaps = 10/158 (6%)
 Frame = -3

Query  2342  ITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHK--ASPNHQ--------NGGPDA  2193
             +  VA+DKDK S +A+KW VD+LL     V LLHVR +  +SP           +G   A
Sbjct  8     MVAVAIDKDKGSQTALKWAVDHLLSKGKNVTLLHVRQRQTSSPGINKKIAMKIWDGVRFA  67

Query  2192  HGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSR  2013
                + D      F PFR +  R+ I + E  IED ++A+AI  Y+  + +  +V+G S +
Sbjct  68    GKVVVDSQAKDFFLPFRCFCTRKDIQVNEVVIEDMDIARAICQYVKNNLIETLVVGTSVK  127

Query  2012  SAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIR  1899
             +   R+F + D P  + K+AP+FC+VYVI+KGK  S+R
Sbjct  128   NGFIRRFKSVDTPATITKSAPEFCTVYVIAKGKISSVR  165



>ref|XP_002880578.1| kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56837.1| kinase [Arabidopsis lyrata subsp. lyrata]
Length=788

 Score =   551 bits (1421),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 305/403 (76%), Positives = 351/403 (87%), Gaps = 0/403 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK+ A ELQ+ K+EE ++ E+AR AEEAAL 
Sbjct  348   DVEAEMRRLKLELKQTMEMYSTACKEALTAKQKATELQRWKLEEERKLEEARHAEEAALA  407

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK KAAMEAAE AQ+IAE+EA++   AEMKA KE+ EK +AL+ L+ SD RYRK
Sbjct  408   IAEKEKAKSKAAMEAAEAAQRIAELEAKKRVNAEMKALKESEEKTKALTALANSDVRYRK  467

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE ATE F++  KIGEGGYGPVY+  LDHTPVA+KVLRPDAAQGR QFQQEVEVL
Sbjct  468   YSIEEIELATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVL  527

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPE GCLVYE+M NGSLEDRL R GN+P + W++RF+I+AEI T L
Sbjct  528   SCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAEIGTGL  587

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKP NILLDRNFVSKISDVGLARLVPPSVAD VTQY MTS AGTF
Sbjct  588   LFLHQAKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTF  647

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG+M LQ+ITAKPPMGLTH+VERA+EKGT ADLLDP +S
Sbjct  648   CYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKPPMGLTHYVERALEKGTLADLLDPAVS  707

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
             DWP+E+   FAKL+L+CAELR+KDRPDL  VILPELNRL+ LA
Sbjct  708   DWPMEDTEEFAKLALKCAELRRKDRPDLAKVILPELNRLRTLA  750


 Score =   122 bits (305),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 104/177 (59%), Gaps = 18/177 (10%)
 Frame = -3

Query  2363  DGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAHGG  2184
             +G ++G I  VA+DKDK+S  A+KW VD+LL     VIL+HV+ + SP   N  P  H  
Sbjct  13    EGGSSG-IVAVAIDKDKSSQHALKWAVDHLLQRGQSVILVHVKLRPSP--LNNSPSLHAS  69

Query  2183  MS----DHDGHC---------VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRV  2043
              +    D    C         +F PFR +  R+ I  ++  +E+++VAKA+V Y+N   +
Sbjct  70    SAKLSQDSSLVCRDPEGISKELFLPFRCFCTRKDIQCQDVLLEESDVAKALVEYVNQAAI  129

Query  2042  SNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR--PLT  1878
               +V+G+SS+    R     D+P  + K APDFC+VY+ISKGK Q++R A+R  P+T
Sbjct  130   EVLVVGSSSKGGFLRFNKPTDIPGNITKNAPDFCTVYIISKGKIQTMRSASRSAPMT  186



>ref|XP_010548525.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Tarenaya 
hassleriana]
Length=783

 Score =   551 bits (1420),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 302/409 (74%), Positives = 351/409 (86%), Gaps = 0/409 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             ++E+EM+RLKLELKQTM+MY+ ACKEA+TAK+ A ELQ+ K+EE  + E+AR  EEAAL 
Sbjct  343   EVEAEMRRLKLELKQTMEMYSTACKEALTAKQKATELQRWKLEEEWKLEEARLGEEAALA  402

