BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22227_g2_i1 len=854 path=[5359:0-59 2258:60-98 781:99-853]

Length=854
                                                                      Score     E

emb|CDP10384.1|  unnamed protein product                                294   1e-96   
ref|XP_004251572.1|  PREDICTED: transmembrane protein 128               279   1e-90   
ref|XP_006364903.1|  PREDICTED: uncharacterized protein LOC102596...    272   6e-88   
ref|XP_009767800.1|  PREDICTED: transmembrane protein 128-like          265   6e-85   
ref|XP_009601666.1|  PREDICTED: uncharacterized protein LOC104096915    264   9e-85   
ref|XP_008444020.1|  PREDICTED: uncharacterized protein LOC103487466    263   1e-84   
ref|XP_009781830.1|  PREDICTED: uncharacterized protein LOC104230664    263   2e-84   
ref|XP_004167917.1|  PREDICTED: uncharacterized LOC101212505            262   6e-84   
ref|XP_004150017.1|  PREDICTED: uncharacterized protein LOC101212505    261   6e-84   
ref|XP_010520581.1|  PREDICTED: uncharacterized protein LOC104799645    258   2e-82   
ref|XP_002524468.1|  conserved hypothetical protein                     249   3e-79   Ricinus communis
ref|XP_006450969.1|  hypothetical protein CICLE_v10009612mg             248   2e-78   
ref|XP_004508514.1|  PREDICTED: uncharacterized protein LOC101515480    247   5e-78   
ref|XP_002285091.1|  PREDICTED: transmembrane protein 128               243   1e-76   Vitis vinifera
ref|XP_010049982.1|  PREDICTED: transmembrane protein 128               241   4e-76   
ref|XP_010688028.1|  PREDICTED: uncharacterized protein LOC104902062    236   7e-74   
ref|XP_011006165.1|  PREDICTED: transmembrane protein 128 isoform X1    236   1e-73   
ref|XP_003609292.1|  hypothetical protein MTR_4g114100                  249   1e-72   
gb|KEH32116.1|  transmembrane protein, putative                         231   3e-72   
ref|XP_010535869.1|  PREDICTED: uncharacterized protein LOC104811035    228   1e-70   
ref|XP_010093733.1|  hypothetical protein L484_006287                   227   2e-70   
ref|XP_007202607.1|  hypothetical protein PRUPE_ppa011736mg             227   3e-70   
ref|XP_008242751.1|  PREDICTED: transmembrane protein 128               226   4e-70   
ref|XP_007013396.1|  Uncharacterized protein TCM_038048                 219   4e-67   
ref|XP_009368826.1|  PREDICTED: uncharacterized protein LOC103958295    216   4e-66   
ref|XP_010254373.1|  PREDICTED: transmembrane protein 128 isoform X2    216   5e-66   
ref|XP_008385748.1|  PREDICTED: uncharacterized protein LOC103448273    215   1e-65   
ref|XP_008337313.1|  PREDICTED: uncharacterized protein LOC103400440    213   1e-64   
ref|XP_009126423.1|  PREDICTED: uncharacterized protein LOC103851328    211   3e-64   
ref|XP_010254372.1|  PREDICTED: transmembrane protein 128 isoform X1    209   3e-63   
emb|CDY45105.1|  BnaA02g04710D                                          208   4e-63   
ref|XP_006450968.1|  hypothetical protein CICLE_v10009612mg             206   5e-63   
ref|XP_006288734.1|  hypothetical protein CARUB_v10002044mg             207   2e-62   
ref|XP_010250046.1|  PREDICTED: transmembrane protein 128-like          205   1e-61   
ref|XP_007154989.1|  hypothetical protein PHAVU_003G163500g             204   2e-61   
ref|XP_010420848.1|  PREDICTED: uncharacterized protein LOC104706359    204   3e-61   
ref|XP_010454310.1|  PREDICTED: uncharacterized protein LOC104736086    202   9e-61   
ref|XP_002871923.1|  hypothetical protein ARALYDRAFT_910052             201   3e-60   
ref|XP_003549769.1|  PREDICTED: uncharacterized protein LOC100818154    201   4e-60   
ref|XP_003542687.1|  PREDICTED: uncharacterized protein LOC100792...    199   2e-59   
ref|NP_197512.1|  uncharacterized protein                               197   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400579.1|  hypothetical protein EUTSA_v10014769mg             195   9e-58   
ref|XP_004287345.1|  PREDICTED: uncharacterized protein LOC101303735    194   3e-57   
ref|XP_006594279.1|  PREDICTED: uncharacterized protein LOC100792...    191   3e-56   
ref|XP_008792057.1|  PREDICTED: uncharacterized protein LOC103708764    184   1e-53   
ref|XP_011006166.1|  PREDICTED: uncharacterized protein LOC105112...    182   3e-53   
ref|XP_010914887.1|  PREDICTED: uncharacterized protein LOC105040...    181   4e-52   
ref|XP_010914886.1|  PREDICTED: uncharacterized protein LOC105040...    178   9e-51   
ref|XP_010925235.1|  PREDICTED: uncharacterized protein LOC105047835    168   2e-47   
gb|KDO80286.1|  hypothetical protein CISIN_1g029778mg                   146   5e-40   
emb|CAN63499.1|  hypothetical protein VITISV_011674                     143   2e-38   Vitis vinifera
ref|XP_010254374.1|  PREDICTED: uncharacterized protein LOC104595...    121   4e-30   
gb|KHG00048.1|  putative serine carboxypeptidase CPVL                   120   7e-30   
ref|XP_006371989.1|  hypothetical protein POPTR_0018s06980g             118   1e-29   
ref|XP_006842864.1|  hypothetical protein AMTR_s00081p00159750          116   1e-27   
gb|KHG17743.1|  Testis- and ovary-specific PAZ domain-containing 1      106   7e-25   
ref|XP_001772741.1|  predicted protein                                  104   4e-24   
ref|XP_001762889.1|  predicted protein                                88.6    4e-18   
ref|XP_006371990.1|  hypothetical protein POPTR_0018s06990g           78.6    6e-15   
gb|EJY87374.1|  Transmembrane protein putative                        71.6    1e-11   
gb|EJY68430.1|  Transmembrane protein putative                        71.2    2e-11   
ref|XP_009839016.1|  hypothetical protein H257_13250                  68.2    2e-10   
ref|XP_008621625.1|  hypothetical protein SDRG_17166                  66.6    5e-10   
gb|ELU07790.1|  hypothetical protein CAPTEDRAFT_193160                66.2    7e-10   
ref|XP_008863251.1|  hypothetical protein H310_01787                  65.5    1e-09   
ref|XP_004349204.1|  hypothetical protein CAOG_02454                  65.5    2e-09   
ref|XP_002114544.1|  hypothetical protein TRIADDRAFT_58477            63.9    4e-09   Trichoplax adhaerens
ref|XP_002507132.1|  hypothetical protein MICPUN_112731               63.5    6e-09   Micromonas commoda
ref|XP_008621624.1|  hypothetical protein SDRG_17165                  64.7    2e-08   
gb|EKC28930.1|  hypothetical protein CGI_10016433                     62.4    2e-08   
ref|XP_001629195.1|  predicted protein                                60.5    4e-08   Nematostella vectensis
gb|KDO27550.1|  hypothetical protein SPRG_06817                       61.2    4e-08   
ref|XP_003725152.1|  PREDICTED: transmembrane protein 128-like        59.7    1e-07   
emb|CDW75709.1|  UNKNOWN                                              60.5    2e-07   
ref|XP_002596679.1|  hypothetical protein BRAFLDRAFT_78425            57.4    8e-07   Branchiostoma floridae
gb|ADE76726.1|  unknown                                               57.0    1e-06   
ref|NP_001134319.1|  Transmembrane protein 128                        56.6    2e-06   Salmo salar
ref|XP_006815234.1|  PREDICTED: transmembrane protein 128-like        56.6    3e-06   
emb|CDQ88016.1|  unnamed protein product                              55.5    3e-06   
emb|CBN79064.1|  conserved unknown protein                            55.5    9e-06   
ref|XP_005759390.1|  hypothetical protein EMIHUDRAFT_359359           52.0    8e-05   
ref|XP_008407744.1|  PREDICTED: transmembrane protein 128             48.5    9e-04   



>emb|CDP10384.1| unnamed protein product [Coffea canephora]
Length=187

 Score =   294 bits (753),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+P VGGGYMRQR+SQGYASSGDDLEDDACSR    +    +TRTWVEVVEN LWIA
Sbjct  1    MSGGTP-VGGGYMRQRHSQGYASSGDDLEDDACSRPIPSATLVPKTRTWVEVVENFLWIA  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA+FIIYYGD+  NFIYLLWHD RIRRIPLYMGM  + LN +FF YT MLAWG+RKSSEK
Sbjct  60   SAVFIIYYGDRHSNFIYLLWHDDRIRRIPLYMGMLGISLNVLFFLYTSMLAWGVRKSSEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE SS A LP +TVLGLISFCLFSFALWPIWSFLTLPLVFTLFMA MVILPYL+L   K 
Sbjct  120  WEISSIAALPFITVLGLISFCLFSFALWPIWSFLTLPLVFTLFMAGMVILPYLLLGTFKP  179

Query  608  QEDDFRID  631
            Q D  R D
Sbjct  180  QPDVLRTD  187



>ref|XP_004251572.1| PREDICTED: transmembrane protein 128 [Solanum lycopersicum]
Length=188

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+P   G Y+RQR SQGY SSGDDLEDDACSR  +QS S  RTRTW E++EN LWIA
Sbjct  1    MSGGTPAGSGRYVRQRLSQGYGSSGDDLEDDACSRFVSQSHSLPRTRTWTEILENFLWIA  60

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA+FI+YYGD+ +N I+LLWHD RIRR+PLY GMF VG N +FF +T MLA G+RKS EK
Sbjct  61   SAIFIVYYGDRHHNLIFLLWHDDRIRRLPLYFGMFGVGFNVLFFIHTSMLALGVRKSYEK  120

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE SS+A LP +T LG++SF LF FALWPIWS LTLPLVFTLFMACMVILPYLVL R K 
Sbjct  121  WEVSSTAALPYITALGILSFLLFCFALWPIWSLLTLPLVFTLFMACMVILPYLVLRRFKL  180

Query  608  QEDDFRID  631
            Q D FR D
Sbjct  181  QTDLFRTD  188



>ref|XP_006364903.1| PREDICTED: uncharacterized protein LOC102596632 isoform X1 [Solanum 
tuberosum]
 ref|XP_006364904.1| PREDICTED: uncharacterized protein LOC102596632 isoform X2 [Solanum 
tuberosum]
Length=188

 Score =   272 bits (695),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+P     Y+RQR SQGY SSGDDLEDDACSR  +QS S  RTRTW E++EN LWIA
Sbjct  1    MSGGTPAGSSRYVRQRLSQGYGSSGDDLEDDACSRFVSQSHSIPRTRTWTEILENFLWIA  60

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA+FI+YYGD+ +N I+LLWHD RIRR+PLY+GMF VGLN +FF +T MLA G+RKS EK
Sbjct  61   SAIFIVYYGDRHHNLIFLLWHDDRIRRLPLYIGMFGVGLNVLFFIHTSMLALGVRKSYEK  120

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE S +A LP +T LG++SF LF  ALWPIWS LTLPLVFTLFMACMVILPYLVL R K 
Sbjct  121  WEISGTAALPYITGLGILSFLLFCCALWPIWSLLTLPLVFTLFMACMVILPYLVLRRFKL  180

Query  608  QEDDFRID  631
            Q D FR D
Sbjct  181  QTDLFRTD  188



>ref|XP_009767800.1| PREDICTED: transmembrane protein 128-like [Nicotiana sylvestris]
Length=190

 Score =   265 bits (676),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCL--RTRTWVEVVENCLWIASALFIIYYG  274
            Y+RQR SQGY SSGDDLEDDACSR  +QS S    RTRTW E++EN LWIASALFI+YYG
Sbjct  12   YVRQRLSQGYGSSGDDLEDDACSRFVSQSQSIPIPRTRTWTEILENFLWIASALFIVYYG  71

Query  275  DQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANL  454
            D  +N I+LLWHDGRIRRIPLY+GMF VGLN +FF YT MLA G+RKS EKWE SS+A L
Sbjct  72   DWHHNLIFLLWHDGRIRRIPLYIGMFGVGLNVMFFLYTSMLALGVRKSYEKWEISSTAAL  131

Query  455  PVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            P +TVLGL+SF LF +ALWPIWS LTLPLVFTLFMACMVILPYLVL   K Q D  R D
Sbjct  132  PFITVLGLLSFLLFCYALWPIWSLLTLPLVFTLFMACMVILPYLVLGTFKPQTDLLRTD  190



>ref|XP_009601666.1| PREDICTED: uncharacterized protein LOC104096915 [Nicotiana tomentosiformis]
Length=190

