BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22218_g1_i1 len=3946 path=[4438:0-2015 6454:2016-2039
6478:2040-2274 6713:2275-2298 6737:2299-2517 6956:2518-2557
6996:2558-3945]

Length=3946
                                                                      Score     E

ref|XP_009761470.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    778   0.0      
ref|XP_009609184.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    768   0.0      
ref|XP_006338134.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    725   0.0      
ref|XP_004237986.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    697   0.0      
emb|CDP11495.1|  unnamed protein product                                661   0.0      
emb|CBI19252.3|  unnamed protein product                                605   0.0      
ref|XP_010664385.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    616   0.0      
ref|XP_010664383.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    612   0.0      
ref|XP_004301361.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    602   0.0      
ref|XP_007018207.1|  Ubiquitin-specific protease 16, putative iso...    601   0.0      
ref|XP_007018208.1|  Ubiquitin-specific protease 16, putative iso...    596   0.0      
ref|XP_007225419.1|  hypothetical protein PRUPE_ppa000527mg             588   0.0      
ref|XP_002514028.1|  conserved hypothetical protein                     584   0.0      Ricinus communis
ref|XP_006433843.1|  hypothetical protein CICLE_v10000079mg             585   0.0      
ref|XP_008219286.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    583   0.0      
ref|XP_006472486.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    583   0.0      
ref|XP_009376247.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    583   0.0      
ref|XP_011016914.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    583   0.0      
ref|XP_009373969.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    580   0.0      
ref|XP_003523774.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    579   0.0      
ref|XP_006578260.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    580   0.0      
ref|XP_010107689.1|  Ubiquitin carboxyl-terminal hydrolase 16           578   0.0      
ref|XP_004501631.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    580   0.0      
ref|XP_006578259.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    579   0.0      
ref|XP_002301091.2|  UBIQUITIN-SPECIFIC PROTEASE 16 family protein      579   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003518257.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    574   2e-180   
ref|XP_008338940.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    573   5e-180   
gb|KHN26130.1|  Ubiquitin carboxyl-terminal hydrolase 16                573   5e-180   
gb|KHN08238.1|  Ubiquitin carboxyl-terminal hydrolase 16                575   6e-180   
gb|KDP41469.1|  hypothetical protein JCGZ_15876                         574   1e-179   
ref|XP_011016915.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    574   2e-179   
ref|XP_003527871.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    573   3e-179   
gb|AES98232.2|  ubiquitin carboxy-terminal hydrolase                    570   5e-179   
ref|XP_004490438.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    565   2e-178   
ref|XP_003615274.1|  Ubiquitin carboxyl-terminal hydrolase              567   8e-178   
gb|EYU36471.1|  hypothetical protein MIMGU_mgv1a000653mg                565   5e-177   
ref|XP_003544242.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    565   7e-177   
ref|XP_003602929.1|  Ubiquitin carboxyl-terminal hydrolase              566   8e-177   
ref|XP_010061517.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    561   4e-176   
ref|XP_011013097.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    564   5e-176   
ref|XP_010916668.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    561   8e-176   
ref|XP_011013096.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    563   1e-175   
gb|KGN60255.1|  hypothetical protein Csa_3G890110                       559   2e-175   
ref|XP_007141259.1|  hypothetical protein PHAVU_008G181000g             558   2e-175   
ref|XP_002307344.2|  hypothetical protein POPTR_0005s17820g             563   3e-175   Populus trichocarpa [western balsam poplar]
ref|XP_008795170.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    555   1e-173   
ref|XP_010916667.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    555   2e-173   
ref|XP_007137649.1|  hypothetical protein PHAVU_009G144200g             553   1e-171   
gb|KHG13290.1|  Ubiquitin carboxyl-terminal hydrolase 16 -like pr...    551   2e-171   
ref|XP_008795168.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    550   2e-171   
ref|XP_010060095.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    550   4e-171   
ref|XP_008795169.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    549   4e-171   
gb|KEH35732.1|  ubiquitin carboxy-terminal hydrolase                    550   2e-170   
ref|XP_010675222.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    548   3e-170   
ref|XP_010266094.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    548   7e-170   
ref|XP_008795167.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    543   9e-169   
ref|XP_011074220.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    539   3e-167   
ref|XP_008466167.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    536   3e-166   
ref|XP_008802270.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    536   4e-166   
ref|XP_009401442.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    526   2e-164   
ref|XP_007047805.1|  Ubiquitin-specific protease 17, putative iso...    528   3e-164   
ref|XP_008444939.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    531   1e-163   
ref|XP_010942663.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    528   7e-163   
ref|XP_010939750.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    525   8e-162   
ref|XP_010646974.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    519   9e-162   
ref|XP_003635052.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    521   1e-161   
ref|XP_004148434.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    526   1e-161   
ref|XP_004163959.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    526   1e-161   
ref|XP_006841208.1|  hypothetical protein AMTR_s00135p00021060          520   1e-159   
ref|XP_006466293.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    514   2e-159   
ref|XP_008359211.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    511   3e-159   
ref|XP_008385675.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    511   3e-159   
ref|XP_009387155.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    517   3e-159   
ref|XP_009381476.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    515   1e-158   
ref|XP_009410122.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    516   2e-158   
ref|XP_010525656.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    515   3e-158   
emb|CBI18698.3|  unnamed protein product                                503   4e-158   
ref|XP_008235462.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    506   1e-157   
ref|XP_008444940.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    508   2e-157   
ref|XP_004489806.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    508   9e-157   
ref|XP_010520756.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    510   4e-156   
ref|XP_007208087.1|  hypothetical protein PRUPE_ppa001429mg             500   3e-155   
ref|XP_003519843.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    503   4e-155   
ref|XP_009340982.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    500   4e-155   
ref|XP_007158378.1|  hypothetical protein PHAVU_002G148100g             501   2e-154   
gb|KCW68483.1|  hypothetical protein EUGRSUZ_F02136                     500   3e-154   
gb|AES96032.2|  ubiquitin carboxy-terminal hydrolase                    501   5e-154   
ref|XP_003574640.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    501   8e-154   
ref|XP_004289526.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    497   2e-153   
ref|XP_010277575.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    493   2e-153   
gb|EEE68872.1|  hypothetical protein OsJ_27681                          492   3e-151   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84719.1|  hypothetical protein OsI_31685                          492   6e-151   Oryza sativa Indica Group [Indian rice]
ref|XP_006413414.1|  hypothetical protein EUTSA_v10024307mg             493   1e-150   
gb|KFK28990.1|  hypothetical protein AALP_AA7G074400                    493   3e-150   
ref|NP_001062051.1|  Os08g0478500                                       492   3e-150   Oryza sativa Japonica Group [Japonica rice]
gb|EPS68694.1|  hypothetical protein M569_06073                         485   5e-150   
ref|XP_004973705.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    489   4e-149   
ref|XP_004973704.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    488   9e-149   
gb|KDP29752.1|  hypothetical protein JCGZ_18687                         482   3e-148   
gb|EMS47345.1|  Ubiquitin carboxyl-terminal hydrolase 17                486   3e-148   
ref|NP_567705.1|  ubiquitin carboxyl-terminal hydrolase 16              487   4e-148   Arabidopsis thaliana [mouse-ear cress]
gb|AAG42757.1|AF302666_1  ubiquitin-specific protease 16                487   4e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006660217.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    486   6e-148   
gb|EMT33844.1|  Ubiquitin carboxyl-terminal hydrolase 17                483   1e-147   
ref|XP_002867659.1|  ubiquitin-specific protease 16                     486   1e-147   
ref|XP_010439011.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    486   1e-147   
ref|NP_001063411.2|  Os09g0464400                                       482   2e-147   Oryza sativa Japonica Group [Japonica rice]
emb|CDX92643.1|  BnaC07g39010D                                          485   2e-147   
dbj|BAD33960.1|  putative ubiquitin-specific protease                   483   2e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010433753.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    484   7e-147   
ref|XP_010448548.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    484   7e-147   
ref|XP_002445647.1|  hypothetical protein SORBIDRAFT_07g023330          482   3e-146   Sorghum bicolor [broomcorn]
emb|CDY34291.1|  BnaA01g13940D                                          481   5e-146   
ref|XP_006466294.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    478   6e-146   
ref|XP_009138224.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    481   7e-146   
ref|XP_010239389.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    476   3e-145   
emb|CBI35523.3|  unnamed protein product                                468   2e-144   
gb|EAZ07363.1|  hypothetical protein OsI_29613                          476   3e-144   Oryza sativa Indica Group [Indian rice]
tpg|DAA48490.1|  TPA: putative ubiquitin carboxyl-terminal hydrol...    475   5e-144   
ref|XP_008678623.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    472   6e-144   
gb|KHG26104.1|  Ubiquitin carboxyl-terminal hydrolase 17                474   8e-144   
ref|XP_008678622.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    472   8e-144   
ref|XP_008664540.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    475   1e-143   
emb|CDY11021.1|  BnaA03g46800D                                          473   6e-143   
emb|CDY03441.1|  BnaC01g16410D                                          471   3e-142   
ref|XP_011100001.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    464   6e-141   
ref|XP_010681055.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    459   2e-140   
ref|XP_009137457.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    466   3e-140   
ref|XP_004957062.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    458   8e-139   
ref|XP_002530694.1|  cysteine-type endopeptidase, putative              454   2e-138   Ricinus communis
ref|XP_010523321.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    450   5e-137   
gb|EYU30946.1|  hypothetical protein MIMGU_mgv1a004116mg                441   1e-136   
gb|KHG26103.1|  Ubiquitin carboxyl-terminal hydrolase 17                453   8e-136   
ref|XP_011097488.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    450   1e-135   
gb|KFK28246.1|  hypothetical protein AALP_AA8G491300                    440   2e-133   
ref|NP_201348.1|  ubiquitin-specific protease 17                        439   2e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282127.1|  hypothetical protein CARUB_v10028379mg             439   2e-133   
ref|XP_002864957.1|  hypothetical protein ARALYDRAFT_332761             439   2e-133   
ref|XP_010463054.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    439   2e-133   
ref|XP_006394032.1|  hypothetical protein EUTSA_v10003706mg             438   4e-133   
ref|XP_010444522.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    439   5e-133   
ref|XP_004957061.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    443   7e-133   
ref|XP_010484359.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    438   9e-133   
ref|XP_002462507.1|  hypothetical protein SORBIDRAFT_02g026980          440   3e-132   Sorghum bicolor [broomcorn]
ref|XP_006426286.1|  hypothetical protein CICLE_v10024864mg             439   7e-132   
ref|XP_009150635.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    429   3e-129   
ref|XP_010444523.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    427   9e-129   
ref|XP_010484360.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    426   2e-128   
gb|EPS64787.1|  hypothetical protein M569_09988                         411   2e-128   
emb|CDY08792.1|  BnaA06g24320D                                          426   3e-128   
gb|EPS59868.1|  hypothetical protein M569_14935                         411   8e-128   
emb|CDY14564.1|  BnaC03g48950D                                          424   9e-128   
gb|ACF83022.1|  unknown                                                 407   2e-124   Zea mays [maize]
ref|XP_010274759.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    408   4e-119   
ref|XP_011044935.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    399   7e-119   
ref|XP_010279646.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    407   8e-119   
gb|EMT11184.1|  Ubiquitin carboxyl-terminal hydrolase 16                397   2e-118   
ref|XP_006450208.1|  hypothetical protein CICLE_v10007658mg             395   9e-118   
emb|CBI33027.3|  unnamed protein product                                401   1e-117   
ref|XP_006483493.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    395   1e-117   
gb|KHN19658.1|  Ubiquitin carboxyl-terminal hydrolase 19                394   1e-117   
ref|XP_011044934.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    398   1e-117   
ref|XP_002308728.2|  hypothetical protein POPTR_0006s28540g             392   2e-117   Populus trichocarpa [western balsam poplar]
ref|XP_011044933.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    399   2e-117   
ref|XP_009390669.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    402   2e-117   
gb|KDO67336.1|  hypothetical protein CISIN_1g004724mg                   395   2e-117   
ref|XP_011044931.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    399   2e-117   
ref|XP_003550229.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    395   2e-117   
ref|XP_006483492.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    395   2e-117   
ref|NP_565576.1|  ubiquitin carboxyl-terminal hydrolase 19              393   4e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003545417.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    394   5e-117   
ref|XP_002298917.2|  hypothetical protein POPTR_0001s38800g             392   5e-117   Populus trichocarpa [western balsam poplar]
ref|XP_001772702.1|  predicted protein                                  384   8e-117   
ref|XP_006293755.1|  hypothetical protein CARUB_v10022714mg             394   1e-116   
ref|XP_004488653.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    399   1e-116   
ref|XP_010644793.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    401   1e-116   
ref|XP_002317364.2|  UBIQUITIN-SPECIFIC PROTEASE 15 family protein      396   1e-116   Populus trichocarpa [western balsam poplar]
ref|XP_004498826.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    393   2e-116   
ref|XP_011044972.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    392   2e-116   
ref|XP_007161112.1|  hypothetical protein PHAVU_001G043700g             391   4e-116   
ref|XP_010417220.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    389   5e-116   
gb|AES66462.2|  ubiquitin carboxy-terminal hydrolase                    398   6e-116   
gb|EPS72742.1|  hypothetical protein M569_02015                         380   6e-116   
ref|XP_009396938.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    395   1e-115   
gb|KFK29759.1|  hypothetical protein AALP_AA7G175300                    387   1e-115   
ref|XP_011031394.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    387   2e-115   
ref|XP_011045594.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    396   2e-115   
gb|KHN14516.1|  Ubiquitin carboxyl-terminal hydrolase 17                394   2e-115   
ref|XP_008782751.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    392   2e-115   
ref|XP_002324377.2|  hypothetical protein POPTR_0018s03350g             390   2e-115   Populus trichocarpa [western balsam poplar]
ref|XP_006477929.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    398   2e-115   
ref|XP_006601204.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    390   3e-115   
ref|XP_008378636.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    379   3e-115   
ref|XP_009117107.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    387   3e-115   
emb|CDY20330.1|  BnaC04g36260D                                          386   4e-115   
ref|XP_011070235.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    392   5e-115   
ref|XP_006412571.1|  hypothetical protein EUTSA_v10024675mg             385   5e-115   
emb|CDY34761.1|  BnaA09g41280D                                          386   5e-115   
ref|XP_010429445.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    387   6e-115   
ref|XP_010472472.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    387   7e-115   
gb|KDO60602.1|  hypothetical protein CISIN_1g039539mg                   380   7e-115   
ref|XP_006477932.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    396   7e-115   
ref|XP_007022154.1|  Ubiquitin-specific protease 15, putative iso...    392   7e-115   
ref|XP_007022155.1|  Ubiquitin-specific protease 15, putative iso...    395   8e-115   
ref|XP_009140568.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    385   8e-115   
ref|XP_002970813.1|  hypothetical protein SELMODRAFT_171601             377   9e-115   
emb|CDX75188.1|  BnaA01g05140D                                          384   1e-114   
gb|KEH39885.1|  ubiquitin carboxy-terminal hydrolase                    391   1e-114   
ref|XP_007022153.1|  Ubiquitin-specific protease 15, putative iso...    395   1e-114   
emb|CDX76801.1|  BnaC08g33870D                                          385   1e-114   
gb|KFK32657.1|  hypothetical protein AALP_AA6G271600                    385   2e-114   
ref|XP_010539169.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    392   2e-114   
gb|KCW68484.1|  hypothetical protein EUGRSUZ_F02136                     389   2e-114   
ref|XP_009126746.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    384   2e-114   
ref|XP_008782673.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    392   2e-114   
ref|XP_011045595.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    392   3e-114   
ref|XP_010694568.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    392   4e-114   
gb|EYU39312.1|  hypothetical protein MIMGU_mgv1a001469mg                389   4e-114   
emb|CDP06086.1|  unnamed protein product                                392   5e-114   
gb|KDP33469.1|  hypothetical protein JCGZ_07040                         385   6e-114   
ref|XP_010525922.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    382   7e-114   
ref|XP_006442255.1|  hypothetical protein CICLE_v10018666mg             393   9e-114   
ref|XP_006405001.1|  hypothetical protein EUTSA_v10000088mg             382   9e-114   
gb|AAD50020.1|AC007651_15  Unknown protein                              390   9e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004141442.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    385   9e-114   
ref|XP_002880603.1|  ubiquitin carboxyl-terminal hydrolase family...    383   1e-113   
ref|XP_004157412.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    385   1e-113   
ref|NP_564014.1|  ubiquitin carboxyl-terminal hydrolase 15              391   1e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006598163.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    392   1e-113   
emb|CDY45587.1|  BnaA04g14540D                                          382   1e-113   
ref|XP_006598161.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    392   2e-113   
gb|KHN29845.1|  Ubiquitin carboxyl-terminal hydrolase 15                392   2e-113   
ref|XP_009110426.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    389   2e-113   
ref|XP_008781931.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    391   2e-113   
ref|NP_001189593.1|  ubiquitin carboxyl-terminal hydrolase 19           377   2e-113   
gb|KHN47474.1|  Ubiquitin carboxyl-terminal hydrolase 15                391   3e-113   
ref|XP_007149328.1|  hypothetical protein PHAVU_005G061400g             391   3e-113   
dbj|BAD44466.1|  unknown protein                                        380   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194895.1|  ubiquitin carboxyl-terminal hydrolase 18              380   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010092717.1|  Ubiquitin carboxyl-terminal hydrolase 15           391   4e-113   
ref|XP_006594689.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    390   5e-113   
emb|CDX68773.1|  BnaC01g06800D                                          380   5e-113   
ref|XP_003541793.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    390   5e-113   
emb|CDX96790.1|  BnaA08g23330D                                          386   6e-113   
ref|XP_002867287.1|  ubiquitin carboxyl-terminal hydrolase family...    380   6e-113   
gb|KHG15081.1|  Ubiquitin carboxyl-terminal hydrolase 19 -like pr...    377   6e-113   
ref|XP_010459276.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    389   7e-113   
ref|XP_010498051.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    389   7e-113   
ref|XP_010459274.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    389   8e-113   
emb|CDX83925.1|  BnaC08g17200D                                          386   9e-113   
ref|XP_007011632.1|  Ubiquitin carboxyl-terminal hydrolase 19, pu...    383   9e-113   
ref|XP_006306123.1|  hypothetical protein CARUB_v10011568mg             389   1e-112   
ref|XP_002515370.1|  cysteine-type endopeptidase, putative              379   1e-112   Ricinus communis
ref|XP_010062748.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    389   1e-112   
ref|XP_010476845.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    388   1e-112   
gb|KHN29656.1|  Ubiquitin carboxyl-terminal hydrolase 19                382   2e-112   
ref|XP_003523663.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    382   2e-112   
ref|XP_010476847.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    387   2e-112   
ref|NP_001185019.1|  ubiquitin carboxyl-terminal hydrolase 15           387   2e-112   
ref|XP_004291227.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    381   2e-112   
ref|XP_006477933.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    389   3e-112   
ref|XP_007136918.1|  hypothetical protein PHAVU_009G084800g             381   3e-112   
ref|XP_010062745.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    388   3e-112   
ref|XP_008220608.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    380   3e-112   
ref|XP_010062746.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    388   3e-112   
ref|XP_010062747.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    388   3e-112   
dbj|BAD43230.1|  unknown protein                                        378   3e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010062743.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    388   3e-112   
ref|XP_009354862.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    389   4e-112   
ref|XP_009354860.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    389   4e-112   
ref|XP_008377533.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    375   5e-112   
gb|KHF97895.1|  Ubiquitin carboxyl-terminal hydrolase 15 -like pr...    388   5e-112   
ref|XP_008356196.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    388   5e-112   
ref|XP_008356195.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    388   5e-112   
ref|XP_011082032.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    383   5e-112   
ref|XP_010928622.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    386   6e-112   
ref|XP_009354861.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    387   9e-112   
ref|XP_010447529.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    377   1e-111   
ref|XP_002892935.1|  ubiquitin-specific protease 15                     385   1e-111   
ref|XP_009354859.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    387   1e-111   
ref|XP_006283326.1|  hypothetical protein CARUB_v10004366mg             376   2e-111   
emb|CDY65125.1|  BnaA06g38410D                                          383   2e-111   
ref|XP_010915558.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    385   2e-111   
ref|XP_011077821.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    385   3e-111   
ref|XP_008452810.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    378   3e-111   
ref|XP_009367759.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    386   3e-111   
ref|XP_009149147.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    383   3e-111   
ref|XP_009776208.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    385   4e-111   
ref|XP_006355189.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    380   4e-111   
ref|XP_010438014.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    375   4e-111   
ref|XP_006416743.1|  hypothetical protein EUTSA_v10006749mg             383   5e-111   
emb|CDY48465.1|  BnaC05g13250D                                          382   6e-111   
ref|XP_008226232.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    385   7e-111   
ref|XP_004245303.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    379   7e-111   
ref|XP_008226235.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    385   7e-111   
ref|XP_009607564.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    380   7e-111   
ref|XP_008356197.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    385   7e-111   
ref|XP_009359054.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    374   7e-111   
ref|XP_009359053.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    377   7e-111   
ref|XP_007211338.1|  hypothetical protein PRUPE_ppa000901mg             384   9e-111   
ref|XP_010540128.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    381   1e-110   
gb|EYU28912.1|  hypothetical protein MIMGU_mgv1a001776mg                377   2e-110   
ref|XP_009354863.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    384   2e-110   
ref|XP_009609977.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    384   2e-110   
emb|CBI23999.3|  unnamed protein product                                381   2e-110   
ref|XP_008382966.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    384   2e-110   
ref|XP_010432837.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    372   2e-110   
ref|XP_001774704.1|  predicted protein                                  365   2e-110   
ref|XP_008783949.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    382   2e-110   
ref|XP_009363067.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    375   3e-110   
ref|XP_010049833.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    374   3e-110   
ref|XP_010925671.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    381   3e-110   
gb|AAG42756.1|AF302665_1  ubiquitin-specific protease 15                381   3e-110   
ref|XP_006348364.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    382   3e-110   
ref|XP_010548553.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    371   4e-110   
gb|EEC72815.1|  hypothetical protein OsI_06524                          377   5e-110   
ref|XP_002271840.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    381   6e-110   
ref|XP_010444524.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    374   7e-110   
ref|XP_008789702.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    379   9e-110   
ref|XP_010432836.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    371   1e-109   
ref|XP_008393558.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    374   1e-109   
ref|XP_009772698.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    376   1e-109   
ref|XP_010484361.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    372   2e-109   
ref|XP_008645575.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    380   2e-109   
ref|XP_002453597.1|  hypothetical protein SORBIDRAFT_04g008750          380   3e-109   
ref|XP_010444525.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    371   4e-109   
ref|XP_010484362.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    370   7e-109   
gb|KHN37220.1|  Ubiquitin carboxyl-terminal hydrolase 19                372   8e-109   
ref|XP_010259741.1|  PREDICTED: uncharacterized protein LOC104599075    384   8e-109   
dbj|BAD28270.1|  putative ubiquitin-specific protease                   377   8e-109   
ref|XP_003527768.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    372   1e-108   
ref|XP_004301951.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    379   1e-108   
ref|XP_008649027.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    377   1e-108   
gb|KHG25224.1|  Ubiquitin carboxyl-terminal hydrolase 15 -like pr...    377   2e-108   
ref|XP_010324419.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    377   2e-108   
ref|NP_001046415.1|  Os02g0244300                                       377   2e-108   
ref|XP_004244319.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    377   2e-108   
ref|XP_006647115.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    377   3e-108   
ref|XP_002969545.1|  hypothetical protein SELMODRAFT_91996              358   3e-108   
ref|XP_008679796.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    376   4e-108   
ref|XP_004951331.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    376   8e-108   
ref|XP_003560376.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    377   9e-108   
ref|XP_003596211.1|  Ubiquitin carboxyl-terminal hydrolase              375   1e-107   
ref|XP_002980323.1|  hypothetical protein SELMODRAFT_420048             372   4e-107   
ref|XP_006657202.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    373   6e-107   
ref|XP_010098405.1|  Ubiquitin carboxyl-terminal hydrolase 19           365   2e-106   
ref|XP_009367758.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    372   3e-106   
ref|XP_002438776.1|  hypothetical protein SORBIDRAFT_10g026010          371   5e-106   
ref|XP_010240068.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    372   5e-106   
ref|NP_001058243.1|  Os06g0654000                                       370   6e-106   
gb|EAZ37856.1|  hypothetical protein OsJ_22202                          370   2e-105   
ref|XP_008382965.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    370   3e-105   
ref|XP_009408046.1|  PREDICTED: uncharacterized protein LOC103990...    371   3e-105   
gb|KDO45638.1|  hypothetical protein CISIN_1g0014791mg                  363   3e-105   
gb|EAZ01926.1|  hypothetical protein OsI_23952                          370   6e-105   
ref|XP_004965693.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    369   6e-105   
dbj|BAD37420.1|  putative ubiquitin-specific protease 15                370   7e-105   
dbj|BAJ87234.1|  predicted protein                                      367   7e-105   
gb|KDO45637.1|  hypothetical protein CISIN_1g0014791mg                  362   3e-104   
ref|XP_006840775.1|  hypothetical protein AMTR_s00096p00170210          359   9e-104   
dbj|BAJ97014.1|  predicted protein                                      365   9e-104   
gb|EMT03019.1|  Ubiquitin carboxyl-terminal hydrolase 19                363   1e-103   
gb|EMS56666.1|  Ubiquitin carboxyl-terminal hydrolase 19                363   1e-103   
gb|EYU22051.1|  hypothetical protein MIMGU_mgv1a001964mg                356   5e-103   
ref|XP_010693053.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    363   2e-102   
ref|XP_003571975.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    360   2e-102   
gb|KDO81146.1|  hypothetical protein CISIN_1g0011342mg                  355   2e-102   
ref|XP_010234088.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    359   2e-102   
ref|XP_007223115.1|  hypothetical protein PRUPE_ppa005433mg             344   4e-102   
gb|EMS59305.1|  Ubiquitin carboxyl-terminal hydrolase 15                356   5e-101   
ref|XP_006845518.1|  hypothetical protein AMTR_s00019p00164720          349   2e-100   
emb|CAN68406.1|  hypothetical protein VITISV_035043                     351   3e-99    
ref|XP_006283136.1|  hypothetical protein CARUB_v10004163mg             347   3e-99    
ref|XP_010049834.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    335   7e-99    
ref|XP_006342461.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    336   3e-97    
ref|XP_001771280.1|  predicted protein                                  322   9e-96    
gb|EMT09965.1|  Ubiquitin carboxyl-terminal hydrolase 15                326   4e-93    
ref|XP_007047806.1|  Ubiquitin-specific protease 17, putative iso...    324   4e-93    
ref|XP_001758249.1|  predicted protein                                  317   1e-92    
ref|XP_010314797.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    323   2e-92    
gb|EEE56641.1|  hypothetical protein OsJ_06049                          316   1e-87    
emb|CAN77546.1|  hypothetical protein VITISV_025214                     317   6e-87    
gb|AFW65940.1|  putative ubiquitin carboxyl-terminal hydrolase su...    294   4e-84    
ref|XP_008653981.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    300   7e-82    
ref|XP_003613074.1|  Ubiquitin carboxyl-terminal hydrolase              299   7e-81    
dbj|BAD95379.1|  putative ubiquitin carboxyl terminal hydrolase         268   2e-75    
tpg|DAA48489.1|  TPA: putative ubiquitin carboxyl-terminal hydrol...    274   2e-75    
gb|KDO45641.1|  hypothetical protein CISIN_1g0014791mg                  270   3e-73    
emb|CAN78307.1|  hypothetical protein VITISV_005598                     261   2e-72    
gb|EMC84050.1|  Ubiquitin carboxyl-terminal hydrolase 36                245   3e-68    
gb|KFP76104.1|  Ubiquitin carboxyl-terminal hydrolase 42                243   1e-67    
ref|XP_009408047.1|  PREDICTED: uncharacterized protein LOC103990...    256   9e-67    
ref|XP_009867504.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   9e-67    
gb|KFU93838.1|  Ubiquitin carboxyl-terminal hydrolase 42                238   2e-66    
ref|XP_010570639.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    239   3e-66    
ref|XP_005508434.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    251   1e-65    
ref|XP_004840503.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    254   1e-65    
gb|EHB07899.1|  Ubiquitin carboxyl-terminal hydrolase 42                254   1e-65    
gb|AFW71122.1|  putative ubiquitin carboxyl-terminal hydrolase su...    249   2e-65    
gb|KFQ07629.1|  Ubiquitin carboxyl-terminal hydrolase 42                236   3e-65    
ref|XP_004892426.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    254   3e-65    
gb|AFW71123.1|  putative ubiquitin carboxyl-terminal hydrolase su...    249   4e-65    
ref|XP_002110073.1|  hypothetical protein TRIADDRAFT_53651              246   2e-64    
gb|EMP34977.1|  Ubiquitin carboxyl-terminal hydrolase 42                245   5e-64    
gb|AAR01977.1|  DUB1                                                    243   6e-64    
emb|CDP06110.1|  unnamed protein product                                243   7e-64    
ref|XP_004918308.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    236   8e-64    
gb|KFU93877.1|  Ubiquitin carboxyl-terminal hydrolase 42                248   8e-64    
ref|XP_007667480.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    249   8e-64    
ref|XP_643982.1|  peptidase C19 family protein                          245   1e-63    
ref|XP_005249940.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    242   1e-63    
ref|XP_004243191.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    241   1e-63    
gb|ELU08703.1|  hypothetical protein CAPTEDRAFT_136598                  234   2e-63    
ref|XP_003227691.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    248   2e-63    
ref|XP_003289130.1|  hypothetical protein DICPUDRAFT_15497              243   2e-63    
ref|XP_010001626.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    248   3e-63    
ref|XP_005398030.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   3e-63    
ref|XP_007498323.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    247   3e-63    
ref|XP_005002006.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    242   3e-63    
ref|XP_003761533.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    247   4e-63    
gb|KFO52947.1|  Ubiquitin carboxyl-terminal hydrolase 36                230   4e-63    
ref|XP_001377522.3|  PREDICTED: ubiquitin carboxyl-terminal hydro...    246   4e-63    
emb|CAG04440.1|  unnamed protein product                                236   5e-63    
ref|XP_007060712.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    246   6e-63    
ref|XP_005811757.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   6e-63    
ref|XP_007425215.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    246   6e-63    
ref|XP_005304763.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    246   7e-63    
ref|XP_004918037.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   7e-63    
ref|XP_007558965.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   7e-63    
ref|NP_001099379.1|  ubiquitin carboxyl-terminal hydrolase 42           245   9e-63    
ref|XP_010641064.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   1e-62    
ref|XP_006889821.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   1e-62    
ref|XP_005003767.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   1e-62    
ref|XP_007081191.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    243   1e-62    
ref|XP_003469939.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   1e-62    
gb|KFP01515.1|  Ubiquitin carboxyl-terminal hydrolase 36                228   1e-62    
ref|XP_008071103.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   1e-62    
ref|XP_004629760.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   1e-62    
ref|XP_008436360.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   1e-62    
ref|XP_007525142.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   1e-62    
ref|XP_008249445.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    245   1e-62    
ref|XP_003291691.1|  hypothetical protein DICPUDRAFT_156310             234   2e-62    
ref|XP_005698158.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   2e-62    
ref|XP_007647189.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   2e-62    
gb|EAW55047.1|  ubiquitin specific peptidase 42, isoform CRA_a          244   2e-62    
ref|XP_008352731.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    225   2e-62    
dbj|BAB14232.1|  unnamed protein product                                244   2e-62    
gb|AAH60846.2|  USP42 protein                                           244   2e-62    
ref|XP_007615073.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   2e-62    
ref|XP_006765537.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    244   2e-62    
ref|XP_006906664.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   2e-62    
ref|XP_006150254.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   2e-62    
ref|XP_005080080.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   2e-62    
gb|KFQ30817.1|  Ubiquitin carboxyl-terminal hydrolase 36                227   2e-62    
gb|ERE76345.1|  ubiquitin carboxyl-terminal hydrolase 42-like pro...    244   3e-62    
gb|KDO81148.1|  hypothetical protein CISIN_1g0011341mg                  229   3e-62    
ref|XP_005368085.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   3e-62    
ref|XP_008154255.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   3e-62    
ref|XP_005982188.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   3e-62    
gb|KFW79216.1|  Ubiquitin carboxyl-terminal hydrolase 36                227   3e-62    
ref|NP_084025.2|  ubiquitin carboxyl-terminal hydrolase 42              244   3e-62    
gb|ELK28954.1|  Ubiquitin carboxyl-terminal hydrolase 42                243   3e-62    
ref|XP_001493909.3|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   3e-62    
ref|XP_003281959.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   3e-62    
ref|XP_007131125.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin sp...    243   3e-62    
gb|KFH64886.1|  hypothetical protein MVEG_09614                         238   3e-62    
ref|XP_008016913.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   3e-62    
ref|XP_005879483.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   3e-62    
ref|XP_001090104.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   3e-62    
ref|XP_010844060.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   3e-62    
ref|XP_008822230.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   3e-62    
gb|ELK17417.1|  Ubiquitin carboxyl-terminal hydrolase 42                244   3e-62    
ref|XP_007187097.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   4e-62    
ref|XP_006097760.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   4e-62    
ref|XP_006715853.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   4e-62    
sp|E1B9W9.1|UBP42_BOVIN  RecName: Full=Ubiquitin carboxyl-termina...    243   4e-62    
ref|XP_002271760.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    236   4e-62    
ref|XP_006097758.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   4e-62    
ref|NP_001193568.1|  ubiquitin carboxyl-terminal hydrolase 42           243   4e-62    
ref|XP_006044362.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    243   4e-62    
ref|XP_005998431.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   4e-62    
ref|XP_005549142.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   4e-62    
ref|XP_008525763.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    243   4e-62    
ref|XP_003895748.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   4e-62    
ref|XP_009450882.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   4e-62    
ref|XP_006859921.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   4e-62    
ref|NP_115548.1|  ubiquitin carboxyl-terminal hydrolase 42              243   4e-62    
ref|XP_005249939.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   4e-62    
gb|EAL23715.1|  ubiquitin specific protease 42                          243   4e-62    
ref|XP_001759420.1|  predicted protein                                  226   4e-62    
ref|XP_005339771.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   5e-62    
emb|CAE53097.1|  ubiquitin-specific protease 42                         243   5e-62    
ref|XP_004080264.1|  PREDICTED: uncharacterized protein LOC101169567    241   5e-62    
gb|ELR51150.1|  Ubiquitin carboxyl-terminal hydrolase 42                243   5e-62    
ref|XP_005549141.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   5e-62    
ref|XP_003832997.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   5e-62    
ref|XP_005903007.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   5e-62    
ref|XP_003934290.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   5e-62    
ref|XP_009450879.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   5e-62    
gb|AAT67238.1|  ubiquitin specific protease 42                          243   5e-62    