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK KAA+EAAE AQ+IAE+EAQ+   AEMKA KE  EK +AL+ L+ SD RYRK
Sbjct  403   IAEKEKAKSKAAIEAAEAAQRIAELEAQKRVNAEMKAHKEAEEKTKALNALAHSDVRYRK  462

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE ATE F++  K+GEGGYGPVY+  LDHTPVA+KVL PDAAQGR QFQQEVEVL
Sbjct  463   YSIEEIERATEFFAEKYKVGEGGYGPVYKCFLDHTPVAVKVLSPDAAQGRSQFQQEVEVL  522

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPE GCLVYEYM NGSLEDRL R+GN+P + W+ RF+ISAEI T L
Sbjct  523   SCIRHPNMVLLLGACPECGCLVYEYMANGSLEDRLFRRGNSPPLSWQTRFRISAEIGTGL  582

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             +FLHQ+KPEPLVHRDLKPANILLDRNFVSKI+DVGLARLVPPSVAD VTQY MTS AGTF
Sbjct  583   MFLHQTKPEPLVHRDLKPANILLDRNFVSKIADVGLARLVPPSVADHVTQYRMTSTAGTF  642

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG+M LQ++TAK PMGLTH+VE+AIEKGT AD+LDP + 
Sbjct  643   CYIDPEYQQTGMLGVKSDIYSLGIMFLQLLTAKSPMGLTHYVEKAIEKGTLADMLDPAVP  702

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
             DWP+EEA  FAKL+L+CAELR+KDRPDL +VILPELNRL+ LA +S  S
Sbjct  703   DWPIEEATEFAKLALKCAELRRKDRPDLATVILPELNRLRVLAEESTQS  751


 Score =   119 bits (299),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 99/174 (57%), Gaps = 18/174 (10%)
 Frame = -3

Query  2360  GATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVR--------------HKAS  2223
             G     +  VA+D+DK S +A+KWTVD+LL     VIL+HV+              + A 
Sbjct  17    GCGANGLVAVAIDRDKTSQNALKWTVDHLLQRGQSVILIHVKLRPSPLSSSPSLNGNSAK  76

Query  2222  PNHQNGGPDAHGGMSDHDG--HCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTH  2049
              N  NG  DA     D +G    ++ PFR +  R+ I  K+  +ED++VAKA+V Y+N  
Sbjct  77    LNQING--DASLVCRDPEGPYKELYLPFRCFCTRKDIQCKDVLLEDSDVAKALVEYVNQA  134

Query  2048  RVSNVVLGASSRSAISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
              +  +V+G SSR+   R     D+P  V +TAPDFC+VYVISKGK  ++R A+R
Sbjct  135   GIEVLVIGTSSRNGFFRFNKPADIPGTVTRTAPDFCTVYVISKGKISTMRSASR  188



>ref|XP_010654499.1| PREDICTED: U-box domain-containing protein 52 isoform X2 [Vitis 
vinifera]
Length=684

 Score =   547 bits (1410),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 291/406 (72%), Positives = 348/406 (86%), Gaps = 2/406 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITA--KKSAKELQQMKIeesqrfeqarqaeeaa  1368
             ++++EM RLKLELKQ+MD YN+A KEA+TA  +  A+++ Q K EE++RF +AR  EE A
Sbjct  271   EMDAEMNRLKLELKQSMDAYNSASKEAMTATQRHRARDIHQRKTEEARRFPEARIGEETA  330

Query  1367  lRMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRY  1188
             L +VE+EK K + AM+AA+ AQ++AE+EA + K  E+KAK+E     RA+  LS +D RY
Sbjct  331   LAIVELEKQKSRKAMQAAQMAQRLAELEAHKRKNTELKAKREAEASGRAMDKLSHNDIRY  390