 Score =   264 bits (674),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPS--CLRTRTWVEVVENCLWIASALFIIYYG  274
            Y+RQR SQGY SSGDDLEDDACSR  +QS +    RTRTW E++EN LWIASALFI+YYG
Sbjct  12   YVRQRLSQGYGSSGDDLEDDACSRFVSQSQTIPVPRTRTWTEILENFLWIASALFIVYYG  71

Query  275  DQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANL  454
            D  +N I+LLWHDGRIRRIPLY+GMF VGLN +FF YT MLA G+RKS EKWE SS+A L
Sbjct  72   DWHHNLIFLLWHDGRIRRIPLYIGMFGVGLNVMFFLYTSMLALGVRKSYEKWEISSTAAL  131

Query  455  PVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            P +TVLGL+SF LF +ALWPIWS LTLPLVFTLFMACMVILPYLVL   K Q D  R D
Sbjct  132  PFITVLGLLSFLLFCYALWPIWSLLTLPLVFTLFMACMVILPYLVLGTFKPQTDLLRTD  190



>ref|XP_008444020.1| PREDICTED: uncharacterized protein LOC103487466 [Cucumis melo]
Length=187

 Score =   263 bits (673),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 149/188 (79%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+P V GGYMRQR+SQGYASSGDD+EDDACSR    S    ++RTW+EVVEN LW+A
Sbjct  1    MSGGTP-VAGGYMRQRHSQGYASSGDDIEDDACSRFQTMSFHTPKSRTWIEVVENVLWLA  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA FI+YYGD+  N IYLLWHDGRIRR+PLY+GM  +GLN + F YT M AW IR+  EK
Sbjct  60   SAAFIVYYGDKHSNMIYLLWHDGRIRRLPLYLGMVGIGLNIVIFIYTSMSAWSIRRFDEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE +S + LP+VT+LGLISFCL SFALWPIW FLT+PL+FT+FMACMV+ P +++ + + 
Sbjct  120  WELASLSVLPIVTLLGLISFCLLSFALWPIWGFLTIPLLFTMFMACMVVFPNIMIGKFRP  179

Query  608  QEDDFRID  631
            Q D  R D
Sbjct  180  QSDFLRTD  187



>ref|XP_009781830.1| PREDICTED: uncharacterized protein LOC104230664 [Nicotiana sylvestris]
Length=190

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCL--RTRTWVEVVENCLWIASALFIIYYG  274
            Y+RQR SQGY SSGDDLEDDACSR  +QS +    RTRTW E++EN LWIASALFI+YYG
Sbjct  12   YVRQRLSQGYGSSGDDLEDDACSRFVSQSNTIPIPRTRTWTEILENFLWIASALFIVYYG  71

Query  275  DQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANL  454
            D  +N I+LLWHDGRIRRIPLY+GMF VGLN +FF YT MLA G+RKS EKWE SS+A L
Sbjct  72   DWHHNLIFLLWHDGRIRRIPLYIGMFGVGLNVMFFLYTSMLALGVRKSYEKWEISSTAAL  131

Query  455  PVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            P +TVLGL+SF LF +ALWPIWS LTLPLVFTLFMACMVILPYLVL   K Q D  R D
Sbjct  132  PFITVLGLLSFLLFCYALWPIWSLLTLPLVFTLFMACMVILPYLVLGSFKPQTDLLRTD  190



>ref|XP_004167917.1| PREDICTED: uncharacterized LOC101212505 [Cucumis sativus]
Length=187

 Score =   262 bits (669),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+P V GGYMRQR+SQGYASSGDD+EDDACSR    S    ++RTW+EVVEN LW+ 
Sbjct  1    MSGGTP-VAGGYMRQRHSQGYASSGDDIEDDACSRFQTMSFHTPKSRTWIEVVENVLWLV  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA FI+YYGD+  N IYLLWHDGR+RR+PLY+GM  +GLN + F YT M AW IR+  EK
Sbjct  60   SATFIVYYGDRHSNMIYLLWHDGRVRRLPLYLGMVGIGLNIVIFIYTSMSAWSIRRFDEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE +S + LP+VT+LGLISFCL SFALWPIW FLTLPL+FT+FMACMV+ P +++ + + 
Sbjct  120  WELASLSVLPIVTLLGLISFCLLSFALWPIWGFLTLPLLFTMFMACMVVFPNIMIGKFRP  179

Query  608  QEDDFRID  631
            Q D  R D
Sbjct  180  QSDFLRTD  187



>ref|XP_004150017.1| PREDICTED: uncharacterized protein LOC101212505 [Cucumis sativus]
 gb|KGN65313.1| hypothetical protein Csa_1G320310 [Cucumis sativus]
Length=187

 Score =   261 bits (668),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+P V GGYMRQR+SQGYASSGDD+EDDACSR    S    ++RTW+EVVEN LW+ 
Sbjct  1    MSGGTP-VAGGYMRQRHSQGYASSGDDIEDDACSRFQTMSFHTPKSRTWIEVVENVLWLV  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA FI+YYGD+  N IYLLWHDGR+RR+PLY+GM  +GLN + F YT M AW IR+  EK
Sbjct  60   SAAFIVYYGDRHSNMIYLLWHDGRVRRLPLYLGMVGIGLNIVIFIYTSMSAWSIRRFDEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE +S + LP+VT+LGLISFCL SFALWPIW FLTLPL+FT+FMACMV+ P +++ + + 
Sbjct  120  WELASLSVLPIVTLLGLISFCLLSFALWPIWGFLTLPLLFTMFMACMVVFPNIMIGKFRP  179

Query  608  QEDDFRID  631
            Q D  R D
Sbjct  180  QSDFLRTD  187



>ref|XP_010520581.1| PREDICTED: uncharacterized protein LOC104799645 [Tarenaya hassleriana]
 ref|XP_010520582.1| PREDICTED: uncharacterized protein LOC104799645 [Tarenaya hassleriana]
Length=188

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 146/188 (78%), Gaps = 0/188 (0%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+P   GGYMRQR+SQGYAS GDDLEDDACSRS   SP   R++TWVE +EN LWIA
Sbjct  1    MSGGTPVGAGGYMRQRHSQGYASGGDDLEDDACSRSQPLSPVSHRSKTWVEFLENGLWIA  60

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA FI+Y+GD+  N I++L HD RIRR PLY+GM  +G+N I   Y  ML+W IR+  EK
Sbjct  61   SAFFIVYFGDRHSNMIHILLHDVRIRRTPLYLGMIGIGVNIIILIYENMLSWSIRRFEEK  120

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE  S + LP +T+LGLISFCL S+ALWPIW FL LPL+FTLFMAC+V+LP LV+ +L+ 
Sbjct  121  WELWSISALPFITLLGLISFCLLSYALWPIWGFLALPLLFTLFMACLVVLPNLVIIKLRP  180

Query  608  QEDDFRID  631
            Q DDFRID
Sbjct  181  QYDDFRID  188



>ref|XP_002524468.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37908.1| conserved hypothetical protein [Ricinus communis]
Length=187

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 152/188 (81%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGGSP VGGGYMRQR+SQGYAS GDDLEDDACSR    S    R R+WVE+VEN LWIA
Sbjct  1    MSGGSP-VGGGYMRQRHSQGYASGGDDLEDDACSRPQPFSTPSPRVRSWVEIVENVLWIA  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA+FI+Y+GD+  N IYLLWHDGRIRR+PLY+GM  VGLN + FFYT + AW +R+  EK
Sbjct  60   SAIFIVYFGDRHCNLIYLLWHDGRIRRLPLYLGMIGVGLNVVIFFYTSVFAWSVRRFDEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE SS + LP+VT+LGL+SF LFSFALWPIWSFLTLPL+FTLFMACMVI P++++   K 
Sbjct  120  WELSSISALPLVTLLGLVSFSLFSFALWPIWSFLTLPLLFTLFMACMVIFPHIMIGTFKQ  179

Query  608  QEDDFRID  631
              D FRID
Sbjct  180  PNDTFRID  187



>ref|XP_006450969.1| hypothetical protein CICLE_v10009612mg [Citrus clementina]
 ref|XP_006475819.1| PREDICTED: transmembrane protein 128-like [Citrus sinensis]
 gb|ESR64209.1| hypothetical protein CICLE_v10009612mg [Citrus clementina]
 gb|KDO80284.1| hypothetical protein CISIN_1g029778mg [Citrus sinensis]
Length=188

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGGS  V GGYMRQR+SQGYASSGDDLEDDACSR    SPS  R +TWVE++EN LWIA
Sbjct  1    MSGGSTPVAGGYMRQRHSQGYASSGDDLEDDACSRPQPFSPSIPRAKTWVEILENVLWIA  60

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SALFIIYYGD+  NFIYLLWHD RIRR+PLY+GM  VGLN  FFFYT ML W +R+  EK
Sbjct  61   SALFIIYYGDRHSNFIYLLWHDERIRRLPLYLGMVLVGLNVAFFFYTSMLVWNVRRFDEK  120

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE+   + LP VT+LG++SF L SFALWPIWSFLTLPL+FTLFMA MVI P+ ++  L+ 
Sbjct  121  WESFCISALPYVTLLGVVSFFLLSFALWPIWSFLTLPLLFTLFMASMVIFPHSMIGTLRP  180

Query  608  QEDDFRID  631
            Q D FRID
Sbjct  181  QNDAFRID  188



>ref|XP_004508514.1| PREDICTED: uncharacterized protein LOC101515480 [Cicer arietinum]
Length=193

 Score =   247 bits (630),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 148/196 (76%), Gaps = 11/196 (6%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRS---FAQSPSCLRTRTWVEVVENCL  238
            MSGG+P   GG+MRQR+SQGYASSGDDLEDDACSR     A SP      TW+E++EN L
Sbjct  1    MSGGTPVGAGGFMRQRHSQGYASSGDDLEDDACSRQRHFLAPSPP---RWTWIEMLENFL  57

Query  239  WIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKS  418
            W+ASA+FI+YYGDQ  N IYL+ HD RIRR+PLY+G+  +GLNA+ F YT +LAW +R+ 
Sbjct  58   WLASAVFILYYGDQHSNLIYLVCHDDRIRRLPLYLGLIGIGLNALIFVYTSVLAWSVRRF  117

Query  419  SE-----KWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPY  583
             E     KWE +S   LP  TV G+ISFCLFSFALWPIWSFLT+PL+FTLFMACMV++PY
Sbjct  118  DEKWGLKKWEITSITVLPFATVFGIISFCLFSFALWPIWSFLTIPLLFTLFMACMVVIPY  177

Query  584  LVLERLKSQEDDFRID  631
            L+   L+ Q D+ R D
Sbjct  178  LIFGTLRPQYDELRTD  193



>ref|XP_002285091.1| PREDICTED: transmembrane protein 128 [Vitis vinifera]
 emb|CBI28176.3| unnamed protein product [Vitis vinifera]
Length=187

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 151/188 (80%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+P VGGG+MRQR+SQGYASSGDDLEDDACSR    SP+  R RTW EV+EN LWIA
Sbjct  1    MSGGTP-VGGGFMRQRHSQGYASSGDDLEDDACSRQTPSSPAMPRARTWTEVMENILWIA  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA+FIIYYGD++ NFIYLL HD RIRR+PLY+GM  V LN + FFYT M A G++K  EK
Sbjct  60   SAVFIIYYGDRNSNFIYLLLHDDRIRRLPLYLGMVGVSLNILIFFYTSMFASGVKKFCEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE SS + LP +T+LGL+SFCLFSFALWPIWSFLTLPL+FTLFMAC+V  PY++   L+ 
Sbjct  120  WELSSPSALPFLTLLGLVSFCLFSFALWPIWSFLTLPLLFTLFMACIVASPYVMTGTLRP  179

Query  608  QEDDFRID  631
            Q +  R D
Sbjct  180  QTEVLRTD  187



>ref|XP_010049982.1| PREDICTED: transmembrane protein 128 [Eucalyptus grandis]
 gb|KCW82817.1| hypothetical protein EUGRSUZ_C04187 [Eucalyptus grandis]
Length=188

 Score =   241 bits (616),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 153/189 (81%), Gaps = 2/189 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSR-SFAQSPSCLRTRTWVEVVENCLWI  244
            MSGG+P VGGG++RQR+SQGY+S GDDLEDDACSR +   S    R RTWVEVVEN LWI
Sbjct  1    MSGGTP-VGGGFVRQRHSQGYSSGGDDLEDDACSRPTTPGSAPVPRGRTWVEVVENVLWI  59

Query  245  ASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSE  424
            ASA+FI+Y+GD   N IYLLWHDGRIRR+PLY+GMFAVGLN + F YT M+AW I++  E
Sbjct  60   ASAIFIVYFGDWHSNLIYLLWHDGRIRRVPLYLGMFAVGLNLLIFLYTSMMAWRIKRFDE  119