>ref|XP_009761470.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Nicotiana 
sylvestris]
Length=1175

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/799 (60%), Positives = 569/799 (71%), Gaps = 48/799 (6%)
 Frame = +2

Query  1352  GFWEGTAHYSRSKVNVVDDVSHPDSED-----VSYSWLPTNRSSEMARTSSPSVDEQGPK  1516
             GFWEG   Y+RSK+  +D +++  S +     +S S   +++  EMA+  S  V EQG  
Sbjct  355   GFWEGAVPYTRSKIQSLDSIAYSPSRNACNTKISDSQSTSSQPPEMAKPLS-EVGEQGSN  413

Query  1517  AK---------------PSDAAQ-LLQVKDNVDLKRSSLRPD-SHNTIDLNKASVRSTSS  1645
             +K               P D A+   +VKD  + +RSS     + N +D++ +S + TS+
Sbjct  414   SKKNLKNPNPITVELRKPVDRAESRFEVKDETESRRSSASRSVTSNQLDVHDSSDKCTST  473

Query  1646  FKESRRSLSTASDACKVEHLVNNDTLKVNS----PPKASDKSIEGLKNVSQTPKARQVES  1813
               E R S S AS      +L N+D LKV+S     P  S   +EG  NV Q PK RQ ES
Sbjct  474   SDEGRYSSSGASG-----NLKNHDGLKVSSLSFSSPNKSYFGVEGSTNVLQLPKDRQKES  528

Query  1814  LSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVT-ACssdsggdsqssksglkssvskvvd  1990
                K    H SS+N RH+ Q  KSAKIDS QV+ ACS++S     ++++GLKSSV KVVD
Sbjct  529   SPAKISGSHISSSNGRHEVQNVKSAKIDSTQVSSACSAESNVPLPNARNGLKSSVLKVVD  588

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q + SK +RHNSLG   E+ GRY NKGLFPYE FVKL N K  ELRPFGL NCGNSCYAN
Sbjct  589   QFRGSKLTRHNSLGDECEVVGRYGNKGLFPYESFVKLHNWKN-ELRPFGLVNCGNSCYAN  647

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFTPP T+YFLQG H K C KK WCF CEFESLVLKAK+GNSPLSPI IISHLE
Sbjct  648   AVLQCLAFTPPLTSYFLQGLHFKTCEKKGWCFTCEFESLVLKAKDGNSPLSPISIISHLE  707

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             +IGS+LGNGREEDAHEFLRYVI+TMQS+CL+EAGV  S S EE+T+L+GL FGG+LRSKI
Sbjct  708   SIGSNLGNGREEDAHEFLRYVIDTMQSICLREAGVSASGSFEEETTLVGLMFGGYLRSKI  767

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             ECMRCGGKSER ER+MDLTVEIDGDI +LE AL+QFTHTE LDGENKY C RCKSYEKA+
Sbjct  768   ECMRCGGKSERQERMMDLTVEIDGDIGTLEEALKQFTHTETLDGENKYRCGRCKSYEKAK  827

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKLK+LEAPNVLTIALKRFQSGKFGKLNKTI FPEILNLA YMSGTSDKSP+YQLYGV+ 
Sbjct  828   KKLKVLEAPNVLTIALKRFQSGKFGKLNKTIKFPEILNLAPYMSGTSDKSPVYQLYGVVV  887

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DVMNAAFSGHYVCYV+NFQN+WFKV+DS VK VE+E VLSKGAYMLLYSRCSPRAP++
Sbjct  888   HLDVMNAAFSGHYVCYVRNFQNRWFKVDDSSVKSVELERVLSKGAYMLLYSRCSPRAPRI  947

Query  3068  IRSLT-SHDPRGQKYVNCKSSSHTNS-WDLSKGDSTNDPACRECFNSVQASSWPHRTIfe  3241
             +RSL    DPR  K V CKS SHT S WD S GDST D  C EC  +   S  P R+IFE
Sbjct  948   MRSLAIPRDPRRSKQVACKSRSHTRSPWDSSHGDST-DQTCGECSYTSHTSVRPSRSIFE  1006

Query  3242  dsssdnssslfsegcssstdssyrdsisAEDYAADQLFGDPGGACWNSPWRIstdsdtss  3421
             D SS   SS      +S +  S     ++ D   DQ+FG+ GG CWN+PWR S+DSDTSS
Sbjct  1007  DDSSSEQSSSLFSEGASCSTESTNRDSTSTDELFDQIFGESGG-CWNNPWRNSSDSDTSS  1065

Query  3422  sssspsplysrhsrlsNMGHYASGYPET----SGYADSAVEDRGFWTGTCDPE----VSK  3577
             SSSSPSPLYSRHS L+++  YAS + ET    S  A++A +  GFWTG  D      V +
Sbjct  1066  SSSSPSPLYSRHSPLADLDRYASAHEETCSSCSDGAETAGDGHGFWTGLPDRNGFAGVRE  1125

Query  3578  SKGSIPSLSPDSAKQCRHL  3634
             S    P L P+S+K CR+L
Sbjct  1126  SNSRTP-LCPNSSKHCRNL  1143


 Score =   148 bits (374),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 137/211 (65%), Gaps = 4/211 (2%)
 Frame = +2

Query  377  AAFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysf  556
            AAF+   GP+LGF+VR+KWR + ARREEI RLLVLASEEAARAE  AA EYG+ Y  YS+
Sbjct  16   AAFVAVFGPVLGFVVRRKWRRSVARREEIKRLLVLASEEAARAELLAAEEYGYGYGGYSY  75

Query  557  gsVVGDEvpa----avpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCS  724
              +  D+V      ++ A  P SST TS   ARQL YQCA C S  STRCS+CKAVRYCS
Sbjct  76   DYLKEDDVFVDPPVSLSATPPPSSTTTSYSGARQLQYQCAVCSSPTSTRCSQCKAVRYCS  135

Query  725  GKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSI  904
            GKCQI+HWR GHKDEC P  N++H +     +    ++QE+N  + + IE E R++  S 
Sbjct  136  GKCQILHWRQGHKDECRPVSNSDHHNDVDATSHLNAYKQESNGSHLKSIEVEGRHSSESG  195

Query  905  DASFAEPTCSEPSISGAENTEDVMEGKHFTD  997
            DAS AE        S A + +DV + +  T+
Sbjct  196  DASPAEAAVLRSKHSAAYDGKDVTDEQSLTE  226



>ref|XP_009609184.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Nicotiana 
tomentosiformis]
Length=1175

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/799 (59%), Positives = 566/799 (71%), Gaps = 47/799 (6%)
 Frame = +2

Query  1352  GFWEGTAHYSRSKVNVVDDVSHPDSEDVSYSWLPTNRSS-----EMARTSSPSVDEQGP-  1513
             GFWEG   Y+RSK+  +D +++  S +   + +   +S+     EMAR     V E G  
Sbjct  354   GFWEGAVPYTRSKIQSLDSIAYSPSRNACNTKISDFQSTSSQPPEMARPLVSEVGEHGSN  413

Query  1514  --------------KAKPSDAAQ-LLQVKDNVDLKRSSLRPD-SHNTIDLNKASVRSTSS  1645
                           + KP + A+   +VKD  + +RSS     + N +D++ +S + TS+
Sbjct  414   SKKNLKNPNPITVERRKPVERAESRFEVKDETESRRSSASRSVTSNQLDVHDSSDKYTST  473

Query  1646  FKESRRSLSTASDACKVEHLVNNDTLKVNSPPKASDK----SIEGLKNVSQTPKARQVES  1813
              +E R S S AS      +L N+D LKV+S P +S K     +EG  +V Q PK RQ ES
Sbjct  474   PEEGRYSSSGASG-----NLKNHDGLKVSSLPLSSPKKSYCGVEGSASVLQLPKDRQKES  528

Query  1814  LSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVT-ACssdsggdsqssksglkssvskvvd  1990
                K    H SS+N RH+ Q  KS +IDS QV+ ACS++S     +++SGLKSSV KVVD
Sbjct  529   SPAKISGSHISSSNGRHEVQNVKSPRIDSTQVSSACSAESNVPLPNARSGLKSSVLKVVD  588

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q + SK +RHNSLG   E+ GRY NKGLFPYE FVKL N K  ELRPFGL NCGNSCYAN
Sbjct  589   QFRGSKLTRHNSLGDECEVVGRYGNKGLFPYESFVKLHNWKN-ELRPFGLVNCGNSCYAN  647

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFTPP T+YFLQG HSK C KK WCF CEFESLVLKAK+G SPLSPI IISHLE
Sbjct  648   AVLQCLAFTPPLTSYFLQGLHSKTCEKKGWCFTCEFESLVLKAKDGTSPLSPISIISHLE  707

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             +IGS+LGNGREEDAHEFLRYVI+TMQS+CL+EAGV  S S EE+T+L+GL FGG+LRSKI
Sbjct  708   SIGSNLGNGREEDAHEFLRYVIDTMQSICLREAGVSASGSFEEETTLVGLMFGGYLRSKI  767

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             ECMRCGGKSER ER+MDLTVEIDGDI +LE AL+QFTHTE LDGENKY C RCKSYEKA+
Sbjct  768   ECMRCGGKSERQERMMDLTVEIDGDIGTLEEALKQFTHTETLDGENKYRCGRCKSYEKAK  827

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKLK+LEAPNVLTIALKRFQSGKFGKLNKTI FPEILNLA YMSGT DKSP+YQLYGV+ 
Sbjct  828   KKLKVLEAPNVLTIALKRFQSGKFGKLNKTIKFPEILNLAPYMSGTRDKSPVYQLYGVVV  887

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DVMNAAFSGHYVCYV+NFQN+WFKVNDS VK VE+E VLS+GAYMLLYSRCSPRAP++
Sbjct  888   HLDVMNAAFSGHYVCYVRNFQNRWFKVNDSSVKSVELERVLSEGAYMLLYSRCSPRAPRI  947

Query  3068  IRSLT-SHDPRGQKYVNCKSSSHTNS-WDLSKGDSTNDPACRECFNSVQASSWPHRTIfe  3241
             +RSL    DPR  K + CKS SHT S WD S GDST D  C EC  +   S  P R+IFE
Sbjct  948   MRSLAIPLDPRRSKQLACKSRSHTRSPWDSSHGDST-DQTCSECSYTSHTSVRPSRSIFE  1006

Query  3242  dsssdnssslfsegcssstdssyrdsisAEDYAADQLFGDPGGACWNSPWRIstdsdtss  3421
             D SS   SS      +S +  S     ++ D   DQ+FG+ GG CWN+PWR S+DSDTSS
Sbjct  1007  DDSSSEQSSSLFSEGASCSTESTNRDSTSTDELFDQIFGESGG-CWNNPWRNSSDSDTSS  1065

Query  3422  sssspsplysrhsrlsNMGHYASGYPET----SGYADSAVEDRGFWTGTCDPE----VSK  3577
             SSSSPSPLYS+HS L+++   AS + ET    S  A++A +  GFWTG  D      V +
Sbjct  1066  SSSSPSPLYSKHSPLADLDRNASAHEETCSSCSDGAETAGDGHGFWTGLPDRNGYAGVRE  1125

Query  3578  SKGSIPSLSPDSAKQCRHL  3634
             S    P L P+S+K CR+L
Sbjct  1126  SNSRTP-LCPNSSKHCRNL  1143


 Score =   145 bits (365),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 130/210 (62%), Gaps = 3/210 (1%)
 Frame = +2

Query  377  AAFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysf  556
            AAF+   GP+LGF+VR+KWR + ARREEI RLLVLASEEAARAE  AA EYG+ Y  YS+
Sbjct  16   AAFVAVFGPVLGFVVRRKWRRSVARREEIKRLLVLASEEAARAELLAAEEYGYGYGGYSY  75

Query  557  gsVVGDEvpaavpapapvSSTLTSVPV---ARQLPYQCAQCFSSASTRCSRCKAVRYCSG  727
              +  D+V    PA +      ++      +RQL YQCA C S  STRCS+CKAVRYCSG
Sbjct  76   DILKEDDVFVEPPASSAPPPPSSTTTSYSGSRQLQYQCAVCSSPTSTRCSQCKAVRYCSG  135

Query  728  KCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSID  907
            KCQI+HWR GHKDEC P  N +H +     +    ++QE+N  + + IE E R++  S D
Sbjct  136  KCQILHWRQGHKDECRPVSNTDHHNDVDATSHLNAYKQESNGSHLKSIEVEGRHSSESGD  195

Query  908  ASFAEPTCSEPSISGAENTEDVMEGKHFTD  997
            AS AE        S   + +DV   +  T+
Sbjct  196  ASPAEAAVLRSKHSATYDAKDVSNEQSLTE  225



>ref|XP_006338134.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Solanum 
tuberosum]
Length=1165

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/797 (59%), Positives = 560/797 (70%), Gaps = 47/797 (6%)
 Frame = +2

Query  1352  GFWEGTAHYSRSKVNVVDDVSHPDSED-----VSYSWLPTNRSSEMARTSSPSVDEQGPK  1516
             GFWEG   Y+RS++  +D ++ P S++     +S S   + R  E+AR   P   EQGP 
Sbjct  348   GFWEGPVPYTRSRIGSLDSIADPPSKNACDIKISDSQSTSCRPPEIARPLIPEAGEQGPN  407

Query  1517  AK---------------PSDAAQ-LLQVKDNVDLKRSSL-RPDSHNTIDLNKASVRSTSS  1645
             +K               P + A+   ++KD  +  RSS  R  + + +D++ +  + T  
Sbjct  408   SKTNLENPTPIMVEVLKPVNRAESRFEIKDQKESTRSSASRSVTSDQLDVHGSRDKCTLI  467

Query  1646  FKESRRSLSTASDACKVEHLVNNDTLKVNSPPKASD----KSIEGLKNVSQTPKARQVES  1813
              +E R S S+AS      +L  +D LKV+S   +S     + +EG  +  Q  K RQ  S
Sbjct  468   SEEGRYSSSSAS-----ANLKKHDGLKVSSLRSSSPSKSYRGVEGSTSALQLSKDRQKGS  522

Query  1814  LSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsq-ssksglkssvskvvd  1990
                K  +    S+N RHD Q  KSAKI+  QV +  S        ++K+GLKSSV KVVD
Sbjct  523   FPAKISDN--ISSNNRHDIQNVKSAKINGTQVASACSAESSAPLPNAKNGLKSSVLKVVD  580

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             QL++SK +R NSLG  S++ GRY NK LFPYE FVKL N K  ELRPFGL NCGNSCYAN
Sbjct  581   QLRSSKLTRLNSLGEESDVNGRYGNKALFPYESFVKLHNWKN-ELRPFGLVNCGNSCYAN  639

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFTPP T+YFLQG HSK C KK WCF CEFESLVLKAK+GNSPLSP  IISHLE
Sbjct  640   AVLQCLAFTPPLTSYFLQGLHSKTCEKKGWCFTCEFESLVLKAKDGNSPLSPSSIISHLE  699

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             +IGS+LGNGREEDAHEFLRYVI+TMQS+CLKEAGV    S EE+TSLIGLTFGG+LRSKI
Sbjct  700   SIGSNLGNGREEDAHEFLRYVIDTMQSICLKEAGVTAPGSFEEETSLIGLTFGGYLRSKI  759

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             ECMRCGGKSER ERIMDLTVEIDGDI +LE AL+QFTHTE LDGENKY C RCKSYEKA+
Sbjct  760   ECMRCGGKSERQERIMDLTVEIDGDIGTLEEALKQFTHTETLDGENKYRCGRCKSYEKAK  819

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKLK++EAPNVLT+ALKRFQSGKFGKLNKTI FPE LNLA YMSGTSDKSP+YQLYGV+ 
Sbjct  820   KKLKVVEAPNVLTVALKRFQSGKFGKLNKTIKFPEFLNLAPYMSGTSDKSPVYQLYGVVV  879

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DVMNAAFSGHYVCYV+NFQNKW+KV+DS VK VE+E VLSKGAYMLLYSRCSPR P++
Sbjct  880   HLDVMNAAFSGHYVCYVRNFQNKWYKVDDSSVKSVELERVLSKGAYMLLYSRCSPRGPRI  939

Query  3068  IRSLT-SHDPRGQKYVNCKSSSHTNS-WDLSKGDSTNDPACRECFNSVQASSWPHRTIfe  3241
             +RSLT   DPR  K   CKS SHT S WD S GDST+   C EC      S  P R+IFE
Sbjct  940   MRSLTIPRDPRRSKQPTCKSRSHTRSPWDSSHGDSTSK-TCNECAYPSHTSVRPIRSIFE  998

Query  3242  dsssdnssslfsegcssstdssyrdsisAEDYAADQLFGDPGGACWNSPWRIstdsdtss  3421
             + +S   SS FSE  S STDS+ RDS S +D   D +FGD  G CWNS WR S+DSDTSS
Sbjct  999   EDTSSEQSSFFSELGSCSTDSTNRDSTSTDDLNID-IFGD-SGVCWNSLWRSSSDSDTSS  1056

Query  3422  sssspsplysrhsrlsNMGHYASGYPET--SGYADSAVEDRGFWTGTCDPE----VSKSK  3583
             SSSSPSPLYSRHS L+N+  YAS + ET  SG  ++A + +GFWTG  D      + ++ 
Sbjct  1057  SSSSPSPLYSRHSPLANLDRYASAHEETSCSGNPETAGDGQGFWTGLHDRNGYTGIPETS  1116

Query  3584  GSIPSLSPDSAKQCRHL  3634
             G  P L P+  K CR +
Sbjct  1117  GRTPPLCPNPTKHCRKV  1133


 Score =   140 bits (354),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 118/183 (64%), Gaps = 1/183 (1%)
 Frame = +2

Query  377  AAFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysf  556
            AAF+   GP+LGF+VR+KWR + ARREEI RLLVLASE+AAR E +AA EYG+ Y     
Sbjct  11   AAFVAVFGPVLGFVVRRKWRRSVARREEIKRLLVLASEKAARVELQAAEEYGYGYGYRYE  70

Query  557  gsVVGDEvpaavpapapvSSTL-TSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKC  733
                 DEV    PA +    T+ TS   +RQL YQCA C S  STRCS+CKAVRYCSGKC
Sbjct  71   SLKEEDEVFVETPASSAPPPTISTSYSGSRQLQYQCAVCSSPTSTRCSQCKAVRYCSGKC  130

Query  734  QIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDAS  913
            QI+HWR GHK EC P  N +H +  +  +  K ++QE++  + +  E E + +  S DAS
Sbjct  131  QILHWRQGHKGECRPVSNLDHLNDVEAKSHLKTYKQESDGSHLKSTEVEGKRSSESGDAS  190

Query  914  FAE  922
              E
Sbjct  191  PEE  193



>ref|XP_004237986.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Solanum 
lycopersicum]
Length=1158

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/796 (58%), Positives = 551/796 (69%), Gaps = 58/796 (7%)
 Frame = +2

Query  1352  GFWEGTAHYSRSKVNVVDDVSHPDSED-----VSYSWLPTNRSSEMARTSSPSVDEQGPK  1516
             GFWEG   Y+RS++  +D ++ P S+D     +S S   +    E A    P   EQG  
Sbjct  354   GFWEGPVPYTRSRIGSLDGIADPPSKDACDIKISDSQSTSCHPPEFAIPLLPKAGEQGSN  413

Query  1517  AK-------------PSDAAQL---LQVKDNVDLKRSSLRPD-SHNTIDLNKASVRSTSS  1645
             +K             P    ++   +++KD  +  RSS     + + +D++ +  + T +
Sbjct  414   SKKNLENPTPIIVEVPKPVNRVESRIEIKDQKESSRSSASRSVTLDQLDVHGSRDKCTLT  473

Query  1646  FKESRRSLSTASDACKVEHLVNNDTLKVNS----PPKASDKSIEGLKNVSQTPKARQVES  1813
              +E R S S AS   K      +D LKV+S     P  S + +EG  +  Q PK RQ  S
Sbjct  474   SEEGRYSSSRASANIK-----KHDGLKVSSLRSSSPNESYRGVEGSASALQLPKERQKGS  528

Query  1814  LSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQV-TACssdsggdsqssksglkssvskvvd  1990
                K  + + SSNN RHD Q  KS KID  QV +AC ++S     ++K+GLKSSV KVVD
Sbjct  529   SPAKIAD-NISSNNVRHDIQNVKSPKIDGTQVASACLAESSAPLPNAKNGLKSSVLKVVD  587

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             QL++SK +R NSLG   ++ GR+ NK LFPYE FVKL N K  ELRPFGL NCGNSCYAN
Sbjct  588   QLRSSKLTRLNSLGDECDVNGRHGNKALFPYESFVKLHNWKN-ELRPFGLVNCGNSCYAN  646

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFTPP T+YFLQG HSK C KK WCF CEFESLVLKAK+GNSPLSP  IISHLE
Sbjct  647   AVLQCLAFTPPLTSYFLQGLHSKTCEKKGWCFTCEFESLVLKAKDGNSPLSPSSIISHLE  706

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             +IGS+LGNGREEDAHEFLRYVI+TMQS+CLK AGV    S EE+TSLIGLTFGG+LRSKI
Sbjct  707   SIGSNLGNGREEDAHEFLRYVIDTMQSICLKGAGVTAPGSFEEETSLIGLTFGGYLRSKI  766

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             ECMRCGGKSER ERIMDLTVEIDGDI +LE AL+QFTHTE LDGENKY C RCKSYE+A+
Sbjct  767   ECMRCGGKSERQERIMDLTVEIDGDIGTLEEALKQFTHTETLDGENKYRCVRCKSYERAK  826

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKLK++EAPNVLT+ALKRFQSGKFGKLNKTI FPE LNLA YMSGTSDKSP+YQLYGV+ 
Sbjct  827   KKLKVVEAPNVLTVALKRFQSGKFGKLNKTIKFPEFLNLAPYMSGTSDKSPVYQLYGVVV  886

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DVMNAAFSGHYVCYV+NFQNKW+KV+DS VK VE+E VLSKGAYMLLYSRCSPRAP++
Sbjct  887   HLDVMNAAFSGHYVCYVRNFQNKWYKVDDSSVKSVELERVLSKGAYMLLYSRCSPRAPRI  946

Query  3068  IRSLTSHDPRGQKYVNCKSSSHTNS-WDLSKGDSTNDPACRECFNSVQASSWPHRTIfed  3244
             +RSL             KS SHT S WD S GDST+   C+ C      S  P R+IFE+
Sbjct  947   MRSL-------------KSRSHTRSPWDSSHGDSTSK-TCKGCSYPSHTSVRPIRSIFEE  992

Query  3245  sssdnssslfsegcssstdssyrdsisAEDYAADQLFGDPGGACWNSPWRIstdsdtsss  3424
              SS   SS FSE  S STDS+ RDS S +D   D +FGD  G CWNS WR S+DSDTSSS
Sbjct  993   DSSSEQSSFFSELGSCSTDSTNRDSTSTDDLNID-IFGD-SGVCWNSLWRSSSDSDTSSS  1050

Query  3425  ssspsplysrhsrlsNMGHYASGYPETSGYA--DSAVEDRGFWTGTCDPE----VSKSKG  3586
             SSSPSPLYSRHS L+++  YAS   ETS     ++A + +GFWTG  D      V ++ G
Sbjct  1051  SSSPSPLYSRHSPLADLDRYASAREETSCSVNPETAGDGQGFWTGLRDRNSYTGVPETSG  1110

Query  3587  SIPSLSPDSAKQCRHL  3634
               P L P+  K CR +
Sbjct  1111  RTPPLCPNPTKHCRKV  1126


 Score =   132 bits (333),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 121/216 (56%), Gaps = 4/216 (2%)
 Frame = +2

Query  377   AAFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysf  556
             AAF+   GP+L F+VR+KWR + ARREEI RLLVLASEEAAR E +AA EYG+ Y     
Sbjct  16    AAFVAVFGPVLCFVVRRKWRRSVARREEIKRLLVLASEEAARVELQAAEEYGYGYGYRYE  75

Query  557   gsVVGDEvpaavpapapvSSTLTSVPV----ARQLPYQCAQCFSSASTRCSRCKAVRYCS  724
                  DEV    PA +       ++      +RQL YQCA C S  STRCS+CKAVRYCS
Sbjct  76    SLKEEDEVFVETPASSASPPPPPTISTSYSGSRQLQYQCAVCSSPTSTRCSQCKAVRYCS  135

Query  725   GKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSI  904
             GKCQI+HWR GHKDEC P  N +H +  +  +  K ++QE +  + +  E E R +  S 
Sbjct  136   GKCQILHWRQGHKDECRPVSNLDHLNDAEAKSHLKAYKQEPDGSHLKSTEVEGRRSSESG  195

Query  905   DASFAEPTCSEPSISGAENTEDVMEGKHFTDDGTTN  1012
              AS  E            + E    G+  TD    N
Sbjct  196   IASPEEAALLRSKYFATSDGEHDTGGQSLTDSKCLN  231



>emb|CDP11495.1| unnamed protein product [Coffea canephora]
Length=1177

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/802 (53%), Positives = 510/802 (64%), Gaps = 52/802 (6%)
 Frame = +2

Query  1352  GFWEGTAHYSRSKVNVVDDVSHP-DSE---DVSYSWLPTNRSSEMARTSSPSVDEQG---  1510
             GFW+GT + +RS+++ VDD SH  D+    D+S S   +  S E  R+  P  D  G   
Sbjct  351   GFWDGTINRTRSRIDAVDDTSHSCDAAAHVDLSSSQFSSPCSFESPRSVLPQKDMTGFCD  410

Query  1511  -------PKAKPSDAAQLLQ-----VKDNVD-LKRSSLRPDSHNTIDLNKASVRSTSSFK  1651
                    P   PS+  +        VK N D L  S+L       +D    S R     K
Sbjct  411   EKALSDDPHTSPSEEKKPTNGSSSPVKLNKDDLASSALCLKRPEHVDFRDFSTRKV--LK  468

Query  1652  ESRRSLSTASDACKVEHLVNNDTLKVNSPPKASDKSIEGLKNVSQTPKARQVESLSTKAP  1831
                      S   K   L + ++ KVN         + G  ++ Q  K+ +V+S S+KA 
Sbjct  469   SRDPGDHAMSKDVKAGSLPSLNSEKVNC-------KVAGQSSIPQESKSVEVKSFSSKAS  521

Query  1832  NGHPSSNNRRHDSQGAKSAKIDSA-QVTACssdsggdsqssksglkssvskvvdQLKASK  2008
               H S N   +  Q  KS K DSA ++ AC+S     S+++++  K SV KVVDQ++ASK
Sbjct  522   TEHLSPNYGTYTVQNVKSVKADSAHELPACASSCFDHSENARNSSKPSVWKVVDQIRASK  581

Query  2009  -SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCL  2185
              +R   LG   E  G+Y NKGLFPY+LFVKL+N  KVEL P GL NCGNSCYAN VLQCL
Sbjct  582   LTRLAPLGGMGENVGKYYNKGLFPYDLFVKLYNWNKVELLPCGLLNCGNSCYANVVLQCL  641

Query  2186  AFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSL  2365
             AFTPP TAYFLQG HS+ C K+ WCF CEFESLVLKAK+GNSP+SP RIIS L+NIGS+L
Sbjct  642   AFTPPLTAYFLQGLHSRACKKRGWCFTCEFESLVLKAKDGNSPISPSRIISQLQNIGSNL  701

Query  2366  GNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCG  2545
             GNGREEDAHEFLR  I+TMQS CL EAG+  S +LEE T+L+GLTFGG+LRSKIECMRCG
Sbjct  702   GNGREEDAHEFLRCAIDTMQSGCLNEAGISASGTLEE-TTLLGLTFGGYLRSKIECMRCG  760

Query  2546  GKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKIL  2725
             GKSER E+IMDLTVEI GDI +LE ALRQFTHTE LDGENKYHCSRCKSYEKA+KKL++L
Sbjct  761   GKSERQEKIMDLTVEIGGDIGTLEEALRQFTHTETLDGENKYHCSRCKSYEKAKKKLRVL  820

Query  2726  EAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMN  2905
             EAPN+LTIALKRFQSGKFGKLNKTI FPEIL+LA YMSGTSDKSPIY+LYGVI H D+MN
Sbjct  821   EAPNILTIALKRFQSGKFGKLNKTIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDIMN  880

Query  2906  AAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LT  3082
             AAFSGHYVCYVKN QNKWFK++DS V  VE+E VL+KGAYMLLY+RCSPRAP+LIRS L 
Sbjct  881   AAFSGHYVCYVKNTQNKWFKIDDSMVNAVELERVLTKGAYMLLYARCSPRAPRLIRSTLV  940

Query  3083  SHDPRGQKYVNCKSSSH--TNSWDLSKGDSTNDPACRECFNSVQASSWPHRTIfedsssd  3256
               DPR  ++ + K   H     WD+   DS+N+    E      +S  P RTI+E+ SS 
Sbjct  941   PRDPRKSRHPDSKPRYHHARGPWDIHADDSSNNETNDEHACPNYSSFQPFRTIWEEDSSS  1000

Query  3257  nssslfsegcssstdssyrdsisAEDYAADQLF--GDPGGACWNSPWRIstdsdtsssss  3430
             + SS F    +S +  S        D   DQ+   GD G     S WR +     +SSSS
Sbjct  1001  DKSSSFFSEVNSCSTDSSARDSMCSDDLFDQMLGIGDMGVYYGGSSWR-NASDSETSSSS  1059

Query  3431  spsplysrhsrlsNMGHYASGYP-ETSGYADSA---VEDRGFWTGTCDPEVS--------  3574
             S          L ++  YAS YP ET    D+A   V+DR    G  + EV+        
Sbjct  1060  SSPSPLYSRHPLRDLEAYASKYPEETDECIDTAVPTVDDRPGPPGRTEVEVTGGRGTMLC  1119

Query  3575  --KSKGSIPSLSPDSAKQCRHL  3634
                 KGS P L PDS K+CR L
Sbjct  1120  PDSGKGSTPFLCPDSTKRCRKL  1141


 Score = 89.7 bits (221),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  641  RQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGAN  820
            R+LPYQC  C S  +TRC+RCKAVRYCSGKCQIIHWR GHKDEC P    +  S+  G  
Sbjct  120  RRLPYQCEVCSSPTTTRCARCKAVRYCSGKCQIIHWRQGHKDECQPFTFEDQ-SHKMGIT  178

Query  821  DFKVFRQEANEGYAEGIETEER  886
                 + + NE +    ET  R
Sbjct  179  SPVKLKAKQNEIHKNSFETGVR  200



>emb|CBI19252.3| unnamed protein product [Vitis vinifera]
Length=841

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/476 (66%), Positives = 362/476 (76%), Gaps = 29/476 (6%)
 Frame = +2

Query  1760  IEGLKNVSQTPKARQVESLSTKAPNGHPSSNN-------------------------RRH  1864
             + G    S   K+R+VESLS+ A + H SS+                          R H
Sbjct  321   VNGKSGASHQLKSREVESLSSGASDPHLSSSTEGHSVASMRSGKSTVDSDLHLSSSTRGH  380

Query  1865  DSQGAKSAKIDSAQ-VTACssdsggdsqssksglkssvskvvdQLKASK-SRHNSLGAWS  2038
                  KS K+D    V A SS     S    +GLK+SV KVVDQ + SK S+   LG  S
Sbjct  381   PVPNVKSGKVDGVHTVAASSSQIANHSPIVSNGLKTSVRKVVDQFRPSKLSKSLPLGVGS  440

Query  2039  EIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFL  2218
             EI GR ++KGLF YE+FVKL+   KVELRP GL NCGNSCYANAVLQCLAFTPP T+YFL
Sbjct  441   EIAGRCSDKGLFSYEVFVKLYIWNKVELRPCGLMNCGNSCYANAVLQCLAFTPPLTSYFL  500