Query  1187  RKYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVE  1008
             RKY+I++IE AT+ FS S+KIGEGGYGPVY+G LDHTPVAIKVLRPD +QG KQF+QEVE
Sbjct  391   RKYTIEDIEVATDYFSNSLKIGEGGYGPVYKGSLDHTPVAIKVLRPDVSQGLKQFKQEVE  450

Query  1007  VLSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIAT  828
             VLS MRHPNMVLL+GACPEYGCLVYEYMENGSL+DRL R+ NT  +PW  RFKI++EIA+
Sbjct  451   VLSCMRHPNMVLLVGACPEYGCLVYEYMENGSLDDRLFRRNNTLPLPWATRFKIASEIAS  510

Query  827   ALLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAG  648
             ALLFLHQ+KP PLVHRDLKPANILL RN+VSKISDVGLARLVP SVAD VTQYHMT+AAG
Sbjct  511   ALLFLHQTKPAPLVHRDLKPANILLGRNYVSKISDVGLARLVPASVADSVTQYHMTAAAG  570

Query  647   TFCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPT  468
             TFCYIDPEYQQTG LG KSD+YSLGV+LLQIITAKPPMGLTH V R+IE+GTFA++LDPT
Sbjct  571   TFCYIDPEYQQTGMLGVKSDVYSLGVLLLQIITAKPPMGLTHQVARSIERGTFAEMLDPT  630

Query  467   ISDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELAL  330
             + DWPVEEAL FAK++L C ELRKKDRPDLGSV+LPELNRL++L L
Sbjct  631   VEDWPVEEALSFAKMALNCCELRKKDRPDLGSVVLPELNRLRDLGL  676


 Score =   103 bits (257),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = -3

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F PFR + AR+GI  KE  + D ++A A+V YI+ + + N+V+GAS+RS ++RKF   D
Sbjct  31    LFLPFRGFCARKGIEAKEVVLHDLDIASALVDYISNNSIGNIVVGASNRSVLTRKFRNPD  90

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
             VPT + K+AP+ C+VYVISKGK QS+R A R
Sbjct  91    VPTCLAKSAPESCAVYVISKGKIQSVRSAIR  121



>ref|XP_010419304.1| PREDICTED: U-box domain-containing protein 52-like, partial [Camelina 
sativa]
Length=535

 Score =   542 bits (1396),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 302/409 (74%), Positives = 351/409 (86%), Gaps = 0/409 (0%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             D+E+EM+RLKLELKQTM+MY+ ACKEA+TAK+ A ELQ+ K+EE ++ E+AR AEEAAL 
Sbjct  95    DVEAEMRRLKLELKQTMEMYSTACKEALTAKQKATELQRWKLEEERKLEEARHAEEAALA  154

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EKAK KAAMEAAE AQ+IAE+E+++   AEMKA KE+ EK +AL+ L+ SD RYRK
Sbjct  155   IAEKEKAKSKAAMEAAEAAQRIAELESKKRVNAEMKALKESEEKTKALTALANSDVRYRK  214

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             YSI+EIE ATE F++  KIGEGGYGPVY+  LDHTPVA+KVLRPDAAQGR QFQQEVEVL
Sbjct  215   YSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVL  274

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             S +RHPNMVLLLGACPE GCLVYE+M NGSLEDRL R GN+P + W++R+ I+AEI T L
Sbjct  275   SCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRYIIAAEIGTGL  334

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKP NILLDRNFV KISDVGLARLVPPSVAD VTQY MTS AGTF
Sbjct  335   LFLHQAKPEPLVHRDLKPGNILLDRNFVCKISDVGLARLVPPSVADTVTQYRMTSTAGTF  394

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LG KSDIYSLG+M LQ+ITAKPPMGLTH+VERA+EKGT ADLLDP + 
Sbjct  395   CYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKPPMGLTHYVERALEKGTLADLLDPAVP  454

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLAS  315
             DWP+E+   FAKL+L+C+ELR+KDRPDL  VILPELNRL+ LA +S  S
Sbjct  455   DWPMEDTAKFAKLALKCSELRRKDRPDLAKVILPELNRLRTLADESTHS  503



>ref|XP_009385916.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata 
subsp. malaccensis]
Length=741