Query  425  KWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLK  604
            KWE +  A LP VT+LGL++FCL SFALWP+WSFLTLPL+FTLFMACMV+LP L++   +
Sbjct  120  KWELAGIAALPYVTLLGLVAFCLLSFALWPVWSFLTLPLLFTLFMACMVVLPNLMIGMCR  179

Query  605  SQEDDFRID  631
             Q  +FRID
Sbjct  180  PQNGEFRID  188



>ref|XP_010688028.1| PREDICTED: uncharacterized protein LOC104902062 [Beta vulgaris 
subsp. vulgaris]
Length=191

 Score =   236 bits (602),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 143/191 (75%), Gaps = 3/191 (2%)
 Frame = +2

Query  68   MSGGSPT---VGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCL  238
            MSGG+P    VG  +MRQR+S GYAS G+DLEDDA S+     PS  R +TW+E++EN L
Sbjct  1    MSGGTPVGTPVGANFMRQRHSWGYASGGEDLEDDASSKPMPPPPSIPRAKTWIEILENVL  60

Query  239  WIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKS  418
            WI SA+FII +GD   N IYLLWHD RIRRIPLY+G     L+A +FFYT M  WG+RKS
Sbjct  61   WIGSAVFIIIFGDWHSNLIYLLWHDDRIRRIPLYLGFGGAVLSAAYFFYTSMSLWGVRKS  120

Query  419  SEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLER  598
            +E WE   ++ LP+VT+LGL SFCLF++ALWPIWSFLTLPLVFTLFMACMVI PYL+   
Sbjct  121  NENWEILGASALPLVTLLGLTSFCLFTWALWPIWSFLTLPLVFTLFMACMVISPYLISGT  180

Query  599  LKSQEDDFRID  631
            LK Q +  R+D
Sbjct  181  LKPQSEVLRLD  191



>ref|XP_011006165.1| PREDICTED: transmembrane protein 128 isoform X1 [Populus euphratica]
Length=188

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            Y+RQR+SQGYASSGDDLEDDACSR+   SP   R R W+E+VEN +WIASA+FIIY+GD+
Sbjct  12   YIRQRHSQGYASSGDDLEDDACSRAQPFSPPNQRVRPWLEIVENVIWIASAIFIIYFGDR  71

Query  281  DYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPV  460
              N IYLLWHD RIRR+PLY+GM  VGLN + F YTIM AW +R+  EKWE SS + LP+
Sbjct  72   RSNLIYLLWHDERIRRLPLYLGMVGVGLNILIFLYTIMFAWSVRRFDEKWELSSISTLPL  131

Query  461  VTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            VT+LGL+SFCLFSF+LWPIWSFLTLPL+FTLFMACM+I P +++   ++Q D FRID
Sbjct  132  VTLLGLVSFCLFSFSLWPIWSFLTLPLLFTLFMACMIIFPNIMIGTFRTQNDAFRID  188



>ref|XP_003609292.1| hypothetical protein MTR_4g114100 [Medicago truncatula]
Length=856

 Score =   249 bits (637),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 146/199 (73%), Gaps = 6/199 (3%)
 Frame = +2

Query  53   GCSVNMSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVEN  232
            G ++   GG+P   GG MRQR+SQGYASSGDDLEDDACSR  A  P     +TW+E++EN
Sbjct  658  GVALQCLGGTPVGAGGLMRQRHSQGYASSGDDLEDDACSRQRAFLPPSPPKKTWIELLEN  717

Query  233  CLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIR  412
             LW+ASA FI+Y+GDQ  NFIYLL HD RIRR+PLY+GM  +GLN + F YT +LAW +R
Sbjct  718  FLWLASAAFILYFGDQHSNFIYLLCHDDRIRRLPLYLGMIGIGLNTLIFVYTTILAWSVR  777

Query  413  KSSE-----KWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVIL  577
            +  E     KWE +S   LP  T  G+ SFCLF+FALWPIWSFLT+PL+FTLFMACMV++
Sbjct  778  RFDEKWGLMKWEITSITVLPFATGFGITSFCLFTFALWPIWSFLTIPLLFTLFMACMVVI  837

Query  578  PYLVLERL-KSQEDDFRID  631
            PYL+   L + Q D+FR D
Sbjct  838  PYLIFGILGRPQNDEFRTD  856



>gb|KEH32116.1| transmembrane protein, putative [Medicago truncatula]
Length=182

 Score =   231 bits (590),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 137/182 (75%), Gaps = 6/182 (3%)
 Frame = +2

Query  104  MRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQD  283
            MRQR+SQGYASSGDDLEDDACSR  A  P     +TW+E++EN LW+ASA FI+Y+GDQ 
Sbjct  1    MRQRHSQGYASSGDDLEDDACSRQRAFLPPSPPKKTWIELLENFLWLASAAFILYFGDQH  60

Query  284  YNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSE-----KWETSSSA  448
             NFIYLL HD RIRR+PLY+GM  +GLN + F YT +LAW +R+  E     KWE +S  
Sbjct  61   SNFIYLLCHDDRIRRLPLYLGMIGIGLNTLIFVYTTILAWSVRRFDEKWGLMKWEITSIT  120

Query  449  NLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERL-KSQEDDFR  625
             LP  T  G+ SFCLF+FALWPIWSFLT+PL+FTLFMACMV++PYL+   L + Q D+FR
Sbjct  121  VLPFATGFGITSFCLFTFALWPIWSFLTIPLLFTLFMACMVVIPYLIFGILGRPQNDEFR  180

Query  626  ID  631
             D
Sbjct  181  TD  182



>ref|XP_010535869.1| PREDICTED: uncharacterized protein LOC104811035 [Tarenaya hassleriana]
 ref|XP_010535870.1| PREDICTED: uncharacterized protein LOC104811035 [Tarenaya hassleriana]
Length=182

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 141/188 (75%), Gaps = 6/188 (3%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+P   GGYMRQR+SQGYAS GDDLEDDA SR     P   R++TWVE +EN LWIA
Sbjct  1    MSGGTPK--GGYMRQRHSQGYASGGDDLEDDAGSRLQPLLPVSPRSKTWVEFLENGLWIA  58

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA+FI+Y+GD+  N +++L HD RIRR PLY+GM  +G+N I   Y  ML+W IR+   K
Sbjct  59   SAVFIVYFGDRHSNMLHILLHDVRIRRTPLYLGMLGIGVNIIILIYEKMLSWSIRRFEGK  118

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE  + ++LP +T+LGL+SFCL SFALWPIW FL++PL+FTLFMAC+V+ PYL++ +   
Sbjct  119  WELWNISSLPFITLLGLVSFCLLSFALWPIWGFLSIPLLFTLFMACLVVFPYLMIIK---  175

Query  608  QEDDFRID  631
               DFR+D
Sbjct  176  -SCDFRLD  182



>ref|XP_010093733.1| hypothetical protein L484_006287 [Morus notabilis]
 gb|EXB54539.1| hypothetical protein L484_006287 [Morus notabilis]
Length=187

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+PT  GG+MRQR+SQGYASSGDDLEDDACSR      S  R  + +E+VEN LW+ 
Sbjct  1    MSGGTPT-AGGFMRQRHSQGYASSGDDLEDDACSRLRQTFESSPRIWSRIEIVENVLWLV  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA F++Y+GD+  N I+LLWHD RIRR+PLY+GM  VGLN I F YT MLAW  R+  EK
Sbjct  60   SAAFVVYFGDRHSNLIHLLWHDDRIRRVPLYLGMVGVGLNFIVFCYTSMLAWSARRFDEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE +S++ LP VT+LG+ SFCLF+FALWPIW FLTLPL+FTLFMACMV  PY+++   + 
Sbjct  120  WEMTSTSALPFVTLLGMTSFCLFTFALWPIWGFLTLPLLFTLFMACMVTFPYIIIGTFRP  179

Query  608  QEDDFRID  631
            Q D+FR D
Sbjct  180  QYDEFRTD  187



>ref|XP_007202607.1| hypothetical protein PRUPE_ppa011736mg [Prunus persica]
 gb|EMJ03806.1| hypothetical protein PRUPE_ppa011736mg [Prunus persica]
Length=198

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 142/188 (76%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+PT G GYMRQR+SQGYASSGDDLEDDACS     SP   R  + +E+VEN LW+A
Sbjct  1    MSGGTPT-GAGYMRQRHSQGYASSGDDLEDDACSVMRTSSPRSPRVWSRIEIVENVLWLA  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA FI+YYGD+  N IYL WHD RIRR+PLY+G   V  N I F YT M AW +R+  EK
Sbjct  60   SAAFIVYYGDRKSNLIYLFWHDDRIRRLPLYLGTVGVVFNIIIFCYTSMSAWSVRRFDEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE +S + LP VT+LG+ISFCLF FALWPIWSFLTLPL+FTLFMACMVI PY+++   + 
Sbjct  120  WELASISALPFVTLLGVISFCLFCFALWPIWSFLTLPLLFTLFMACMVICPYIIIGIFRQ  179

Query  608  QEDDFRID  631
            Q D  RID
Sbjct  180  QHDVLRID  187



>ref|XP_008242751.1| PREDICTED: transmembrane protein 128 [Prunus mume]
Length=198

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 142/188 (76%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+PT G GYMRQR+SQGYASSGDDLEDDACS     SP   R  + +E+VEN LW+A
Sbjct  1    MSGGTPT-GAGYMRQRHSQGYASSGDDLEDDACSVMRTSSPRTPRVWSRIEIVENVLWLA  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA FI+YYGD+  N IYL WHD RIRR+PLY+G   V LN I F YT M AW +R+  EK
Sbjct  60   SAAFIVYYGDRKSNLIYLFWHDDRIRRLPLYLGTVGVVLNIIIFCYTSMSAWSVRRFDEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE +S + LP VT+LG+ISFCLF FALWPIWSFLTLPL+FTLFMACMVI PY+++   + 
Sbjct  120  WELASISALPFVTLLGVISFCLFCFALWPIWSFLTLPLLFTLFMACMVICPYVIIGIFRQ  179

Query  608  QEDDFRID  631
            Q D  R D
Sbjct  180  QHDVLRTD  187



>ref|XP_007013396.1| Uncharacterized protein TCM_038048 [Theobroma cacao]
 gb|EOY31015.1| Uncharacterized protein TCM_038048 [Theobroma cacao]
Length=187

 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            YMRQR+SQGYAS  +DLEDDACSR    SP+  R+RTW E++EN LW+ SALFIIY+GD+
Sbjct  11   YMRQRHSQGYASGNEDLEDDACSRLHPLSPATPRSRTWTEILENVLWVGSALFIIYFGDR  70

Query  281  DYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPV  460
              N IYLLWHD RIRR+PLY+G+  +GLN   FFYT MLAW +R+  EKWE  S + LP+
Sbjct  71   HSNLIYLLWHDERIRRMPLYLGLVGIGLNIAIFFYTSMLAWSVRRFDEKWELLSISALPI  130

Query  461  VTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            +T+LGL+SFCL  FALWPIW FLTLPL+FTLFMA +V+ P++++E  + Q + FR D
Sbjct  131  ITLLGLVSFCLLCFALWPIWGFLTLPLLFTLFMAGLVVYPHIMIETFRPQNEFFRTD  187



>ref|XP_009368826.1| PREDICTED: uncharacterized protein LOC103958295 [Pyrus x bretschneideri]
Length=197

 Score =   216 bits (551),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+PT G GYMRQR+SQGYASSGDDLEDDACS     SP   +  +W+E+ EN LW+A
Sbjct  1    MSGGTPT-GAGYMRQRHSQGYASSGDDLEDDACSVMRTSSPQSPKVWSWIEIFENVLWLA  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA FI+YYGD+  N IYL  HD RIRR+PLY+GM  V LN I FFYT M AW + +  EK
Sbjct  60   SAAFIVYYGDRKSNLIYLFCHDERIRRLPLYLGMAGVVLNIIIFFYTSMSAWSVGRFDEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE +S + LP VT++G ISFC F FALWPIWSFLTLPL+FTLFMA MVI PY+++   + 
Sbjct  120  WELASISALPFVTLVGGISFCFFCFALWPIWSFLTLPLLFTLFMAGMVICPYIIIGIFRQ  179

Query  608  QEDDFRID  631
            Q D  R D
Sbjct  180  QHDVLRTD  187



>ref|XP_010254373.1| PREDICTED: transmembrane protein 128 isoform X2 [Nelumbo nucifera]
Length=187