Query  2219  QGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEF  2398
             QG HSK C KK+WCF CEFESL+LKAK GNSPLSP+ I+S + NIGS LGNG+EEDAHEF
Sbjct  501   QGLHSKSCLKKEWCFTCEFESLILKAKEGNSPLSPLGILSQIRNIGSHLGNGKEEDAHEF  560

Query  2399  LRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMD  2578
             LRY I+ MQSVCLKEAGV  S SLEE+TSLIGLTFGG+LRSKI+CM+C GKSERHER+MD
Sbjct  561   LRYAIDAMQSVCLKEAGVNASGSLEEETSLIGLTFGGYLRSKIKCMKCHGKSERHERMMD  620

Query  2579  LTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALK  2758
             LTVEI+GDI +LE AL +FT TEILDGENKY CSRCKSYEKA+KKL + EAPN+LTIALK
Sbjct  621   LTVEIEGDIGTLEEALHKFTSTEILDGENKYQCSRCKSYEKAKKKLTVSEAPNILTIALK  680

Query  2759  RFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYV  2938
             RFQSGKFGKLNK+I FPEIL+LA +MSGTSDKSPIY+LY V+ H D+MNAAFSGHYVCYV
Sbjct  681   RFQSGKFGKLNKSIRFPEILDLAPFMSGTSDKSPIYRLYAVVVHLDIMNAAFSGHYVCYV  740

Query  2939  KNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQK  3106
             KN QNKWFK++DS VKPVE+E VL+KGAYMLLY+RCSPRAP+LIR+     PR +K
Sbjct  741   KNIQNKWFKIDDSTVKPVELERVLTKGAYMLLYARCSPRAPRLIRNAVI--PRNRK  794


 Score =   106 bits (265),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 74/134 (55%), Gaps = 37/134 (28%)
 Frame = +2

Query  380  AFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            A L    P++G ++R KWR A AR+EEI RLL+LASEEAAR                   
Sbjct  13   ALLSLFFPVIGLVIRHKWRVAVARKEEIKRLLILASEEAAR-------------------  53

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                              + L +  V+    +QCA C+   +TRC+RCKAVRYCSGKCQI
Sbjct  54   ------------------AELETAAVSVSPQFQCAVCYCPTTTRCARCKAVRYCSGKCQI  95

Query  740  IHWRLGHKDECHPP  781
            IHWR GHK+EC+PP
Sbjct  96   IHWRQGHKEECNPP  109



>ref|XP_010664385.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X2 
[Vitis vinifera]
Length=1207

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/886 (47%), Positives = 527/886 (59%), Gaps = 122/886 (14%)
 Frame = +2

Query  1352  GFWEGTAHYSRSKVNVVDDVSHP----------DSEDV-------SYSWLPTNRSSEMAR  1480
             GFWEGT   +R++ +  DD +            DSE V       S S +P    +E++ 
Sbjct  326   GFWEGTLDLNRTRNHAQDDSAQSYASGADSNISDSESVLRFSFNLSGSTIPP-LHAEVSE  384

Query  1481  TSSPSVDEQGPKA----KPSD--------AAQLLQVKDNVDLK-RSSLRPDSHNTIDLNK  1621
             + S  +D+  P      KP +        + + L+ +++  L   SS   DS  + D +K
Sbjct  385   SKSTVLDDAHPSTLGIKKPIEGVASSEKISTKALKFRNSPSLAFESSNLVDSGPSNDSHK  444

Query  1622  ASVRSTSSFKESRRSLSTASDACKVEHLVNNDTLKVNSPP---------KASDKSIEGLK  1774
                R    F  S   +S A  +C        D++ +++P          + S+  + G  
Sbjct  445   LKSREVKPFSSS---VSNAHPSCST----GGDSISIDAPKARSSSSLSSERSNHVVNGKS  497

Query  1775  NVSQTPKARQVESLSTKAPNGHPSSNN-------------------------RRHDSQGA  1879
               S   K+R+VESLS+ A + H SS+                          R H     
Sbjct  498   GASHQLKSREVESLSSGASDPHLSSSTEGHSVASMRSGKSTVDSDLHLSSSTRGHPVPNV  557

Query  1880  KSAKIDSAQ-VTACssdsggdsqssksglkssvskvvdQLKASK-SRHNSLGAWSEIGGR  2053
             KS K+D    V A SS     S    +GLK+SV KVVDQ + SK S+   LG  SEI GR
Sbjct  558   KSGKVDGVHTVAASSSQIANHSPIVSNGLKTSVRKVVDQFRPSKLSKSLPLGVGSEIAGR  617

Query  2054  YNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHS  2233
              ++KGLF YE+FVKL+   KVELRP GL NCGNSCYANAVLQCLAFTPP T+YFLQG HS
Sbjct  618   CSDKGLFSYEVFVKLYIWNKVELRPCGLMNCGNSCYANAVLQCLAFTPPLTSYFLQGLHS  677

Query  2234  KGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVI  2413
             K C KK+WCF CEFESL+LKAK GNSPLSP+ I+S + NIGS LGNG+EEDAHEFLRY I
Sbjct  678   KSCLKKEWCFTCEFESLILKAKEGNSPLSPLGILSQIRNIGSHLGNGKEEDAHEFLRYAI  737

Query  2414  ETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEI  2593
             + MQSVCLKEAGV  S SLEE+TSLIGLTFGG+LRSKI+CM+C GKSERHER+MDLTVEI
Sbjct  738   DAMQSVCLKEAGVNASGSLEEETSLIGLTFGGYLRSKIKCMKCHGKSERHERMMDLTVEI  797

Query  2594  DGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSG  2773
             +GDI +LE AL +FT TEILDGENKY CSRCKSYEKA+KKL + EAPN+LTIALKRFQSG
Sbjct  798   EGDIGTLEEALHKFTSTEILDGENKYQCSRCKSYEKAKKKLTVSEAPNILTIALKRFQSG  857

Query  2774  KFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQN  2953
             KFGKLNK+I FPEIL+LA +MSGTSDKSPIY+LY V+ H D+MNAAFSGHYVCYVKN QN
Sbjct  858   KFGKLNKSIRFPEILDLAPFMSGTSDKSPIYRLYAVVVHLDIMNAAFSGHYVCYVKNIQN  917

Query  2954  KWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSSS-  3130
             KWFK++DS VKPVE+E VL+KGAYMLLY+RCSPRAP+LIR+     PR +K     S + 
Sbjct  918   KWFKIDDSTVKPVELERVLTKGAYMLLYARCSPRAPRLIRNAVI--PRNRKLEAASSRNI  975

Query  3131  --------HTNSWDLSKGDS--------------TNDPACRECFNSVQASSWPHRTIfed  3244
                       +S D + G S               + PA  E F S + + +P +    +
Sbjct  976   VKNTTFKLRHDSIDSTAGQSMIHSKPTAYHSRSPVDCPASFESFYS-EETRFPWKQRIVE  1034

Query  3245  sssdnssslfsegcssstdssyrdsisAEDYAADQLFGDPGGACWNSPWRIstdsdtsss  3424
             + S + +S       S +  S RDS S ED  +D +FG  G   W+SPW     +++S S
Sbjct  1035  ADSSSDNSSLFTEEGSCSTESNRDSTSTEDL-SDYIFGYSGRG-WSSPW-----TNSSDS  1087

Query  3425  ssspsplysrhsrlsNMGHYASGYPETS----GYADSAVEDRGFWT----GTCDPEVSKS  3580
              +S S    R S L+ +  Y+S   ETS      A   +E  GFW     G+      + 
Sbjct  1088  DTSSSSSSLRSSPLAELNRYSSCSTETSHSQTDKAKLVMEGDGFWARPPNGSSKLVDMEG  1147

Query  3581  KGSIPSLSPDSAKQCRHLggssssgg-------QRLGSDKPFGTMK  3697
             KG IP L  D AK CR L  +SSS         +++G   P  +MK
Sbjct  1148  KGDIPFLLSDIAKPCRKLVSNSSSDSYCKETDKEKVGRVNPLDSMK  1193


 Score =   118 bits (296),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 98/190 (52%), Gaps = 37/190 (19%)
 Frame = +2

Query  380  AFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            A L    P++G ++R KWR A AR+EEI RLL+LASEEAAR                   
Sbjct  13   ALLSLFFPVIGLVIRHKWRVAVARKEEIKRLLILASEEAAR-------------------  53

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                              + L +  V+    +QCA C+   +TRC+RCKAVRYCSGKCQI
Sbjct  54   ------------------AELETAAVSVSPQFQCAVCYCPTTTRCARCKAVRYCSGKCQI  95

Query  740  IHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDASFA  919
            IHWR GHK+EC+PP   +       ++  K  +QE +  Y   +ETE +     I+   +
Sbjct  96   IHWRQGHKEECNPPSITHQIIDESISSSQKAVKQEKHAIYDNRLETEGQQCVKPIETFLS  155

Query  920  EPTCSEPSIS  949
            EP  S+P+ S
Sbjct  156  EPAFSKPNCS  165



>ref|XP_010664383.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X1 
[Vitis vinifera]
 ref|XP_010664384.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X1 
[Vitis vinifera]
 emb|CAN74012.1| hypothetical protein VITISV_003549 [Vitis vinifera]
Length=1225

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/901 (47%), Positives = 527/901 (58%), Gaps = 134/901 (15%)
 Frame = +2

Query  1352  GFWEGTAHYSRSKVNVVDDVSHP----------DSEDV-------SYSWLPTNRSSEMAR  1480
             GFWEGT   +R++ +  DD +            DSE V       S S +P   + E++ 
Sbjct  326   GFWEGTLDLNRTRNHAQDDSAQSYASGADSNISDSESVLRFSFNLSGSTIPPLHA-EVSE  384

Query  1481  TSSPSVDEQGPKA----KP------SDAAQLLQVKDNVDLKRSS---------------L  1585
             + S  +D+  P      KP      S+    L +K  ++   SS               L
Sbjct  385   SKSTVLDDAHPSTLGIKKPIEGVASSEKISTLGIKKPIEGVASSEKISTKALKFRNSPSL  444

Query  1586  RPDSHNTIDL---NKASVRSTSSFKESRRSLSTASDACKVEHLVNNDTLKVNSPP-----  1741
               +S N +D    N +    +   K    S+S A  +C        D++ +++P      
Sbjct  445   AFESSNLVDSGPSNDSHKLKSREVKPFSSSVSNAHPSCST----GGDSISIDAPKARSSS  500

Query  1742  ----KASDKSIEGLKNVSQTPKARQVESLSTKAPNGHPSSNN------------------  1855
                 + S+  + G    S   K+R+VESLS+ A + H SS+                   
Sbjct  501   SLSSERSNHVVNGKSGASHQLKSREVESLSSGASDPHLSSSTEGHSVASMRSGKSTVDSD  560

Query  1856  -------RRHDSQGAKSAKIDSAQ-VTACssdsggdsqssksglkssvskvvdQLKASK-  2008
                    R H     KS K+D    V A SS     S    +GLK+SV KVVDQ + SK 
Sbjct  561   LHLSSSTRGHPVPNVKSGKVDGVHTVAASSSQIANHSPIVSNGLKTSVRKVVDQFRPSKL  620

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S+   LG  SEI GR ++KGLF YE+FVKL+   KVELRP GL NCGNSCYANAVLQCLA
Sbjct  621   SKSLPLGVGSEIAGRCSDKGLFSYEVFVKLYIWNKVELRPCGLMNCGNSCYANAVLQCLA  680

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP T+YFLQG HSK C KK+WCF CEFESL+LKAK GNSPLSP+ I+S + NIGS LG
Sbjct  681   FTPPLTSYFLQGLHSKSCLKKEWCFTCEFESLILKAKEGNSPLSPLGILSQIRNIGSHLG  740

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NG+EEDAHEFLRY I+ MQSVCLKEAGV  S SLEE+TSLIGLTFGG+LRSKI+CM+C G
Sbjct  741   NGKEEDAHEFLRYAIDAMQSVCLKEAGVNASGSLEEETSLIGLTFGGYLRSKIKCMKCHG  800

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSERHER+MDLTVEI+GDI +LE AL +FT TEILDGENKY CSRCKSYEKA+KKL + E
Sbjct  801   KSERHERMMDLTVEIEGDIGTLEEALHKFTSTEILDGENKYQCSRCKSYEKAKKKLTVSE  860

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APN+LTIALKRFQSGKFGKLNK+I FPEIL+LA +MSGTSDKSPIY+LY V+ H D+MNA
Sbjct  861   APNILTIALKRFQSGKFGKLNKSIRFPEILDLAPFMSGTSDKSPIYRLYAVVVHLDIMNA  920

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSH  3088
             AFSGHYVCYVKN QNKWFK++DS VKPVE+E VL+KGAYMLLY+RCSPRAP+LIR+    
Sbjct  921   AFSGHYVCYVKNIQNKWFKIDDSTVKPVELERVLTKGAYMLLYARCSPRAPRLIRNAVI-  979

Query  3089  DPRGQKYVNCKSSSHT---------NSWDLSKGDS--------------TNDPACRECFN  3199
              PR +K     S +           +S D + G S               + PA  E F 
Sbjct  980   -PRNRKLEAASSRNIVKNTTFKLRHDSIDSTAGQSMIHSKPTAYHSRSPVDCPASFESFY  1038

Query  3200  SVQASSWPHRTIfedsssdnssslfsegcssstdssyrdsisAEDYAADQLFGDPGGACW  3379
             S + + +P +    ++ S + +S       S +  S RDS S ED  +D +FG  G   W
Sbjct  1039  S-EETRFPWKQRIVEADSSSDNSSLFTEEGSCSTESNRDSTSTEDL-SDYIFGYSGRG-W  1095

Query  3380  NSPWRIstdsdtsssssspsplysrhsrlsNMGHYASGYPETS----GYADSAVEDRGFW  3547
             +SPW     +++S S +S S    R S L+ +  Y+S   ETS      A   +E  GFW
Sbjct  1096  SSPW-----TNSSDSDTSSSSSSLRSSPLAELNRYSSCSTETSHSQTDKAKLVMEGDGFW  1150

Query  3548  T----GTCDPEVSKSKGSIPSLSPDSAKQCRHLggssssgg-------QRLGSDKPFGTM  3694
                  G+      + KG IP L  D AK CR L  +SSS         +++G   P  +M
Sbjct  1151  ARPPNGSSKLVDMEGKGDIPFLLSDIAKPCRKLVSNSSSDSYCKETDKEKVGRVNPLDSM  1210

Query  3695  K  3697
             K
Sbjct  1211  K  1211


 Score =   118 bits (296),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 98/190 (52%), Gaps = 37/190 (19%)
 Frame = +2

Query  380  AFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            A L    P++G ++R KWR A AR+EEI RLL+LASEEAAR                   
Sbjct  13   ALLSLFFPVIGLVIRHKWRVAVARKEEIKRLLILASEEAAR-------------------  53

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                              + L +  V+    +QCA C+   +TRC+RCKAVRYCSGKCQI
Sbjct  54   ------------------AELETAAVSVSPQFQCAVCYCPTTTRCARCKAVRYCSGKCQI  95

Query  740  IHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDASFA  919
            IHWR GHK+EC+PP   +       ++  K  +QE +  Y   +ETE +     I+   +
Sbjct  96   IHWRQGHKEECNPPSITHQIIDESISSSQKAVKQEKHAIYDNRLETEGQQCVKPIETFLS  155

Query  920  EPTCSEPSIS  949
            EP  S+P+ S
Sbjct  156  EPAFSKPNCS  165



>ref|XP_004301361.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Fragaria 
vesca subsp. vesca]
Length=1140

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/644 (57%), Positives = 433/644 (67%), Gaps = 28/644 (4%)
 Frame = +2

Query  1739  PKASDKSIEGLKNVSQTPKARQVESLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTAC  1918
             P +S++S    KN S+T K+R+ +  S+   +    S  R       KS    S + +  
Sbjct  473   PTSSERSSHISKNSSRTLKSREADCQSSSVSDACLVSGGRGSSGVSVKSGNGHSVEASDT  532

Query  1919  ssdsggdsqssksglkssvskvvdQLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVK  2095
              S     S + K+GLK+SV KV DQ +  K S+H  LG   EI G++  K LFPYE+FVK
Sbjct  533   VSSQVTRSLNDKTGLKTSVFKVFDQFRGPKLSKHYPLGVGGEIAGKHAEKELFPYEVFVK  592

Query  2096  LFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEF  2275
             L+N  KVEL P GL NCGNSCYANAVLQCLAFTPP TAY LQG HSK CAKKDWCF CEF
Sbjct  593   LYNWNKVELHPSGLINCGNSCYANAVLQCLAFTPPLTAYLLQGLHSKSCAKKDWCFMCEF  652

Query  2276  ESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVR  2455
             E L+LKAK G SPLSPI I+S L NIGS LGNGREEDAHEFLR+ I+TMQSVCL E+GV 
Sbjct  653   EILILKAKEGKSPLSPIGILSQLRNIGSQLGNGREEDAHEFLRHAIDTMQSVCLMESGVN  712

Query  2456  TSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQF  2635
                SL+E+T+LIGLTFGG+LRSKI+C RC GKSER ER+MDLTVEI+GDIA+LE ALR+F
Sbjct  713   APRSLKEETTLIGLTFGGYLRSKIKCSRCQGKSERQERMMDLTVEIEGDIATLEEALRRF  772

Query  2636  THTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEI  2815
             T TE+LDGENKY CSRCKSYEKA+KKL ILEAPNVLTIALKRFQSGKFGK+NK I FPEI
Sbjct  773   TGTEVLDGENKYQCSRCKSYEKAKKKLTILEAPNVLTIALKRFQSGKFGKINKPIRFPEI  832

Query  2816  LNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVE  2995
             LNLA YMSGTSDKSPIY+LYGV+ H DVMNAAFSGHYVCYVKN QNKWFKV+DS V  VE
Sbjct  833   LNLAPYMSGTSDKSPIYKLYGVVVHLDVMNAAFSGHYVCYVKNLQNKWFKVDDSTVTAVE  892

Query  2996  IESVLSKGAYMLLYSRCSPRAPKLIRS-LTSHDPRGQKYVNCKSSSHTN--SWDLSKGDS  3166
             +E+VL+KGAYMLLYSRCS RAP+LIR+ + S DP+ +   +C S   TN  S   S   S
Sbjct  893   LENVLAKGAYMLLYSRCSARAPRLIRNRIISSDPKHRAIPSCISGKSTNLKSNSFSTHPS  952

Query  3167  -TNDPACRECFNSVQASSWP--HRTIfedsssdnssslfsegcssstdssyrdsisAEDY  3337
              +  P C        ++S+P   R   EDSSSDNSS + S     S+ +      ++ D 
Sbjct  953   GSQSPTC----PPENSTSYPLLQRISEEDSSSDNSSLISSRSDEGSSSTDSTWYSTSTDD  1008

Query  3338  AADQLFGDPGGACWNSPWRIstdsdtsssssspsplysrhsrlsNMGHYASGYPETSGYA  3517
              +D   GDPG   WNSP R         S S      S  S   ++ H  S   +++ YA
Sbjct  1009  CSDYSCGDPGRG-WNSPGR---------SFSDCDSSSSSSSSPMSLKH--SPLSDSNRYA  1056

Query  3518  DSAVEDRGFWTGTCDPEV-----SKSKGSIPSLSPDSAKQCRHL  3634
              SA E  GFW      +      S  K S P L+ D  KQCR L
Sbjct  1057  SSASESVGFWDSRPFEDSRRFADSDGKVSGPFLNSDITKQCRKL  1100


 Score = 76.3 bits (186),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 51/91 (56%), Gaps = 1/91 (1%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVFR  838
            CA C+   +TRC+RCKAVRYCSGKCQI+HWR GH++ C P    + +  G+     KV +
Sbjct  78   CAVCYCPTTTRCARCKAVRYCSGKCQIVHWRQGHRENCQPAPTVDPNVDGESDEGQKVTK  137

Query  839  QEANEGYAEGIETEERNTPGSIDASFAEPTC  931
            +   E  A+  E  +     S + +   P C
Sbjct  138  KNL-ESNADKFEARQSTEKISEEPAVPNPGC  167



>ref|XP_007018207.1| Ubiquitin-specific protease 16, putative isoform 1 [Theobroma 
cacao]
 gb|EOY15432.1| Ubiquitin-specific protease 16, putative isoform 1 [Theobroma 
cacao]
Length=1138

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/363 (76%), Positives = 317/363 (87%), Gaps = 1/363 (0%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q + SK  +H  LG  +E+ G+Y++KGLFPYE FVKL+N  KVEL+P GL NCGNSCYAN
Sbjct  550   QFRGSKLPKHYPLGVGNEVTGKYSDKGLFPYESFVKLYNWNKVELQPCGLVNCGNSCYAN  609

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCL FTPP TAYFLQG HSK CAKK+WCF+CEFE+L+LKAK+G SPLSPI I+S L+
Sbjct  610   AVLQCLTFTPPLTAYFLQGLHSKACAKKEWCFSCEFENLILKAKDGKSPLSPIGILSQLQ  669

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             NIGS L NG+EEDAHEFLRY I+ MQSVCL+EAGV +S   EE+T+L+GLTFGG+LRSKI
Sbjct  670   NIGSQLANGKEEDAHEFLRYAIDAMQSVCLREAGVDSSGCSEEETTLVGLTFGGYLRSKI  729

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+C GKSERHER+MDLTVEI+GDI +LE ALR+FT TEILDGENKY CSRCKSYEKA+
Sbjct  730   KCMKCQGKSERHERMMDLTVEIEGDIGTLEEALRRFTATEILDGENKYQCSRCKSYEKAK  789

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL ILEAPNVLTIALKRFQSGKFGKLNK I FPEILNLA YMSGTSDKSPIY+LYGV+ 
Sbjct  790   KKLTILEAPNVLTIALKRFQSGKFGKLNKAIRFPEILNLAPYMSGTSDKSPIYRLYGVVV  849

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H D+MNAAFSGHYVCYVKN QNKWFK++DS V   E+E VL+KGAYMLLY+RCSPRAP+L
Sbjct  850   HLDIMNAAFSGHYVCYVKNVQNKWFKIDDSTVTSAELERVLTKGAYMLLYARCSPRAPRL  909

Query  3068  IRS  3076
             IRS
Sbjct  910   IRS  912


 Score =   112 bits (281),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 108/195 (55%), Gaps = 39/195 (20%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            PL+G  +R+KWR + AR+ EI RLL+LASEEAARAE E+               ++G   
Sbjct  21   PLIGLFIRRKWRLSVARQAEIKRLLILASEEAARAELES---------------LLG---  62

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
                           ++ V+R   +QCA CF   +TRC+RCKAVRYCS KCQIIHWR GH
Sbjct  63   -------------YGTISVSRNY-HQCAICFCPTTTRCARCKAVRYCSAKCQIIHWRQGH  108

Query  761  KDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDASFAEPTCSEP  940
            K+ECHPP    H ++ +G++  +   ++   G    IE ++   P        E + ++P
Sbjct  109  KEECHPPSIATHQNHDEGSDSGQKVVEQDQYGDRYEIEEKQHTKP-------TETSSTKP  161

Query  941  SISGAENTEDVMEGK  985
            ++S + ++  V+ GK
Sbjct  162  ALSNSTSSSVVLHGK  176



>ref|XP_007018208.1| Ubiquitin-specific protease 16, putative isoform 2 [Theobroma 
cacao]
 gb|EOY15433.1| Ubiquitin-specific protease 16, putative isoform 2 [Theobroma 
cacao]
Length=1139

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/364 (76%), Positives = 317/364 (87%), Gaps = 2/364 (1%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q + SK  +H  LG  +E+ G+Y++KGLFPYE FVKL+N  KVEL+P GL NCGNSCYAN
Sbjct  550   QFRGSKLPKHYPLGVGNEVTGKYSDKGLFPYESFVKLYNWNKVELQPCGLVNCGNSCYAN  609

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCL FTPP TAYFLQG HSK CAKK+WCF+CEFE+L+LKAK+G SPLSPI I+S L+
Sbjct  610   AVLQCLTFTPPLTAYFLQGLHSKACAKKEWCFSCEFENLILKAKDGKSPLSPIGILSQLQ  669

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             NIGS L NG+EEDAHEFLRY I+ MQSVCL+EAGV +S   EE+T+L+GLTFGG+LRSKI
Sbjct  670   NIGSQLANGKEEDAHEFLRYAIDAMQSVCLREAGVDSSGCSEEETTLVGLTFGGYLRSKI  729

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+C GKSERHER+MDLTVEI+GDI +LE ALR+FT TEILDGENKY CSRCKSYEKA+
Sbjct  730   KCMKCQGKSERHERMMDLTVEIEGDIGTLEEALRRFTATEILDGENKYQCSRCKSYEKAK  789

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL ILEAPNVLTIALKRFQSGKFGKLNK I FPEILNLA YMSGTSDKSPIY+LYGV+ 
Sbjct  790   KKLTILEAPNVLTIALKRFQSGKFGKLNKAIRFPEILNLAPYMSGTSDKSPIYRLYGVVV  849

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSK-VKPVEIESVLSKGAYMLLYSRCSPRAPK  3064
             H D+MNAAFSGHYVCYVKN QNKWFK++DS  V   E+E VL+KGAYMLLY+RCSPRAP+
Sbjct  850   HLDIMNAAFSGHYVCYVKNVQNKWFKIDDSTVVTSAELERVLTKGAYMLLYARCSPRAPR  909

Query  3065  LIRS  3076
             LIRS
Sbjct  910   LIRS  913


 Score =   112 bits (281),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 108/195 (55%), Gaps = 39/195 (20%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            PL+G  +R+KWR + AR+ EI RLL+LASEEAARAE E+               ++G   
Sbjct  21   PLIGLFIRRKWRLSVARQAEIKRLLILASEEAARAELES---------------LLG---  62

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
                           ++ V+R   +QCA CF   +TRC+RCKAVRYCS KCQIIHWR GH
Sbjct  63   -------------YGTISVSRNY-HQCAICFCPTTTRCARCKAVRYCSAKCQIIHWRQGH  108

Query  761  KDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDASFAEPTCSEP  940
            K+ECHPP    H ++ +G++  +   ++   G    IE ++   P        E + ++P
Sbjct  109  KEECHPPSIATHQNHDEGSDSGQKVVEQDQYGDRYEIEEKQHTKP-------TETSSTKP  161

Query  941  SISGAENTEDVMEGK  985
            ++S + ++  V+ GK
Sbjct  162  ALSNSTSSSVVLHGK  176



>ref|XP_007225419.1| hypothetical protein PRUPE_ppa000527mg [Prunus persica]
 gb|EMJ26618.1| hypothetical protein PRUPE_ppa000527mg [Prunus persica]
Length=1114

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/472 (66%), Positives = 358/472 (76%), Gaps = 5/472 (1%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q + SK S+H  LG  +EI G++  K +FPYELFVK++N  KVELRP GL NCGNSCYAN
Sbjct  557   QFRGSKTSKHYPLGVGTEIAGKHIEKEIFPYELFVKIYNWNKVELRPSGLINCGNSCYAN  616

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFTPP TAY LQG HSK C KK+WCF CEFESLV KAK G SPLSP+ I+S L 
Sbjct  617   AVLQCLAFTPPLTAYLLQGLHSKVCVKKEWCFMCEFESLVSKAKEGKSPLSPMAILSQLR  676

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             NIGS LGNGREEDAHEFLRY I+ MQSVCL EAGV  S SL+E+T+LIGLTFGG+LRSKI
Sbjct  677   NIGSQLGNGREEDAHEFLRYAIDMMQSVCLMEAGVNASRSLKEETTLIGLTFGGYLRSKI  736

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             EC +C GKSER ER+MDLTVEI+GDI +LE ALR+FT TE LDGENKY CSRCKSYEKA+
Sbjct  737   ECSKCQGKSERQERMMDLTVEIEGDIGTLEEALRRFTSTETLDGENKYQCSRCKSYEKAK  796

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL ILEAPN+LTIALKRFQSGKFGK+NK I FPEIL+LA YMSGTSDKSPIY+LYGV+ 
Sbjct  797   KKLTILEAPNILTIALKRFQSGKFGKINKPIRFPEILDLAPYMSGTSDKSPIYRLYGVVV  856

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H D+MNAAFSGHYVCYVKN  NKWFK++DS V  VE+E+VL KGAYMLLYSRCSPRAP+L
Sbjct  857   HLDIMNAAFSGHYVCYVKNSHNKWFKIDDSTVTAVELENVLMKGAYMLLYSRCSPRAPRL  916

Query  3068  IRS-LTSHDPRGQKYVNCKSSSHTNSWDLSKGDSTNDPACRECFNSVQ--ASSWPHRTIf  3238
             IR+ + S DP+ +   +  S   TN    S    ++      C N  +   SS   R + 
Sbjct  917   IRNRIISPDPKHRAIPSWISGKTTNLKPKSVSPHSSVDPFLPCSNPPEDTTSSQLKRILE  976

Query  3239  edsssdnssslfsegcssstdssyrdsisAEDYAADQLFGDPGGACWNSPWR  3394
             EDSSSDNSS + +     S  +      S+ D  +D +FGD G   WNSPWR
Sbjct  977   EDSSSDNSSLISNNSDEGSCSTDSTRDSSSADDLSDYIFGDSGRG-WNSPWR  1027


 Score =   108 bits (269),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 90/166 (54%), Gaps = 32/166 (19%)
 Frame = +2

Query  392  FIGPLLGF-LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVV  568
            F+ P++GF +VR+KWR A+AR EEI RLL+LA EEAARAEFE                  
Sbjct  18   FLVPVIGFFVVRRKWRLAKARTEEIKRLLILAKEEAARAEFEV-----------------  60

Query  569  GDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHW  748
                          ++   +V VA      CA C+   +TRC+RCKAVRYCSGKCQIIHW
Sbjct  61   --------------AAGYAAVSVAENKGSYCAVCYCPTTTRCARCKAVRYCSGKCQIIHW  106

Query  749  RLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEER  886
            R GHK+ECHPP + + D  G    +      E N    E  ++ ER
Sbjct  107  RQGHKEECHPPSHQSIDGEGDAGLNVAKKDLEINTDKIENRQSVER  152



>ref|XP_002514028.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48611.1| conserved hypothetical protein [Ricinus communis]
Length=1060

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/351 (77%), Positives = 306/351 (87%), Gaps = 1/351 (0%)
 Frame = +2

Query  2048  GRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGF  2227
             G+Y++KGLF Y+LFVKL+ S KVE+RP GL NCGNSCYANAVLQCLAFTPP TAYF+QG 
Sbjct  496   GKYSDKGLFSYDLFVKLYASNKVEMRPCGLINCGNSCYANAVLQCLAFTPPLTAYFVQGL  555

Query  2228  HSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY  2407
             HSK C  K+WCF CEFESL+LKAK G SPLSPI I+S L+NI S LG GREEDAHEFLRY
Sbjct  556   HSKECVNKEWCFTCEFESLMLKAKEGKSPLSPIGILSQLQNIASQLGTGREEDAHEFLRY  615

Query  2408  VIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTV  2587
              I+TMQSVCLKEAGV    S EE+T+LIGLTFGG+LRSKI+CM+C  KSERHER+MDLTV
Sbjct  616   AIDTMQSVCLKEAGVNALGSFEEETTLIGLTFGGYLRSKIKCMKCHYKSERHERMMDLTV  675

Query  2588  EIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQ  2767
             EI+GDI  LE ALR+FT TEILDG+NKY C RCKSYEKA+KKL ILEAPNVLTIALKRFQ
Sbjct  676   EIEGDIEKLEDALRRFTGTEILDGDNKYQCGRCKSYEKAKKKLTILEAPNVLTIALKRFQ  735

Query  2768  SGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNF  2947
             SGKFGKLNK+I FPEIL+LA YMSGTSDKSPIY+LYGV+ H D+MNA+FSGHYVCYVKN 
Sbjct  736   SGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVVVHLDIMNASFSGHYVCYVKNV  795

Query  2948  QNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTSHDPR  3097
             QNKWFK++DS V  VE+E VL+KGAYMLLY+RCSPRAP+LIR+ + S DP+
Sbjct  796   QNKWFKIDDSTVTAVELERVLTKGAYMLLYARCSPRAPRLIRNRIASSDPK  846


 Score =   110 bits (276),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 88/155 (57%), Gaps = 31/155 (20%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            P++G ++R+KWR + AR EEI RLLVLASEE ARAE EA                     
Sbjct  21   PVIGLIIRRKWRLSIARNEEIKRLLVLASEETARAELEA---------------------  59

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
                      + +   VPV+R   YQCA C+   +TRC+RCKAVRYCSGKCQIIHWR GH
Sbjct  60   ----------TVSYGVVPVSRNSYYQCAVCYCPTTTRCARCKAVRYCSGKCQIIHWRQGH  109

Query  761  KDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAE  865
            K+EC P       +   G++  KV +QE  + Y++
Sbjct  110  KEECRPASATYEINDDGGSSSQKVAKQEQCDIYSD  144



>ref|XP_006433843.1| hypothetical protein CICLE_v10000079mg [Citrus clementina]
 gb|ESR47083.1| hypothetical protein CICLE_v10000079mg [Citrus clementina]
Length=1145

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/372 (74%), Positives = 316/372 (85%), Gaps = 1/372 (0%)
 Frame = +2

Query  1991  QLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANA  2170
             Q + SKS    L    E  GRY++KGLF YELFVKL+N  KVEL+P GL NCGNSCYAN 
Sbjct  540   QFRGSKSSKQCLSVGCETAGRYSDKGLFSYELFVKLYNWNKVELQPCGLINCGNSCYANV  599