 Score =   549 bits (1415),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 285/406 (70%), Positives = 342/406 (84%), Gaps = 1/406 (0%)
 Frame = -3

Query  1538  LESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalRM  1359
             +E+EM RL+LEL+QTMDMY++ACKEAI AK+ A EL    + E QR E+AR AEEAA  M
Sbjct  287   VEAEMNRLRLELQQTMDMYSSACKEAIVAKQKAMELHLWNMGEQQRLEEARVAEEAAFAM  346

Query  1358  VemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRKY  1179
             V  +KAKCKAA+EAAE A+ IA+ E  R +           E++ AL   S +D RYRKY
Sbjct  347   VGKQKAKCKAALEAAEVAKLIADSET-RKRRDAEMKLVGGYEEDEALDSCSAADLRYRKY  405

Query  1178  SIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVLS  999
             +IDEIE AT++F+K+ KIGEGGYGPV+R  LDHT VA+KVLRPDAAQGR QFQQEVE+LS
Sbjct  406   TIDEIEAATDRFAKNRKIGEGGYGPVFRCYLDHTEVAVKVLRPDAAQGRSQFQQEVEILS  465

Query  998   LMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATALL  819
              +RHPNMVLLLGACPEYGCLVYEYM NGSLEDRL R+GNTP +PW+ RF+I+AEI T LL
Sbjct  466   CIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTPPMPWQYRFRIAAEIGTGLL  525

Query  818   FLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTFC  639
             FLHQ+KPEPLVHRDLKPANILLD+N+VSKISDVGLARLVPPSVAD VTQY MTSAAGTFC
Sbjct  526   FLHQTKPEPLVHRDLKPANILLDQNYVSKISDVGLARLVPPSVADSVTQYRMTSAAGTFC  585

Query  638   YIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTISD  459
             YIDPEYQQTG LGTKSD+YSLGV+LLQ+IT +PPMGLTHHVER+IE+GTFA++LDP++ D
Sbjct  586   YIDPEYQQTGMLGTKSDVYSLGVLLLQLITGRPPMGLTHHVERSIERGTFAEMLDPSVRD  645

Query  458   WPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSL  321
             WPVEEAL  AK++L+C ELR++DRPDL +++LPELNRL+ + + ++
Sbjct  646   WPVEEALSLAKVALRCVELRRRDRPDLATIVLPELNRLRAIGVDNM  691


 Score =   117 bits (293),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 96/161 (60%), Gaps = 9/161 (6%)
 Frame = -3

Query  2369  SSDGATTGPITVVAVDKDKNSASAVKWTVDNLLISNPFVILLHVRHKASPNHQNGGPDAH  2190
             ++  A   P+  VAVDKDK+S +A+KW +DN++  N  +IL+HV  KASP +Q    DA 
Sbjct  4     TTKDAAAFPLVAVAVDKDKSSQAALKWALDNVVTKNQILILIHVNTKASPGNQE---DAA  60

Query  2189  GGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRS  2010
               +     H +  PFR +  R+ +   +  ++DT+V +A+V ++    +  +V+GA SRS
Sbjct  61    AAV-----HELLVPFRCFCQRKDVNCVDIVLDDTDVTRAVVDFVAQAAIEKLVVGA-SRS  114

Query  2009  AISRKFWTHDVPTIVNKTAPDFCSVYVISKGKQQSIRPAAR  1887
                R F   D+ T ++K+ PDFC+ Y+++KGK  + R A R
Sbjct  115   GFIRSFRGADISTGISKSVPDFCTTYIVTKGKLSTTRNAIR  155



>emb|CDY24991.1| BnaC02g40170D [Brassica napus]
Length=704

 Score =   548 bits (1412),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 297/404 (74%), Positives = 355/404 (88%), Gaps = 0/404 (0%)
 Frame = -3

Query  1544  KDLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaal  1365
             KD+E+EM+RLKLELKQTMDMY++ACKEA+TAK+ A EL Q KIEE+ +FE+A+ +EEAAL
Sbjct  290   KDIEAEMRRLKLELKQTMDMYSSACKEALTAKRKANELNQWKIEEALKFEKAKLSEEAAL  349