 Score =   216 bits (549),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 140/188 (74%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+P V GG MRQRYSQGYASSGDDLEDDACSR+   +P   R RTWV V+EN LWIA
Sbjct  1    MSGGTP-VSGGLMRQRYSQGYASSGDDLEDDACSRTPPPTPLLPRARTWVNVMENVLWIA  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA FI+Y+GD+  N IYLLW D RIRR+PLY+GM    LN   FFYT  +AWGI KS EK
Sbjct  60   SATFIVYFGDRQSNLIYLLWRDDRIRRMPLYLGMACFFLNVGIFFYTSFVAWGIWKSDEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE  + +  P V +LGL SFCL SFALWPIWSFLTLPL+FTLFM+C+V+ PYL +   + 
Sbjct  120  WEVVTPSAAPAVALLGLFSFCLLSFALWPIWSFLTLPLLFTLFMSCIVVSPYLTIGAFRQ  179

Query  608  QEDDFRID  631
            Q D  R D
Sbjct  180  QTDVLRTD  187



>ref|XP_008385748.1| PREDICTED: uncharacterized protein LOC103448273 [Malus domestica]
 ref|XP_008354375.1| PREDICTED: uncharacterized protein LOC103417994 [Malus domestica]
 ref|XP_008354376.1| PREDICTED: uncharacterized protein LOC103417995 [Malus domestica]
Length=197

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+PT G GYMRQR+SQGYASSGDDLEDDACS   + SP   +  + +E++EN LW+A
Sbjct  1    MSGGTPT-GAGYMRQRHSQGYASSGDDLEDDACSVMRSPSPQSPKVWSRIEILENALWLA  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA FI+YYGD+  N IY+L HD RIRR+PLY+GM  V LN I FFYT   AW +R+  EK
Sbjct  60   SAAFIVYYGDRKSNMIYILCHDERIRRLPLYLGMVGVVLNIIIFFYTSXSAWSVRRFDEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE  S   LP VT+LG ISFC F FALWPIWSFLTLPL+FTLFMA MVI PY+++   + 
Sbjct  120  WELESITALPFVTLLGGISFCFFCFALWPIWSFLTLPLLFTLFMAGMVICPYIIIGIFRQ  179

Query  608  QEDDFRID  631
            Q D  R D
Sbjct  180  QHDVLRTD  187



>ref|XP_008337313.1| PREDICTED: uncharacterized protein LOC103400440 [Malus domestica]
Length=197

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+PT G  YMRQR+SQGYASSGDDLEDDACS     SP   +  + +E+ EN LW+A
Sbjct  1    MSGGTPT-GARYMRQRHSQGYASSGDDLEDDACSVMRTSSPQSPKVWSRIEIFENVLWLA  59

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA FI+YYGD+  N IYL  HD RIRR+PLY+GM  + LN I FFYT M AW +R+  EK
Sbjct  60   SAAFIVYYGDRKSNLIYLFCHDERIRRLPLYLGMAGIVLNIIIFFYTSMSAWSVRRFDEK  119

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE +S + LP VT+LG ISFC F FALWPIWSFLTLPL+FTLFMA MVI PY+++   + 
Sbjct  120  WELASISALPFVTLLGGISFCFFCFALWPIWSFLTLPLLFTLFMAGMVICPYIIIGIFRQ  179

Query  608  QEDDFRID  631
            Q D  R D
Sbjct  180  QHDVLRTD  187



>ref|XP_009126423.1| PREDICTED: uncharacterized protein LOC103851328 [Brassica rapa]
 ref|XP_009126424.1| PREDICTED: uncharacterized protein LOC103851328 [Brassica rapa]
Length=188

 Score =   211 bits (538),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            Y+RQR+SQGYAS GDDLEDDACSR    S    R +TWVEV+EN LWIASA+FI+Y+GD 
Sbjct  12   YIRQRHSQGYASGGDDLEDDACSRHQPFSLESPRCKTWVEVLENVLWIASAVFIVYFGDM  71

Query  281  DYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPV  460
              N IY+L HD RI+R+PLY+GM  +G+N +   Y  ML+W +R+  EKWE  S + LP 
Sbjct  72   HSNMIYILLHDARIKRMPLYLGMLGIGVNVVIIIYESMLSWSMRRFDEKWELWSISALPF  131

Query  461  VTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            +T+LG+ISFCL SFALWPIW FLTLPL+FTLFMAC+V+ P+L + +L+ Q ++ RID
Sbjct  132  ITLLGIISFCLLSFALWPIWGFLTLPLLFTLFMACLVVFPHLTIIKLRPQNEELRID  188



>ref|XP_010254372.1| PREDICTED: transmembrane protein 128 isoform X1 [Nelumbo nucifera]
Length=188

 Score =   209 bits (531),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 134/181 (74%), Gaps = 0/181 (0%)
 Frame = +2

Query  89   VGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIY  268
            V GG MRQRYSQGYASSGDDLEDDACSR+   +P   R RTWV V+EN LWIASA FI+Y
Sbjct  8    VSGGLMRQRYSQGYASSGDDLEDDACSRTPPPTPLLPRARTWVNVMENVLWIASATFIVY  67

Query  269  YGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSA  448
            +GD+  N IYLLW D RIRR+PLY+GM    LN   FFYT  +AWGI KS EKWE  + +
Sbjct  68   FGDRQSNLIYLLWRDDRIRRMPLYLGMACFFLNVGIFFYTSFVAWGIWKSDEKWEVVTPS  127

Query  449  NLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRI  628
              P V +LGL SFCL SFALWPIWSFLTLPL+FTLFM+C+V+ PYL +   + Q D  R 
Sbjct  128  AAPAVALLGLFSFCLLSFALWPIWSFLTLPLLFTLFMSCIVVSPYLTIGAFRQQTDVLRT  187

Query  629  D  631
            D
Sbjct  188  D  188



>emb|CDY45105.1| BnaA02g04710D [Brassica napus]
Length=188

 Score =   208 bits (530),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            Y+RQR+SQGYAS GDDLEDDACSR    S    R +TWVEV+EN LWIASA+FI+Y+GD 
Sbjct  12   YIRQRHSQGYASGGDDLEDDACSRHQPFSLESPRCKTWVEVLENVLWIASAVFIVYFGDM  71

Query  281  DYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPV  460
              N IY+L HD RI+R+PL++GM  +G+N +   Y  +L+W +R+  EKWE  S + LP 
Sbjct  72   HSNMIYILLHDARIKRMPLFLGMLGIGVNVVIIIYESLLSWSMRRFDEKWELWSISALPF  131

Query  461  VTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            +T+LG+ISFCL SFALWPIW FLTLPL+FTLFMAC+V+ P+L + +L+ Q ++ RID
Sbjct  132  ITLLGIISFCLLSFALWPIWGFLTLPLLFTLFMACLVVFPHLTIIKLRPQNEELRID  188



>ref|XP_006450968.1| hypothetical protein CICLE_v10009612mg [Citrus clementina]
 gb|ESR64208.1| hypothetical protein CICLE_v10009612mg [Citrus clementina]
 gb|KDO80285.1| hypothetical protein CISIN_1g029778mg [Citrus sinensis]
Length=142

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGGS  V GGYMRQR+SQGYASSGDDLEDDACSR    SPS  R +TWVE++EN LWIA
Sbjct  1    MSGGSTPVAGGYMRQRHSQGYASSGDDLEDDACSRPQPFSPSIPRAKTWVEILENVLWIA  60

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SALFIIYYGD+  NFIYLLWHD RIRR+PLY+GM  VGLN  FFFYT ML W +R+  EK
Sbjct  61   SALFIIYYGDRHSNFIYLLWHDERIRRLPLYLGMVLVGLNVAFFFYTSMLVWNVRRFDEK  120

Query  428  WETSSSANLPVVTVLGLISFCL  493
            WE+   + LP VT+LG++SF L
Sbjct  121  WESFCISALPYVTLLGVVSFFL  142



>ref|XP_006288734.1| hypothetical protein CARUB_v10002044mg [Capsella rubella]
 ref|XP_006288735.1| hypothetical protein CARUB_v10002044mg [Capsella rubella]
 gb|EOA21632.1| hypothetical protein CARUB_v10002044mg [Capsella rubella]
 gb|EOA21633.1| hypothetical protein CARUB_v10002044mg [Capsella rubella]
Length=188

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            Y+RQR+SQGYAS GDDLEDDACSR    +    R++TWVE++EN LWIASA+FI+Y+GD+
Sbjct  12   YIRQRHSQGYASGGDDLEDDACSRPQPFALESPRSKTWVEILENVLWIASAVFIVYFGDR  71

Query  281  DYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPV  460
              N I+LL HD RI+R+PLY GM  + +N I  FY  ML+W +R+  EKWE  S + LP 
Sbjct  72   HSNMIHLLLHDARIKRMPLYFGMLGIAVNIIIIFYESMLSWSMRRFDEKWELWSISALPF  131

Query  461  VTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            +T+LGLISF L SFALWPIW FLTLPL+FTLFMAC+V+ P+L++ + + Q D+ RID
Sbjct  132  ITLLGLISFGLLSFALWPIWGFLTLPLLFTLFMACLVVFPHLMIIKFRPQSDELRID  188



>ref|XP_010250046.1| PREDICTED: transmembrane protein 128-like [Nelumbo nucifera]
 ref|XP_010250047.1| PREDICTED: transmembrane protein 128-like [Nelumbo nucifera]
Length=185

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 138/188 (73%), Gaps = 3/188 (2%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MS G+P V  G +R R+SQGYASSGDDLEDDACSR+ + +P     RTWVEV+EN LWIA
Sbjct  1    MSSGTP-VSSGLLR-RHSQGYASSGDDLEDDACSRTPSSTP-LPTARTWVEVLENVLWIA  57

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
            SA FI+Y+GD++ N IYLLW D RI+RIPLY+G+  + LN   F Y  + AWGI+KS +K
Sbjct  58   SAAFIVYFGDRESNLIYLLWRDDRIKRIPLYLGLACIFLNFGVFVYASLSAWGIKKSEDK  117

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE  + A  P V +LGL SFCL SFALWPIWSFLTLPL+FTL+MAC+VI PYL +   K 
Sbjct  118  WEVMTPAAAPFVAILGLSSFCLLSFALWPIWSFLTLPLLFTLYMACVVISPYLTIGGFKQ  177

Query  608  QEDDFRID  631
            Q    R D
Sbjct  178  QTCVLRTD  185



>ref|XP_007154989.1| hypothetical protein PHAVU_003G163500g [Phaseolus vulgaris]
 gb|ESW26983.1| hypothetical protein PHAVU_003G163500g [Phaseolus vulgaris]
Length=194

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 137/185 (74%), Gaps = 12/185 (6%)
 Frame = +2

Query  104  MRQRYSQGYASSGDDLEDDACSRS---FAQSPSCLRTRTWVEVVENCLWIASALFIIYYG  274
            MRQR+SQGYASSGDDLEDDACSR     A SP     +TW+E++EN LW+ASA FI+Y+G
Sbjct  13   MRQRHSQGYASSGDDLEDDACSRHRPFLAPSPP---PKTWIEMLENFLWLASAAFILYFG  69

Query  275  DQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSE-----KWETS  439
            DQ  N I+LL HD RIRR+PLY+GM  VGLN I F YT  LAW  R+  E     KWE +
Sbjct  70   DQQSNMIHLLCHDNRIRRLPLYLGMIGVGLNTIIFIYTTFLAWSARRFDEKWGLKKWEIT  129

Query  440  SSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQ-ED  616
            + + LP  TV G+ISFCLFSFALWPIWSFLTLPL+FTLFMACMV++PYL+   L+ Q  D
Sbjct  130  TLSVLPFATVFGIISFCLFSFALWPIWSFLTLPLLFTLFMACMVVIPYLIFGTLRPQYYD  189

Query  617  DFRID  631
            + R D
Sbjct  190  ELRTD  194



>ref|XP_010420848.1| PREDICTED: uncharacterized protein LOC104706359 [Camelina sativa]
 ref|XP_010420849.1| PREDICTED: uncharacterized protein LOC104706359 [Camelina sativa]
 ref|XP_010420850.1| PREDICTED: uncharacterized protein LOC104706359 [Camelina sativa]
Length=188

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            Y+RQR+SQGYAS GDDLEDDACSR    +    R++TWVE++EN LWIASA+FI+Y+GD+
Sbjct  12   YIRQRHSQGYASGGDDLEDDACSRPQPFALESPRSKTWVEILENVLWIASAVFIVYFGDR  71

Query  281  DYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPV  460
              N I++L HD RI+R+PLY GM  + +N +   Y  ML+W +R+  EKWE  S + LP 
Sbjct  72   HSNMIHILLHDARIKRMPLYFGMLGIAVNIVIIIYESMLSWSMRRFDEKWELWSISALPF  131

Query  461  VTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            +T+LGLISF L SFALWPIWSFLTLPL+FTLFMAC+V+ P+L++ + + Q D+ RID
Sbjct  132  ITLLGLISFGLLSFALWPIWSFLTLPLLFTLFMACLVVFPHLMIIKFRPQYDELRID  188