Query  2171  VLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLEN  2350
             VLQCLAFTPP TAYFLQG HSK CAKKDWCF CE E+L+L+AK+G SPLSPI I+S L++
Sbjct  600   VLQCLAFTPPLTAYFLQGLHSKECAKKDWCFTCELENLILRAKDGKSPLSPIGILSRLQS  659

Query  2351  IGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIE  2530
             IGS LGNGREEDAHEFLRY I+TMQSVC+KEAGV  S  LE++T+LIGLTFGG+LRSKI+
Sbjct  660   IGSQLGNGREEDAHEFLRYAIDTMQSVCIKEAGVNASGPLEDETTLIGLTFGGYLRSKIK  719

Query  2531  CMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARK  2710
             C +C GKSER ER+MDLTVEI+GDI +LE ALR++T TEILDGENKY C RCKSYEKA+K
Sbjct  720   CTKCHGKSERQERMMDLTVEIEGDIGNLEEALRRYTGTEILDGENKYKCDRCKSYEKAKK  779

Query  2711  KLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEH  2890
             KL I+EAPN+LTIALKRFQSGKFGKLNK+I FPEIL+LA YMSGTSDK PIY+LYGV+ H
Sbjct  780   KLTIVEAPNILTIALKRFQSGKFGKLNKSIQFPEILDLAPYMSGTSDKLPIYRLYGVVVH  839

Query  2891  EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
              D+MNAAFSGHYVCY+K+ QNKWFKV+DS V  VE E VL++GAYMLLY+RCSPRAP+LI
Sbjct  840   LDIMNAAFSGHYVCYIKSTQNKWFKVDDSTVTAVERERVLTEGAYMLLYARCSPRAPRLI  899

Query  3071  R-SLTSHDPRGQ  3103
             R S+ SHD R +
Sbjct  900   RNSIISHDGRNK  911


 Score =   105 bits (263),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 80/130 (62%), Gaps = 32/130 (25%)
 Frame = +2

Query  392  FIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVG  571
            F+ P +  ++R+KWR A AR+EEI RLL+LASEEAARAEFEA+  Y              
Sbjct  18   FVFPAIALIIRRKWRRAVARKEEIKRLLILASEEAARAEFEASYGY--------------  63

Query  572  DEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWR  751
                          ST   VP   Q P QCA CFS  +TRC+RCKAVRYCSGKCQI+HWR
Sbjct  64   --------------STTVYVP---QHP-QCAVCFSPTTTRCARCKAVRYCSGKCQIVHWR  105

Query  752  LGHKDECHPP  781
             GHKDEC PP
Sbjct  106  QGHKDECQPP  115



>ref|XP_008219286.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 [Prunus mume]
Length=1109

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/371 (74%), Positives = 312/371 (84%), Gaps = 2/371 (1%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q + SK S+H  LG  +EI G++  K LF YELFVK++N  KVELRP GL NCGNSCYAN
Sbjct  557   QFRGSKISKHYPLGVGTEIAGKHIEKELFSYELFVKIYNWNKVELRPSGLINCGNSCYAN  616

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFTPP TAY LQG HSK C  K+WCF CEFESLV KAK G SPLSP+ I+S L 
Sbjct  617   AVLQCLAFTPPLTAYLLQGLHSKVCVNKEWCFMCEFESLVSKAKEGKSPLSPMAILSQLR  676

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             NIGS LGNGREEDAHEFLRY I+ MQSVCL EAG+  S SL+E+T+LIGLTFGG+LRSKI
Sbjct  677   NIGSQLGNGREEDAHEFLRYAIDMMQSVCLMEAGINASRSLKEETTLIGLTFGGYLRSKI  736

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             EC +C GKSER ER+MDLTVEI+GDI +LE ALR+FT TE LDGENKY CSRCKSYEKA+
Sbjct  737   ECSKCQGKSERQERMMDLTVEIEGDIGTLEEALRRFTSTETLDGENKYQCSRCKSYEKAK  796

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL ILEAPN+LTIALKRFQSGKFGK+NK I FPEIL+LA YMSGTSDKSPIY+LYGV+ 
Sbjct  797   KKLTILEAPNILTIALKRFQSGKFGKINKPIRFPEILDLAPYMSGTSDKSPIYRLYGVVV  856

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H D+MNAAFSGHYVCYVKN  NKWFK++DS V  VE+E+VL+KGAYMLLYSRC PRAP+L
Sbjct  857   HLDIMNAAFSGHYVCYVKNSHNKWFKIDDSTVTAVELENVLTKGAYMLLYSRCLPRAPRL  916

Query  3068  IRS-LTSHDPR  3097
             IR+ + S DPR
Sbjct  917   IRNRIISPDPR  927


 Score =   108 bits (271),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 107/208 (51%), Gaps = 38/208 (18%)
 Frame = +2

Query  392   FIGPLLGF-LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVV  568
             F+ P++GF +VR+KWR A+AR EEI RLL+LA EEAARAEFE                  
Sbjct  18    FLVPVIGFFVVRRKWRLAKARTEEIKRLLILAKEEAARAEFEV-----------------  60

Query  569   GDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHW  748
                           ++   +V VA      CA C+   +TRC+RCKAVRYCSGKCQIIHW
Sbjct  61    --------------AAGYAAVSVAENKGSYCAVCYCPTTTRCARCKAVRYCSGKCQIIHW  106

Query  749   RLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDASFAEPT  928
             R GHK+ECHPP + + D  G    +      E N    E  ++ ER    S + +   P 
Sbjct  107   RQGHKEECHPPSHQSIDREGDAGLNVAKKDLEINTDKIENRQSVER---FSEEPALPNPG  163

Query  929   CSEPSISGAENTEDVMEGKHFTDDGTTN  1012
             CS P +     T+D  E +  ++   TN
Sbjct  164   CS-PEVQCI--TDDDSEDEFLSERKGTN  188



>ref|XP_006472486.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Citrus 
sinensis]
Length=1128

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/372 (74%), Positives = 316/372 (85%), Gaps = 1/372 (0%)
 Frame = +2

Query  1991  QLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANA  2170
             Q + SKS    L    E  GRY++KGLF YELFVKL+N  KVEL+P GL NCGNSCYAN 
Sbjct  540   QFRGSKSSKQCLSVGCETAGRYSDKGLFSYELFVKLYNWNKVELQPCGLINCGNSCYANV  599

Query  2171  VLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLEN  2350
             VLQCLAFTPP TAYFLQG HSK CAKKDWCF CE E+L+L+AK+G SPLSPI I+S L++
Sbjct  600   VLQCLAFTPPLTAYFLQGLHSKECAKKDWCFTCELENLILRAKDGKSPLSPIGILSRLQS  659

Query  2351  IGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIE  2530
             IGS LGNGREEDAHEFLRY I+TMQSVC++EAGV  S  LE++T+LIGLTFGG+LRSKI+
Sbjct  660   IGSQLGNGREEDAHEFLRYAIDTMQSVCIEEAGVNASGPLEDETTLIGLTFGGYLRSKIK  719

Query  2531  CMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARK  2710
             C +C GKSER ER+MDLTVEI+GDI +LE ALR++T TEILDGENKY C RCKSYEKA+K
Sbjct  720   CTKCHGKSERQERMMDLTVEIEGDIGNLEEALRRYTGTEILDGENKYKCDRCKSYEKAKK  779

Query  2711  KLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEH  2890
             KL I+EAPN+LTIALKRFQSGKFGKLNK+I FPEIL+LA YMSGTSDK PIY+LYGV+ H
Sbjct  780   KLTIVEAPNILTIALKRFQSGKFGKLNKSIQFPEILDLAPYMSGTSDKLPIYRLYGVVVH  839

Query  2891  EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
              D+MNAAFSGHYVCYVK+ QNKWFKV+DS V  VE E VL++GAYMLLY+RCSPRAP+LI
Sbjct  840   LDIMNAAFSGHYVCYVKSTQNKWFKVDDSTVTAVERERVLTEGAYMLLYARCSPRAPRLI  899

Query  3071  R-SLTSHDPRGQ  3103
             R S+ SHD R +
Sbjct  900   RNSIISHDGRNK  911


 Score =   102 bits (253),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 79/130 (61%), Gaps = 32/130 (25%)
 Frame = +2

Query  392  FIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVG  571
            F+   +  ++R+KWR A AR+EEI RLL+LASEEAARAEFEA+  Y              
Sbjct  18   FVFLAIALIIRRKWRRAVARKEEIKRLLILASEEAARAEFEASYGY--------------  63

Query  572  DEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWR  751
                          ST   VP   Q P QCA CFS  +TRC+RCKAVRYCSGKCQI+HWR
Sbjct  64   --------------STTVYVP---QHP-QCAVCFSPTTTRCARCKAVRYCSGKCQIVHWR  105

Query  752  LGHKDECHPP  781
             GHKDEC PP
Sbjct  106  QGHKDECQPP  115



>ref|XP_009376247.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Pyrus 
x bretschneideri]
Length=1126

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/668 (54%), Positives = 444/668 (66%), Gaps = 39/668 (6%)
 Frame = +2

Query  1745  ASDKSIEGLKNVSQTPKARQVESLSTKAPNGHPSSNNRRHDSQG-----AKSAKIDSAQV  1909
             +S++S   +KN S+T    +     T  P+    S+ R   + G      KS K+D  + 
Sbjct  475   SSERSGHAVKNCSRTSDVLKSREAGTPPPS---VSDARLASAVGGALPRVKSGKVDCVEA  531

Query  1910  TACssdsggdsqssksglkssvskvvdQLKASK-SRHNSLGAWSEIGGRYNNKGLFPYEL  2086
             +   S    +  + ++GLK+SV KV DQ + SK  +H  LG  SEI G+Y+ K LF YEL
Sbjct  532   SDTVSSQATNLSNDRNGLKTSVFKVFDQFRGSKIPKHYPLGVGSEIAGKYSEKELFSYEL  591

Query  2087  FVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFN  2266
             FVKL+N  KVELRP GL NCGNSCYANAVLQCL+FTPP TAY LQG HSK C KK WCF 
Sbjct  592   FVKLYNWNKVELRPSGLINCGNSCYANAVLQCLSFTPPLTAYLLQGLHSKACVKKGWCFM  651

Query  2267  CEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEA  2446
             CEFESLVL AK GNSPL P+ I+S L  IGS LGNGREEDAHEFLRY I+ MQSVCL E 
Sbjct  652   CEFESLVLMAKEGNSPLPPMGILSQLRKIGSQLGNGREEDAHEFLRYAIDMMQSVCLTET  711

Query  2447  GVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGAL  2626
             GV +S SL E+T+LIGLTFGG+LRSKI+C +C GKSER ER+MDLTVEI+GDI +LE AL
Sbjct  712   GVNSSRSLNEETTLIGLTFGGYLRSKIKCTKCQGKSERQERMMDLTVEIEGDIGTLEEAL  771

Query  2627  RQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITF  2806
             R+FT TE LDGENKY CS CKSYEKA+KKL ILEAPN+LTIALKRFQSGKFGK+NK I F
Sbjct  772   RRFTGTETLDGENKYQCSSCKSYEKAKKKLTILEAPNILTIALKRFQSGKFGKINKPIRF  831

Query  2807  PEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVK  2986
             PEIL+LA +MSGTSDKSPIY+LYGV+ H D+MNAAFSGHYVCYV+N  NKWFKV+DS V 
Sbjct  832   PEILDLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVRNSHNKWFKVDDSTVT  891

Query  2987  PVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTSHDPRGQKYVNCKSSSHTNSWDLSKGD  3163
             PVE+E VL+KGAYMLLYSRC PRAP+LIR+ + S+DP+ +   +      TN     K  
Sbjct  892   PVELEKVLTKGAYMLLYSRCLPRAPRLIRNRIISNDPKHRAIPSWIGGKATN----LKPK  947

Query  3164  STNDPACRECFNSVQASSWP----HRTIfedsssdnssslfsegcssstdssyrdsisAE  3331
             S +  +     +    +++P     R + EDSSSDNSS + +    SS  +      ++ 
Sbjct  948   SVSRLSTHSGVDHSVPNAYPPEELRRILEEDSSSDNSSLISNNSDESSYSTGSTRCSTST  1007

Query  3332  DYAADQLFGDPGGACWNSPWRIstdsdtsssssspsplysrhsrlsNMGHYASGYPETSG  3511
             D  +D +FG  G   W+  WR +     +SS+SS SP  ++HS LS+   YAS  PET  
Sbjct  1008  DDLSDYIFGHSGRG-WSRSWR-NFSDSDTSSTSSSSPSSTKHSPLSDSNRYASVSPET--  1063

Query  3512  YADSAVEDRGFWTGTCDPEVSKSKGSIPSLSPDSAKQCRHLggsss----sggQRLGSDK  3679
                          G+  P  S    ++  L  D+ KQCR L  SSS    +G +RLG D 
Sbjct  1064  ------------IGSSKPVDSFGAATVTFLHSDTTKQCRKLASSSSRNRETGTERLGPDS  1111

Query  3680  PFGTMKYR  3703
               G +K+R
Sbjct  1112  -LGDVKFR  1118


 Score = 99.4 bits (246),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 88/185 (48%), Gaps = 40/185 (22%)
 Frame = +2

Query  392  FIGPLLGF-LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVV  568
            F+ P++GF +VR+KWR A ARREEI RLLVL                             
Sbjct  18   FLAPVIGFFVVRRKWRLANARREEIRRLLVL-----------------------------  48

Query  569  GDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHW  748
              E  A             SV   +  PY C  C+   +TRC+RCKAVRYCSGKCQI+HW
Sbjct  49   AKEEAARAEFEVTAGDGAASVAEIKG-PY-CVVCYCPTTTRCARCKAVRYCSGKCQIVHW  106

Query  749  RLGHKDECHPPVNNNHDSYGKGAND-FKVFRQEANEGYAEGIETEERNTPGSIDASFAEP  925
            R GHK+EC  P    H +   G++   KV +++        I T++  +  S++ S  EP
Sbjct  107  RQGHKEECR-PFTIVHQNIDVGSDSGVKVTKEDLE------INTDKFQSRQSVEKSSGEP  159

Query  926  TCSEP  940
                P
Sbjct  160  ALPNP  164



>ref|XP_011016914.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X1 
[Populus euphratica]
Length=1139

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/353 (76%), Positives = 307/353 (87%), Gaps = 1/353 (0%)
 Frame = +2

Query  2048  GRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGF  2227
             GRY+NKGLFPY+LFVKL+ S KVE+RPFGL NCGNSCYANAVLQCLAFTPP T+YF+QG 
Sbjct  574   GRYSNKGLFPYDLFVKLYTSNKVEMRPFGLINCGNSCYANAVLQCLAFTPPLTSYFVQGL  633

Query  2228  HSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY  2407
             HSK C  K+ CF+CEFE+++LKAK G SPLSPI I+S L+NIG+ LGNGREEDAHEFLRY
Sbjct  634   HSKACVNKERCFSCEFENVILKAKEGKSPLSPIGILSQLQNIGTQLGNGREEDAHEFLRY  693

Query  2408  VIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTV  2587
              I+ MQSVCLKEA V    S EE+ +LIGLTFGG+LRSKI+CM+C  KSE  ER+MDLTV
Sbjct  694   AIDAMQSVCLKEAKVNAVGSFEEEATLIGLTFGGYLRSKIKCMKCHYKSEWQERMMDLTV  753

Query  2588  EIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQ  2767
             EI+GDI  LE ALR+FT TEILDG+NKYHC RC+SYEKA+KKL ILEAPNVLTIALKRFQ
Sbjct  754   EIEGDIGKLEDALRRFTGTEILDGDNKYHCGRCRSYEKAKKKLTILEAPNVLTIALKRFQ  813

Query  2768  SGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNF  2947
             SGKFGKLNK+I FPEIL+LA YMSGTSDKSPIY+LYGVI H DVMNAAFSGHYVCYVKN 
Sbjct  814   SGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKNI  873

Query  2948  QNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTSHDPRGQ  3103
             QNKWFK++DS V  VE+E VLSKGAYMLLY+RCSPRAP+LIRS + S DP+ +
Sbjct  874   QNKWFKIDDSTVTAVELERVLSKGAYMLLYARCSPRAPRLIRSRIISSDPKNK  926


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 75/153 (49%), Gaps = 32/153 (21%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            P+  F++R KWR    R+EEI RL+VL                                 
Sbjct  23   PVGWFVIRCKWRGVVVRKEEIKRLMVL-------------------------------AA  51

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
              A  A    + +  +VPV +   YQCA CF   +TRC+RCKAVRYCSGKCQIIHWR GH
Sbjct  52   EEAARAEFEATVSYGTVPVLKN-NYQCAVCFCPRTTRCARCKAVRYCSGKCQIIHWRQGH  110

Query  761  KDECHPPVNNNHDSYGKGANDFKVFRQEANEGY  859
            K+EC PP    H +   G    +  +Q+ ++ Y
Sbjct  111  KEECRPPPTTYHINDDGGNPGQRAAKQDQHDIY  143



>ref|XP_009373969.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Pyrus 
x bretschneideri]
Length=1050

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/459 (65%), Positives = 359/459 (78%), Gaps = 11/459 (2%)
 Frame = +2

Query  1745  ASDKSIEGLKNVSQTPKARQVESLSTKAPNGHPSSNNRRHDSQG-----AKSAKIDSAQV  1909
             +S++S + +KN ++T    +     T +P+    S++R   + G      KS K+D A+ 
Sbjct  472   SSERSDQAVKNCNRTSDVLKSREAGTPSPS---VSDSRHAPAVGGSLPLVKSGKVDFAEA  528

Query  1910  TACssdsggdsqssksglkssvskvvdQLKASK-SRHNSLGAWSEIGGRYNNKGL-FPYE  2083
             +   S    +  ++++GLK+SV KV DQ + SK  +H  +G  SEI G+Y+ K   F YE
Sbjct  529   SNAVSSQATNLSNNRNGLKTSVFKVFDQFRGSKIPKHYPVGVGSEIAGKYSEKEEHFRYE  588

Query  2084  LFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCF  2263
             LFVKL+N  KVELRP GL NCGNSCYANAVLQCL+FTPP TAY LQGFHSK C KK+WCF
Sbjct  589   LFVKLYNWNKVELRPSGLINCGNSCYANAVLQCLSFTPPLTAYLLQGFHSKACVKKEWCF  648

Query  2264  NCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKE  2443
              CEFESLV KAK G+SPLSP+ I+S L  IGS LGNGREEDAHEFLRY I+ MQSVCL E
Sbjct  649   MCEFESLVSKAKEGSSPLSPMGILSQLRKIGSQLGNGREEDAHEFLRYAIDMMQSVCLTE  708

Query  2444  AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGA  2623
             AGV +S SL+E+T+LIGLTFGG+LRSKI+C +C GKSER ER+MDLTVEI+GDI +LE A
Sbjct  709   AGVNSSRSLKEETTLIGLTFGGYLRSKIKCTKCQGKSERQERMMDLTVEIEGDIGTLEEA  768

Query  2624  LRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTIT  2803
             LR+FT TE LDGENKY CSRCKSYEKA+KKL ILEAPN+LTIALKRFQSGKFGK+NK I 
Sbjct  769   LRRFTGTETLDGENKYQCSRCKSYEKAKKKLTILEAPNILTIALKRFQSGKFGKINKPIR  828

Query  2804  FPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKV  2983
             FPEIL+LA +MS TSDKSPIY+LYGV+ H D+MNAAFSGHYVCYV+N QNKWF V+DS V
Sbjct  829   FPEILDLAPFMSSTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVRNSQNKWFMVDDSTV  888

Query  2984  KPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTSHDPR  3097
              PVE+E VL+KGAYMLLYSRC PRAP+LIR+ + S DP+
Sbjct  889   TPVELERVLTKGAYMLLYSRCLPRAPRLIRNRIISPDPK  927


 Score =   105 bits (261),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 96/186 (52%), Gaps = 38/186 (20%)
 Frame = +2

Query  386  LVFIGPLLGFL-VRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgs  562
            + F+  ++GF  VR+KWR A ARREEI RLLVLA EE ARAEFE                
Sbjct  16   VCFLASVIGFFAVRRKWRLANARREEIRRLLVLAKEEVARAEFEV---------------  60

Query  563  VVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQII  742
                            ++   +VPVA      C  C+   +TRC+RCKAVRYCS KCQI+
Sbjct  61   ----------------TAGYGAVPVAEIKGSYCVVCYCPTTTRCARCKAVRYCSAKCQIV  104

Query  743  HWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDASFAE  922
            HWR GHK+EC PP   + +      ++ KV +++        I T++  +  S++ S AE
Sbjct  105  HWRQGHKEECRPPSIIHQNVVVASDSELKVTKEDLE------INTDKFESRESVEKSSAE  158

Query  923  PTCSEP  940
            P    P
Sbjct  159  PALPNP  164



>ref|XP_003523774.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X1 [Glycine max]
Length=1063

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/469 (64%), Positives = 352/469 (75%), Gaps = 9/469 (2%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S+H  L   S+I GR+N+K  FPYELFVKL+NS KVEL PFGL NCGNSCYANAVLQCLA
Sbjct  563   SKHFPLAVGSDIAGRHNDKSFFPYELFVKLYNSNKVELCPFGLINCGNSCYANAVLQCLA  622

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP TAY LQG HSK CA K WCF CEFE L+LK+K+  S +SP+ IISHL+NIGS L 
Sbjct  623   FTPPLTAYLLQGSHSKSCANKKWCFTCEFERLILKSKDTKSAVSPMGIISHLQNIGSQLA  682

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NGREEDAHEFLR+VI+TMQSVCL EAGV    SLEE T+L+G TFGG+L SKI+CMRCGG
Sbjct  683   NGREEDAHEFLRHVIDTMQSVCLMEAGVNALGSLEEDTTLMGQTFGGYLLSKIKCMRCGG  742

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSER ER+MDLTVEI+G+I +L  ALR+FT TE LDGENKYHC RCKSYEKA+KKL + E
Sbjct  743   KSERQERMMDLTVEIEGEITTLVEALRRFTSTETLDGENKYHCVRCKSYEKAKKKLTVSE  802

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APNVLT+ALKRFQSGKFGKLNK I FPEILNLA +MSGTSDKSPIY+LYGV+ H D+MNA
Sbjct  803   APNVLTVALKRFQSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDIMNA  862

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTS  3085
             AFSGHYVCYVKN QNKWFKV+DS V  VE++ VL+KGAYML Y+RCSPRAP+LIR+ + S
Sbjct  863   AFSGHYVCYVKNIQNKWFKVDDSVVTAVELDRVLTKGAYMLFYARCSPRAPRLIRNRILS  922

Query  3086  HDPR----GQKYVNCKSSSHTNSWDLSKGDSTNDPACRECFNSVQASSWPH--RTIfeds  3247
              D +    G+       S  TNS      +S+  P      +S   S + H  R + EDS
Sbjct  923   PDSKRKVSGKTLTTKARSISTNSGVAEHVNSSISPDDSPALDSFY-SKFHHLKRILEEDS  981

Query  3248  ssdnssslfsegcssstdssyrdsisAEDYAADQLFGDPGGACWNSPWR  3394
             SSDNSS + S     S  +      ++ D  ++ LFGD G   W+S WR
Sbjct  982   SSDNSSLISSNSDEGSCSTDSTRDSTSTDDFSEYLFGDSGNG-WSSVWR  1029


 Score = 82.8 bits (203),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 62/125 (50%), Gaps = 32/125 (26%)
 Frame = +2

Query  407  LGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpa  586
            +GF++R+KW+ +EAR++EI RLLVL                              +E   
Sbjct  24   IGFVIRRKWQVSEARKDEIKRLLVL----------------------------AAEETAR  55

Query  587  avpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKD  766
            A    +    T  S   +      CA C+  A+ RC++CK+VRYCS +CQ +HWR GHK 
Sbjct  56   AEKEASYEYGTAVSAAPSNL----CAVCYFPATARCAQCKSVRYCSFECQTVHWRQGHKL  111

Query  767  ECHPP  781
            EC PP
Sbjct  112  ECRPP  116



>ref|XP_006578260.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X3 [Glycine max]
Length=1080

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/355 (75%), Positives = 302/355 (85%), Gaps = 0/355 (0%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S+H  L   S+I GR+N+K  FPYELFVKL+NS KVEL PFGL NCGNSCYANAVLQCLA
Sbjct  563   SKHFPLAVGSDIAGRHNDKSFFPYELFVKLYNSNKVELCPFGLINCGNSCYANAVLQCLA  622

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP TAY LQG HSK CA K WCF CEFE L+LK+K+  S +SP+ IISHL+NIGS L 
Sbjct  623   FTPPLTAYLLQGSHSKSCANKKWCFTCEFERLILKSKDTKSAVSPMGIISHLQNIGSQLA  682

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NGREEDAHEFLR+VI+TMQSVCL EAGV    SLEE T+L+G TFGG+L SKI+CMRCGG
Sbjct  683   NGREEDAHEFLRHVIDTMQSVCLMEAGVNALGSLEEDTTLMGQTFGGYLLSKIKCMRCGG  742

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSER ER+MDLTVEI+G+I +L  ALR+FT TE LDGENKYHC RCKSYEKA+KKL + E
Sbjct  743   KSERQERMMDLTVEIEGEITTLVEALRRFTSTETLDGENKYHCVRCKSYEKAKKKLTVSE  802

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APNVLT+ALKRFQSGKFGKLNK I FPEILNLA +MSGTSDKSPIY+LYGV+ H D+MNA
Sbjct  803   APNVLTVALKRFQSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDIMNA  862

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR  3073
             AFSGHYVCYVKN QNKWFKV+DS V  VE++ VL+KGAYML Y+RCSPRAP+LIR
Sbjct  863   AFSGHYVCYVKNIQNKWFKVDDSVVTAVELDRVLTKGAYMLFYARCSPRAPRLIR  917


 Score = 82.8 bits (203),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 62/125 (50%), Gaps = 32/125 (26%)
 Frame = +2

Query  407  LGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpa  586
            +GF++R+KW+ +EAR++EI RLLVL                              +E   
Sbjct  24   IGFVIRRKWQVSEARKDEIKRLLVL----------------------------AAEETAR  55

Query  587  avpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKD  766
            A    +    T  S   +      CA C+  A+ RC++CK+VRYCS +CQ +HWR GHK 
Sbjct  56   AEKEASYEYGTAVSAAPSNL----CAVCYFPATARCAQCKSVRYCSFECQTVHWRQGHKL  111

Query  767  ECHPP  781
            EC PP
Sbjct  112  ECRPP  116



>ref|XP_010107689.1| Ubiquitin carboxyl-terminal hydrolase 16 [Morus notabilis]
 gb|EXC16662.1| Ubiquitin carboxyl-terminal hydrolase 16 [Morus notabilis]
Length=1038

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/474 (64%), Positives = 349/474 (74%), Gaps = 20/474 (4%)
 Frame = +2

Query  2024  LGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPF  2203
             L   SEI GRY +KGLFPY+ FVKL+N  KVEL+P GL NCGNSCYANAVLQCLAFTPP 
Sbjct  561   LAHGSEIAGRYTDKGLFPYDSFVKLYNWNKVELQPSGLINCGNSCYANAVLQCLAFTPPL  620

Query  2204  TAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREE  2383
             TAYFLQG HSK C KK+WCF CEFE L+LKAK   SPLSPI I+S L+NIGS LGNGREE
Sbjct  621   TAYFLQGIHSKDCIKKEWCFTCEFEGLILKAKEKKSPLSPIGIVSRLQNIGSQLGNGREE  680

Query  2384  DAHEFL--------RYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMR  2539
             DAHEFL        RY I+ MQS+CL EA V  S  LEE+T+L+GLTFGG+LRSKI+CM+
Sbjct  681   DAHEFLSLINECTDRYAIDAMQSICLAEARVGASGHLEEETTLLGLTFGGYLRSKIKCMK  740

Query  2540  CGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLK  2719
             C G+SER E ++DLTVEI+GDI SLE ALR+FT TEILDGENKYHC RCKSYEKA+KKL 
Sbjct  741   CQGRSERQEGMLDLTVEIEGDIGSLEEALRKFTSTEILDGENKYHCGRCKSYEKAKKKLT  800

Query  2720  ILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDV  2899
             ILEAPNVLTIALKRFQSGKFGKLNK I FPEILNLA +MSGTSDK  IY+LYGV+ H DV
Sbjct  801   ILEAPNVLTIALKRFQSGKFGKLNKPIRFPEILNLAPFMSGTSDKLAIYRLYGVVVHLDV  860

Query  2900  MNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-  3076
             MNAAFSGHYVCYVKN  NKWFK++DS V PV++E VLSKGAYML Y+RCSPRAP+LIR+ 
Sbjct  861   MNAAFSGHYVCYVKNAHNKWFKIDDSTVTPVDLEKVLSKGAYMLFYARCSPRAPRLIRNR  920

Query  3077  LTSHDPR---------GQKYVNCKSSSHTNSWDLSKGDSTNDPACRECFNSVQAS-SWPH  3226
             + S DP+         G K    KS S TN        S++ P     ++S  A      
Sbjct  921   IVSSDPKARVTPSWIGGGKTTALKSKSTTNPNVAQFLSSSSPPGVSASYDSFYARYHRLQ  980

Query  3227  RTIfedsssdnssslfsegcssstdssyrdsisAEDYAADQLFGDPGGACWNSP  3388
             R + EDSSSDNSS + +     S  +      ++ D  +D +FGD  G  W+SP
Sbjct  981   RILEEDSSSDNSSLISNNSDEGSCSTDSTRDSTSTDDLSDYIFGD-SGRVWSSP  1033


 Score =   100 bits (249),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 97/165 (59%), Gaps = 37/165 (22%)
 Frame = +2

Query  407  LGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpa  586
            +GF+VR+KWR A AR+EEI RLL+LASEEAARAE EA+A+YG                  
Sbjct  23   IGFVVRRKWRLALARKEEIRRLLILASEEAARAELEASAQYGV-----------------  65

Query  587  avpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKD  766
                            VA     QCA C+   +TRC+RCKAVRYCSGKCQI+HWR GHK+
Sbjct  66   ----------------VAAVAQNQCAVCYFPTTTRCARCKAVRYCSGKCQIMHWRQGHKE  109

Query  767  ECHP--PVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTP  895
            EC P  P    +D  GK ++  K+ ++E +E Y+E  E+ ER  P
Sbjct  110  ECRPACPTQTVND-IGKDSSQ-KLNKEEHSEVYSENYESIERAKP  152



>ref|XP_004501631.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Cicer 
arietinum]
Length=1129

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/372 (72%), Positives = 314/372 (84%), Gaps = 1/372 (0%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S+H  L   S+I G+YN+KGLFPYELFVKL+N  KVEL+PFGL NCGNSCYANAVLQCLA
Sbjct  547   SKHIPLAVGSDIAGKYNDKGLFPYELFVKLYNFNKVELQPFGLINCGNSCYANAVLQCLA  606

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP T+Y LQG HSK CA K WCF CEFESL+LK+K+  SPLSP+ I+S L++IGS LG
Sbjct  607   FTPPLTSYLLQGLHSKSCANKKWCFVCEFESLILKSKDTKSPLSPMAILSQLQSIGSHLG  666

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NG+EEDAHEFLR+ I+TMQSVCL EAG   S SLEE T+L+G TFGG+LRSKI+CM+CGG
Sbjct  667   NGKEEDAHEFLRHAIDTMQSVCLMEAGENVSGSLEEDTTLMGQTFGGYLRSKIKCMKCGG  726

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSER ER+MDLTVEI+G+I++L  ALR+FT TE LDGENKYHC RCKSYEKA+KKL + E
Sbjct  727   KSERQERMMDLTVEIEGEISTLAEALRRFTSTETLDGENKYHCVRCKSYEKAKKKLTVSE  786

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APN+LT+ALKRFQSGKFGKLNK I FPEIL+LA +MSGTSDK+PIY+LYGV+ H D+MNA
Sbjct  787   APNILTVALKRFQSGKFGKLNKPIQFPEILDLAPFMSGTSDKTPIYRLYGVVVHLDIMNA  846

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSH  3088
             +FSGHYVCY+KN QNKWFKV+DS V  VE+E VL+KGAYML Y+RCSPRAPKLIR+    
Sbjct  847   SFSGHYVCYLKNIQNKWFKVDDSVVTAVELERVLTKGAYMLFYARCSPRAPKLIRNRI-L  905

Query  3089  DPRGQKYVNCKS  3124
              P  +  VN KS
Sbjct  906   SPDSKSKVNGKS  917


 Score = 97.1 bits (240),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 104/192 (54%), Gaps = 38/192 (20%)
 Frame = +2

Query  407  LGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpa  586
            +GF++R+KW+ A AR EEI+RLL+LA+EE ARAE EA+              V G     
Sbjct  24   IGFVIRRKWKLAVARNEEINRLLILAAEETARAETEASG-------------VYG-----  65

Query  587  avpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKD  766
                        T VP      YQCA C+  A+ RC++CK+VRYCS  CQ +HWR GHK 
Sbjct  66   ------------TVVPATYN--YQCALCYFPATARCAQCKSVRYCSAHCQTVHWRQGHKF  111

Query  767  ECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDASFAEPTCSEPSI  946
            ECHPP +  H S G  ++   + ++E  + Y  GI  E+  + G+     +E T   P +
Sbjct  112  ECHPP-SKTHQSDGVISD---IHKREVVQDYT-GIREEKSESGGAECKIPSEDTSFSPEV  166