Query  1364  RMVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYR  1185
              + EMEKAKC+ A+EAAEKAQ++AE+E QR K AE+KA+ E+ +K+RA++ L+ +D RYR
Sbjct  350   AVAEMEKAKCRTALEAAEKAQRMAELEGQRRKQAEIKARNESEDKDRAMNALAHNDVRYR  409

Query  1184  KYSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEV  1005
             +YSI+EIE ATE F+   KIGEGGYGPVY+G+LDHTPVAIKVLRPDAAQG+KQFQQEVEV
Sbjct  410   RYSIEEIEEATENFANHRKIGEGGYGPVYKGELDHTPVAIKVLRPDAAQGKKQFQQEVEV  469

Query  1004  LSLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATA  825
             LS +RHP+MVLLLGACPEYGCLVYE MENGSLED L+R+GN+  + W  RF+I+AEIATA
Sbjct  470   LSSIRHPHMVLLLGACPEYGCLVYELMENGSLEDILIRRGNSKPLSWRKRFEIAAEIATA  529

Query  824   LLFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGT  645
             L FLHQ+KPEPLVHRDLKPANILLD+N+VSKISDVGLARLVP SVA++VTQYHMTSAAGT
Sbjct  530   LSFLHQAKPEPLVHRDLKPANILLDKNYVSKISDVGLARLVPASVANNVTQYHMTSAAGT  589

Query  644   FCYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTI  465
             FCYIDPEYQQTG L TKSDIYSLG+MLLQIITA+PPMGL HHV RAI +GT  D+LDPT+
Sbjct  590   FCYIDPEYQQTGMLTTKSDIYSLGIMLLQIITARPPMGLAHHVSRAISRGTLKDMLDPTV  649

Query  464   SDWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELA  333
              DWP++EA  FA +SL+CAELRK+DRPDLG  ++P L RLK L 
Sbjct  650   PDWPLQEAQAFAAMSLRCAELRKRDRPDLGKDVVPLLIRLKNLG  693


 Score =   151 bits (382),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 118/177 (67%), Gaps = 18/177 (10%)
 Frame = -3

Query  2378  PTISSDGATTGPI--TVVAVDKDKNSASAVKWTVDNL--LISNPFVILLHVRHKASPNHQ  2211
             P  SSD + + P+  TV+A+DK+K+S  AV+W VD+L   I NP +ILLHVR K+S    
Sbjct  3     PPYSSDDSHS-PVNSTVIAIDKEKHSHYAVRWAVDHLANTIHNPLIILLHVRLKSSNYGG  61

Query  2210  NGGPDAHGGMSDHDGHCVFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVV  2031
             NG  D        D + +F P+R Y AR+GI M E  I+D++VAKAI+ Y+N++ V+N+V
Sbjct  62    NGASD--------DLNQLFIPYRGYCARKGISMSEAVIDDSDVAKAILEYVNSNLVNNLV  113

Query  2030  LGASSRS----AISRKFWT-HDVPTIVNKTAPDFCSVYVISKGKQQSIRPAARPLTN  1875
             LGAS++S    A S  F   HDV   + K+ PDFCSVYVISKGK QS RPA RP+TN
Sbjct  114   LGASAKSTYTFARSLMFSKHHDVQGAIMKSIPDFCSVYVISKGKVQSSRPAQRPITN  170



>ref|XP_010542113.1| PREDICTED: U-box domain-containing protein 52 [Tarenaya hassleriana]
Length=867

 Score =   553 bits (1426),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 305/417 (73%), Positives = 358/417 (86%), Gaps = 5/417 (1%)
 Frame = -3

Query  1541  DLESEMKRLKLELKQTMDMYNNACKEAITAKKSAKELQQMKIeesqrfeqarqaeeaalR  1362
             ++E+EM+RLKLELKQT DMY+N CKEA+ AKK A EL Q K E++Q+ E+ R A+EAAL 
Sbjct  402   EVEAEMRRLKLELKQTTDMYSNVCKEAVAAKKKATELHQWKEEKTQKLEEVRLAKEAALA  461