>ref|XP_010454310.1| PREDICTED: uncharacterized protein LOC104736086 [Camelina sativa]
 ref|XP_010454311.1| PREDICTED: uncharacterized protein LOC104736086 [Camelina sativa]
 ref|XP_010454312.1| PREDICTED: uncharacterized protein LOC104736086 [Camelina sativa]
 ref|XP_010493117.1| PREDICTED: uncharacterized protein LOC104770394 [Camelina sativa]
 ref|XP_010493118.1| PREDICTED: uncharacterized protein LOC104770394 [Camelina sativa]
Length=188

 Score =   202 bits (515),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            Y+RQR+SQGYAS GDDLEDDACSR    +    R++TWVE++EN LWIASA+FI+Y+GD+
Sbjct  12   YIRQRHSQGYASGGDDLEDDACSRPQPFALESPRSKTWVEILENVLWIASAVFIVYFGDR  71

Query  281  DYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPV  460
              N I++L HD RI+R+PLY GM  + +N +   Y  ML+W +R+  EKWE  S + LP 
Sbjct  72   HSNMIHILLHDARIKRMPLYFGMLGIAVNIVIIIYESMLSWSMRRFDEKWELWSISALPF  131

Query  461  VTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            +T+LGLISF L SFALWPIWSFLTLPL+FTLFMAC+V+ P+L++ + + Q ++ RID
Sbjct  132  ITLLGLISFGLLSFALWPIWSFLTLPLLFTLFMACLVVFPHLMIIKFRPQYEELRID  188



>ref|XP_002871923.1| hypothetical protein ARALYDRAFT_910052 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48182.1| hypothetical protein ARALYDRAFT_910052 [Arabidopsis lyrata subsp. 
lyrata]
Length=188

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 135/177 (76%), Gaps = 0/177 (0%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            Y+RQR+SQGYAS GDDLEDDACSR    S    R++TWVE++EN LWIASA+FI+Y+GD+
Sbjct  12   YIRQRHSQGYASGGDDLEDDACSRPQPFSLENPRSKTWVEILENVLWIASAVFIVYFGDR  71

Query  281  DYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPV  460
              N I++L HD RI+R+PLY GM  + +N I   Y  ML+W +R+  EKWE  S + LP 
Sbjct  72   HSNMIHILLHDARIKRMPLYFGMLGIAVNIIIIIYESMLSWSMRRFDEKWELWSISALPF  131

Query  461  VTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            +T+LGLISF L SFALWPIW FLTLPL+FTLFMAC+V+ P+L++ + + Q D+ RID
Sbjct  132  ITLLGLISFGLLSFALWPIWGFLTLPLLFTLFMACLVVFPHLMIIKFRPQNDELRID  188



>ref|XP_003549769.1| PREDICTED: uncharacterized protein LOC100818154 [Glycine max]
 gb|KHN15102.1| hypothetical protein glysoja_011720 [Glycine soja]
Length=194

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 136/185 (74%), Gaps = 12/185 (6%)
 Frame = +2

Query  104  MRQRYSQGYASSGDDLEDDACSRS---FAQSPSCLRTRTWVEVVENCLWIASALFIIYYG  274
            MRQR+SQGYASSGDDLEDDACSR     A SP     RTW+E++EN LW+ASA FI+Y+G
Sbjct  13   MRQRHSQGYASSGDDLEDDACSRHRPFLAPSPP---PRTWIEMLENFLWLASAAFILYFG  69

Query  275  DQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSE-----KWETS  439
            DQ  N IYLL HD RIRR+PLY+GM  +GLN + F YT +L W  R+  E     KWE +
Sbjct  70   DQHSNLIYLLCHDNRIRRLPLYLGMIGIGLNTMIFIYTTILVWSARRFDEKWGLKKWEVT  129

Query  440  SSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQ-ED  616
            S + LP  TV G+ISFC+FSFALWPIWSFLTLPL+FTLFMACMV++P L+   L+ Q  D
Sbjct  130  SISVLPFATVFGIISFCMFSFALWPIWSFLTLPLLFTLFMACMVVIPCLIFGTLRPQYYD  189

Query  617  DFRID  631
            + R D
Sbjct  190  ELRTD  194



>ref|XP_003542687.1| PREDICTED: uncharacterized protein LOC100792201 isoform X1 [Glycine 
max]
 gb|KHN47165.1| hypothetical protein glysoja_022466 [Glycine soja]
Length=194

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 135/185 (73%), Gaps = 12/185 (6%)
 Frame = +2

Query  104  MRQRYSQGYASSGDDLEDDACSRS---FAQSPSCLRTRTWVEVVENCLWIASALFIIYYG  274
            MRQR+SQGYASSGDDLEDDACSR     A SP     RTW+E++EN LW+ASA FI+Y+G
Sbjct  13   MRQRHSQGYASSGDDLEDDACSRHRPFLAPSPP---PRTWIEMLENFLWLASAAFILYFG  69

Query  275  DQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSE-----KWETS  439
            DQ  N IYLL HD RI+R PLY+GM  +GLN + F YT  LAW  R+  E     KWE +
Sbjct  70   DQHSNLIYLLCHDNRIKRPPLYLGMIGIGLNIMIFIYTTTLAWSARRFDEKWGLKKWEIT  129

Query  440  SSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQ-ED  616
            S + LP  TV G+ISFCLFSFALWPIWSFLTLPL+FTLFMACMV++P L+   L+ Q  D
Sbjct  130  SISVLPFATVFGIISFCLFSFALWPIWSFLTLPLLFTLFMACMVVIPCLIFGTLRPQYYD  189

Query  617  DFRID  631
            + R D
Sbjct  190  ELRTD  194



>ref|NP_197512.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO44066.1| At5g20120 [Arabidopsis thaliana]
 dbj|BAE99783.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92797.1| uncharacterized protein AT5G20120 [Arabidopsis thaliana]
Length=188

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            Y+RQR+SQGYAS GDDLEDDACSR    S    R++TWVE++EN LWIASA+FI+Y+GD+
Sbjct  12   YIRQRHSQGYASGGDDLEDDACSRPQPFSLENPRSKTWVEILENVLWIASAVFIVYFGDR  71

Query  281  DYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPV  460
              N I++L  D RI+R+PLY GM  + +N I   Y  ML+W +R+  EKWE  S + LP 
Sbjct  72   HSNMIHILLRDARIKRMPLYFGMLGIAVNIIIIIYESMLSWSMRRFDEKWELWSISALPF  131

Query  461  VTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            +T+LG+ISF L SFALWPIW FLTLPL+FTLFMAC+V+ P+L++ + + Q D+ RID
Sbjct  132  ITLLGIISFGLLSFALWPIWGFLTLPLLFTLFMACLVVFPHLMIIKFRPQNDELRID  188



>ref|XP_006400579.1| hypothetical protein EUTSA_v10014769mg [Eutrema salsugineum]
 ref|XP_006400580.1| hypothetical protein EUTSA_v10014769mg [Eutrema salsugineum]
 gb|ESQ42032.1| hypothetical protein EUTSA_v10014769mg [Eutrema salsugineum]
 gb|ESQ42033.1| hypothetical protein EUTSA_v10014769mg [Eutrema salsugineum]
Length=188

 Score =   195 bits (495),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            Y+RQR+SQGYAS GDDLEDDACSR    S    R +TWVE++EN LWIASA+FIIY+GD+
Sbjct  12   YIRQRHSQGYASGGDDLEDDACSRQQPFSLDSPRCKTWVEILENALWIASAVFIIYFGDR  71

Query  281  DYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPV  460
              N IY+L HD RI+R+PLY+GM  +G+N +   Y  ML+W +R+  EK E  S + LP 
Sbjct  72   HSNMIYILLHDARIKRMPLYIGMLGIGVNIVIIIYESMLSWSLRRFDEKLELWSISALPF  131

Query  461  VTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            +T+LGLISF L SFALWPIWSFLTLPL+FTLFMAC+V+ P+L++ + + Q D+ RID
Sbjct  132  ITLLGLISFGLLSFALWPIWSFLTLPLLFTLFMACLVVFPHLMIIKFRPQNDELRID  188



>ref|XP_004287345.1| PREDICTED: uncharacterized protein LOC101303735 [Fragaria vesca 
subsp. vesca]
Length=198

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 131/185 (71%), Gaps = 0/185 (0%)
 Frame = +2

Query  77   GSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASAL  256
            GS T  GGYMRQR+SQGYASSGDDLEDDACS   + S S  R  +  E+ EN +W+ SA 
Sbjct  3    GSTTPTGGYMRQRHSQGYASSGDDLEDDACSMMHSSSGSSPRVWSKREIAENVIWLVSAA  62

Query  257  FIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWET  436
             I+Y GD   N I+LLWHD RIRR+PLY+GM  V LN I F YT + AW + +  EKWE 
Sbjct  63   GIMYLGDSKSNLIFLLWHDDRIRRLPLYIGMVGVVLNIIIFCYTSISAWSVGRFDEKWEL  122

Query  437  SSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQED  616
            +S + LP VT+LG ISFCLF FALWPIW FLTLPL+FTLFMA MVI PY+++   + Q D
Sbjct  123  ASISALPYVTLLGAISFCLFCFALWPIWGFLTLPLLFTLFMAGMVIFPYIIIGIFRKQHD  182

Query  617  DFRID  631
              R D
Sbjct  183  ALRTD  187



>ref|XP_006594279.1| PREDICTED: uncharacterized protein LOC100792201 isoform X2 [Glycine 
max]
Length=200

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 134/191 (70%), Gaps = 18/191 (9%)
 Frame = +2

Query  104  MRQRYSQGYASSGDDLEDDACSRS---FAQSPSCLRTRTWVEVVENCLWIASALFIIYYG  274
            MRQR+SQGYASSGDDLEDDACSR     A SP     RTW+E++EN LW+ASA FI+Y+G
Sbjct  13   MRQRHSQGYASSGDDLEDDACSRHRPFLAPSPP---PRTWIEMLENFLWLASAAFILYFG  69

Query  275  DQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSE-----KWETS  439
            DQ  N IYLL HD RI+R PLY+GM  +GLN + F YT  LAW  R+  E     KWE +
Sbjct  70   DQHSNLIYLLCHDNRIKRPPLYLGMIGIGLNIMIFIYTTTLAWSARRFDEKWGLKKWEIT  129

Query  440  SSANLPVVTVLGLISFCL------FSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERL  601
            S + LP  TV G+ISFC       FSFALWPIWSFLTLPL+FTLFMACMV++P L+   L
Sbjct  130  SISVLPFATVFGIISFCFIPCLSRFSFALWPIWSFLTLPLLFTLFMACMVVIPCLIFGTL  189

Query  602  KSQ-EDDFRID  631
            + Q  D+ R D
Sbjct  190  RPQYYDELRTD  200



>ref|XP_008792057.1| PREDICTED: uncharacterized protein LOC103708764 [Phoenix dactylifera]
 ref|XP_008792058.1| PREDICTED: uncharacterized protein LOC103708764 [Phoenix dactylifera]
Length=204

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 128/206 (62%), Gaps = 20/206 (10%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLE-----------------DDACSRSFAQS-PS  193
            MSGG+P VGGGY+RQR +QGY  SGDDLE                 DDACSR    S P+
Sbjct  1    MSGGTP-VGGGYVRQRRNQGYFFSGDDLERQQNSGGYSSTGDDDLEDDACSRPPTYSVPT  59

Query  194  CLRTRTWVEVVENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAI  373
              R RTW EVVE  +W+  A FIIYYGD+  N I +L  DGRI+R  LY+G+  V L+  
Sbjct  60   LQRARTWKEVVETVIWLVFAAFIIYYGDRRSNLISILCWDGRIKRTALYLGLLGVALDLG  119

Query  374  FFFYTIMLAWGIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTL  553
               Y+    WG +K  EK E  SS   P + + G ISFCLFSFALWPIWSFL++PL+FTL
Sbjct  120  LVLYSTFFLWGPQKLYEKNEAFSSIA-PYIIMFGFISFCLFSFALWPIWSFLSIPLLFTL  178

Query  554  FMACMVILPYLVLERLKSQEDDFRID  631
            FMA MV+ PYL++  L+  E   R D
Sbjct  179  FMAFMVVSPYLLIGPLRLSELAVRAD  204



>ref|XP_011006166.1| PREDICTED: uncharacterized protein LOC105112239 isoform X2 [Populus 
euphratica]
Length=160

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 124/177 (70%), Gaps = 28/177 (16%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            Y+RQR+SQGYASSGDDLEDDACSR+   SP   R R W+E+VEN +WIASA+FIIY+GD+
Sbjct  12   YIRQRHSQGYASSGDDLEDDACSRAQPFSPPNQRVRPWLEIVENVIWIASAIFIIYFGDR  71

Query  281  DYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPV  460
              N IYLLWHD RIR                            R+  EKWE SS + LP+
Sbjct  72   RSNLIYLLWHDERIR----------------------------RRFDEKWELSSISTLPL  103