Query  947  SGAENTEDVMEG  982
            S  ++ ++++ G
Sbjct  167  SFGKD-DNIISG  177



>ref|XP_006578259.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X2 [Glycine max]
Length=1138

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/469 (64%), Positives = 352/469 (75%), Gaps = 9/469 (2%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S+H  L   S+I GR+N+K  FPYELFVKL+NS KVEL PFGL NCGNSCYANAVLQCLA
Sbjct  563   SKHFPLAVGSDIAGRHNDKSFFPYELFVKLYNSNKVELCPFGLINCGNSCYANAVLQCLA  622

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP TAY LQG HSK CA K WCF CEFE L+LK+K+  S +SP+ IISHL+NIGS L 
Sbjct  623   FTPPLTAYLLQGSHSKSCANKKWCFTCEFERLILKSKDTKSAVSPMGIISHLQNIGSQLA  682

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NGREEDAHEFLR+VI+TMQSVCL EAGV    SLEE T+L+G TFGG+L SKI+CMRCGG
Sbjct  683   NGREEDAHEFLRHVIDTMQSVCLMEAGVNALGSLEEDTTLMGQTFGGYLLSKIKCMRCGG  742

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSER ER+MDLTVEI+G+I +L  ALR+FT TE LDGENKYHC RCKSYEKA+KKL + E
Sbjct  743   KSERQERMMDLTVEIEGEITTLVEALRRFTSTETLDGENKYHCVRCKSYEKAKKKLTVSE  802

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APNVLT+ALKRFQSGKFGKLNK I FPEILNLA +MSGTSDKSPIY+LYGV+ H D+MNA
Sbjct  803   APNVLTVALKRFQSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDIMNA  862

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTS  3085
             AFSGHYVCYVKN QNKWFKV+DS V  VE++ VL+KGAYML Y+RCSPRAP+LIR+ + S
Sbjct  863   AFSGHYVCYVKNIQNKWFKVDDSVVTAVELDRVLTKGAYMLFYARCSPRAPRLIRNRILS  922

Query  3086  HDPR----GQKYVNCKSSSHTNSWDLSKGDSTNDPACRECFNSVQASSWPH--RTIfeds  3247
              D +    G+       S  TNS      +S+  P      +S   S + H  R + EDS
Sbjct  923   PDSKRKVSGKTLTTKARSISTNSGVAEHVNSSISPDDSPALDSFY-SKFHHLKRILEEDS  981

Query  3248  ssdnssslfsegcssstdssyrdsisAEDYAADQLFGDPGGACWNSPWR  3394
             SSDNSS + S     S  +      ++ D  ++ LFGD G   W+S WR
Sbjct  982   SSDNSSLISSNSDEGSCSTDSTRDSTSTDDFSEYLFGDSGNG-WSSVWR  1029


 Score = 82.8 bits (203),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 62/125 (50%), Gaps = 32/125 (26%)
 Frame = +2

Query  407  LGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpa  586
            +GF++R+KW+ +EAR++EI RLLVL                              +E   
Sbjct  24   IGFVIRRKWQVSEARKDEIKRLLVL----------------------------AAEETAR  55

Query  587  avpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKD  766
            A    +    T  S   +      CA C+  A+ RC++CK+VRYCS +CQ +HWR GHK 
Sbjct  56   AEKEASYEYGTAVSAAPSNL----CAVCYFPATARCAQCKSVRYCSFECQTVHWRQGHKL  111

Query  767  ECHPP  781
            EC PP
Sbjct  112  ECRPP  116



>ref|XP_002301091.2| UBIQUITIN-SPECIFIC PROTEASE 16 family protein [Populus trichocarpa]
 gb|EEE80364.2| UBIQUITIN-SPECIFIC PROTEASE 16 family protein [Populus trichocarpa]
Length=1141

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/353 (76%), Positives = 305/353 (86%), Gaps = 1/353 (0%)
 Frame = +2

Query  2048  GRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGF  2227
             GRY+NKGLFPY+LFVKL+ S KVE+RP GL NCGNSCYANAVLQCLAFTPP T+YF+QG 
Sbjct  576   GRYSNKGLFPYDLFVKLYTSNKVEMRPCGLINCGNSCYANAVLQCLAFTPPLTSYFVQGL  635

Query  2228  HSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY  2407
             HSK C KK+ CF+CEFE ++LKAK G SPLSPI I+S L+NIGS LGNGREEDAHEFLRY
Sbjct  636   HSKACVKKERCFSCEFEKVILKAKEGKSPLSPIGILSQLQNIGSQLGNGREEDAHEFLRY  695

Query  2408  VIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTV  2587
              I+ MQSVCLKEA V    S EE+ +LIGLTFGG+LRSKI+CM+C  KSE  ER+MDLTV
Sbjct  696   AIDAMQSVCLKEARVNAVDSFEEEATLIGLTFGGYLRSKIKCMKCHYKSEWQERMMDLTV  755

Query  2588  EIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQ  2767
             EI+GDI  LE ALR+FT TEILDG+NKY C RC+SYEKA+KKL ILEAPNVLTIALKRFQ
Sbjct  756   EIEGDIGKLEDALRRFTGTEILDGDNKYQCGRCRSYEKAKKKLTILEAPNVLTIALKRFQ  815

Query  2768  SGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNF  2947
             SGKFGKLNK+I FPEIL+LA YMSGTSDKSPIY+LYGVI H DVMNAAFSGHYVCYVKN 
Sbjct  816   SGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKNI  875

Query  2948  QNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTSHDPRGQ  3103
             QNKWFK++DS V  VE+E VLSKGAYMLLY+RCSPRAP+LIRS + S DP+ +
Sbjct  876   QNKWFKIDDSTVTAVELERVLSKGAYMLLYARCSPRAPRLIRSRIISSDPKNK  928


 Score = 98.6 bits (244),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 96/183 (52%), Gaps = 31/183 (17%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            P+  F++R KWR   AR+EEI+RL+VLA+EEAARAEFEA   Y                 
Sbjct  23   PVGWFVIRCKWRGVVARKEEINRLMVLAAEEAARAEFEATVSYSTVPV------------  70

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
                        +  +VPV++   YQC  CF   +TRCSRCKAVRYCSGKCQIIHWR GH
Sbjct  71   ------------SYGTVPVSKN-NYQCVVCFCPRTTRCSRCKAVRYCSGKCQIIHWRQGH  117

Query  761  KDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDASFAEPTCSEP  940
            K+EC  P    H +   G    +  +Q+ ++ Y      + R     I+    EP  S+ 
Sbjct  118  KEECRRPPTTYHINDDGGNPGQRAAKQDQHDIY------DGRYEKRPIETFSVEPVVSDS  171

Query  941  SIS  949
            S S
Sbjct  172  SYS  174



>ref|XP_003518257.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Glycine 
max]
Length=1036

 Score =   574 bits (1479),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 270/371 (73%), Positives = 317/371 (85%), Gaps = 3/371 (1%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             QL+ SK S+       S+I G+Y++KGLFPY+LFVKL+N  +VEL+PFGL NCGNSCYAN
Sbjct  459   QLRGSKLSKPFPSAVGSDITGKYSDKGLFPYDLFVKLYNWNRVELQPFGLINCGNSCYAN  518

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLA TPP TAY LQG HSK CA K WCF CEFESL+LK+K+ NSP+SP+ I+S L+
Sbjct  519   AVLQCLAVTPPLTAYLLQGLHSKSCANKKWCFTCEFESLILKSKDTNSPMSPLGILSQLQ  578

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             NIGS LGNGREEDAHEFLR V+ETMQSVCL E+G   S SL+E+T+L+GLTFGG+L+SKI
Sbjct  579   NIGSQLGNGREEDAHEFLRLVVETMQSVCLMESGDNMSDSLKEETNLMGLTFGGYLQSKI  638

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+CGGKSER ER+MDLTVEI+G+IA+LE ALRQFT  E LDGENKY C RCKSYEKA+
Sbjct  639   KCMKCGGKSERQERMMDLTVEIEGEIATLEEALRQFTSAETLDGENKYRCVRCKSYEKAK  698

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KK+ +LEAPNVLTIALKRFQSGKFGKLNK I FPEIL+LA +MSGTSD  PIY+LYGV+ 
Sbjct  699   KKMTVLEAPNVLTIALKRFQSGKFGKLNKPIRFPEILDLAPFMSGTSDL-PIYRLYGVVV  757

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H D+MNAAFSGHYVCYVKNFQ++WFKV+DS V  VE+ESVL+KGAYML YSRCSPRAP+L
Sbjct  758   HLDIMNAAFSGHYVCYVKNFQSRWFKVDDSVVTAVELESVLAKGAYMLFYSRCSPRAPRL  817

Query  3068  IR-SLTSHDPR  3097
             IR S+ S D +
Sbjct  818   IRNSIVSSDSK  828


 Score = 85.5 bits (210),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 69/129 (53%), Gaps = 31/129 (24%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            P + F VR   R   AR EEI RLLVLA+EE+ RAE E  A Y  +Y             
Sbjct  23   PAVAFFVRHGCRRTAARAEEIKRLLVLANEESVRAETETEALYYHQYRV-----------  71

Query  581  paavpapapvSSTLTSVPVARQLPYQ--CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRL  754
                              V+ +LP    CA C+S  +TRC+RCKAV YCSGKCQI+HWR 
Sbjct  72   ------------------VSGELPRDKVCAVCYSPTTTRCARCKAVHYCSGKCQIVHWRQ  113

Query  755  GHKDECHPP  781
             HKD+CHPP
Sbjct  114  DHKDKCHPP  122



>ref|XP_008338940.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Malus domestica]
Length=1060

 Score =   573 bits (1478),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 296/460 (64%), Positives = 353/460 (77%), Gaps = 13/460 (3%)
 Frame = +2

Query  1745  ASDKSIEGLKNVSQTPKARQVESLSTKAPNGHPSSNNRRHDSQG------AKSAKIDSAQ  1906
             +S++S   +KN ++T    +    S +A    PS ++ RH S         KS K+D  +
Sbjct  482   SSERSDHAVKNCNRTSDVLK----SREAGTPSPSVSDSRHASAVGGSLPCVKSGKVDXVE  537

Query  1907  VTACssdsggdsqssksglkssvskvvdQLKASK-SRHNSLGAWSEIGGRYNNKG-LFPY  2080
              +   S    +  + ++GLK+SV KV DQ + SK  +H  +G  SE  G+Y+ K  LF Y
Sbjct  538   ASNAVSSQATNLSNDRNGLKTSVFKVFDQFRGSKIPKHYPVGVGSEXAGKYSEKQELFRY  597

Query  2081  ELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWC  2260
             ELFVKL+N  KVELRP GL NCGNSCYANAVLQCL+FTPP TAY LQGFHSK C KK+WC
Sbjct  598   ELFVKLYNWNKVELRPSGLINCGNSCYANAVLQCLSFTPPLTAYLLQGFHSKACVKKEWC  657

Query  2261  FNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLK  2440
             F CEFESLV KAK G+SPLSP+ I+S L  IGS LGNGREEDAHEFLRY I+ MQSVCL 
Sbjct  658   FMCEFESLVSKAKEGSSPLSPMGILSQLRKIGSQLGNGREEDAHEFLRYAIDMMQSVCLT  717

Query  2441  EAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEG  2620
             EAGV +S  L+E+T+LIGLTFGG+LRSKI+C +C GKSER ER+MDLTVEI+GDI +LE 
Sbjct  718   EAGVNSSRFLKEETTLIGLTFGGYLRSKIKCTKCQGKSERQERMMDLTVEIEGDIGTLEE  777

Query  2621  ALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTI  2800
             ALR+FT TE LDGENKY C RCKSYEKA+KKL ILEAPN+LTIALKRFQSGKFGK+NK I
Sbjct  778   ALRRFTGTETLDGENKYQCVRCKSYEKAKKKLTILEAPNILTIALKRFQSGKFGKINKPI  837

Query  2801  TFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSK  2980
              FPEIL+LA +MS TSDKSPIY+LYGV+ H D+MN+AFSGHYVCYV+N QNKWF V+DS 
Sbjct  838   RFPEILDLAPFMSSTSDKSPIYRLYGVVVHLDIMNSAFSGHYVCYVRNSQNKWFMVDDST  897

Query  2981  VKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTSHDPR  3097
             V PVE+E VL KGAYMLLYSRC PRAP+LIR+ + S DP+
Sbjct  898   VTPVELEKVLXKGAYMLLYSRCLPRAPRLIRNRIISPDPK  937


 Score =   101 bits (252),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 94/184 (51%), Gaps = 38/184 (21%)
 Frame = +2

Query  392  FIGPLLGF-LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVV  568
            F+  ++GF +VR+KWR A ARREEI RLLVLA EE ARAEFE                  
Sbjct  18   FLASVIGFFVVRRKWRLANARREEIRRLLVLAKEEDARAEFEV-----------------  60

Query  569  GDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHW  748
                          ++   +VPVA      C  C+   +TRC+RCKAVRYCS KCQI+HW
Sbjct  61   --------------TAGYGAVPVAEIKGSYCVVCYCPTTTRCARCKAVRYCSAKCQIVHW  106

Query  749  RLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDASFAEPT  928
            R GHK+EC PP   + +       + KV +++        I T +  +  S++ S  EP 
Sbjct  107  RQGHKEECRPPSIIHQNVVVASDFELKVTKEDLE------INTNKFESRESVEKSSEEPA  160

Query  929  CSEP  940
              +P
Sbjct  161  LPKP  164



>gb|KHN26130.1| Ubiquitin carboxyl-terminal hydrolase 16 [Glycine soja]
Length=1054

 Score =   573 bits (1477),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 270/371 (73%), Positives = 317/371 (85%), Gaps = 3/371 (1%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             QL+ SK S+       S+I G+Y++KGLFPY+LFVKL+N  +VEL+PFGL NCGNSCYAN
Sbjct  477   QLRGSKLSKPFPSAVGSDITGKYSDKGLFPYDLFVKLYNWNRVELQPFGLINCGNSCYAN  536

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLA TPP TAY LQG HSK CA K WCF CEFESL+LK+K+ NSP+SP+ I+S L+
Sbjct  537   AVLQCLAVTPPLTAYLLQGLHSKSCANKKWCFTCEFESLILKSKDTNSPMSPLGILSQLQ  596

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             NIGS LGNGREEDAHEFLR V+ETMQSVCL E+G   S SL+E+T+L+GLTFGG+L+SKI
Sbjct  597   NIGSQLGNGREEDAHEFLRLVVETMQSVCLMESGDNMSDSLKEETNLMGLTFGGYLQSKI  656

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+CGGKSER ER+MDLTVEI+G+IA+LE ALRQFT  E LDGENKY C RCKSYEKA+
Sbjct  657   KCMKCGGKSERQERMMDLTVEIEGEIATLEEALRQFTSAETLDGENKYRCVRCKSYEKAK  716

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KK+ +LEAPNVLTIALKRFQSGKFGKLNK I FPEIL+LA +MSGTSD  PIY+LYGV+ 
Sbjct  717   KKMTVLEAPNVLTIALKRFQSGKFGKLNKPIRFPEILDLAPFMSGTSDL-PIYRLYGVVV  775

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H D+MNAAFSGHYVCYVKNFQ++WFKV+DS V  VE+ESVL+KGAYML YSRCSPRAP+L
Sbjct  776   HMDIMNAAFSGHYVCYVKNFQSRWFKVDDSVVTAVELESVLAKGAYMLFYSRCSPRAPRL  835

Query  3068  IR-SLTSHDPR  3097
             IR S+ S D +
Sbjct  836   IRNSIVSSDSK  846



>gb|KHN08238.1| Ubiquitin carboxyl-terminal hydrolase 16 [Glycine soja]
Length=1138

 Score =   575 bits (1483),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 300/469 (64%), Positives = 351/469 (75%), Gaps = 9/469 (2%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S+H  L   S+I GR+N+K  FPYELFVKL+NS KVEL PFGL NCGNSCYANAVLQCLA
Sbjct  563   SKHFPLAVGSDIAGRHNDKSFFPYELFVKLYNSNKVELCPFGLINCGNSCYANAVLQCLA  622

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP TAY LQG HSK CA K WCF CE E L+LK+K+  S +SP+ IISHL+NIGS L 
Sbjct  623   FTPPLTAYLLQGSHSKSCANKKWCFTCESERLILKSKDTKSAVSPMGIISHLQNIGSQLA  682

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NGREEDAHEFLR+VI+TMQSVCL EAGV    SLEE T+L+G TFGG+L SKI+CMRCGG
Sbjct  683   NGREEDAHEFLRHVIDTMQSVCLMEAGVNALGSLEEDTTLMGQTFGGYLLSKIKCMRCGG  742

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSER ER+MDLTVEI+G+I +L  ALR+FT TE LDGENKYHC RCKSYEKA+KKL + E
Sbjct  743   KSERQERMMDLTVEIEGEITTLVEALRRFTSTETLDGENKYHCVRCKSYEKAKKKLTVSE  802

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APNVLT+ALKRFQSGKFGKLNK I FPEILNLA +MSGTSDKSPIY+LYGV+ H D+MNA
Sbjct  803   APNVLTVALKRFQSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDIMNA  862

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTS  3085
             AFSGHYVCYVKN QNKWFKV+DS V  VE++ VL+KGAYML Y+RCSPRAP+LIR+ + S
Sbjct  863   AFSGHYVCYVKNIQNKWFKVDDSVVTAVELDRVLTKGAYMLFYARCSPRAPRLIRNRILS  922

Query  3086  HDPR----GQKYVNCKSSSHTNSWDLSKGDSTNDPACRECFNSVQASSWPH--RTIfeds  3247
              D +    G+       S  TNS      +S+  P      +S   S + H  R + EDS
Sbjct  923   PDSKRKVSGKTLTTKARSISTNSGVAEHVNSSISPDDSPALDSFY-SKFHHLKRILEEDS  981

Query  3248  ssdnssslfsegcssstdssyrdsisAEDYAADQLFGDPGGACWNSPWR  3394
             SSDNSS + S     S  +      ++ D  ++ LFGD G   W+S WR
Sbjct  982   SSDNSSLISSNSDEGSCSTDSTRDSTSTDDFSEYLFGDSGNG-WSSVWR  1029


 Score = 84.0 bits (206),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 62/125 (50%), Gaps = 32/125 (26%)
 Frame = +2

Query  407  LGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpa  586
            +GFL+R+KW+ +EAR++EI RLLVL                              +E   
Sbjct  24   IGFLIRRKWQVSEARKDEIKRLLVL----------------------------AAEETAR  55

Query  587  avpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKD  766
            A    +    T  S   +      CA C+  A+ RC++CK+VRYCS +CQ +HWR GHK 
Sbjct  56   AEKEASYEYGTAVSAAPSNL----CAVCYFPATARCAQCKSVRYCSFECQTVHWRQGHKL  111

Query  767  ECHPP  781
            EC PP
Sbjct  112  ECRPP  116



>gb|KDP41469.1| hypothetical protein JCGZ_15876 [Jatropha curcas]
Length=1103

 Score =   574 bits (1479),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 263/364 (72%), Positives = 312/364 (86%), Gaps = 3/364 (1%)
 Frame = +2

Query  2048  GRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGF  2227
              +Y++KGLF Y LFVKL+ S KVE++P GL NCGNSCYANAVLQCLAFTPP TAYF+QG 
Sbjct  555   AKYSDKGLFSYNLFVKLYTSSKVEMKPCGLVNCGNSCYANAVLQCLAFTPPLTAYFVQGL  614

Query  2228  HSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY  2407
             H+K C  K+WCF CEFESL+LKAK G SPLSPI I+S L NIGS LG+GREEDAHEFLRY
Sbjct  615   HAKECVNKEWCFTCEFESLILKAKEGKSPLSPIGILSQLHNIGSQLGSGREEDAHEFLRY  674

Query  2408  VIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTV  2587
              I+TMQSVCLKEAGV    SLEE+T+LIGLTFGG+LRSKI+CM+C  KSERHER+MDLTV
Sbjct  675   AIDTMQSVCLKEAGVNVLGSLEEETTLIGLTFGGYLRSKIKCMKCHYKSERHERMMDLTV  734

Query  2588  EIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQ  2767
             EI+GDI  LE AL++FT TE+LDG+NKY CSRCKS+EKA+KKL I+EAPNVLTI LKRFQ
Sbjct  735   EIEGDIGKLEDALKRFTSTELLDGDNKYQCSRCKSFEKAKKKLTIVEAPNVLTIVLKRFQ  794

Query  2768  SGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNF  2947
             SGKFGKLNK+I FPEIL+LA Y+SGTSDKSPIY+LYGV+ H D+MNA+FSGHYVCY+KN 
Sbjct  795   SGKFGKLNKSIRFPEILDLAPYISGTSDKSPIYRLYGVVVHLDIMNASFSGHYVCYIKNI  854

Query  2948  QNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR-SLTSHD--PRGQKYVNC  3118
             QNKWFK++DS V  V+++ VL+KGAYMLLY+RCSPRAP+LIR SL S +   +G   +N 
Sbjct  855   QNKWFKIDDSTVTAVDLDRVLTKGAYMLLYARCSPRAPRLIRNSLVSRELKTKGTSKLNA  914

Query  3119  KSSS  3130
             K+++
Sbjct  915   KNTA  918


 Score =   106 bits (265),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 88/170 (52%), Gaps = 38/170 (22%)
 Frame = +2

Query  383  FLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgs  562
             L  + P++GF++R+KWR + AR+EEI RLL+                            
Sbjct  15   LLCVVFPVIGFVIRRKWRLSIARQEEIKRLLI----------------------------  46

Query  563  VVGDEvpaavpapapvSSTLTSVPV-ARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                 + +   A A + +T++ V V A +  YQCA C+S  +TRCSRCK VRYCSGKCQI
Sbjct  47   -----LASEEAARAELEATVSYVAVSASKNNYQCAVCYSPTTTRCSRCKTVRYCSGKCQI  101

Query  740  IHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGY----AEGIET  877
            IHWR GHK+EC PP    H +   G +  K+ ++     Y     E IET
Sbjct  102  IHWRQGHKEECCPPSTTYHVNDDGGNSSQKLAKRSQRVIYDIVGNESIET  151



>ref|XP_011016915.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X2 
[Populus euphratica]
Length=1137

 Score =   574 bits (1480),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 269/353 (76%), Positives = 305/353 (86%), Gaps = 3/353 (1%)
 Frame = +2

Query  2048  GRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGF  2227
             GRY+NKGLFPY+LFVKL+ S KVE+RPFGL NCGNSCYANAVLQCLAFTPP T+YF+QG 
Sbjct  574   GRYSNKGLFPYDLFVKLYTSNKVEMRPFGLINCGNSCYANAVLQCLAFTPPLTSYFVQGL  633

Query  2228  HSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY  2407
             HSK C  K+ CF+CEFE+++LKAK G SPLSPI I+S L+NIG+ LGNGREEDAHEFLRY
Sbjct  634   HSKACVNKERCFSCEFENVILKAKEGKSPLSPIGILSQLQNIGTQLGNGREEDAHEFLRY  693

Query  2408  VIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTV  2587
              I+ MQSVCLKEA V    S EE+ +LIGLTFGG+LRSKI+CM+C  KSE  ER+MDLTV
Sbjct  694   AIDAMQSVCLKEAKVNAVGSFEEEATLIGLTFGGYLRSKIKCMKCHYKSEWQERMMDLTV  753

Query  2588  EIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQ  2767
             EI+GDI  LE ALR+FT TEILDG+NKYHC R  SYEKA+KKL ILEAPNVLTIALKRFQ
Sbjct  754   EIEGDIGKLEDALRRFTGTEILDGDNKYHCGR--SYEKAKKKLTILEAPNVLTIALKRFQ  811

Query  2768  SGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNF  2947
             SGKFGKLNK+I FPEIL+LA YMSGTSDKSPIY+LYGVI H DVMNAAFSGHYVCYVKN 
Sbjct  812   SGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKNI  871

Query  2948  QNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTSHDPRGQ  3103
             QNKWFK++DS V  VE+E VLSKGAYMLLY+RCSPRAP+LIRS + S DP+ +
Sbjct  872   QNKWFKIDDSTVTAVELERVLSKGAYMLLYARCSPRAPRLIRSRIISSDPKNK  924


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 75/153 (49%), Gaps = 32/153 (21%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            P+  F++R KWR    R+EEI RL+VL                                 
Sbjct  23   PVGWFVIRCKWRGVVVRKEEIKRLMVL-------------------------------AA  51

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
              A  A    + +  +VPV +   YQCA CF   +TRC+RCKAVRYCSGKCQIIHWR GH
Sbjct  52   EEAARAEFEATVSYGTVPVLKN-NYQCAVCFCPRTTRCARCKAVRYCSGKCQIIHWRQGH  110

Query  761  KDECHPPVNNNHDSYGKGANDFKVFRQEANEGY  859
            K+EC PP    H +   G    +  +Q+ ++ Y
Sbjct  111  KEECRPPPTTYHINDDGGNPGQRAAKQDQHDIY  143



>ref|XP_003527871.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Glycine 
max]
 gb|KHN09020.1| Ubiquitin carboxyl-terminal hydrolase 16 [Glycine soja]
Length=1125

 Score =   573 bits (1477),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 265/355 (75%), Positives = 301/355 (85%), Gaps = 0/355 (0%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S+H  L   S++ GR N+K  FPYELFVKL+NS KVEL PFGL NCGNSCYANAVLQCLA
Sbjct  560   SKHFPLVVGSDLAGRRNDKSFFPYELFVKLYNSNKVELCPFGLVNCGNSCYANAVLQCLA  619

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP TAY LQG H K CA K WCF CEFE L+LK+K+  S +SP+ IISHL+NIGS LG
Sbjct  620   FTPPLTAYLLQGLHLKSCANKKWCFTCEFERLILKSKDTKSAVSPMGIISHLQNIGSQLG  679

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NGREEDAHEFLR+VI+TMQSVCL EAGV  S SLEE T+L+G TFGG+LRSKI+CMRCGG
Sbjct  680   NGREEDAHEFLRHVIDTMQSVCLTEAGVNASGSLEEDTTLMGQTFGGYLRSKIKCMRCGG  739

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSE  ER+MDLTVEI+G+I +L  ALR+FT TE LDGENKYHC RCKSYEKA+KKL + E
Sbjct  740   KSEHQERMMDLTVEIEGEITTLVEALRRFTSTETLDGENKYHCVRCKSYEKAKKKLTVSE  799

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APNVLT+ALKRFQSGKFGKLNK I FPEILNLA +MSGTSDKSPIY+LYGV+ H DVMNA
Sbjct  800   APNVLTVALKRFQSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDVMNA  859

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR  3073
             +FSGHYVCYVKN QNKW KV+DS V  VE++ VL+KGAY+L Y+RCSPRAP+LIR
Sbjct  860   SFSGHYVCYVKNIQNKWSKVDDSVVTAVELDRVLTKGAYILFYARCSPRAPRLIR  914


 Score = 82.4 bits (202),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 73/134 (54%), Gaps = 33/134 (25%)
 Frame = +2

Query  407  LGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpa  586
            +GF++R KW+ +EAR+EEI RL +LA+EE ARA                       E  A
Sbjct  24   IGFVIRHKWQVSEARKEEIKRLFILAAEETARA-----------------------EKEA  60

Query  587  avpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKD  766
            +      VS+  T++         CA C+  A+ RC++CK+VRYCS +CQ +HWR GHK 
Sbjct  61   SYEYGTAVSAAPTNL---------CAVCYFPATARCAQCKSVRYCSFECQTVHWRQGHKL  111

Query  767  ECHPPVNNNHDSYG  808
            EC PP +  H S G
Sbjct  112  ECRPP-STTHQSDG  124



>gb|AES98232.2| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=1048

 Score =   570 bits (1470),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 260/357 (73%), Positives = 307/357 (86%), Gaps = 1/357 (0%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S+H  +    +I G+Y++KGLFPY+LFVKL+N  + E +PFGLTNCGNSCYANAVLQCL 
Sbjct  502   SKHFPVAVGGDIAGKYSDKGLFPYDLFVKLYNWNRAEFQPFGLTNCGNSCYANAVLQCLV  561

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP TAY LQG HSK CA K WCF CEFESL+LK+K+   PLSPI I+S L++IGS LG
Sbjct  562   FTPPLTAYLLQGLHSKSCASKKWCFTCEFESLILKSKDTKFPLSPIGILSQLQSIGSQLG  621

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NGREEDAHEFLR+V+ETMQSVCL E GV  S +L+EQT+L+GLTFGG+LRSKI+CM+CGG
Sbjct  622   NGREEDAHEFLRHVVETMQSVCLMECGVDASDALKEQTNLVGLTFGGYLRSKIQCMKCGG  681

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSER ER+MDLTVEI+G+I SLE AL+QFT TE LDGENKYHC RCKSYEKA+K++ + E
Sbjct  682   KSERQERMMDLTVEIEGEITSLEEALKQFTSTETLDGENKYHCGRCKSYEKAKKQMAVSE  741

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APNVLTIALKRF+SGKFGKLNK+I FPEIL+LA +MSGTSD + IY+LYGV+ H D MNA
Sbjct  742   APNVLTIALKRFRSGKFGKLNKSIRFPEILDLAPFMSGTSDLA-IYRLYGVVVHLDTMNA  800

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSL  3079
             AFSGHYV YVKNFQN WFKV+DS V PVE+E+VL+KGAYMLLY+RCSPRAP+LIR +
Sbjct  801   AFSGHYVGYVKNFQNSWFKVDDSVVTPVELETVLTKGAYMLLYARCSPRAPRLIRDM  857


 Score = 96.3 bits (238),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 82/136 (60%), Gaps = 3/136 (2%)
 Frame = +2

Query  380  AFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            A    + P++GF +R KWR A  R EE+ RLL+ A+EE+AR E EAA  Y +  ++ S+ 
Sbjct  16   ALFCVVLPVIGFFIRYKWRRAAERAEEVRRLLIFAAEESARVEREAATSYQYVTAANSYQ  75

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPY--QCAQCFSSASTRCSRCKAVRYCSGKC  733
             +  D VPA+            +V VA+      QCA CFS  +TRCS+CK V YCS KC
Sbjct  76   -IQNDAVPASYQYVNKNLYQNVAVSVAKNKNKNNQCAVCFSPTTTRCSKCKLVHYCSAKC  134

Query  734  QIIHWRLGHKDECHPP  781
            Q  HWR GHKD+CHPP
Sbjct  135  QFAHWRQGHKDKCHPP  150



>ref|XP_004490438.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Cicer 
arietinum]
Length=940

 Score =   565 bits (1457),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 258/357 (72%), Positives = 306/357 (86%), Gaps = 1/357 (0%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S+  S+   S++ G+Y++KGLFPY+LFVKL+N  +VE +PFGLTN GNSCYANAVLQCL 
Sbjct  394   SKQFSVSVGSDVVGKYSDKGLFPYDLFVKLYNCNRVEFQPFGLTNVGNSCYANAVLQCLV  453

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP TAY LQG HSK C  K WCF CEFESL++K+K+   PLSP+ I+S L+NIGS LG
Sbjct  454   FTPPLTAYLLQGLHSKSCVNKKWCFTCEFESLIMKSKDTKYPLSPVGILSQLQNIGSQLG  513

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NGREEDAHEFLR+V+ETMQSVCL E  V  S SL+EQT+L+GLTFGG+LRSKI+CM+CGG
Sbjct  514   NGREEDAHEFLRHVVETMQSVCLMECRVNASDSLKEQTNLLGLTFGGYLRSKIQCMKCGG  573

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSER ER+MDLTVEI+G+IASLE AL+QFT TE LDGENKYHC RCKSYEKA+KK+ + E
Sbjct  574   KSERQERMMDLTVEIEGEIASLEEALKQFTSTETLDGENKYHCVRCKSYEKAKKKMAVSE  633

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APNVLTIALKRF+SGKFGKLNK I FPEIL+LA +MSGTSD + IY+LYGVI H D+ NA
Sbjct  634   APNVLTIALKRFRSGKFGKLNKPIRFPEILDLAPFMSGTSDLA-IYRLYGVIVHLDIGNA  692

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSL  3079
             A+SGHYVCYVKNFQN WFKV+DS V PVE+E+VL++GAYML Y+RCSPRAP+LIR +
Sbjct  693   AYSGHYVCYVKNFQNSWFKVDDSVVMPVELETVLTRGAYMLFYARCSPRAPRLIRDM  749


 Score =   108 bits (270),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 93/175 (53%), Gaps = 26/175 (15%)
 Frame = +2

Query  377  AAFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysf  556
             A +  + P +GFL+R KWR AE R EEI RLL+LA+EE+AR                  
Sbjct  15   VAAVSVVLPAIGFLIRHKWRRAEERAEEIKRLLILAAEESAR------------------  56

Query  557  gsVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQ  736
                 +   A+    AP S    +V VA+    QCA CFS  +TRC+RCK VRYCSGKCQ
Sbjct  57   ----AEREAASYQYVAPNSYENDAVSVAKN--NQCAMCFSPTTTRCARCKTVRYCSGKCQ  110

Query  737  IIHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIET-EERNTPG  898
            I HWR GHK+ECHPP +  H +    +N  K   +    G  E +E+  E N  G
Sbjct  111  IAHWRQGHKEECHPP-STTHQTDDLVSNIGKKVAEPDYRGINERVESLAEENITG  164