Query  1361  MVemekakckaameaaekaqkiaemeAQRTkyaemkakketaeKNRALSVLSKSDCRYRK  1182
             + E EK+KC+AA+EAA  AQ+I E+EAQ+ K AE+ A +E  EK + LS L + D R+RK
Sbjct  462   LAESEKSKCRAAIEAAAAAQRITELEAQKRKQAEITALREAEEKKKVLSALIQDDVRFRK  521

Query  1181  YSIDEIEFATEKFSKSMKIGEGGYGPVYRGKLDHTPVAIKVLRPDAAQGRKQFQQEVEVL  1002
             Y+I+EIE ATE FS S KIGEGGYGPVY+G LDHTPVAIKVLRPDAAQGR QFQQEVEVL
Sbjct  522   YTIEEIEQATENFSDSRKIGEGGYGPVYKGTLDHTPVAIKVLRPDAAQGRSQFQQEVEVL  581

Query  1001  SLMRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLLRKGNTPAIPWEIRFKISAEIATAL  822
             + MRHPNMVLL+GACPEYGCLVYEYM NGSL+DRL R+ NTP +PW++RF+I+AEIAT L
Sbjct  582   TCMRHPNMVLLVGACPEYGCLVYEYMANGSLDDRLSRRSNTPVLPWQLRFRIAAEIATGL  641

Query  821   LFLHQSKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADDVTQYHMTSAAGTF  642
             LFLHQ+KPEPLVHRDLKP NILLD+NF+SKISDVGLARLVPPSVAD +TQY MT+ AGTF
Sbjct  642   LFLHQTKPEPLVHRDLKPGNILLDKNFISKISDVGLARLVPPSVADTMTQYRMTATAGTF  701

Query  641   CYIDPEYQQTGKLGTKSDIYSLGVMLLQIITAKPPMGLTHHVERAIEKGTFADLLDPTIS  462
             CYIDPEYQQTG LGTKSDIYSLG+MLLQIITAKPPMGLTH+VER+IEKGTFA++LDP + 
Sbjct  702   CYIDPEYQQTGMLGTKSDIYSLGIMLLQIITAKPPMGLTHYVERSIEKGTFAEMLDPAVP  761

Query  461   DWPVEEALHFAKLSLQCAELRKKDRPDLGSVILPELNRLKELALQSLASKNGTQTFG  291
             DWPVEEAL FAKL+LQC+ELR+KDRPDLG V+LPELNRL+     +LA +N   TFG
Sbjct  762   DWPVEEALVFAKLALQCSELRRKDRPDLGKVVLPELNRLR-----ALAEENMPLTFG  813


 Score =   113 bits (282),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 92/157 (59%), Gaps = 11/157 (7%)
 Frame = -3

Query  2333  VAVDKDKNSASAVKWTVDNLLISNPFVILLHVR--HKASPNHQNGGPDAHGGMSDHDGHC  2160
             VA+D+DK S +A+KW +DNL+     + L+HVR  H  +P      P A  G    D   
Sbjct  19    VAIDRDKGSQNALKWAIDNLITRAQTLTLVHVRVKHVPTPPFSGSTPSAKHG---DDVKD  75

Query  2159  VFTPFRAYSARRGIIMKEDFIEDTEVAKAIVGYINTHRVSNVVLGASSRSAISRKFWTHD  1980
             +F PFR + AR+ I  ++  ++D + +K ++ Y+  + +  +VLGAS  + +  +F   D
Sbjct  76    LFLPFRCFCARKDINCEDVILDDVDASKGLINYVTENTIETLVLGASKTNLL--RFKAPD  133

Query  1979  VPTIVNKTAPDFCSVYVISKGKQQSIRPAA----RPL  1881
             VP+ V K AP+FC+VYVIS+GK  S RPA     RPL
Sbjct  134   VPSSVMKGAPNFCTVYVISRGKISSARPATCSPPRPL  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8036477131288