Query  461  VTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            VT+LGL+SFCLFSF+LWPIWSFLTLPL+FTLFMACM+I P +++   ++Q D FRID
Sbjct  104  VTLLGLVSFCLFSFSLWPIWSFLTLPLLFTLFMACMIIFPNIMIGTFRTQNDAFRID  160



>ref|XP_010914887.1| PREDICTED: uncharacterized protein LOC105040175 isoform X2 [Elaeis 
guineensis]
 ref|XP_010914888.1| PREDICTED: uncharacterized protein LOC105040175 isoform X2 [Elaeis 
guineensis]
Length=204

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 127/206 (62%), Gaps = 20/206 (10%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLE-----------------DDACSRSFAQS-PS  193
            MSGG+P VGGG +RQR +QGY SSGDDLE                 DDACSR    S P+
Sbjct  1    MSGGTP-VGGGCVRQRRNQGYFSSGDDLERQQNSGGYSSTGDDDLEDDACSRPPVHSIPT  59

Query  194  CLRTRTWVEVVENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAI  373
              R RTW EVVE  +W+  A FIIYYGD+  N I +L  DGRI+R  LY+G+  V L+  
Sbjct  60   LQRARTWKEVVEAMIWLVFAAFIIYYGDRHSNLISILCWDGRIKRTALYLGLVGVALDLG  119

Query  374  FFFYTIMLAWGIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTL  553
               Y+    WG +K  EK E   S   P + + G +SFCLFSFALWPIWSFL++PL+FTL
Sbjct  120  LVLYSTFFLWGPQKIYEKNEALLSIA-PCIILFGFLSFCLFSFALWPIWSFLSIPLLFTL  178

Query  554  FMACMVILPYLVLERLKSQEDDFRID  631
            FMA MV+ PYL++  L+  E   R D
Sbjct  179  FMAFMVVSPYLLIGPLRLPEFTVRAD  204



>ref|XP_010914886.1| PREDICTED: uncharacterized protein LOC105040175 isoform X1 [Elaeis 
guineensis]
Length=238

 Score =   178 bits (452),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 126/205 (61%), Gaps = 20/205 (10%)
 Frame = +2

Query  71   SGGSPTVGGGYMRQRYSQGYASSGDDLE-----------------DDACSRSFAQS-PSC  196
            SGG+P VGGG +RQR +QGY SSGDDLE                 DDACSR    S P+ 
Sbjct  36   SGGTP-VGGGCVRQRRNQGYFSSGDDLERQQNSGGYSSTGDDDLEDDACSRPPVHSIPTL  94

Query  197  LRTRTWVEVVENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIF  376
             R RTW EVVE  +W+  A FIIYYGD+  N I +L  DGRI+R  LY+G+  V L+   
Sbjct  95   QRARTWKEVVEAMIWLVFAAFIIYYGDRHSNLISILCWDGRIKRTALYLGLVGVALDLGL  154

Query  377  FFYTIMLAWGIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLF  556
              Y+    WG +K  EK E   S   P + + G +SFCLFSFALWPIWSFL++PL+FTLF
Sbjct  155  VLYSTFFLWGPQKIYEKNEALLSIA-PCIILFGFLSFCLFSFALWPIWSFLSIPLLFTLF  213

Query  557  MACMVILPYLVLERLKSQEDDFRID  631
            MA MV+ PYL++  L+  E   R D
Sbjct  214  MAFMVVSPYLLIGPLRLPEFTVRAD  238



>ref|XP_010925235.1| PREDICTED: uncharacterized protein LOC105047835 [Elaeis guineensis]
 ref|XP_010925236.1| PREDICTED: uncharacterized protein LOC105047835 [Elaeis guineensis]
 ref|XP_010925237.1| PREDICTED: uncharacterized protein LOC105047835 [Elaeis guineensis]
Length=204

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 123/200 (62%), Gaps = 20/200 (10%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLE-----------------DDACSRSFAQS-PS  193
            MSG +P V GGY+RQR++QGY SS DDLE                 DDACSR    S P+
Sbjct  1    MSGSTP-VAGGYVRQRHNQGYFSSADDLERQRNSGGYSSTGDDDIEDDACSRPPTYSIPA  59

Query  194  CLRTRTWVEVVENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAI  373
              R +TW +VVE  +W+  A+FIIYYGD+  N I +L+ DGRI+R  LY G+  V  +  
Sbjct  60   LRRAQTWKQVVETVIWLVFAVFIIYYGDRRSNLISILFWDGRIKRTTLYFGLVGVASDLG  119

Query  374  FFFYTIMLAWGIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTL  553
               Y+     G +K  EK E   S   P + +LG +SFCL SFALWPIWSFL++PL+FTL
Sbjct  120  LILYSTFFLCGPQKLYEKNEALLSIA-PYIIMLGFLSFCLLSFALWPIWSFLSIPLLFTL  178

Query  554  FMACMVILPYLVLERLKSQE  613
            FMA MV+ PYL++  L+  E
Sbjct  179  FMAVMVMPPYLLIGPLRPPE  198



>gb|KDO80286.1| hypothetical protein CISIN_1g029778mg [Citrus sinensis]
Length=111

 Score =   146 bits (369),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGGS  V GGYMRQR+SQGYASSGDDLEDDACSR    SPS  R +TWVE++EN LWIA
Sbjct  1    MSGGSTPVAGGYMRQRHSQGYASSGDDLEDDACSRPQPFSPSIPRAKTWVEILENVLWIA  60

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGL  364
            SALFIIYYGD+  NFIYLLWHD RIRR+  +     +GL
Sbjct  61   SALFIIYYGDRHSNFIYLLWHDERIRRVEYFQFNQIIGL  99



>emb|CAN63499.1| hypothetical protein VITISV_011674 [Vitis vinifera]
Length=142

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +2

Query  53   GCSVNMSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVEN  232
            G S +MSGG+P VGGG+MRQR+SQGYASSGDDLEDDACSR    SP+  R RTW EV+EN
Sbjct  52   GKSRSMSGGTP-VGGGFMRQRHSQGYASSGDDLEDDACSRQTPSSPAMPRARTWTEVMEN  110

Query  233  CLWIASALFIIYYGDQDYNFIYLLWHDGRIRR  328
             LWIASA+FIIYYGD++ NFIYLL HD RIRR
Sbjct  111  ILWIASAVFIIYYGDRNSNFIYLLLHDDRIRR  142



>ref|XP_010254374.1| PREDICTED: uncharacterized protein LOC104595366 isoform X3 [Nelumbo 
nucifera]
Length=133

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 98/181 (54%), Gaps = 55/181 (30%)
 Frame = +2

Query  89   VGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIY  268
            V GG MRQRYSQGYASSGDDLEDDACSR+   +P   R RTWV V+EN LWIASA FI+Y
Sbjct  8    VSGGLMRQRYSQGYASSGDDLEDDACSRTPPPTPLLPRARTWVNVMENVLWIASATFIVY  67

Query  269  YGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSA  448
            +GD+  N IYLLW D RIRR                                        
Sbjct  68   FGDRQSNLIYLLWRDDRIRR----------------------------------------  87

Query  449  NLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRI  628
                      +SF L     WPIWSFLTLPL+FTLFM+C+V+ PYL +   + Q D  R 
Sbjct  88   ----------LSFAL-----WPIWSFLTLPLLFTLFMSCIVVSPYLTIGAFRQQTDVLRT  132

Query  629  D  631
            D
Sbjct  133  D  133



>gb|KHG00048.1| putative serine carboxypeptidase CPVL [Gossypium arboreum]
Length=135

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 102/188 (54%), Gaps = 53/188 (28%)
 Frame = +2

Query  68   MSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIA  247
            MSGG+P VGGGY+RQR+SQGYASS +DLE                               
Sbjct  1    MSGGTP-VGGGYIRQRHSQGYASSNEDLE-------------------------------  28

Query  248  SALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEK  427
                                 D    R+PLY+G+ +   +   FFY  ++ W +R+  EK
Sbjct  29   ---------------------DDACSRMPLYLGLVSTVFSVAIFFYMSIITWSVRRFDEK  67

Query  428  WETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKS  607
            WE  S   LP +T+LGLISFCL  FALWPIW FLTLPL+FTLFMA +V+ P++++E L+ 
Sbjct  68   WELLSINALPFLTLLGLISFCLLCFALWPIWGFLTLPLLFTLFMAGLVVYPHIMIETLRQ  127

Query  608  QEDDFRID  631
            Q D FRID
Sbjct  128  QNDSFRID  135



>ref|XP_006371989.1| hypothetical protein POPTR_0018s06980g [Populus trichocarpa]
 gb|ERP49786.1| hypothetical protein POPTR_0018s06980g [Populus trichocarpa]
Length=87

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +2

Query  101  YMRQRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            Y+RQR+SQGYASSGDDLEDDACSR+   SP   R R W+E+VEN +WIASA+FIIY+GD+
Sbjct  12   YIRQRHSQGYASSGDDLEDDACSRAQPFSPPNQRVRPWLEIVENVIWIASAIFIIYFGDR  71

Query  281  DYNFIYLLWHDGRIRR  328
              N IYLLWHD RIRR
Sbjct  72   RSNLIYLLWHDERIRR  87



>ref|XP_006842864.1| hypothetical protein AMTR_s00081p00159750 [Amborella trichopoda]
 gb|ERN04539.1| hypothetical protein AMTR_s00081p00159750 [Amborella trichopoda]
Length=188

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 110/179 (61%), Gaps = 3/179 (2%)
 Frame = +2

Query  104  MRQRYSQG---YASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYG  274
            +RQR++QG   YASS DDLE+++        P   R+R W+  +EN LW+ASA FI+YYG
Sbjct  10   VRQRHNQGDSGYASSSDDLEENSPLSLNDPEPKLDRSRPWIHFMENFLWLASAAFILYYG  69

Query  275  DQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANL  454
            D+  NFIYL+ HD RI+R  L +G+  + L      Y  +L     ++ E+ +      L
Sbjct  70   DRRSNFIYLVCHDERIKRTALNLGLACLVLIVGIMSYMAVLMREKGRADERLDLLPPFAL  129

Query  455  PVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            P + VLGL+SF LFS ALWPIWSFLTLPL+ TL++A  V+ PY     L+S  +  R D
Sbjct  130  PTMAVLGLLSFLLFSVALWPIWSFLTLPLLLTLYVALTVVSPYTPFANLRSHAEMMRAD  188



>gb|KHG17743.1| Testis- and ovary-specific PAZ domain-containing 1 [Gossypium 
arboreum]
Length=101

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  329  IPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPVVTVLGLISFCLFSFAL  508
            +PLY+G+  +GLN   FFYT MLAW +R+  EKWE  S   LP +T+LGL+SFCL  FAL
Sbjct  1    MPLYLGLIGIGLNVAIFFYTSMLAWSVRRFDEKWELLSIIALPFLTLLGLVSFCLLCFAL  60

Query  509  WPIWSFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            WPIW FLTLPL+FTLFMA +V+ P++++E L+ Q D FRID
Sbjct  61   WPIWGFLTLPLLFTLFMAGLVLYPHIMIETLRPQNDFFRID  101



>ref|XP_001772741.1| predicted protein [Physcomitrella patens]
 gb|EDQ62455.1| predicted protein [Physcomitrella patens]
Length=120

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  227  ENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWG  406
            EN LW+A+A+F IYYGD  ++  ++L++D RIRR P  +G+  + +N   F Y  +    
Sbjct  1    ENLLWLAAAVFAIYYGDSRHHLFHVLFYDTRIRRFPFQLGLLGLAINTAIFTYLAIWLRH  60

Query  407  IRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYL  586
            I K+ +KWE  + A +P  T++GL SF LFS ALWPIW FLTLPL+FTLFMA +VI PYL
Sbjct  61   ILKTEDKWELIAPAAIPTATLVGLTSFLLFSIALWPIWGFLTLPLLFTLFMALVVISPYL  120



>ref|XP_001762889.1| predicted protein [Physcomitrella patens]
 gb|EDQ72390.1| predicted protein [Physcomitrella patens]
Length=139

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 81/142 (57%), Gaps = 4/142 (3%)
 Frame = +2

Query  209  TWVEVVENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYT  388
            +W   +EN LW  +A+F IYYGD  ++  ++L+ D R+ RIP  +G  ++ + A    Y 
Sbjct  1    SWSRTIENLLWQFAAVFAIYYGDSRHHLCHVLFFDTRVCRIPFLLGFASLAIGAAISTYL  60

Query  389  IMLAWGIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMA-C  565
             +    I K  +KWE  +   +P  T++GL S  LFS ALWPIW  L+LPL+ TL MA  
Sbjct  61   AVWFRHILKCEDKWELIAPTAIPTATLVGLTSLLLFSVALWPIWDVLSLPLLITLLMALS  120