>ref|XP_003615274.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=1050

 Score =   567 bits (1462),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 260/359 (72%), Positives = 308/359 (86%), Gaps = 3/359 (1%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S+H  +    +I G+Y++KGLFPY+LFVKL+N  + E +PFGLTNCGNSCYANAVLQCL 
Sbjct  502   SKHFPVAVGGDIAGKYSDKGLFPYDLFVKLYNWNRAEFQPFGLTNCGNSCYANAVLQCLV  561

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP TAY LQG HSK CA K WCF CEFESL+LK+K+   PLSPI I+S L++IGS LG
Sbjct  562   FTPPLTAYLLQGLHSKSCASKKWCFTCEFESLILKSKDTKFPLSPIGILSQLQSIGSQLG  621

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NGREEDAHEFLR+V+ETMQSVCL E GV  S +L+EQT+L+GLTFGG+LRSKI+CM+CGG
Sbjct  622   NGREEDAHEFLRHVVETMQSVCLMECGVDASDALKEQTNLVGLTFGGYLRSKIQCMKCGG  681

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSER ER+MDLTVEI+G+I SLE AL+QFT TE LDGENKYHC RCKSYEKA+K++ + E
Sbjct  682   KSERQERMMDLTVEIEGEITSLEEALKQFTSTETLDGENKYHCGRCKSYEKAKKQMAVSE  741

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APNVLTIALKRF+SGKFGKLNK+I FPEIL+LA +MSGTSD + IY+LYGV+ H D MNA
Sbjct  742   APNVLTIALKRFRSGKFGKLNKSIRFPEILDLAPFMSGTSDLA-IYRLYGVVVHLDTMNA  800

Query  2909  AFSGHYVCYVKNFQNKWFKVNDS--KVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSL  3079
             AFSGHYV YVKNFQN WFKV+DS  +V PVE+E+VL+KGAYMLLY+RCSPRAP+LIR +
Sbjct  801   AFSGHYVGYVKNFQNSWFKVDDSVVRVTPVELETVLTKGAYMLLYARCSPRAPRLIRDM  859


 Score = 96.3 bits (238),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 82/136 (60%), Gaps = 3/136 (2%)
 Frame = +2

Query  380  AFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            A    + P++GF +R KWR A  R EE+ RLL+ A+EE+AR E EAA  Y +  ++ S+ 
Sbjct  16   ALFCVVLPVIGFFIRYKWRRAAERAEEVRRLLIFAAEESARVEREAATSYQYVTAANSYQ  75

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPY--QCAQCFSSASTRCSRCKAVRYCSGKC  733
             +  D VPA+            +V VA+      QCA CFS  +TRCS+CK V YCS KC
Sbjct  76   -IQNDAVPASYQYVNKNLYQNVAVSVAKNKNKNNQCAVCFSPTTTRCSKCKLVHYCSAKC  134

Query  734  QIIHWRLGHKDECHPP  781
            Q  HWR GHKD+CHPP
Sbjct  135  QFAHWRQGHKDKCHPP  150



>gb|EYU36471.1| hypothetical protein MIMGU_mgv1a000653mg [Erythranthe guttata]
Length=1031

 Score =   565 bits (1455),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 261/362 (72%), Positives = 305/362 (84%), Gaps = 3/362 (1%)
 Frame = +2

Query  2012  RHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAF  2191
             RH SLGA S   GRY  +G FPY++FVKL++  +VEL PFGL NCGNSCYANAVLQCLAF
Sbjct  495   RHGSLGAGSGKMGRY--EGSFPYDVFVKLYHWNEVELCPFGLLNCGNSCYANAVLQCLAF  552

Query  2192  TPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGN  2371
             TPP TAYFLQG H+K C +K+WCF CEFE+LV KA   N PLSP RI+S ++N+ S LGN
Sbjct  553   TPPLTAYFLQGLHAKSCRRKEWCFTCEFEALVEKAMETNYPLSPARIMSRMQNVASHLGN  612

Query  2372  GREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGK  2551
             GREEDAHEFLRY I+ MQ++CLKEAGV    SL+E+T+L+GLTFGG+L+SKI+CMRCGGK
Sbjct  613   GREEDAHEFLRYAIDAMQNICLKEAGVNAPGSLDEETTLMGLTFGGYLQSKIKCMRCGGK  672

Query  2552  SERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEA  2731
             S++HE+IMDLT+EI G I +LE ALRQFTH+E+LDGENKYHC RC SYEKA+KKL +LEA
Sbjct  673   SKQHEKIMDLTIEIGGQIGTLEDALRQFTHSEVLDGENKYHCGRCNSYEKAKKKLTVLEA  732

Query  2732  PNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAA  2911
             PNVLTIALKRFQSGKFGKLNK + FPEILNLA++MS TSDKSPIYQLYGV+ H DV NA 
Sbjct  733   PNVLTIALKRFQSGKFGKLNKPVKFPEILNLATFMSRTSDKSPIYQLYGVLVHLDVSNAT  792

Query  2912  FSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR-SLTSH  3088
             FSGHYVCY+KN Q +WFK +DS V+PVE+E VLSK AYML Y+RCSPRAPK IR S+  H
Sbjct  793   FSGHYVCYIKNNQGRWFKADDSVVQPVEVEKVLSKDAYMLFYARCSPRAPKPIRESIACH  852

Query  3089  DP  3094
             DP
Sbjct  853   DP  854


 Score = 90.5 bits (223),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 58/102 (57%), Gaps = 1/102 (1%)
 Frame = +2

Query  632  PVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGK  811
            P  RQL YQC  CFS  +TRC +CKAVRYCS +CQI HWR GHKDECH   +N +   G 
Sbjct  83   PPVRQLQYQCEVCFSPTTTRCKQCKAVRYCSRRCQIFHWRQGHKDECHSFSSNQNGDAG-  141

Query  812  GANDFKVFRQEANEGYAEGIETEERNTPGSIDASFAEPTCSE  937
              +D + F+Q   +     IE E  ++   +  S  E   S+
Sbjct  142  AQSDHEEFKQNEIQSSQNVIEVEVMDSTKPVILSSREDVVSD  183



>ref|XP_003544242.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Glycine 
max]
 gb|KHN25065.1| Ubiquitin carboxyl-terminal hydrolase 16 [Glycine soja]
Length=1045

 Score =   565 bits (1455),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 263/368 (71%), Positives = 314/368 (85%), Gaps = 4/368 (1%)
 Frame = +2

Query  1997  KASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVL  2176
             + SK   +++G++  I G+Y++KGLFPY+LFVKL+N  +VEL PFGL NCGNSCYANAVL
Sbjct  465   RLSKPFPSAVGSY--ITGKYSDKGLFPYDLFVKLYNWNRVELEPFGLINCGNSCYANAVL  522

Query  2177  QCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIG  2356
             QCLAFTPP TAY LQG HSK CA K WCF CEFESL+LK+K+ NSP+SP+ I+S L+NIG
Sbjct  523   QCLAFTPPLTAYLLQGLHSKSCANKKWCFTCEFESLILKSKDTNSPISPVGILSQLQNIG  582

Query  2357  SSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECM  2536
             S LGNGREEDAHEFLR  +ETMQSVCL E+G   S SL+E+T+L+GLTFGG+L+SKI+CM
Sbjct  583   SQLGNGREEDAHEFLRLAVETMQSVCLMESGDNMSDSLKEETNLMGLTFGGYLQSKIKCM  642

Query  2537  RCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKL  2716
             +CGGKSE  ER+MDLTVEI+G+I +LE AL+QFT  E LDGENKYHC RCKSYEKA+KK+
Sbjct  643   KCGGKSECQERMMDLTVEIEGEITTLEEALQQFTSAETLDGENKYHCVRCKSYEKAKKKM  702

Query  2717  KILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHED  2896
              + EAPNVLTIALKRFQSGKFGKLNK I FPEIL+LA +MSGTSD  PIY+LYGV+ H D
Sbjct  703   TVSEAPNVLTIALKRFQSGKFGKLNKPIRFPEILDLAPFMSGTSDL-PIYRLYGVVVHLD  761

Query  2897  VMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR-  3073
             +MNAAFSGHYVCYVKNFQ++WFKV+DS V  VE+ESVL+KGAYML Y+RCSPRAP+LIR 
Sbjct  762   IMNAAFSGHYVCYVKNFQSRWFKVDDSVVTAVELESVLAKGAYMLFYARCSPRAPRLIRN  821

Query  3074  SLTSHDPR  3097
             S+ S D +
Sbjct  822   SIVSSDSK  829


 Score = 93.6 bits (231),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 69/130 (53%), Gaps = 28/130 (22%)
 Frame = +2

Query  392  FIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVG  571
             I P + F+VR++ + A AR EEI RLLVLA EE+                         
Sbjct  20   LIVPAIAFVVRRQCQRAAARAEEIKRLLVLAEEESV------------------------  55

Query  572  DEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWR  751
                +   A     + + S P   ++   CA C+S  +TRC+RCKAV YCSGKCQI+HWR
Sbjct  56   -RAESESEASVYQQNGIVSAPPKNKV---CAVCYSPTTTRCARCKAVHYCSGKCQIVHWR  111

Query  752  LGHKDECHPP  781
             GHKD+CHPP
Sbjct  112  QGHKDKCHPP  121



>ref|XP_003602929.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
 gb|AES73180.1| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=1116

 Score =   566 bits (1460),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 261/374 (70%), Positives = 312/374 (83%), Gaps = 3/374 (1%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S+H    A S+I G+YN+KG FPYE FVKL+NS KVELRPFGL N GNSCYANAVLQCLA
Sbjct  544   SKHVPSAARSDIAGKYNDKGFFPYETFVKLYNSNKVELRPFGLINIGNSCYANAVLQCLA  603

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP +AY +QG HSK C+ K WCF CEFE L+ K+K+  SPLSP  I+S L++IGS LG
Sbjct  604   FTPPLSAYLVQGLHSKSCSNKTWCFICEFERLIFKSKDTKSPLSPTGILSQLQSIGSQLG  663

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NG+EEDAHEFLR+ I+TMQSVCL EAG+  S S EE T+L+G TFGG+LRSKI+CM+CGG
Sbjct  664   NGKEEDAHEFLRHAIDTMQSVCLMEAGINASGSSEEDTTLMGQTFGGYLRSKIKCMKCGG  723

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSER ER+MDLTVEI+G+I++L  ALR+FT TE LDGENKYHC RCKSY+KA+KKL + E
Sbjct  724   KSERQERMMDLTVEIEGEISTLAEALRRFTSTETLDGENKYHCVRCKSYQKAKKKLTVSE  783

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APN+LT+ALKRFQSGKFGKLNK + FPEIL+LA ++SGTSDK+PIY+LYGV+ H DVMNA
Sbjct  784   APNILTVALKRFQSGKFGKLNKPVQFPEILDLAPFVSGTSDKTPIYRLYGVVVHLDVMNA  843

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTS  3085
             +FSGHYVCY+KN QNKWFKV+DS V  VE+E VL+KGAYML Y+RCSPRAPKLIR+ + S
Sbjct  844   SFSGHYVCYLKNIQNKWFKVDDSVVTAVELERVLTKGAYMLFYARCSPRAPKLIRNRILS  903

Query  3086  HDPRGQKYVNCKSS  3127
              D   +  VN KS+
Sbjct  904   QDSNSK--VNGKST  915


 Score = 83.6 bits (205),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 59/125 (47%), Gaps = 32/125 (26%)
 Frame = +2

Query  407  LGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpa  586
            +GF++R+KW+ A AR EEI RLL+L                              +E   
Sbjct  24   IGFVIRRKWQIAVARNEEIKRLLIL----------------------------AAEETAR  55

Query  587  avpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKD  766
                    S  +    V+    YQCA C+  A+ RC++CK+VRYCS  CQ +HW  GHK 
Sbjct  56   VERETLYSSGAV----VSATNNYQCALCYFPATARCAKCKSVRYCSTGCQTVHWHQGHKF  111

Query  767  ECHPP  781
            +C PP
Sbjct  112  DCRPP  116



>ref|XP_010061517.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Eucalyptus 
grandis]
Length=1005

 Score =   561 bits (1447),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 270/382 (71%), Positives = 310/382 (81%), Gaps = 5/382 (1%)
 Frame = +2

Query  1991  QLKAS-KSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q K S  S+H  LG  S++ GR N+KG+FPYELFV L+  K VEL P GL NCGNSCYAN
Sbjct  527   QFKGSVMSKHQRLGVGSDVPGRCNDKGIFPYELFVTLYTWKGVELHPRGLINCGNSCYAN  586

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFTPP TAYFLQG HSK C +KDWCF CEFESL+L+   G SP+SPI I+S L 
Sbjct  587   AVLQCLAFTPPLTAYFLQGLHSKACVRKDWCFTCEFESLILRMNEGKSPISPIGIVSQLR  646

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             NIG  LGNG+EEDAHEFLR  I+ MQS CL ++G + S S EE T LIGLTFGG+LRSKI
Sbjct  647   NIGRQLGNGKEEDAHEFLRCAIDKMQSDCLVDSGKKVSRSKEEAT-LIGLTFGGYLRSKI  705

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +C RC GKSERHER+MDLTVEI GDI +LE ALRQFT TE LDGENKY C+RC SYEKAR
Sbjct  706   QCTRCNGKSERHERMMDLTVEIGGDIRTLEEALRQFTSTETLDGENKYQCTRCNSYEKAR  765

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSG-TSDKSPIYQLYGVI  2884
             KKL +LEAPN+LTIALKRFQSGKFGKLNK+I F EIL+L+ YM G TSD+S +Y+LYGVI
Sbjct  766   KKLTVLEAPNILTIALKRFQSGKFGKLNKSIRFSEILDLSPYMKGTTSDRSAVYRLYGVI  825

Query  2885  EHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPK  3064
              H D+MNAAFSGHYVCYVKN  NKWFK++DS VKP E+E VL+KGAYMLLY+RC PRAP+
Sbjct  826   VHLDIMNAAFSGHYVCYVKNMHNKWFKIDDSTVKPAELERVLTKGAYMLLYARCLPRAPR  885

Query  3065  LIR-SLTSHDPRGQKYVNCKSS  3127
             L++ S+TS DPR  K +N KSS
Sbjct  886   LLKDSMTSADPR-NKPMNVKSS  906


 Score = 79.3 bits (194),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 57/100 (57%), Gaps = 12/100 (12%)
 Frame = +2

Query  653  YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKV  832
            Y CA C+   +TRCS+CKAVRYCSGKCQIIHWR GHK+EC P    +H        D K 
Sbjct  88   YYCAVCYCPTTTRCSQCKAVRYCSGKCQIIHWRQGHKEECRPVEAGSH-------FDGKD  140

Query  833  FRQEANEGYAEGIETEER-----NTPGSIDASFAEPTCSE  937
             R   +  + E +E++ +     N   S +   A+ +CSE
Sbjct  141  NRSGEDTYHGETLESKAKQCAKPNVSFSDECVRAQSSCSE  180



>ref|XP_011013097.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X2 [Populus euphratica]
Length=1103

 Score =   564 bits (1454),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 259/338 (77%), Positives = 294/338 (87%), Gaps = 0/338 (0%)
 Frame = +2

Query  2048  GRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGF  2227
             GRY+ KGLFPY+LFVKL+NS KVE+RP GL NCGNSCYANAVLQCLAFTPP T++F+QG 
Sbjct  540   GRYSKKGLFPYDLFVKLYNSSKVEMRPCGLINCGNSCYANAVLQCLAFTPPLTSFFVQGL  599

Query  2228  HSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY  2407
             HSK C  ++ CF+CEFES++LKAK G SPLSP+ I+S L+NIGS LGNGREEDAHEFLRY
Sbjct  600   HSKACLNRECCFSCEFESIILKAKEGKSPLSPLGILSLLQNIGSRLGNGREEDAHEFLRY  659

Query  2408  VIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTV  2587
              I+ MQSVCLKEAGV    S  E+T+LIGLTFGG+L SKI+CM+C  KSER ER+MDLTV
Sbjct  660   AIDAMQSVCLKEAGVNAMNSFAEETTLIGLTFGGYLHSKIKCMKCHYKSERQERMMDLTV  719

Query  2588  EIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQ  2767
             EI+GDI  LE AL++FT  EILDG+NKY C RCKSYEKA+KK+ ILEAPNVLTIALKRFQ
Sbjct  720   EIEGDIGKLEDALKRFTGAEILDGDNKYQCGRCKSYEKAKKKMTILEAPNVLTIALKRFQ  779

Query  2768  SGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNF  2947
             SGKFGKLNK+I FPEIL+LA YMSGTSDKSPIY+LYGVI H DVMNAAFSGHYVCYVKN 
Sbjct  780   SGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKNI  839

Query  2948  QNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             QNKWFK++DS V  VE+E VLSKGAYMLLY+RCSPRAP
Sbjct  840   QNKWFKIDDSTVTAVELERVLSKGAYMLLYARCSPRAP  877


 Score = 99.0 bits (245),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 64/125 (51%), Gaps = 32/125 (26%)
 Frame = +2

Query  422  RQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaavpap  601
            R KWR A AR+EEI RLLVL                                   A  A 
Sbjct  6    RCKWRGAVARKEEIKRLLVL-------------------------------AAEEAARAE  34

Query  602  apvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP  781
               +++  +VPV     YQCA CF   +TRC+RCKAVRYCSGKCQIIHWR GHK+ECHPP
Sbjct  35   FEAAASYGTVPVLTN-NYQCAVCFCPTTTRCARCKAVRYCSGKCQIIHWRQGHKEECHPP  93

Query  782  VNNNH  796
                H
Sbjct  94   TTRYH  98



>ref|XP_010916668.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X2 [Elaeis guineensis]
Length=1022

 Score =   561 bits (1446),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 267/378 (71%), Positives = 306/378 (81%), Gaps = 3/378 (1%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             QLK+SK S H+  G  S+I  +Y  K LFPY+ FVKL+N  KVELRP GLTNCGNSC+AN
Sbjct  474   QLKSSKVSMHHPSGFGSDISRKY--KMLFPYDYFVKLYNCDKVELRPCGLTNCGNSCFAN  531

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQ LAFT P TAY LQG HSK C +++WCF CEFESL++KAK G SPLSPI I+SH+ 
Sbjct  532   AVLQSLAFTRPLTAYLLQGLHSKACQRREWCFTCEFESLLMKAKQGQSPLSPIGILSHIH  591

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG+GREEDAHEFLRY I+ M SVCLKEAG      L E+T+LI LTFGG+LRSKI
Sbjct  592   KIGSHLGHGREEDAHEFLRYAIDVMHSVCLKEAGSYAVGPLAEETTLIQLTFGGYLRSKI  651

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
              CMRC GKSERHER+MDLTVEI G+I +LE ALR+FT TEILDGENKYHC+RCKSYE+A+
Sbjct  652   RCMRCWGKSERHERMMDLTVEIQGNIGTLEEALRKFTATEILDGENKYHCNRCKSYERAK  711

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL IL+APN+LTIALKRFQSGKFGKLNK + FPE L+LA YMSGT+DKSP+Y+LY V+ 
Sbjct  712   KKLTILDAPNILTIALKRFQSGKFGKLNKAVKFPEYLDLAPYMSGTNDKSPLYRLYAVVV  771

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DVMNAAFSGHYVCYVK+ Q KW+K +DS VK VE+ESVLSK AYMLLY+RCSP AP L
Sbjct  772   HLDVMNAAFSGHYVCYVKSTQGKWYKTDDSMVKQVELESVLSKNAYMLLYARCSPHAPSL  831

Query  3068  IRSLTSHDPRGQKYVNCK  3121
             IRS  S  P   K   CK
Sbjct  832   IRSTISQGPVKSKNSQCK  849


 Score = 95.1 bits (235),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 67/120 (56%), Gaps = 10/120 (8%)
 Frame = +2

Query  656   QCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVF  835
             QCA C+S  +TRCSRCKAVRYCSGKCQIIHWR GHKDECHPP  ++H +     ++ K  
Sbjct  80    QCAVCYSPTTTRCSRCKAVRYCSGKCQIIHWRQGHKDECHPPQVDDHYNGHATVSNLKEV  139

Query  836   RQEANEGYAEGIETEERNTPGSIDASFAEPTCSEPSISGAEN--TEDVMEGKHFTDDGTT  1009
               +  + + + +E E +        S  EP  + P    +E+  + +      FTD   T
Sbjct  140   EAQQPDLHNDNLEIEGK--------SKKEPIVTSPERPSSESNFSSEAFSESEFTDTSGT  191



>ref|XP_011013096.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X1 [Populus euphratica]
Length=1127

 Score =   563 bits (1452),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 259/338 (77%), Positives = 294/338 (87%), Gaps = 0/338 (0%)
 Frame = +2

Query  2048  GRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGF  2227
             GRY+ KGLFPY+LFVKL+NS KVE+RP GL NCGNSCYANAVLQCLAFTPP T++F+QG 
Sbjct  564   GRYSKKGLFPYDLFVKLYNSSKVEMRPCGLINCGNSCYANAVLQCLAFTPPLTSFFVQGL  623

Query  2228  HSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY  2407
             HSK C  ++ CF+CEFES++LKAK G SPLSP+ I+S L+NIGS LGNGREEDAHEFLRY
Sbjct  624   HSKACLNRECCFSCEFESIILKAKEGKSPLSPLGILSLLQNIGSRLGNGREEDAHEFLRY  683

Query  2408  VIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTV  2587
              I+ MQSVCLKEAGV    S  E+T+LIGLTFGG+L SKI+CM+C  KSER ER+MDLTV
Sbjct  684   AIDAMQSVCLKEAGVNAMNSFAEETTLIGLTFGGYLHSKIKCMKCHYKSERQERMMDLTV  743

Query  2588  EIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQ  2767
             EI+GDI  LE AL++FT  EILDG+NKY C RCKSYEKA+KK+ ILEAPNVLTIALKRFQ
Sbjct  744   EIEGDIGKLEDALKRFTGAEILDGDNKYQCGRCKSYEKAKKKMTILEAPNVLTIALKRFQ  803

Query  2768  SGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNF  2947
             SGKFGKLNK+I FPEIL+LA YMSGTSDKSPIY+LYGVI H DVMNAAFSGHYVCYVKN 
Sbjct  804   SGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKNI  863

Query  2948  QNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             QNKWFK++DS V  VE+E VLSKGAYMLLY+RCSPRAP
Sbjct  864   QNKWFKIDDSTVTAVELERVLSKGAYMLLYARCSPRAP  901


 Score =   110 bits (276),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 72/139 (52%), Gaps = 32/139 (23%)
 Frame = +2

Query  380  AFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
             F V I PL  F++R KWR A AR+EEI RLLVL                          
Sbjct  16   VFCVVIIPLGCFIIRCKWRGAVARKEEIKRLLVL--------------------------  49

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                     A  A    +++  +VPV     YQCA CF   +TRC+RCKAVRYCSGKCQI
Sbjct  50   -----AAEEAARAEFEAAASYGTVPVLTN-NYQCAVCFCPTTTRCARCKAVRYCSGKCQI  103

Query  740  IHWRLGHKDECHPPVNNNH  796
            IHWR GHK+ECHPP    H
Sbjct  104  IHWRQGHKEECHPPTTRYH  122



>gb|KGN60255.1| hypothetical protein Csa_3G890110 [Cucumis sativus]
Length=978

 Score =   559 bits (1440),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 274/402 (68%), Positives = 327/402 (81%), Gaps = 1/402 (0%)
 Frame = +2

Query  1880  KSAKIDSAQVTACssdsggdsqssksglkssvskvvdQLKASKSRHNSLG-AWSEIGGRY  2056
             +S ++D+ Q T+        + +SK+GL++S+ KVVDQ + SK   NS     +EI GR+
Sbjct  454   QSGRVDTMQATSGIPSQVACTLNSKNGLRTSMLKVVDQFRGSKLLKNSHACTVTEIPGRF  513

Query  2057  NNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSK  2236
             N KGLF Y+ FVKL+N  K+EL+P GL NCGNSCYAN VLQCLAFTPP TAYFLQG HSK
Sbjct  514   NYKGLFSYDHFVKLYNWNKLELQPAGLINCGNSCYANVVLQCLAFTPPLTAYFLQGLHSK  573

Query  2237  GCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIE  2416
              C KK WCFNCEFESL+LK K G SPLSP+ IIS L NIG  LGNG+EEDAHEFLRYVI+
Sbjct  574   SCVKKGWCFNCEFESLILKVKEGRSPLSPVGIISQLPNIGRQLGNGKEEDAHEFLRYVID  633

Query  2417  TMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEID  2596
             TMQS+C KE GV +S S EE+T+L+GLTFGG+L SKI+C RC G+SER ERIMDLTVEI+
Sbjct  634   TMQSICCKEYGVSSSGSWEEETTLVGLTFGGYLLSKIKCTRCQGRSERQERIMDLTVEIE  693

Query  2597  GDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGK  2776
             GDI  L+ ALR+FT  EILDG+NKY CSRCKSY +A+KKLKILEAPN+LT+ LKRFQSG 
Sbjct  694   GDIGRLDEALRKFTSKEILDGDNKYLCSRCKSYVRAKKKLKILEAPNILTVVLKRFQSGN  753

Query  2777  FGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNK  2956
             FGKLNK I FPEIL+LA ++ GTSDKSPIY+LYGV+ H DVMN++FSGHYVCYVKN +NK
Sbjct  754   FGKLNKPIKFPEILDLAPFIRGTSDKSPIYRLYGVVVHLDVMNSSFSGHYVCYVKNAKNK  813

Query  2957  WFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLT  3082
             WFK++DS V PV+IE+VL+KGAYMLLYSRC PRAP+L+R  T
Sbjct  814   WFKIDDSTVTPVDIETVLTKGAYMLLYSRCLPRAPRLLRHST  855


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 77/147 (52%), Gaps = 35/147 (24%)
 Frame = +2

Query  413  FLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaav  592
             ++R+KWR + AR+EEI+RLLVL+S                            +E   A 
Sbjct  23   LVIRRKWRLSVARKEEINRLLVLSS----------------------------EEAFRAE  54

Query  593  papapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
               +   ++ +  P    L +QCA C+S  +TRCSRCKAVRYCSGKCQIIHWR GHK+ C
Sbjct  55   IEASARYTSSSFTP----LGHQCAVCYSPTTTRCSRCKAVRYCSGKCQIIHWRQGHKENC  110

Query  773  HPPVNNNHDSYGKGANDFKVFRQEANE  853
            HPP   NH        + KV  Q+  E
Sbjct  111  HPP---NHAVASSTDFETKVTEQDHYE  134



>ref|XP_007141259.1| hypothetical protein PHAVU_008G181000g [Phaseolus vulgaris]
 gb|ESW13253.1| hypothetical protein PHAVU_008G181000g [Phaseolus vulgaris]
Length=977

 Score =   558 bits (1439),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 262/362 (72%), Positives = 306/362 (85%), Gaps = 4/362 (1%)
 Frame = +2

Query  1991  QLKASKS-RHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q + SKS +   L   S I G+Y++KG FPY+LFVKLFN  +VEL+PFGL NCGNSCYAN
Sbjct  462   QFRGSKSSKPFPLAVGSNITGKYSDKGHFPYDLFVKLFN--RVELQPFGLINCGNSCYAN  519

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFTPP TAY LQG HSK C  K WCF CEFESL+LK+K+  SP+SP  I+S L+
Sbjct  520   AVLQCLAFTPPLTAYLLQGLHSKSCENKKWCFTCEFESLILKSKDTKSPISPEGILSQLQ  579

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             NIGS LGNGREEDAHEFLR  +ETMQSVCL ++G   S SL+E+T+L+GLTFGG+L+SKI
Sbjct  580   NIGSQLGNGREEDAHEFLRLAVETMQSVCLMDSGDNKSDSLKEETNLMGLTFGGYLQSKI  639

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+CGGKSER ER+MDLTVEIDG+IA+LE ALRQFT  E LDGENKYHC RCKSYEKA+
Sbjct  640   KCMKCGGKSEREERMMDLTVEIDGEIATLEDALRQFTTAETLDGENKYHCVRCKSYEKAK  699

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KK+ +LEAPNVLTIALKRF+SGKFGKLNK I FPEIL+LA +MSGTSD + IY+LYGV+ 
Sbjct  700   KKMTVLEAPNVLTIALKRFKSGKFGKLNKPIQFPEILDLAPFMSGTSDLA-IYRLYGVVV  758

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H D MN AFSGHYVCYVKNFQ++WFKV+DS V  VE+ESVL+KGAYML Y+RCSPRAP+L
Sbjct  759   HLDTMNDAFSGHYVCYVKNFQSRWFKVDDSVVTSVELESVLAKGAYMLFYARCSPRAPRL  818

Query  3068  IR  3073
             IR
Sbjct  819   IR  820


 Score = 87.8 bits (216),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 69/136 (51%), Gaps = 32/136 (24%)
 Frame = +2

Query  377  AAFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysf  556
             A + F+ P +GF++R++ R A AR EEI RLLVLA                        
Sbjct  15   VAVVCFVLPAIGFVLRRRCRRAAARAEEIKRLLVLAE-----------------------  51

Query  557  gsVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQ  736
                 +E   A    +       SVP  +     CA CF   +TRC+RCKAV YCSGKCQ
Sbjct  52   -----EESVRAETEASYHKYGAVSVPKDKI----CAVCFCPTTTRCARCKAVHYCSGKCQ  102

Query  737  IIHWRLGHKDECHPPV  784
            I+HWR GHKDECHP +
Sbjct  103  IVHWRQGHKDECHPAI  118



>ref|XP_002307344.2| hypothetical protein POPTR_0005s17820g [Populus trichocarpa]
 gb|EEE94340.2| hypothetical protein POPTR_0005s17820g [Populus trichocarpa]
Length=1125

 Score =   563 bits (1450),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 263/364 (72%), Positives = 307/364 (84%), Gaps = 1/364 (0%)
 Frame = +2

Query  2048  GRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGF  2227
             GRY+ KGLFPY+LFVKL+NS K E+RP GL NCGNSCYANAVLQCLAFTPP T++F+QG 
Sbjct  564   GRYSKKGLFPYDLFVKLYNSSKAEMRPCGLINCGNSCYANAVLQCLAFTPPLTSFFVQGL  623

Query  2228  HSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY  2407
             HSK C  ++ CF+CEFES++LKAK G SPLSP+ I+S L+NIGS LGNGREEDAHEFLRY
Sbjct  624   HSKSCLNRECCFSCEFESIILKAKEGKSPLSPLGILSQLQNIGSQLGNGREEDAHEFLRY  683

Query  2408  VIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTV  2587
              I+ MQSVCLKEAGV    S  E+T+LIGLTFGG+L SKI+CM+C  KSER ER+MDLTV
Sbjct  684   AIDAMQSVCLKEAGVNAMDSFAEETTLIGLTFGGYLHSKIKCMKCHYKSERQERMMDLTV  743

Query  2588  EIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQ  2767
             EI+G+I  LE ALR+FT  EILDG+NKY C RCKSYEKA+KK+ ILEAPNVLTIALKRFQ
Sbjct  744   EIEGNIGKLEDALRRFTSAEILDGDNKYQCGRCKSYEKAKKKMTILEAPNVLTIALKRFQ  803

Query  2768  SGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNF  2947
             SGKFGKLNK+I FPEIL+LA YMSGTSDKSPIY+LYGVI H DVMNAAFSGHYVCYVKN 
Sbjct  804   SGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKNI  863

Query  2948  QNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP-KLIRSLTSHDPRGQKYVNCKS  3124
             QNKWFK++DS V  VE+E VLSKGAYMLLY+RCSPRAP  +   + S DP+ + Y +  +
Sbjct  864   QNKWFKIDDSTVTAVELERVLSKGAYMLLYARCSPRAPRSIRSRIISSDPKNKCYTSKIN  923

Query  3125  SSHT  3136
             +++T
Sbjct  924   ATNT  927


 Score =   111 bits (277),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 72/139 (52%), Gaps = 32/139 (23%)
 Frame = +2

Query  380  AFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
             F V I PL  F++R KWR A AR+E+I RLLVL                          
Sbjct  16   VFCVVIIPLGCFIIRCKWRGAVARKEDIKRLLVL--------------------------  49

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                     A  A    +++  +VPV     YQCA CF   +TRC+RCKAVRYCSGKCQI
Sbjct  50   -----AAEEAARAEFEAAASYGTVPVLTN-NYQCAVCFCPTTTRCARCKAVRYCSGKCQI  103

Query  740  IHWRLGHKDECHPPVNNNH  796
            IHWR GHK+ECHPP    H
Sbjct  104  IHWRQGHKEECHPPTTTYH  122



>ref|XP_008795170.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X4 [Phoenix dactylifera]
Length=1019

 Score =   555 bits (1431),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 264/378 (70%), Positives = 304/378 (80%), Gaps = 3/378 (1%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             QLK+SK S H+     S+I  +Y  K LFPY+ FVKL+N  KVELRPFGLTNCGNSCYAN
Sbjct  471   QLKSSKVSMHHPSAFGSDISRKY--KMLFPYDYFVKLYNCDKVELRPFGLTNCGNSCYAN  528

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQ LAFT P TAY LQG HSK C +++WCF CEFESL++KAK G SPLSP  I+SH+ 
Sbjct  529   AVLQSLAFTRPLTAYLLQGLHSKACQRREWCFTCEFESLLMKAKQGQSPLSPTGILSHIH  588

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG+GREEDAHEFLR+ I+ M SVCLKEAG      L E+TSLI LTFGG+LRSKI
Sbjct  589   KIGSHLGHGREEDAHEFLRHAIDAMHSVCLKEAGSYAVGPLAEETSLIQLTFGGYLRSKI  648

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
              CMRC GKSERHER+MDLTVEI G+I +LE ALR+FT TEILDGENKYHC+RCKSYE+A+
Sbjct  649   RCMRCWGKSERHERMMDLTVEIQGNIGTLEEALRKFTATEILDGENKYHCNRCKSYERAK  708

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL +L+APN+LTIALKRFQSGKFGKLNK + FPE L+LA YMSGT+DKSP+Y+LY V+ 
Sbjct  709   KKLTVLDAPNILTIALKRFQSGKFGKLNKAVRFPEYLDLAPYMSGTNDKSPVYRLYAVVV  768

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DVMNAAFSGHYVCYVK+ Q KW+K +DS VK VE+ESVLSK AYMLLY+RCSP AP L
Sbjct  769   HLDVMNAAFSGHYVCYVKSTQGKWYKTDDSMVKQVELESVLSKNAYMLLYARCSPHAPSL  828

Query  3068  IRSLTSHDPRGQKYVNCK  3121
             IR+  S      K   CK
Sbjct  829   IRNTISQGQVKSKKSQCK  846


 Score = 91.3 bits (225),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  656  QCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP  781
            QCA C+S  +TRCSRCKAVRYCSGKCQIIHWR GHKDECHPP
Sbjct  81   QCAVCYSPTTTRCSRCKAVRYCSGKCQIIHWRQGHKDECHPP  122



>ref|XP_010916667.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X1 [Elaeis guineensis]
Length=1027

 Score =   555 bits (1429),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 267/383 (70%), Positives = 306/383 (80%), Gaps = 8/383 (2%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             QLK+SK S H+  G  S+I  +Y  K LFPY+ FVKL+N  KVELRP GLTNCGNSC+AN
Sbjct  474   QLKSSKVSMHHPSGFGSDISRKY--KMLFPYDYFVKLYNCDKVELRPCGLTNCGNSCFAN  531

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQ LAFT P TAY LQG HSK C +++WCF CEFESL++KAK G SPLSPI I+SH+ 
Sbjct  532   AVLQSLAFTRPLTAYLLQGLHSKACQRREWCFTCEFESLLMKAKQGQSPLSPIGILSHIH  591

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG+GREEDAHEFLRY I+ M SVCLKEAG      L E+T+LI LTFGG+LRSKI
Sbjct  592   KIGSHLGHGREEDAHEFLRYAIDVMHSVCLKEAGSYAVGPLAEETTLIQLTFGGYLRSKI  651

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
              CMRC GKSERHER+MDLTVEI G+I +LE ALR+FT TEILDGENKYHC+RCKSYE+A+
Sbjct  652   RCMRCWGKSERHERMMDLTVEIQGNIGTLEEALRKFTATEILDGENKYHCNRCKSYERAK  711

Query  2708  KKLKILEAPNVLTIALKRFQ-----SGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQL  2872
             KKL IL+APN+LTIALKRFQ     SGKFGKLNK + FPE L+LA YMSGT+DKSP+Y+L
Sbjct  712   KKLTILDAPNILTIALKRFQVNVHKSGKFGKLNKAVKFPEYLDLAPYMSGTNDKSPLYRL  771

Query  2873  YGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSP  3052
             Y V+ H DVMNAAFSGHYVCYVK+ Q KW+K +DS VK VE+ESVLSK AYMLLY+RCSP
Sbjct  772   YAVVVHLDVMNAAFSGHYVCYVKSTQGKWYKTDDSMVKQVELESVLSKNAYMLLYARCSP  831

Query  3053  RAPKLIRSLTSHDPRGQKYVNCK  3121
              AP LIRS  S  P   K   CK
Sbjct  832   HAPSLIRSTISQGPVKSKNSQCK  854


 Score = 94.7 bits (234),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 67/120 (56%), Gaps = 10/120 (8%)
 Frame = +2

Query  656   QCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVF  835
             QCA C+S  +TRCSRCKAVRYCSGKCQIIHWR GHKDECHPP  ++H +     ++ K  
Sbjct  80    QCAVCYSPTTTRCSRCKAVRYCSGKCQIIHWRQGHKDECHPPQVDDHYNGHATVSNLKEV  139

Query  836   RQEANEGYAEGIETEERNTPGSIDASFAEPTCSEPSISGAEN--TEDVMEGKHFTDDGTT  1009
               +  + + + +E E +        S  EP  + P    +E+  + +      FTD   T
Sbjct  140   EAQQPDLHNDNLEIEGK--------SKKEPIVTSPERPSSESNFSSEAFSESEFTDTSGT  191



>ref|XP_007137649.1| hypothetical protein PHAVU_009G144200g [Phaseolus vulgaris]
 gb|ESW09643.1| hypothetical protein PHAVU_009G144200g [Phaseolus vulgaris]
Length=1125

 Score =   553 bits (1425),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 263/355 (74%), Positives = 300/355 (85%), Gaps = 0/355 (0%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S++  L   S+IG R+N+K  FPYELFVKL+NS KVEL PFG  NCGNSCYANAVLQCLA
Sbjct  551   SKNFPLSVGSDIGERHNDKVFFPYELFVKLYNSNKVELCPFGFINCGNSCYANAVLQCLA  610

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP TAY LQG HSK CA K WCF CEFE L+LK+K+  S +SP+ IISHL+NIGS L 
Sbjct  611   FTPPLTAYLLQGLHSKSCANKKWCFTCEFERLILKSKDTKSSVSPVSIISHLQNIGSQLT  670

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NGREEDAHEFLR+VI+TMQSVCL EAGV    SL E T+L+GLTFGG+LRSKI+CM+CGG
Sbjct  671   NGREEDAHEFLRHVIDTMQSVCLMEAGVNALGSLVEDTTLMGLTFGGYLRSKIKCMKCGG  730

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSER ER+MDLTVEI+GDI +L  AL++FT TE LDGENKYHC RCKSYEKA+KKL + E
Sbjct  731   KSERQERMMDLTVEIEGDITTLVDALQRFTSTETLDGENKYHCVRCKSYEKAKKKLTVSE  790

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APNVLT+ALKRFQ GKFGKLNK I FPEILNLA +MSGTSDKSP+Y+LYGV+ H D MNA
Sbjct  791   APNVLTVALKRFQHGKFGKLNKPIQFPEILNLAPFMSGTSDKSPVYRLYGVVVHLDTMNA  850

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR  3073
             AFSGHYV YVKN QN+WFKV+DS V  VE+E VL+KGAYMLLY+RCSPRAP+LIR
Sbjct  851   AFSGHYVSYVKNIQNRWFKVDDSVVTAVELERVLTKGAYMLLYARCSPRAPRLIR  905


 Score = 75.5 bits (184),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 84/182 (46%), Gaps = 40/182 (22%)
 Frame = +2

Query  410  GFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaa  589
            G ++ ++W+ +E R+ EI RLLVL                              +E   A
Sbjct  25   GLIIIRRWQVSETRKREIRRLLVL----------------------------AAEETARA  56

Query  590  vpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDE  769
                +    T  S   + Q    CA C+  A+ RC++CK+VRYCS +CQ +HWR GHK E
Sbjct  57   EKEASFAYGTAVSATPSNQ----CALCYFPATARCAQCKSVRYCSFECQTVHWRQGHKLE  112

Query  770  CHPPVNNNHDSYGKGANDFKVFRQEANEGYA--EGIETEERNTPGSIDASFAEPTCSEPS  943
            C PP +  H SY   ++   +  +   +GY+   G ++E  NT     +SF +P  S+  
Sbjct  113  CGPP-STIHRSYDVTSD---LGSKVVEQGYSGISGEKSECENT--DYKSSFEKPPISDIC  166

Query  944  IS  949
             S
Sbjct  167  FS  168



>gb|KHG13290.1| Ubiquitin carboxyl-terminal hydrolase 16 -like protein [Gossypium 
arboreum]
Length=1070

 Score =   551 bits (1420),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 275/412 (67%), Positives = 318/412 (77%), Gaps = 1/412 (0%)
 Frame = +2

Query  1844  SSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkssvskvvdQLKASK-SRHN  2020
             SS+ R H    AKS         A +      S  S  GLK+S+ K+ DQ + SK  +H 
Sbjct  496   SSSARVHVVPNAKSGNFGGVHANAATLPKVSSSSDSTHGLKTSMRKIADQFRGSKLPKHY  555

Query  2021  SLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPP  2200
              LG  +E  G YN+K LF YE FVKL++  K  L+P GL NCGNSCYANA+LQCL FTPP
Sbjct  556   PLGVGNEDSGNYNDKVLFSYESFVKLYSGSKANLQPCGLVNCGNSCYANAILQCLTFTPP  615

Query  2201  FTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGRE  2380
              TAYFLQG HSK CAKK+WCF C+ E+L+LKAK G SPLSP  I+S L+NI   L  G+E
Sbjct  616   LTAYFLQGLHSKACAKKEWCFTCDLENLILKAKEGKSPLSPKGILSQLQNICGQLVQGKE  675

Query  2381  EDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSER  2560
             EDAHEFLRYVI+ MQ  CLK+AGVR+S   EE+T+LIGLTFGGFLRSKI C++C GKSER
Sbjct  676   EDAHEFLRYVIDVMQFDCLKKAGVRSSGCSEEETTLIGLTFGGFLRSKIMCVKCQGKSER  735

Query  2561  HERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNV  2740
             +ER+MDLTVEI+GDI +LE AL +FT TEILDGENKY C RC SYEKA+KKL I EAPNV
Sbjct  736   YERMMDLTVEIEGDIETLEEALHRFTRTEILDGENKYQCGRCNSYEKAKKKLTISEAPNV  795

Query  2741  LTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSG  2920
             LTIALKRFQSGKFGKLNK I FPEILNLA YMSGTSD SPIY+LYGV+ H D+MNAAFSG
Sbjct  796   LTIALKRFQSGKFGKLNKAIQFPEILNLAPYMSGTSDNSPIYRLYGVVVHLDIMNAAFSG  855

Query  2921  HYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS  3076
             HYVCYVKN QNKWFK++DSKV   E+ +VL+KGAYML Y+RCSPRAP+ IRS
Sbjct  856   HYVCYVKNAQNKWFKIDDSKVTSSELGNVLTKGAYMLFYARCSPRAPRSIRS  907


 Score = 99.4 bits (246),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 95/199 (48%), Gaps = 36/199 (18%)
 Frame = +2

Query  392  FIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVG  571
             I PL GF +R+KWR +  R+ EI RL++                   E +     + +G
Sbjct  18   IIIPLFGFFIRRKWRLSIVRQAEIKRLMI---------------LASEEAARAELEASIG  62

Query  572  DEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWR  751
                              SVPV+    +QCA C+   +TRC+RCKAVRYCS +CQ+IHWR
Sbjct  63   ----------------YGSVPVSLNY-HQCAVCYCPTTTRCARCKAVRYCSTQCQVIHWR  105

Query  752  LGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERN----TPGSIDASFA  919
             GHK EC+P     H ++G+G++     +        +G E++E+     T  S   S  
Sbjct  106  QGHKKECYPAAVAIHQNHGEGSDCDSGQKVTGQHQIGDGFESKEKQHAEPTESSSKESAL  165

Query  920  EPTCSEPSISGAENTEDVM  976
              + +EP++S + +   V+
Sbjct  166  HNSTTEPALSSSTSCSAVL  184



>ref|XP_008795168.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X2 [Phoenix dactylifera]
Length=1024

 Score =   550 bits (1416),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 264/383 (69%), Positives = 304/383 (79%), Gaps = 8/383 (2%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             QLK+SK S H+     S+I  +Y  K LFPY+ FVKL+N  KVELRPFGLTNCGNSCYAN
Sbjct  471   QLKSSKVSMHHPSAFGSDISRKY--KMLFPYDYFVKLYNCDKVELRPFGLTNCGNSCYAN  528

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQ LAFT P TAY LQG HSK C +++WCF CEFESL++KAK G SPLSP  I+SH+ 
Sbjct  529   AVLQSLAFTRPLTAYLLQGLHSKACQRREWCFTCEFESLLMKAKQGQSPLSPTGILSHIH  588

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG+GREEDAHEFLR+ I+ M SVCLKEAG      L E+TSLI LTFGG+LRSKI
Sbjct  589   KIGSHLGHGREEDAHEFLRHAIDAMHSVCLKEAGSYAVGPLAEETSLIQLTFGGYLRSKI  648

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
              CMRC GKSERHER+MDLTVEI G+I +LE ALR+FT TEILDGENKYHC+RCKSYE+A+
Sbjct  649   RCMRCWGKSERHERMMDLTVEIQGNIGTLEEALRKFTATEILDGENKYHCNRCKSYERAK  708

Query  2708  KKLKILEAPNVLTIALKRFQ-----SGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQL  2872
             KKL +L+APN+LTIALKRFQ     SGKFGKLNK + FPE L+LA YMSGT+DKSP+Y+L
Sbjct  709   KKLTVLDAPNILTIALKRFQVNVHKSGKFGKLNKAVRFPEYLDLAPYMSGTNDKSPVYRL  768

Query  2873  YGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSP  3052
             Y V+ H DVMNAAFSGHYVCYVK+ Q KW+K +DS VK VE+ESVLSK AYMLLY+RCSP
Sbjct  769   YAVVVHLDVMNAAFSGHYVCYVKSTQGKWYKTDDSMVKQVELESVLSKNAYMLLYARCSP  828

Query  3053  RAPKLIRSLTSHDPRGQKYVNCK  3121
              AP LIR+  S      K   CK
Sbjct  829   HAPSLIRNTISQGQVKSKKSQCK  851


 Score = 91.3 bits (225),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  656  QCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP  781
            QCA C+S  +TRCSRCKAVRYCSGKCQIIHWR GHKDECHPP
Sbjct  81   QCAVCYSPTTTRCSRCKAVRYCSGKCQIIHWRQGHKDECHPP  122



>ref|XP_010060095.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Eucalyptus 
grandis]
 gb|KCW66624.1| hypothetical protein EUGRSUZ_F00414 [Eucalyptus grandis]
Length=1065

 Score =   550 bits (1417),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 261/350 (75%), Positives = 297/350 (85%), Gaps = 1/350 (0%)
 Frame = +2

Query  2051  RYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFH  2230
             +YN+KGLFPY+LFVKL+  K+VEL P G  NCGNSCYANAVLQC+AFTPP TAYFLQG H
Sbjct  504   KYNDKGLFPYDLFVKLYTWKEVELLPCGFVNCGNSCYANAVLQCVAFTPPLTAYFLQGLH  563

Query  2231  SKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYV  2410
             SK C KK+WCF CEFESL+ KAK G SP+SPIRI+S L+ IGS L NGREEDAHEFLR  
Sbjct  564   SKFCLKKEWCFMCEFESLIQKAKEGTSPISPIRIVSQLQKIGSQLHNGREEDAHEFLRCA  623

Query  2411  IETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVE  2590
             I+ MQS+CL ++    S S EE+T+L+GLTFGG+LRSKI C +C  KSERHER+MDLTVE
Sbjct  624   IDAMQSICLVKSVEMESGSSEEETTLMGLTFGGYLRSKIRCTKCQVKSERHERMMDLTVE  683

Query  2591  IDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQS  2770
             I+GDI +LE ALR+FT  E LDGENKY+CSRCKSYEKARK+L ILEAPNVLTIALKRFQS
Sbjct  684   IEGDIGTLEQALRRFTENETLDGENKYYCSRCKSYEKARKRLTILEAPNVLTIALKRFQS  743

Query  2771  GKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQ  2950
             GKFGKLNK I FPEILNLA Y+SGTSDKSPIY+LYGVI H DVMNAA SGHYVCYVKN Q
Sbjct  744   GKFGKLNKLIRFPEILNLAPYISGTSDKSPIYRLYGVIVHLDVMNAAVSGHYVCYVKNPQ  803

Query  2951  NKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTSHDPR  3097
             NKWFK++DS V P+E+ESVLS GAYMLLY+RCSPRAP+ IR  + S DP+
Sbjct  804   NKWFKIDDSTVTPMELESVLSTGAYMLLYARCSPRAPRSIRDKIISTDPK  853


 Score = 87.0 bits (214),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 62/130 (48%), Gaps = 33/130 (25%)
 Frame = +2

Query  404  LLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvp  583
            + G ++R+KWR +  R  EI RLL                             V+  E  
Sbjct  24   VFGLVIRRKWRQSVERSREIKRLL-----------------------------VLASEEA  54

Query  584  aavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHK  763
            A     A V     S P      YQCA C+S  +TRC+RCKAVRYCSGKCQIIHWR GHK
Sbjct  55   ARAEREASVGYGAFSAPRG----YQCAICYSPTTTRCARCKAVRYCSGKCQIIHWRQGHK  110

Query  764  DECHPPVNNN  793
            +EC  P   N
Sbjct  111  EECRAPEPGN  120



>ref|XP_008795169.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X3 [Phoenix dactylifera]
Length=1024

 Score =   549 bits (1414),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 264/383 (69%), Positives = 304/383 (79%), Gaps = 8/383 (2%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             QLK+SK S H+     S+I  +Y  K LFPY+ FVKL+N  KVELRPFGLTNCGNSCYAN
Sbjct  471   QLKSSKVSMHHPSAFGSDISRKY--KMLFPYDYFVKLYNCDKVELRPFGLTNCGNSCYAN  528

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCA-----KKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             AVLQ LAFT P TAY LQG HSK C      +++WCF CEFESL++KAK G SPLSP  I
Sbjct  529   AVLQSLAFTRPLTAYLLQGLHSKACMFSLCQRREWCFTCEFESLLMKAKQGQSPLSPTGI  588

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGF  2512
             +SH+  IGS LG+GREEDAHEFLR+ I+ M SVCLKEAG      L E+TSLI LTFGG+
Sbjct  589   LSHIHKIGSHLGHGREEDAHEFLRHAIDAMHSVCLKEAGSYAVGPLAEETSLIQLTFGGY  648

Query  2513  LRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKS  2692
             LRSKI CMRC GKSERHER+MDLTVEI G+I +LE ALR+FT TEILDGENKYHC+RCKS
Sbjct  649   LRSKIRCMRCWGKSERHERMMDLTVEIQGNIGTLEEALRKFTATEILDGENKYHCNRCKS  708

Query  2693  YEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQL  2872
             YE+A+KKL +L+APN+LTIALKRFQSGKFGKLNK + FPE L+LA YMSGT+DKSP+Y+L
Sbjct  709   YERAKKKLTVLDAPNILTIALKRFQSGKFGKLNKAVRFPEYLDLAPYMSGTNDKSPVYRL  768

Query  2873  YGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSP  3052
             Y V+ H DVMNAAFSGHYVCYVK+ Q KW+K +DS VK VE+ESVLSK AYMLLY+RCSP
Sbjct  769   YAVVVHLDVMNAAFSGHYVCYVKSTQGKWYKTDDSMVKQVELESVLSKNAYMLLYARCSP  828

Query  3053  RAPKLIRSLTSHDPRGQKYVNCK  3121
              AP LIR+  S      K   CK
Sbjct  829   HAPSLIRNTISQGQVKSKKSQCK  851


 Score = 90.9 bits (224),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  656  QCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP  781
            QCA C+S  +TRCSRCKAVRYCSGKCQIIHWR GHKDECHPP
Sbjct  81   QCAVCYSPTTTRCSRCKAVRYCSGKCQIIHWRQGHKDECHPP  122



>gb|KEH35732.1| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=1146

 Score =   550 bits (1418),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 261/404 (65%), Positives = 312/404 (77%), Gaps = 33/404 (8%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S+H    A S+I G+YN+KG FPYE FVKL+NS KVELRPFGL N GNSCYANAVLQCLA
Sbjct  544   SKHVPSAARSDIAGKYNDKGFFPYETFVKLYNSNKVELRPFGLINIGNSCYANAVLQCLA  603

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP +AY +QG HSK C+ K WCF CEFE L+ K+K+  SPLSP  I+S L++IGS LG
Sbjct  604   FTPPLSAYLVQGLHSKSCSNKTWCFICEFERLIFKSKDTKSPLSPTGILSQLQSIGSQLG  663

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             NG+EEDAHEFLR+ I+TMQSVCL EAG+  S S EE T+L+G TFGG+LRSKI+CM+CGG
Sbjct  664   NGKEEDAHEFLRHAIDTMQSVCLMEAGINASGSSEEDTTLMGQTFGGYLRSKIKCMKCGG  723

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             KSER ER+MDLTVEI+G+I++L  ALR+FT TE LDGENKYHC RCKSY+KA+KKL + E
Sbjct  724   KSERQERMMDLTVEIEGEISTLAEALRRFTSTETLDGENKYHCVRCKSYQKAKKKLTVSE  783

Query  2729  APNVLTIALKRFQ------------------------------SGKFGKLNKTITFPEIL  2818
             APN+LT+ALKRFQ                              SGKFGKLNK + FPEIL
Sbjct  784   APNILTVALKRFQVFHTLNYKLRYYYLHFLQSVYVEFTSFVSQSGKFGKLNKPVQFPEIL  843

Query  2819  NLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEI  2998
             +LA ++SGTSDK+PIY+LYGV+ H DVMNA+FSGHYVCY+KN QNKWFKV+DS V  VE+
Sbjct  844   DLAPFVSGTSDKTPIYRLYGVVVHLDVMNASFSGHYVCYLKNIQNKWFKVDDSVVTAVEL  903

Query  2999  ESVLSKGAYMLLYSRCSPRAPKLIRS-LTSHDPRGQKYVNCKSS  3127
             E VL+KGAYML Y+RCSPRAPKLIR+ + S D   +  VN KS+
Sbjct  904   ERVLTKGAYMLFYARCSPRAPKLIRNRILSQDSNSK--VNGKST  945


 Score = 83.6 bits (205),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 59/125 (47%), Gaps = 32/125 (26%)
 Frame = +2

Query  407  LGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpa  586
            +GF++R+KW+ A AR EEI RLL+L                              +E   
Sbjct  24   IGFVIRRKWQIAVARNEEIKRLLIL----------------------------AAEETAR  55

Query  587  avpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKD  766
                    S  +    V+    YQCA C+  A+ RC++CK+VRYCS  CQ +HW  GHK 
Sbjct  56   VERETLYSSGAV----VSATNNYQCALCYFPATARCAKCKSVRYCSTGCQTVHWHQGHKF  111

Query  767  ECHPP  781
            +C PP
Sbjct  112  DCRPP  116



>ref|XP_010675222.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 [Beta vulgaris 
subsp. vulgaris]
Length=1084

 Score =   548 bits (1412),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 269/420 (64%), Positives = 316/420 (75%), Gaps = 8/420 (2%)
 Frame = +2

Query  1817  STKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkssvskvvdQL  1996
             STKAP+G PS   + H +   KS       VTA +  +     +      +   K     
Sbjct  448   STKAPSGSPS-GMKEHIAPAMKS-------VTAVTDAANPSQVARPVPGTAVGLKTSVLK  499

Query  1997  KASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVL  2176
                + R   L   S+  GR + K +FPYE FVKL++  KVELRP GL NCGNSCYAN +L
Sbjct  500   VVEQFRAPRLSKKSDDVGRNSEKAVFPYESFVKLYHWNKVELRPCGLINCGNSCYANVIL  559

Query  2177  QCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIG  2356
             QCLAFTPP T+Y LQG HSK C  K+WCF CEFE L+LKAK G  PLSPI I+SH++ IG
Sbjct  560   QCLAFTPPLTSYLLQGLHSKACVNKEWCFTCEFERLILKAKEGGPPLSPIGILSHIQKIG  619

Query  2357  SSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECM  2536
             S L NGREEDAHEFLRY I+TMQS CL+EAGV  S SL+E+T+L+GLTFGG LRSKI C 
Sbjct  620   SHLSNGREEDAHEFLRYAIDTMQSTCLQEAGVNASGSLQEETNLMGLTFGGCLRSKIRCT  679

Query  2537  RCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKL  2716
             RC GKSE+ ER+MDLTVEI+GDI +LE AL++F+ TE LDGENKY+C RCKSYEKA+KKL
Sbjct  680   RCRGKSEKFERMMDLTVEIEGDIETLEDALQKFSGTEPLDGENKYNCGRCKSYEKAKKKL  739

Query  2717  KILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHED  2896
              I EAPN+LTIALKRFQSGKFGKLNKTI FPEILNLA YM G SDK+PIY+LYGV+ H D
Sbjct  740   NISEAPNILTIALKRFQSGKFGKLNKTIRFPEILNLAPYMRGGSDKTPIYRLYGVVVHLD  799

Query  2897  VMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS  3076
             +MNAAFSGHYVCYV+N  NKW+K++DS VKPV++E VL+KGAYML YSR SPRAPK IRS
Sbjct  800   IMNAAFSGHYVCYVRNAHNKWYKIDDSTVKPVDLERVLNKGAYMLFYSRISPRAPKSIRS  859


 Score = 99.4 bits (246),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 85/143 (59%), Gaps = 33/143 (23%)
 Frame = +2

Query  377  AAFLVFI-GPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssys  553
            A F +F+  P  GF++R+KWR A AR++EI+RLLVLASEEAARAE EA+  Y        
Sbjct  12   AVFFIFVLFPAFGFVLRRKWRLAVARQDEINRLLVLASEEAARAELEASFGY--------  63

Query  554  fgsVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKC  733
                                +T  S+P  R     CA CF+  + RC+RCK+V YCSGKC
Sbjct  64   --------------------TTSISIPSQRF----CAVCFTPTANRCARCKSVHYCSGKC  99

Query  734  QIIHWRLGHKDECHPPVNNNHDS  802
            QIIHWR GHKDECH  V+N+  S
Sbjct  100  QIIHWRQGHKDECHLSVDNSEIS  122



>ref|XP_010266094.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Nelumbo 
nucifera]
Length=1113

 Score =   548 bits (1412),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 261/384 (68%), Positives = 308/384 (80%), Gaps = 6/384 (2%)
 Frame = +2

Query  1991  QLKASKSR-HNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q +ASK    N LG  +E GG+YN K +FPYE FVKL++ K +EL+PFGL NCGNSCYAN
Sbjct  505   QFRASKILISNPLG--TEKGGKYNCKMIFPYEQFVKLYHDK-MELQPFGLKNCGNSCYAN  561

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFT P T+Y LQG HSK C KK+WCF CEFE L++KA+   S LSPIRI+S L+
Sbjct  562   AVLQCLAFTRPLTSYLLQGLHSKTCPKKEWCFTCEFEDLIMKARERKSQLSPIRILSQLQ  621

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             NIGS LG GREEDAHEFLRY I+ MQSV LKEAG        E+T+L+ L FGG+LRSKI
Sbjct  622   NIGSHLGQGREEDAHEFLRYSIDAMQSVFLKEAGSNVEGPYAEETTLMSLIFGGYLRSKI  681

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+C GKSER+ER+MDLTVEIDGDI +LE AL++FT TEILDGENKY C RCKSYEKA+
Sbjct  682   KCMKCQGKSERNERMMDLTVEIDGDIGTLEEALKKFTATEILDGENKYQCERCKSYEKAK  741

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL + EAPNVLTIALKRFQSGKFGKLNK + FP +L+LA YMS T+DKSP+Y LY V+ 
Sbjct  742   KKLTVSEAPNVLTIALKRFQSGKFGKLNKVVRFPRVLDLAPYMSTTNDKSPVYTLYAVVV  801

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DVMNAAFSGHYVCY+KNFQ KW+K++DS V+PVE+E VLSKGAYMLLY+RCSPRAP  
Sbjct  802   HLDVMNAAFSGHYVCYIKNFQEKWYKIDDSTVEPVELEKVLSKGAYMLLYARCSPRAPSW  861

Query  3068  IRSLTSHDP--RGQKYVNCKSSSH  3133
             +R+  SHD   R  ++    SS+H
Sbjct  862   VRNSMSHDGKIRRSRFSEAISSNH  885


 Score = 81.3 bits (199),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 58/120 (48%), Gaps = 32/120 (27%)
 Frame = +2

Query  416  LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaavp  595
            ++R+KWR A AR+EEI RL+ L                               E      
Sbjct  26   VIRRKWRIAVARQEEIRRLMEL-----------------------------ASEQEERAA  56

Query  596  apapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
              A V     SV   + L   CA C+   +TRC++CKAVRYCSGKCQIIHWR GHKDEC 
Sbjct  57   LEAAVEYGAISVSARQSL---CAVCYCPTTTRCAQCKAVRYCSGKCQIIHWRQGHKDECQ  113



>ref|XP_008795167.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X1 [Phoenix dactylifera]
Length=1029

 Score =   543 bits (1398),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 264/388 (68%), Positives = 304/388 (78%), Gaps = 13/388 (3%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             QLK+SK S H+     S+I  +Y  K LFPY+ FVKL+N  KVELRPFGLTNCGNSCYAN
Sbjct  471   QLKSSKVSMHHPSAFGSDISRKY--KMLFPYDYFVKLYNCDKVELRPFGLTNCGNSCYAN  528

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCA-----KKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             AVLQ LAFT P TAY LQG HSK C      +++WCF CEFESL++KAK G SPLSP  I
Sbjct  529   AVLQSLAFTRPLTAYLLQGLHSKACMFSLCQRREWCFTCEFESLLMKAKQGQSPLSPTGI  588

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGF  2512
             +SH+  IGS LG+GREEDAHEFLR+ I+ M SVCLKEAG      L E+TSLI LTFGG+
Sbjct  589   LSHIHKIGSHLGHGREEDAHEFLRHAIDAMHSVCLKEAGSYAVGPLAEETSLIQLTFGGY  648

Query  2513  LRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKS  2692
             LRSKI CMRC GKSERHER+MDLTVEI G+I +LE ALR+FT TEILDGENKYHC+RCKS
Sbjct  649   LRSKIRCMRCWGKSERHERMMDLTVEIQGNIGTLEEALRKFTATEILDGENKYHCNRCKS  708

Query  2693  YEKARKKLKILEAPNVLTIALKRFQ-----SGKFGKLNKTITFPEILNLASYMSGTSDKS  2857
             YE+A+KKL +L+APN+LTIALKRFQ     SGKFGKLNK + FPE L+LA YMSGT+DKS
Sbjct  709   YERAKKKLTVLDAPNILTIALKRFQVNVHKSGKFGKLNKAVRFPEYLDLAPYMSGTNDKS  768

Query  2858  PIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLY  3037
             P+Y+LY V+ H DVMNAAFSGHYVCYVK+ Q KW+K +DS VK VE+ESVLSK AYMLLY
Sbjct  769   PVYRLYAVVVHLDVMNAAFSGHYVCYVKSTQGKWYKTDDSMVKQVELESVLSKNAYMLLY  828

Query  3038  SRCSPRAPKLIRSLTSHDPRGQKYVNCK  3121
             +RCSP AP LIR+  S      K   CK
Sbjct  829   ARCSPHAPSLIRNTISQGQVKSKKSQCK  856


 Score = 90.9 bits (224),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  656  QCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP  781
            QCA C+S  +TRCSRCKAVRYCSGKCQIIHWR GHKDECHPP
Sbjct  81   QCAVCYSPTTTRCSRCKAVRYCSGKCQIIHWRQGHKDECHPP  122



>ref|XP_011074220.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18 [Sesamum 
indicum]
 ref|XP_011074221.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18 [Sesamum 
indicum]
Length=1033

 Score =   539 bits (1388),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 288/509 (57%), Positives = 365/509 (72%), Gaps = 19/509 (4%)
 Frame = +2

Query  1673  TASDACKV---------EHLVNNDTLKVNSPPKASDKSIEGLKNVSQTPKARQVESLSTK  1825
             ++SDAC+          +H +N  +L+ +S  K  D   +    V    K +Q +S+  +
Sbjct  419   SSSDACQAHISEEHVPSKHAINISSLQ-SSACKQLDHETDLTNGVLDAKKCQQNDSVRLR  477

Query  1826  APNGHPSSNN--RRHDSQGAKSAKIDSAQVT-ACssdsggdsqssksglkssvskvvdQL  1996
             + + H SS+   R+      KS + + A    ACS DS G    +KSG   S  +V+DQ 
Sbjct  478   SSDAHLSSSTCIRKPAVLNVKSIESECAHRDGACSLDSSGHLPCAKSGTDPSARRVMDQF  537

Query  1997  KASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAV  2173
             +AS  +RH +LGA + I  RY  +GLFPYELFVKL+  K+ EL P GL NCGNSCYANA+
Sbjct  538   RASNFTRHGTLGAENGIT-RY--EGLFPYELFVKLYTWKERELCPSGLINCGNSCYANAI  594

Query  2174  LQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENI  2353
             LQCL FTPP TAYFLQGFH K C KK+WCF CEFE LV KAK G  P+SP RI+SH+++I
Sbjct  595   LQCLTFTPPLTAYFLQGFHEKACQKKEWCFTCEFEMLVKKAKEGKFPVSPSRIMSHMQHI  654