Query  566  MVILPYLVLERLKSQEDDFRID  631
              I+P+L L R     D  R+D
Sbjct  121  ATIVPHLPLHR---YGDSLRVD  139



>ref|XP_006371990.1| hypothetical protein POPTR_0018s06990g [Populus trichocarpa]
 gb|ERP49787.1| hypothetical protein POPTR_0018s06990g [Populus trichocarpa]
Length=94

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 67/97 (69%), Gaps = 5/97 (5%)
 Frame = +2

Query  347  MFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANL--PVVTVLGLISFCLFSFALWPIW  520
            M  VGLN + F YTIM AW +R+  EKWE S  + +  P++  L  + F   SF+LWPIW
Sbjct  1    MVGVGLNILIFLYTIMFAWSVRRFDEKWELSILSLMFRPLILFLNSLRF---SFSLWPIW  57

Query  521  SFLTLPLVFTLFMACMVILPYLVLERLKSQEDDFRID  631
            SFLTLPL+FTLFMACMVI P +++   ++Q D FRID
Sbjct  58   SFLTLPLLFTLFMACMVIFPNIMIGTFRTQNDAFRID  94



>gb|EJY87374.1| Transmembrane protein putative [Oxytricha trifallax]
Length=218

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 80/184 (43%), Gaps = 14/184 (8%)
 Frame = +2

Query  65   NMSGGSPTVGGGYMRQRYSQGYASSGDDLEDDA---CSRSFAQSPSCLRTRTWVEVV---  226
            N     PT   G   +  +Q +  +  + E++      R         R R WV      
Sbjct  5    NKEATGPTNRKGQYAKVETQEHNQNAFEDENEEFELTERQIKALKREARKRKWVRRFNMV  64

Query  227  ----ENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIM  394
                +   WI +  F+IY      NF   +W +         + M  +G+N  F  Y  +
Sbjct  65   NDRGQALCWITACAFMIY----KTNFFRQVWENPHKVSFFFDLAMIGIGINIAFMLYMTV  120

Query  395  LAWGIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVI  574
                I++ +E +ET     +PVVTV+G++SF     ALWPIW +LT  ++F LFM   ++
Sbjct  121  YLPYIKRINEDFETYCPQLIPVVTVIGIVSFFSLLIALWPIWGWLTPIMMFILFMGYTML  180

Query  575  LPYL  586
            L +L
Sbjct  181  LMFL  184



>gb|EJY68430.1| Transmembrane protein putative [Oxytricha trifallax]
Length=218

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 80/184 (43%), Gaps = 14/184 (8%)
 Frame = +2

Query  65   NMSGGSPTVGGGYMRQRYSQGYASSGDDLEDDA---CSRSFAQSPSCLRTRTWVEVV---  226
            N     PT   G   +  +Q +  +  + E++      R         R R WV      
Sbjct  5    NKEATGPTNRKGQYAKVDTQEHNQNAFEDENEEFELTERQIKALKREARKRKWVRRFHMV  64

Query  227  ----ENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIM  394
                +   WI +  F+IY      NF   +W +         + M  +G+N  F  Y  +
Sbjct  65   NDRGQALCWITACAFMIY----KTNFFRQVWENPHKVTFFFDLAMIGIGINIAFMLYMTV  120

Query  395  LAWGIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVI  574
                I++ +E +ET     +PVVTV+G++SF     ALWPIW +LT  ++F LFM   ++
Sbjct  121  YLPYIKRINEDFETYCPQLIPVVTVIGIVSFFSLLIALWPIWGWLTPIMMFILFMGYTML  180

Query  575  LPYL  586
            L +L
Sbjct  181  LMFL  184



>ref|XP_009839016.1| hypothetical protein H257_13250 [Aphanomyces astaci]
 gb|ETV71351.1| hypothetical protein H257_13250 [Aphanomyces astaci]
Length=179

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 80/182 (44%), Gaps = 13/182 (7%)
 Frame = +2

Query  62   VNMSGGSPTVGGGYMRQRYSQGYASSGDDLEDDACS-------RSFAQSPSCLRTRTWVE  220
            ++ SGG  T    Y  QR  Q   S   D   D+ +       +  AQ     R      
Sbjct  1    MSTSGGVRTRPSSY--QRLPQTEDSDVADAAVDSNAETEIAELKKRAQGKPPSRAEVVST  58

Query  221  VVENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLA  400
             +   +WI  A F++YY D     + + + D R+ R+   +G+   G+NA    Y  +  
Sbjct  59   KIHALMWIVGAGFLLYYLD----VLRVAFRDARVHRVYFNIGLVCFGINACITLYLSIWL  114

Query  401  WGIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILP  580
              ++K   +W       +P  TV+G++   +F+  LWP+W F T  ++F LF+  ++   
Sbjct  115  PYVKKIDLEWSVYCPRMVPTATVVGIVCALMFTVGLWPVWGFFTPGILFVLFLGTLMTAH  174

Query  581  YL  586
            +L
Sbjct  175  FL  176



>ref|XP_008621625.1| hypothetical protein SDRG_17166 [Saprolegnia diclina VS20]
 gb|EQC24948.1| hypothetical protein SDRG_17166 [Saprolegnia diclina VS20]
Length=170

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 78/172 (45%), Gaps = 12/172 (7%)
 Frame = +2

Query  86   TVGGGYMR----QRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEV-VENCLWIAS  250
            T  G Y R       ++   ++ D+  +D   RS  ++PS      W+   +   LW+A 
Sbjct  3    TRAGSYQRLAPADTETESLDATLDEEIEDLKKRSLPKAPS---KAEWLSTKLHALLWVAG  59

Query  251  ALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKW  430
            A  + YY D     + +   D R+ R+   +G+ + G+N     Y  +    +RK   +W
Sbjct  60   ACLLAYYLD----VVRVALRDPRVHRLYFNIGVASAGVNGCITAYLALWLPYVRKVDLEW  115

Query  431  ETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYL  586
                   +P  TV+GL+    F   LWP+W F T  ++F LF+  +++  +L
Sbjct  116  SVYCPRMIPTATVVGLVGALGFILGLWPVWGFFTPGILFVLFLGMLMMAHFL  167



>gb|ELU07790.1| hypothetical protein CAPTEDRAFT_193160 [Capitella teleta]
Length=179

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 75/151 (50%), Gaps = 8/151 (5%)
 Frame = +2

Query  137  SGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQDYNFIYLLWHDG  316
            + ++++DD   +   + P   +T+     + N LWIASA  ++YY +    F        
Sbjct  33   AAENVDDDENLKKL-RGPQ--KTKPSPYSIANFLWIASAACVLYYTE----FFTTAIKHP  85

Query  317  RIRRIPLYMGMFAVGLN-AIFFFYTIMLAWGIRKSSEKWETSSSANLPVVTVLGLISFCL  493
            + R   LY G+  + +N A+ FF  + L++  + SS+ WE      +P+ T         
Sbjct  86   KTRMTWLYTGILLICVNLAVAFFLIVYLSYIKKVSSDNWEKQYPPAIPIATACFTFGAIC  145

Query  494  FSFALWPIWSFLTLPLVFTLFMACMVILPYL  586
             +  LWP+WSFLT  L+F +FM  +VI+  L
Sbjct  146  VTVGLWPVWSFLTPFLLFAVFMGVIVIITML  176



>ref|XP_008863251.1| hypothetical protein H310_01787 [Aphanomyces invadans]
 gb|ETW07158.1| hypothetical protein H310_01787 [Aphanomyces invadans]
Length=177

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 69/144 (48%), Gaps = 6/144 (4%)
 Frame = +2

Query  155  DDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIP  334
            ++   R+  + PS  R       +   LWI  A F++YY D     +++ + D R+ R+ 
Sbjct  37   EELKKRAQGKPPS--RAEVISTKIHAFLWIVGAGFLLYYLD----VMHVAFRDSRVHRVY  90

Query  335  LYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWP  514
              +G+   G+N     Y  +    ++K   +W       +P  T++G++   +F+  LWP
Sbjct  91   FNLGLVCFGINTCITLYLAIWLPYVKKIDLEWNVYCPRMVPTATIVGVVCALMFTMGLWP  150

Query  515  IWSFLTLPLVFTLFMACMVILPYL  586
            +W F T  ++F LF+  ++   +L
Sbjct  151  VWGFFTPGILFVLFLGALMTAHFL  174



>ref|XP_004349204.1| hypothetical protein CAOG_02454 [Capsaspora owczarzaki ATCC 30864]
 gb|EPH53675.1| hypothetical protein CAOG_08606 [Capsaspora owczarzaki ATCC 30864]
Length=187

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 4/103 (4%)
 Frame = +2

Query  224  VENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAW  403
            +E  +W   AL I  +     NF  ++  D RIRR  L+ G+  +G+N +   Y ++   
Sbjct  69   IEGVVWFGLALLIYRFT----NFPEVIMFDSRIRRSYLHFGLALMGVNVLISLYLVVYLR  124

Query  404  GIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLT  532
             IRKS   WE  +   +P++T  G+++  L S A+WP+W  L+
Sbjct  125  WIRKSQAAWEVEAPYAIPIITACGVLAAVLLSIAIWPVWGILS  167



>ref|XP_002114544.1| hypothetical protein TRIADDRAFT_58477 [Trichoplax adhaerens]
 gb|EDV22678.1| hypothetical protein TRIADDRAFT_58477 [Trichoplax adhaerens]
Length=169

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 83/175 (47%), Gaps = 28/175 (16%)
 Frame = +2

Query  92   GGGYMRQRYSQGYASSGDDLE----------DDACSRSFAQSPSCLRTRTWVEVVENCLW  241
            G   +R+R+   Y     D            DDA   +  QS +  R+  W +  E+ +W
Sbjct  3    GSAKLRKRFETTYKDFVQDSNMKSMNEVINPDDAVEAARQQSIT--RSTAW-KTAESVIW  59

Query  242  IASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGM-FAVGLNAI----FFFYTIMLAWG  406
            + +AL I+ Y D    F+  + +D RI R+ LY G  F V  + I      +Y I+L   
Sbjct  60   LLAALGILRYTD----FLLTVCYDPRINRLWLYAGAGFLVVFSLIGCWLIIWYKIIL---  112

Query  407  IRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMV  571
                 + ++    A +P+ T   ++SF  F++ALWP+W  LT  L+FTL M  +V
Sbjct  113  ---KIDDYQKRVPAAIPIATTSFILSFGCFTYALWPVWGILTPLLLFTLMMGVIV  164



>ref|XP_002507132.1| hypothetical protein MICPUN_112731 [Micromonas sp. RCC299]
 gb|ACO68390.1| hypothetical protein MICPUN_112731 [Micromonas sp. RCC299]
Length=170

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 74/152 (49%), Gaps = 7/152 (5%)
 Frame = +2

Query  134  SSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQDYNFIYLLWHD  313
            ++G  LE+   ++  A++   +R     E +E  LW+  +L  I+YGD   N +  L++ 
Sbjct  15   NAGSSLENVLSNQYRAKARRQIR-----EKIERLLWLIFSLTTIWYGDGKINLVTWLYNR  69

Query  314  GRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPVVTVLGLISFCL  493
                R    + +FA+  N I   Y I     + +   +WE+ +S  +P    LG +SF  
Sbjct  70   YSAVRTWFLLALFAISANGIILMYLIHRH-DLHRKGSRWESQASWAVPTSCCLGFVSFVG  128

Query  494  FSFALWPIWSFLTLPLVFTLFMACMVILPYLV  589
            F   LWPI+S++T P+   +    +++  Y V
Sbjct  129  FGAVLWPIYSWVT-PIAEVVLCMGLLMSSYFV  159



>ref|XP_008621624.1| hypothetical protein SDRG_17165 [Saprolegnia diclina VS20]
 gb|EQC24947.1| hypothetical protein SDRG_17165 [Saprolegnia diclina VS20]
Length=408

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 69/149 (46%), Gaps = 8/149 (5%)
 Frame = +2

Query  143  DDLEDDACSRSFAQSPSCLRTRTWVEV-VENCLWIASALFIIYYGDQDYNFIYLLWHDGR  319
            D+  +D   RS  ++PS      W+   +   LW+A A  + YY D     + +   D R
Sbjct  264  DEEIEDLKKRSLPKAPS---KAEWLSTKLHALLWVAGACLLAYYLD----VVRVALRDPR  316

Query  320  IRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPVVTVLGLISFCLFS  499
            + R+   +G+   G+N     Y  +    +RK   +W       +P  TV+GL+    F 
Sbjct  317  VHRLYFNIGVVCAGVNGCITAYLALWLPYVRKVDLEWSVYCPRMIPTATVVGLVGALGFI  376

Query  500  FALWPIWSFLTLPLVFTLFMACMVILPYL  586
              LWP+W F T  ++F LF+  +++  +L
Sbjct  377  LGLWPVWGFFTPGILFVLFLGMLMMAHFL  405



>gb|EKC28930.1| hypothetical protein CGI_10016433 [Crassostrea gigas]
Length=200

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/145 (27%), Positives = 70/145 (48%), Gaps = 5/145 (3%)
 Frame = +2

Query  155  DDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIP  334
            D+   R   ++    R +     ++N LW+ +++ + YY D    F     +D R+ R+ 
Sbjct  57   DEKTEREIEKTFGKHRRKESAYSIQNVLWLITSIAVFYYTD----FYIACRYDQRVNRVW  112

Query  335  LYMGMFAVGLN-AIFFFYTIMLAWGIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALW  511
              +G   V +N  I  F  + + +  + SS+ WET   A +P+ T   ++     +  LW
Sbjct  113  FNVGAILVLVNLCIGAFLIVYITYIKKVSSDDWETHYPAAIPIATGSFIMGAVCVTVGLW  172

Query  512  PIWSFLTLPLVFTLFMACMVILPYL  586
            P+W+ LT  ++F LFM  +V L  L
Sbjct  173  PLWNILTPVILFILFMGMIVTLAML  197



>ref|XP_001629195.1| predicted protein [Nematostella vectensis]
 gb|EDO37132.1| predicted protein [Nematostella vectensis]
Length=134

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 5/115 (4%)
 Frame = +2

Query  224  VENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAW  403
            V +  W+ +A+ + YY D    F   +  D RI R  LY+G   +G+N I   Y ++   
Sbjct  17   VHSIFWMTAAMLVFYYTD----FYIAVKVDDRINRPWLYLGTALIGINVIVGLYFVVWCS  72

Query  404  GIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACM  568
              +K ++ W+  S A +PV T   +      + ALWP+WSF T  ++FTLFM  +
Sbjct  73   YYKKVTD-WDQESPALIPVATFSFISGLVCCTIALWPVWSFFTPFIIFTLFMGVV  126



>gb|KDO27550.1| hypothetical protein SPRG_06817 [Saprolegnia parasitica CBS 223.65]
Length=170

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 73/172 (42%), Gaps = 12/172 (7%)
 Frame = +2

Query  86   TVGGGYMRQRYSQGYASSGD---DLE-DDACSRSFAQSPSCLRTRTWVEV-VENCLWIAS  250
            T  G Y R   +     S D   D E +D   RS  ++PS      W+   +   LW+  
Sbjct  3    TRAGSYQRLAPADAETDSLDATLDEEIEDLKKRSLPKAPS---KAEWLSTKLHALLWVGG  59

Query  251  ALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKW  430
            A  + YY D     +++   D R+ R+   +G+   G+N     Y  +    +RK   +W
Sbjct  60   ACLLAYYLD----VVHIALRDVRVHRLYFNIGVVCAGVNGCITAYLALWLPYVRKVDLEW  115

Query  431  ETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYL  586
                   +P  T++GL+        LWP+W   T  ++F LF+  ++   +L
Sbjct  116  SVYCPRMIPTATIVGLVGALGLILGLWPVWGLFTPGILFVLFLGTLMTAHFL  167



>ref|XP_003725152.1| PREDICTED: transmembrane protein 128-like [Strongylocentrotus 
purpuratus]
Length=152

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 66/121 (55%), Gaps = 5/121 (4%)
 Frame = +2

Query  224  VENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAW  403
            ++   WI +++ I    D    F+  +++D  +++  LY+G   +G+N     Y I++  
Sbjct  27   IQTVFWILASIAIFKLTD----FVPAMFYDSAVKKTWLYIGAGFIGINMAIALYLIIVCS  82

Query  404  GIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPY  583
             IRK ++ WE  S + +P+ T   +      + ALWP++ FLT  L+FTLFM  +VI+  
Sbjct  83   WIRKITD-WEKHSPSAVPIATCSFVSGTLCINIALWPVYGFLTPVLLFTLFMGFIVIVSL  141

Query  584  L  586
            L
Sbjct  142  L  142



>emb|CDW75709.1| UNKNOWN [Stylonychia lemnae]
Length=250

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 73/178 (41%), Gaps = 24/178 (13%)
 Frame = +2

Query  110  QRYSQGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVV-------------------EN  232
            +R S+ Y +  ++ E +   R         R R WV  +                   + 
Sbjct  44   KRQSKEYDADFEE-EFNLTERQVKALKREARKRKWVRRLHYVNDKGQALCNNIYWLSKQK  102

Query  233  CLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIR  412
              W+  +  +IY      NF   +W +         + M  +G+N  F  Y  +    I+
Sbjct  103  IGWVLGSALLIY----KTNFFRQVWENPHKVMFFFDLAMIGIGINIAFMIYMTVYLPYIK  158

Query  413  KSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYL  586
               E +ET     +PV+T++G++SF  F  ALWPIW  LT   +F LFM   + L +L
Sbjct  159  GIKEDFETYCPQLIPVITIVGILSFFSFIIALWPIWGLLTPIFMFILFMGYTMFLLFL  216



>ref|XP_002596679.1| hypothetical protein BRAFLDRAFT_78425 [Branchiostoma floridae]
 gb|EEN52691.1| hypothetical protein BRAFLDRAFT_78425 [Branchiostoma floridae]
Length=165

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 71/160 (44%), Gaps = 11/160 (7%)
 Frame = +2

Query  104  MRQRYSQGYASS-GDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQ  280
            +R+R     A S    L+DD+  +   +     R            W+ +++ + YY D 
Sbjct  11   LRRRVQARLAESFMQQLQDDSQDKPPQKEEKLSRINA-----HTIFWLVASMAVFYYTD-  64

Query  281  DYNFIYLLWHDGRIRRIPLYMGMFAVGLNAIFF-FYTIMLAWGIRKSSEKWETSSSANLP  457
                   L  D RI  + L  G   VGLN +   F  + L+W    S+++WE    + +P
Sbjct  65   ---IAVALRVDPRINWLWLLPGAVLVGLNVVIGGFLIVWLSWIKGVSTDEWEKLYPSAIP  121

Query  458  VVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVIL  577
              T   +I        LWP+W FLT  ++FTLFM  ++++
Sbjct  122  TATASFIIGGLCCMMGLWPVWGFLTPIILFTLFMGVVMVI  161



>gb|ADE76726.1| unknown [Picea sitchensis]
Length=158

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +2

Query  335  LYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWP  514
            L +G+  V  N   F Y       + K  ++WE  + A +P  TV+GL++F LF  ALWP
Sbjct  59   LNLGLLCVACNIGIFLYLSFWVKDMAKVDDRWEILAPAAIPTATVIGLLAFFLFCLALWP  118

Query  515  IWSFLTLPLVFTLFMACMVILPYL  586
            IWSFLTLPL+FTLFMA +VI PY+
Sbjct  119  IWSFLTLPLLFTLFMAFVVISPYI  142



>ref|NP_001134319.1| Transmembrane protein 128 [Salmo salar]
 gb|ACI67045.1| Transmembrane protein 128 [Salmo salar]
Length=164

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 78/168 (46%), Gaps = 21/168 (13%)
 Frame = +2

Query  104  MRQRYSQGY------ASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFII  265
            +R R+ +         S+GD  E     +     P   R         +  WI +++ + 
Sbjct  10   LRNRFKKDAELLMQGVSAGDSNEKSQEEKDAKPLPRINR--------HSVFWIVASVGLT  61

Query  266  YYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLN-AIFFFYTIMLAWGIRKSSEKWETSS  442
            YY    ++F+ ++  +G IR     +G+  +G+  A+  F  + L W   K  + ++   
Sbjct  62   YY----FDFLRVITENGDIRSWWFNVGVILLGICLALAMFCIVYLEW--FKGIQHYDHEY  115

Query  443  SANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYL  586
             A  P+ T   L + C F+ ALWP+WSFLT  L+FT FM  ++++  L
Sbjct  116  PAIPPITTAAFLAASCSFNIALWPVWSFLTPVLLFTQFMGVVMLISML  163



>ref|XP_006815234.1| PREDICTED: transmembrane protein 128-like [Saccoglossus kowalevskii]
Length=212

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 79/173 (46%), Gaps = 27/173 (16%)
 Frame = +2

Query  107  RQRYSQ-----------GYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASA  253
            R+R+S+            +   G+++   A  +   QSP  L +  W+        +ASA
Sbjct  50   RKRFSEHFLNLYGKSLADFDKEGEEILQKASKKKEPQSPYNLSSFFWL--------VASA  101

Query  254  LFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLNA-IFFFYTIMLAWGIRKSSEKW  430
              + YY D    F   +  D RI R    +G+  +G+N  I  ++ ++ +W  + SS+ W
Sbjct  102  A-VFYYTD----FAIAIQVDPRINRYWFNIGVVLIGVNVFIGIYFVVVCSWIRKISSDDW  156

Query  431  ETSSSANLPVVTV-LGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYL  586
            E      +P  T    L S CL +  LWP+W  LT  ++F LFM  +V +  L
Sbjct  157  EKHFPFAIPFATACFALGSLCL-NVGLWPLWKLLTPVILFILFMGFVVFVSLL  208



>emb|CDQ88016.1| unnamed protein product [Oncorhynchus mykiss]
Length=143

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/156 (28%), Positives = 75/156 (48%), Gaps = 16/156 (10%)
 Frame = +2

Query  122  QGYASSGDDLEDDACSRSFAQSPSCLRTRTWVEVVENCLWIASALFIIYYGDQDYNFIYL  301
            QG  S+GD  E     +     P   R         +  WI +++ + YY    ++F+ +
Sbjct  2    QG-VSAGDSNEKSQEEKDAKPLPRINR--------HSVFWIVASVGLTYY----FDFLRV  48

Query  302  LWHDGRIRRIPLYMGMFAVGLN-AIFFFYTIMLAWGIRKSSEKWETSSSANLPVVTVLGL  478
            +  +G I+     +G+  +G+  A+  F  + L W   K  + ++    A  P+ T   L
Sbjct  49   ITENGDIKSWWFNVGVILLGICLALAMFCIVYLEW--FKGIQHYDHEYPAIPPITTAAFL  106

Query  479  ISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYL  586
             + C F+ ALWP+WSFLT  L+FT FM  ++++  L
Sbjct  107  AASCSFNIALWPVWSFLTPVLLFTQFMGVVMLISML  142



>emb|CBN79064.1| conserved unknown protein [Ectocarpus siliculosus]
Length=239

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = +2

Query  287  NFIYLLWHDGRIRRIPLYMGMFAVGLNAIFFFYTIMLAWGIRKSSEKWETSSSANLPVVT  466
            +F+ +L  D R+ R+   +G+    +NA+   Y  +    +R     W   S   +P  T
Sbjct  136  DFVRVLVEDERVDRLWFNIGLVCFSVNAVILAYLTVWLPHVRGIRVSWNVYSPRAIPTAT  195

Query  467  VLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPYL  586
            V+GLI     + +LW +W FLT  ++F +F+ C+  L ++
Sbjct  196  VVGLICALALNMSLWNVWGFLTPLILFAVFIGCLFSLHFV  235



>ref|XP_005759390.1| hypothetical protein EMIHUDRAFT_359359 [Emiliania huxleyi CCMP1516]
 ref|XP_005768247.1| hypothetical protein EMIHUDRAFT_370565 [Emiliania huxleyi CCMP1516]
 gb|EOD06961.1| hypothetical protein EMIHUDRAFT_359359 [Emiliania huxleyi CCMP1516]
 gb|EOD15818.1| hypothetical protein EMIHUDRAFT_370565 [Emiliania huxleyi CCMP1516]
Length=172

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  407  IRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACM  568
            ++K + +WE  S   +P+ T+L ++S   F  A WP+W FL++P+VF LF+  +
Sbjct  111  VQKDTREWEEVSPRAIPIATILAVLSLFSFCGAFWPLWGFLSVPIVFMLFLGVL  164



>ref|XP_008407744.1| PREDICTED: transmembrane protein 128 [Poecilia reticulata]
Length=164

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/121 (25%), Positives = 62/121 (51%), Gaps = 7/121 (6%)
 Frame = +2

Query  227  ENCLWIASALFIIYYGDQDYNFIYLLWHDGRIRRIPLYMGMFAVGLN-AIFFFYTIMLAW  403
             +  WI +++ + YY D    F++++  +  ++     +G+  +G+  ++  F  + L W
Sbjct  49   HSVFWIVASVAVTYYAD----FLHVIMENDDVKSWWFNVGLILLGICLSLAMFCIVYLEW  104

Query  404  GIRKSSEKWETSSSANLPVVTVLGLISFCLFSFALWPIWSFLTLPLVFTLFMACMVILPY  583
               K  + ++    A  P+ T   + + C F+ ALWP+WSF T  ++FT FM  ++ +  
Sbjct  105  --FKGIQHYDQEYPAIPPITTAAFIAASCSFNIALWPVWSFFTPLILFTQFMGVVMFISL  162

Query  584  L  586
            L
Sbjct  163  L  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1676318729358