Query  2354  GSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSC-SLEEQTSLIGLTFGGFLRSKIE  2530
             GS +G+G++EDAHEFLR  I+ MQ VCLKEAGV  +  SL+E+T+L+GLTFGG+L+SKIE
Sbjct  655   GSHMGSGKQEDAHEFLRCAIDAMQFVCLKEAGVHVAGGSLDEETTLLGLTFGGYLQSKIE  714

Query  2531  CMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARK  2710
             CM CGG  ++HERIMDLTVEI G+I +LE +L  FT +E+LDGENKYHC RC SYE+A K
Sbjct  715   CMGCGGTFKQHERIMDLTVEIGGEIETLEDSLSLFTRSEMLDGENKYHCRRCNSYEQAEK  774

Query  2711  KLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEH  2890
             KL++ EAPNVLTIALKRFQ G FGKLNK + FPE+LNLA YMSGTSDK PIYQLYG++ H
Sbjct  775   KLRVSEAPNVLTIALKRFQLGTFGKLNKAVKFPEVLNLAPYMSGTSDKCPIYQLYGIVVH  834

Query  2891  EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
              DVMN+A SGHYVCY+KN + +WFK +DS V+ V++E+VLS+ AYML Y+RCSPRAP+LI
Sbjct  835   LDVMNSAVSGHYVCYIKNNEGRWFKADDSMVRAVDLENVLSQEAYMLFYARCSPRAPRLI  894

Query  3071  R-SLTSHDPRGQKYVNCKSSSHTNSWDLS  3154
             R S+   D R  K  + K  SH   WD+S
Sbjct  895   RSSIIPRDTRKAKTPSLKFKSHAAEWDVS  923


 Score = 85.5 bits (210),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 89/179 (50%), Gaps = 14/179 (8%)
 Frame = +2

Query  413  FLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaav  592
            FL R KWR   AR  EI R + LA EE+ R E EAAA Y           V+  E  A  
Sbjct  21   FLARWKWRRWVARNAEIRRRMALAREESDRIELEAAAGYSSYGP------VLAAEPLADE  74

Query  593  papapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
                   S   S P      +QC  CFS  +TRC +CKAVRYCS KCQ IHW  GHK+EC
Sbjct  75   LVVGLGRSPGRSPP-----QHQCEVCFSPTTTRCKQCKAVRYCSRKCQTIHWLQGHKEEC  129

Query  773  HPPVNNNHDSYGKGANDF-KVFRQEANEGYAEGIETEERNTPGSIDASFAEPTCSEPSI  946
            H      + +  KG + + K F+Q+  +     IE E   T  S+++S  E T S P +
Sbjct  130  HS--FTTYQNIDKGVHSYSKEFKQDGIQSSQNYIEIEGTRTTESVESSSGEQTFSSPIL  186



>ref|XP_008466167.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
16-like [Cucumis melo]
Length=1030

 Score =   536 bits (1381),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 271/399 (68%), Positives = 324/399 (81%), Gaps = 1/399 (0%)
 Frame = +2

Query  1880  KSAKIDSAQVTACssdsggdsqssksglkssvskvvdQLKASKSRHNSLG-AWSEIGGRY  2056
             +S ++D+ Q T+        + +SK+GL++S+ KVVDQ + SK   NS     +EI GR+
Sbjct  453   QSGRVDTMQATSGIPSQVACTLNSKNGLRTSMLKVVDQFRGSKLLKNSHACTVAEIPGRF  512

Query  2057  NNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSK  2236
             N KGLF Y+ FVKL+N  K+EL+P GL NCGNSCYAN VLQCLAFTPP TAYFLQG HSK
Sbjct  513   NYKGLFSYDHFVKLYNWNKLELQPAGLINCGNSCYANVVLQCLAFTPPLTAYFLQGLHSK  572

Query  2237  GCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIE  2416
              C KK WCFNCEFESL+LK K G SPLSP+ IIS L NIG  LGNG+EEDAHEFLRYVI+
Sbjct  573   SCIKKGWCFNCEFESLMLKVKEGRSPLSPVGIISQLPNIGRQLGNGKEEDAHEFLRYVID  632

Query  2417  TMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEID  2596
             +MQS+C  E GV +S S EE+T+L+GLTFGG+L SKI+C RC G+SER ERIMDLTVEI+
Sbjct  633   SMQSICCMEYGVSSSGSWEEETTLVGLTFGGYLLSKIKCTRCQGRSERQERIMDLTVEIE  692

Query  2597  GDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGK  2776
             GDI  L+ ALR+FT  EILDG+NKY CSRCKSY K +KKLKILEAPN+LT+ LKRFQSG 
Sbjct  693   GDIGRLDEALRKFTSKEILDGDNKYLCSRCKSYXKGKKKLKILEAPNILTVVLKRFQSGN  752

Query  2777  FGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNK  2956
             FGKLNK I FPEIL+LA ++ GTSDKSPIY+LYGV+ H DVMN++FSGHYVCYVKN +NK
Sbjct  753   FGKLNKPIKFPEILDLAPFIRGTSDKSPIYRLYGVVVHLDVMNSSFSGHYVCYVKNAKNK  812

Query  2957  WFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR  3073
             WFK++DS V PV+IE+VL+KGAYMLLYSRC PRAP+L+R
Sbjct  813   WFKIDDSTVTPVDIETVLTKGAYMLLYSRCLPRAPRLLR  851


 Score =   100 bits (249),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 77/147 (52%), Gaps = 35/147 (24%)
 Frame = +2

Query  413  FLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaav  592
             ++R+KWR + AR+EEI+RLLVL+S                            +E   A 
Sbjct  23   LVIRRKWRLSVARKEEINRLLVLSS----------------------------EEAFRAE  54

Query  593  papapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
               +   S+ +  P    L +QCA C+S  +TRCSRCKAVRYCSGKCQIIHWR GHK+ C
Sbjct  55   LEASARYSSSSFTP----LGHQCAVCYSPTTTRCSRCKAVRYCSGKCQIIHWRQGHKENC  110

Query  773  HPPVNNNHDSYGKGANDFKVFRQEANE  853
            HPP   NH        + KV  Q+  E
Sbjct  111  HPP---NHAVASSTDFETKVTEQDHYE  134



>ref|XP_008802270.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Phoenix 
dactylifera]
Length=1046

 Score =   536 bits (1381),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 246/348 (71%), Positives = 284/348 (82%), Gaps = 0/348 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+LF++L+N  KVELRP GLTNCGNSCYANAVLQCLAFT P  AY L+G HSK C K
Sbjct  489   LFPYDLFIRLYNCDKVELRPCGLTNCGNSCYANAVLQCLAFTRPLAAYLLEGLHSKTCPK  548

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              +WCF CE E L++ AK G SPLSP  I+SHL NIGS+ G+GREEDAHEFLRY IE MQS
Sbjct  549   TEWCFVCELERLLMMAKQGKSPLSPAGILSHLSNIGSNFGHGREEDAHEFLRYAIEAMQS  608

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
              CLKEAG   +  L E+T+LI L FGG+LRSKI CMRC GKSER ER+MDLTVEI+GDI 
Sbjct  609   ACLKEAGTNVTGPLVEETTLIQLIFGGYLRSKIRCMRCQGKSERCERMMDLTVEINGDIG  668

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             +LE AL +FT TEILDGENKY C RCKSYE+A+KKL ILEAPN+LTIALKRFQSGKFGKL
Sbjct  669   TLEEALSRFTATEILDGENKYQCDRCKSYERAKKKLTILEAPNILTIALKRFQSGKFGKL  728

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             NK+I FPE L+LA YMSGT DK P+Y+LY V+ H D+MNA+FSGHYVCYV++ Q KW+K 
Sbjct  729   NKSIRFPEYLDLARYMSGTDDKFPVYRLYAVVVHLDIMNASFSGHYVCYVRDTQGKWYKT  788

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYV  3112
             +DS VKPVE+E VLSKGAYMLLY+RCSPRAP  IR   SH+   +K +
Sbjct  789   DDSTVKPVELERVLSKGAYMLLYARCSPRAPSSIRKALSHEQLQRKKI  836


 Score = 93.2 bits (230),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 90/196 (46%), Gaps = 30/196 (15%)
 Frame = +2

Query  422   RQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaavpap  601
             R++WR A AR+EE+ RL+ LA+EEA                                   
Sbjct  29    RRRWRLAVARQEEVRRLVFLAAEEAE-------------------------RAEMEAVLA  63

Query  602   apvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP  781
                 ST    P AR +   CA CFS  +TRCSRCKAVRYCSGKCQI+HWR GHK+ECHPP
Sbjct  64    YAAESTAVGAP-ARPV---CAVCFSPTTTRCSRCKAVRYCSGKCQIVHWRQGHKEECHPP  119

Query  782   VNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDASFAEPTCSEPSISGAEN  961
                +        +D K    E +      +E EE+    + + S   P+ SE +      
Sbjct  120   CIEDKYDGRTNISDLKEVPVEQSIESGNSLEFEEQPHAKAAETSPKRPS-SESNCCSNIL  178

Query  962   TEDVMEGKHFTDDGTT  1009
             TED  E K   D   T
Sbjct  179   TEDKPEDKPAVDASET  194



>ref|XP_009401442.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Musa 
acuminata subsp. malaccensis]
Length=857

 Score =   526 bits (1355),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 244/354 (69%), Positives = 283/354 (80%), Gaps = 1/354 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+LF+KL+NS  +ELRP GL NCGNSCYANAVLQCLAFT P TAY L+G HSK C K
Sbjct  306   LFPYDLFIKLYNSDNIELRPCGLINCGNSCYANAVLQCLAFTRPLTAYLLEGLHSKRCPK  365

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             KDWCF CEFESLV+  K G SPLSPI I+SHL NIGS+ G+G+EEDAHEFLRY I+ MQS
Sbjct  366   KDWCFTCEFESLVMNTKQGKSPLSPIGILSHLHNIGSNFGHGKEEDAHEFLRYAIDIMQS  425

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VCLKEAG +    L E+T+LI  TFGG+L+SKI C RC   SER ER+MDLTVEI GDIA
Sbjct  426   VCLKEAGAKPDDVLAEETTLIQQTFGGYLQSKIRCYRCKSNSERCERMMDLTVEIHGDIA  485

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             +L+ AL  FT  EILDG+NKY C RCKS E+ARK+L ILEAPNVLTI LKRFQSGK+GKL
Sbjct  486   TLDEALSCFTSPEILDGKNKYECDRCKSRERARKRLSILEAPNVLTIVLKRFQSGKYGKL  545

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             NK + FPE LNLA YMSG  D S +YQLY VI H+DVMNA+FSGHYVCYVK+ Q KW+K+
Sbjct  546   NKAVRFPEYLNLAHYMSG-DDASSMYQLYAVIVHKDVMNASFSGHYVCYVKDTQGKWYKI  604

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSSS  3130
             +DS+VKPVE++ VLSK AYMLLY+RCSP AP L+R   SHDP   + +  K +S
Sbjct  605   DDSEVKPVELKKVLSKSAYMLLYARCSPHAPSLVRKAISHDPLQARKIRSKEAS  658



>ref|XP_007047805.1| Ubiquitin-specific protease 17, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91962.1| Ubiquitin-specific protease 17, putative isoform 1 [Theobroma 
cacao]
Length=941

 Score =   528 bits (1360),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 249/374 (67%), Positives = 300/374 (80%), Gaps = 4/374 (1%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q KASK S+    G  +E   ++N K +FPYELF++L++   VEL PFGL NCGNSCYAN
Sbjct  385   QFKASKQSKSYLFGFGNEFNVKHNYKIIFPYELFMELYSYDAVELCPFGLNNCGNSCYAN  444

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFT P T+Y ++G HS+ C KK+WCF CEFE L+LKAK G SPLSPIRI+S ++
Sbjct  445   AVLQCLAFTRPLTSYLVRGLHSRACRKKEWCFICEFECLILKAKEGESPLSPIRILSKIQ  504

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG G+EEDAHEFLRY ++ MQSVCLKEA  R +  L E+T+L+GLTFGG+L SKI
Sbjct  505   KIGSHLGPGKEEDAHEFLRYAVDAMQSVCLKEA--RAAGPLAEETTLVGLTFGGYLHSKI  562

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+C GKSER+ER+MDL VEIDGDI SLE AL QFT TEILD ENKYHCSRCKSY KAR
Sbjct  563   KCMKCLGKSERYERMMDLPVEIDGDIGSLEEALAQFTATEILDAENKYHCSRCKSYVKAR  622

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL +L+APN+LTI LKRFQSG FGKLNK++  PE+L+LA YMSGTSDK+ +Y LY V+ 
Sbjct  623   KKLTVLDAPNILTIVLKRFQSGNFGKLNKSVQIPEVLDLAPYMSGTSDKAAVYNLYAVVV  682

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DVMNAAFSGHYVCYVK+F  +WF+++DS V PVE+E VL +GAYMLLY+R SPRAP L
Sbjct  683   HLDVMNAAFSGHYVCYVKSFHGEWFRIDDSTVIPVELERVLLEGAYMLLYARRSPRAPAL  742

Query  3068  IR-SLTSHDPRGQK  3106
             +R +L  H  R +K
Sbjct  743   VRNNLECHGLRFKK  756


 Score = 87.4 bits (215),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (59%), Gaps = 9/102 (9%)
 Frame = +2

Query  656  QCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVN-NNHDSYGKGANDF--  826
            QCA CF+  +TRCS+CK+VRYCS KCQIIHWR GHKDEC PP +       G  +NDF  
Sbjct  67   QCAVCFAPTTTRCSQCKSVRYCSSKCQIIHWRQGHKDECRPPTDFAVTKQCGIHSNDFEV  126

Query  827  -KVFRQEANEGYAEGIETEERNTPGSIDA-----SFAEPTCS  934
             ++FR  ++     G +  + N   + DA      FA P+ S
Sbjct  127  ERIFRTASDTSSVVGDDDIDANLKPNADAKATHNGFAPPSSS  168



>ref|XP_008444939.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X1 [Cucumis melo]
Length=1115

 Score =   531 bits (1369),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 248/371 (67%), Positives = 296/371 (80%), Gaps = 0/371 (0%)
 Frame = +2

Query  1991  QLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANA  2170
             +L+ SKS    +   +   G+ NNKG  PYELFV L+N  KVEL+P GL NCGNSCYAN 
Sbjct  551   ELRRSKSHRGYVANGAGNAGKCNNKGDSPYELFVNLYNWNKVELQPSGLVNCGNSCYANV  610

Query  2171  VLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLEN  2350
             VLQCL FTPP TAYFLQG HSK CAK+ WCF CEFESL+L+AK G SPLSP RIIS L  
Sbjct  611   VLQCLTFTPPLTAYFLQGLHSKACAKEKWCFTCEFESLILEAKEGKSPLSPFRIISQLRK  670

Query  2351  IGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIE  2530
             IGS L NG+EEDAHEFLR  I+TMQS+C  EA    +  +EE+T+LIGLTFGG+L SKI+
Sbjct  671   IGSQLVNGKEEDAHEFLRCAIDTMQSICPMEAQASRTGPVEEETTLIGLTFGGYLLSKIK  730

Query  2531  CMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARK  2710
             C RC  KSER ERI+DLTVEI GDI ++E AL+Q+T  EILDG+N+YHC+RC SY KARK
Sbjct  731   CTRCENKSERIERILDLTVEISGDIETIEEALQQYTSPEILDGDNRYHCTRCNSYVKARK  790

Query  2711  KLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEH  2890
             +L ILEAPN+LTIALKRFQSGKFGKLNK + F EIL+LA YMS  SDKSP+Y+LYGVI H
Sbjct  791   RLSILEAPNILTIALKRFQSGKFGKLNKPVIFSEILDLAPYMSSRSDKSPVYRLYGVIVH  850

Query  2891  EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
              DVMNAAFSGHYVCY++N QNKWFKV+DS V  +++++VL++GAYML Y+RCSPRAP+LI
Sbjct  851   LDVMNAAFSGHYVCYIRNNQNKWFKVDDSTVTAMDVKNVLTRGAYMLFYARCSPRAPRLI  910

Query  3071  RSLTSHDPRGQ  3103
             R+  + D R +
Sbjct  911   RNKITTDSRNR  921


 Score =   106 bits (264),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 75/135 (56%), Gaps = 35/135 (26%)
 Frame = +2

Query  377  AAFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysf  556
            A  LVF  P++G  +R KW+   AR++EI+RLLV ASEEAAR E                
Sbjct  15   AVCLVF--PIIGLFLRHKWQLGMARKDEINRLLVFASEEAARVEL---------------  57

Query  557  gsVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQ  736
                               ++   +P    L + CA CFS  +TRC+RCKAVRYCSG+CQ
Sbjct  58   ------------------QASFGHIPAPISLNHHCALCFSPTTTRCARCKAVRYCSGRCQ  99

Query  737  IIHWRLGHKDECHPP  781
            IIHWR GHK+ECHPP
Sbjct  100  IIHWRQGHKNECHPP  114



>ref|XP_010942663.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Elaeis 
guineensis]
Length=1046

 Score =   528 bits (1359),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 244/348 (70%), Positives = 280/348 (80%), Gaps = 0/348 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+LF++L+N  KVELRP GLTNCGNSCYAN VLQCLAFT P TAY L+G HSK C K
Sbjct  488   LFPYDLFIRLYNCDKVELRPCGLTNCGNSCYANVVLQCLAFTRPLTAYLLEGLHSKTCPK  547

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              +WCF CE E L+L AK G SPLSP  I+SHL NIGSS G+GREEDAHEFLRY IE MQS
Sbjct  548   TEWCFTCELERLLLMAKQGKSPLSPSVILSHLSNIGSSFGHGREEDAHEFLRYAIEAMQS  607

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
              CLKEAG   +  L E+T+LI L FGG+LRSKI CMRC GKSER ER+MDLTVEI+GDI 
Sbjct  608   ACLKEAGKNVTGRLVEETTLIQLIFGGYLRSKIRCMRCQGKSERCERMMDLTVEINGDIG  667

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             +LE AL +FT TEILDGEN Y C RCKSYE+A+KKL ILEAPN+LTIALKRFQSGKFGKL
Sbjct  668   TLEEALSRFTATEILDGENMYQCDRCKSYERAKKKLTILEAPNILTIALKRFQSGKFGKL  727

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             NK+I FPE L+LA YMSGT DK  +Y+LY V+ H D+MNA+FSGHYVCYVK+ Q KW+K 
Sbjct  728   NKSIRFPEYLDLARYMSGTDDKFAVYRLYAVVVHLDIMNASFSGHYVCYVKDTQGKWYKT  787

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYV  3112
             +DS VK V++E VLSKGAYMLLY+RCSPRAP  IR    H+   +K +
Sbjct  788   DDSMVKSVDLERVLSKGAYMLLYARCSPRAPSSIRKAMYHEQLQRKKI  835


 Score = 89.0 bits (219),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 63/117 (54%), Gaps = 1/117 (1%)
 Frame = +2

Query  659   CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVFR  838
             CA CFS  +TRCSRCKAVRYCSGKCQIIHWR GHK+EC PP   +    G   +D K   
Sbjct  79    CAVCFSPTTTRCSRCKAVRYCSGKCQIIHWRQGHKEECRPPCVEDKYDGGTNISDLKGVP  138

Query  839   QEANEGYAEGIETEERNTPGSIDASFAEPTCSEPSISGAENTEDVMEGKHFTDDGTT  1009
              + +       E EE+    +++ S   P+ SE + S    TED  E     D   T
Sbjct  139   AKQSIVSGNSSEFEEQPHAKAVETSPKRPS-SESNCSSNILTEDKPEDNPSMDASET  194



>ref|XP_010939750.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Elaeis guineensis]
Length=1046

 Score =   525 bits (1351),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 247/367 (67%), Positives = 290/367 (79%), Gaps = 0/367 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+LF+KL+N  KVELRP GLTNCGNSCYANAVLQCLAFT P TAY L+G HSK C+K
Sbjct  496   LFPYDLFIKLYNCDKVELRPCGLTNCGNSCYANAVLQCLAFTRPLTAYLLEGLHSKTCSK  555

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              + CF CE E L++ AK G SPLSP  I+SHL NIGSS G+GREEDAHEFLRY IE MQS
Sbjct  556   TEGCFTCELEKLLMMAKQGKSPLSPAGILSHLSNIGSSFGHGREEDAHEFLRYAIEAMQS  615

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
              C+KEAG   +  L E T+LI L FGG+LRSKI+CMRC GKSER ER+MDLTV I GDI 
Sbjct  616   ACIKEAGKNVTGRLVEDTTLIQLIFGGYLRSKIKCMRCQGKSERCERMMDLTVGIHGDIG  675

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             +LE AL +FT TEILDGENKY C RCKSYE+A+KKL ILEAPN+LTIA KRFQS KFGKL
Sbjct  676   TLEDALSRFTSTEILDGENKYQCDRCKSYERAKKKLTILEAPNILTIAFKRFQSDKFGKL  735

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             NK+I FPE L+LA YMSGT DK P+Y+LY V+ H D+MNA+FSGHYVCYVK+ Q KW+K+
Sbjct  736   NKSIRFPEYLDLARYMSGTDDKFPVYRLYAVVVHLDIMNASFSGHYVCYVKDTQGKWYKI  795

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSSSHTNSWD  3148
             +DS VKPVE+E VLSKGAYMLLY+RCSPRAP  +R  +S++    K +  K +   +S  
Sbjct  796   DDSMVKPVELERVLSKGAYMLLYARCSPRAPSSVRKASSYEQVQIKKIGGKEAKAKSSSM  855

Query  3149  LSKGDST  3169
              S+  S+
Sbjct  856   FSQHGSS  862


 Score =   115 bits (288),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 111/211 (53%), Gaps = 32/211 (15%)
 Frame = +2

Query  377  AAFLVF--IGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssy  550
            AA ++F  +GPLL  +  Q+WR A ARREE+ RL++LA+EEA R                
Sbjct  12   AALVLFLVVGPLLALVAGQRWRLAAARREEVRRLVLLAAEEAER----------------  55

Query  551  sfgsVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGK  730
                    E   A  A    S+T+ +   AR  P +CA CFS   TRCSRCKAVRYCSGK
Sbjct  56   --------EEVDAALAYVVESATVAATEGARGRP-ECAVCFSPTRTRCSRCKAVRYCSGK  106

Query  731  CQIIHWRLGHKDECHPPVNNNHDSYGKGAN--DFKVFRQEANEGYAEGIETEERNTPGSI  904
            CQIIHWR GHK+ECHPP  +  D Y    N  D K    E +      +E EE+    ++
Sbjct  107  CQIIHWRQGHKEECHPP--HVDDKYNDQTNILDLKGVLGEQSNVSDISLEFEEQPYDKAV  164

Query  905  DASFAEPTCSEPSISGAENTEDVMEGKHFTD  997
            +A + E + SE + S    TED  E K   D
Sbjct  165  EA-YLERSSSESNCSTNIITEDKPEDKLAMD  194



>ref|XP_010646974.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Vitis 
vinifera]
Length=857

 Score =   519 bits (1336),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 241/369 (65%), Positives = 294/369 (80%), Gaps = 4/369 (1%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
               +ASK S+   LG  + I G+YN+K LFPYELF++L++ +KVEL PFGL NCGNSCYAN
Sbjct  349   HFRASKQSKPQLLGIGNGIAGKYNHKMLFPYELFMELYSWEKVELSPFGLMNCGNSCYAN  408

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCL FT P  +Y LQG HSK C K+DWCF CEFE L+L+A+ G SPLSP+ I+S ++
Sbjct  409   AVLQCLTFTRPLASYLLQGLHSKACPKEDWCFICEFECLILEAREGKSPLSPMGILSQIQ  468

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG+GREEDAHEFLRY ++TMQSVCLK+ GV     L E T+L+GLTFGG+L SKI
Sbjct  469   RIGSHLGHGREEDAHEFLRYAVDTMQSVCLKDTGVVGP--LAEDTTLVGLTFGGYLLSKI  526

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+C GKSER ER+MDLTVEIDGDI +LE AL QFT TEILDGENKY C RC+SYEKA+
Sbjct  527   KCMKCRGKSERCERMMDLTVEIDGDIGTLEEALAQFTATEILDGENKYQCGRCRSYEKAK  586

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL +LEAPN+LTI LKRFQS  FGKLNK++ FPE LN+  YMSGT D+ P+Y LY V+ 
Sbjct  587   KKLMVLEAPNILTIVLKRFQSSNFGKLNKSVRFPETLNMTPYMSGTDDRYPVYSLYAVVV  646

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H D+MNAAFSGHYVC+VKNF   WF+++DS V PVE++ VL +GAYMLLY+R SP+ P L
Sbjct  647   HLDIMNAAFSGHYVCFVKNFLGDWFRIDDSTVTPVELDRVLLEGAYMLLYARRSPKPPAL  706

Query  3068  IRSL-TSHD  3091
              R++  SH+
Sbjct  707   SRNMAVSHE  715


 Score = 98.6 bits (244),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 75/146 (51%), Gaps = 36/146 (25%)
 Frame = +2

Query  380  AFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            + +VF+   +G ++RQKWR+A  R+EEI RL+                            
Sbjct  11   SLVVFV---VGVILRQKWRNAAERKEEIMRLVA---------------------------  40

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                     A       +   +S+PVAR+  YQCA C+  A+TRCS+CKAVRYCSGKCQI
Sbjct  41   ----MASEEAAAVELEAAVEYSSIPVARR--YQCAACYGPATTRCSQCKAVRYCSGKCQI  94

Query  740  IHWRLGHKDECHPPVNNNHDSYGKGA  817
             HWR GHK+EC PP   +   +  G+
Sbjct  95   KHWRQGHKNECVPPTPTSAMQFNDGS  120



>ref|XP_003635052.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Vitis 
vinifera]
Length=942

 Score =   521 bits (1342),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 243/369 (66%), Positives = 294/369 (80%), Gaps = 4/369 (1%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
               +ASK S+   LG  S I G+YN+K LFPYELF++L++ +KVEL PFGL NCGNSCYAN
Sbjct  350   HFRASKQSKPQLLGIGSGIAGKYNHKMLFPYELFMELYSWEKVELSPFGLMNCGNSCYAN  409

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCL FT P  +Y LQG HSK C K+DWCF CEFE L+L+A+ G SPLSP+ I+S ++
Sbjct  410   AVLQCLTFTRPLASYLLQGLHSKACPKEDWCFICEFECLILEAREGKSPLSPMGILSQIQ  469

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG+GREEDAHEFLRY ++TMQSVCLK+ GV     L E T+L+GLTFGG+L SKI
Sbjct  470   RIGSHLGHGREEDAHEFLRYAVDTMQSVCLKDTGVVGP--LAEDTTLVGLTFGGYLLSKI  527

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+C GKSER ER+MDLTVEIDGDI +LE AL QFT TEILDGENKY C RC+SYEKA+
Sbjct  528   KCMKCQGKSERCERMMDLTVEIDGDIGTLEEALAQFTATEILDGENKYQCGRCRSYEKAK  587

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL +LEAPN+LTI LKRFQS  FGKLNK++ FPE LNL  YMSGT D+ P+Y LY V+ 
Sbjct  588   KKLMVLEAPNILTIVLKRFQSSNFGKLNKSVRFPETLNLTPYMSGTDDRYPVYSLYAVVV  647

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H D+MNAAFSGHYVC+VKNF   WF+++DS V PVE++ VL +GAYMLLY+R SP+ P L
Sbjct  648   HLDIMNAAFSGHYVCFVKNFLGDWFRIDDSTVTPVELDRVLLEGAYMLLYARRSPKPPAL  707

Query  3068  IRSL-TSHD  3091
              R++  SH+
Sbjct  708   SRNMAVSHE  716


 Score = 99.0 bits (245),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 75/146 (51%), Gaps = 36/146 (25%)
 Frame = +2

Query  380  AFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            + +VF+   +G ++RQKWR+A  R+EEI RL+                            
Sbjct  11   SLVVFV---VGVILRQKWRNAAERKEEIMRLVA---------------------------  40

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                     A       +   +S+PVAR+  YQCA C+  A+TRCS+CKAVRYCSGKCQI
Sbjct  41   ----MASEEAAAVELEAAVEYSSIPVARR--YQCAACYGPATTRCSQCKAVRYCSGKCQI  94

Query  740  IHWRLGHKDECHPPVNNNHDSYGKGA  817
             HWR GHK+EC PP   +   +  G+
Sbjct  95   KHWRQGHKNECVPPTPTSAMQFNDGS  120



>ref|XP_004148434.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Cucumis 
sativus]
 gb|KGN62759.1| hypothetical protein Csa_2G370590 [Cucumis sativus]
Length=1113

 Score =   526 bits (1356),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 248/371 (67%), Positives = 293/371 (79%), Gaps = 0/371 (0%)
 Frame = +2

Query  1991  QLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANA  2170
             +LK SKS    +       G+ NNK    YELFV L+N  KVEL+P GL NCGNSCYAN 
Sbjct  550   ELKRSKSHRGYVANGGGNAGKCNNKEDSLYELFVNLYNWNKVELQPSGLVNCGNSCYANV  609

Query  2171  VLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLEN  2350
             VLQCL FTPP TAYFLQG HSK CAK+ WCF CEFESL+L+AK G SPLSP RIIS L  
Sbjct  610   VLQCLTFTPPLTAYFLQGLHSKACAKERWCFTCEFESLILEAKEGKSPLSPFRIISQLRK  669

Query  2351  IGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIE  2530
             IGS L NG+EEDAHEFLR  I+TMQS+C  EA    S  +EE+T+LIGLTFGG+L SKI+
Sbjct  670   IGSQLVNGKEEDAHEFLRCAIDTMQSICFMEAQASRSGPVEEETTLIGLTFGGYLLSKIK  729

Query  2531  CMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARK  2710
             C RC  KSER ERI+DLTVEI GDI ++E AL+Q+T  EILDG+N+YHC+RC SY KARK
Sbjct  730   CTRCENKSERIERILDLTVEISGDIETIEEALQQYTSPEILDGDNRYHCTRCNSYVKARK  789

Query  2711  KLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEH  2890
             +L ILEAPN+LTIALKRFQSGKFGKLNK + F EIL+LA YMS  SDKSP+Y+LYGVI H
Sbjct  790   RLSILEAPNILTIALKRFQSGKFGKLNKPVIFSEILDLAPYMSSRSDKSPVYRLYGVIVH  849

Query  2891  EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
              DVMNAAFSGHYVCY++N QNKWFKV+DS V  +++++VL++GAYML Y+RCSPRAP+LI
Sbjct  850   LDVMNAAFSGHYVCYIRNNQNKWFKVDDSTVTAMDVKNVLTRGAYMLFYARCSPRAPRLI  909

Query  3071  RSLTSHDPRGQ  3103
             R+  + D R +
Sbjct  910   RNKITTDSRNR  920


 Score =   100 bits (249),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 72/132 (55%), Gaps = 35/132 (27%)
 Frame = +2

Query  386  LVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsV  565
            LVF  P++G  +R KW+   AR+EEI+RLL+ ASEEAAR E                   
Sbjct  18   LVF--PIIGLFLRHKWQLGMARKEEINRLLMFASEEAARVEL------------------  57

Query  566  VGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIH  745
                            ++   +P    L + CA C S  +TRC+RCKAVRYCSG+CQIIH
Sbjct  58   ---------------QASFGCIPAPISLNHHCALCLSPTTTRCARCKAVRYCSGRCQIIH  102

Query  746  WRLGHKDECHPP  781
            WR GHK+EC PP
Sbjct  103  WRQGHKNECQPP  114



>ref|XP_004163959.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
16-like, partial [Cucumis sativus]
Length=1115

 Score =   526 bits (1356),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 248/371 (67%), Positives = 293/371 (79%), Gaps = 0/371 (0%)
 Frame = +2

Query  1991  QLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANA  2170
             +LK SKS    +       G+ NNK    YELFV L+N  KVEL+P GL NCGNSCYAN 
Sbjct  552   ELKRSKSHRGYVANGGGNAGKCNNKEDSLYELFVNLYNWNKVELQPSGLVNCGNSCYANV  611

Query  2171  VLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLEN  2350
             VLQCL FTPP TAYFLQG HSK CAK+ WCF CEFESL+L+AK G SPLSP RIIS L  
Sbjct  612   VLQCLTFTPPLTAYFLQGLHSKACAKERWCFTCEFESLILEAKEGKSPLSPFRIISQLRK  671

Query  2351  IGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIE  2530
             IGS L NG+EEDAHEFLR  I+TMQS+C  EA    S  +EE+T+LIGLTFGG+L SKI+
Sbjct  672   IGSQLVNGKEEDAHEFLRCAIDTMQSICFMEAQASRSGPVEEETTLIGLTFGGYLLSKIK  731

Query  2531  CMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARK  2710
             C RC  KSER ERI+DLTVEI GDI ++E AL+Q+T  EILDG+N+YHC+RC SY KARK
Sbjct  732   CTRCENKSERIERILDLTVEISGDIETIEEALQQYTSPEILDGDNRYHCTRCNSYVKARK  791

Query  2711  KLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEH  2890
             +L ILEAPN+LTIALKRFQSGKFGKLNK + F EIL+LA YMS  SDKSP+Y+LYGVI H
Sbjct  792   RLSILEAPNILTIALKRFQSGKFGKLNKPVIFSEILDLAPYMSSRSDKSPVYRLYGVIVH  851

Query  2891  EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
              DVMNAAFSGHYVCY++N QNKWFKV+DS V  +++++VL++GAYML Y+RCSPRAP+LI
Sbjct  852   LDVMNAAFSGHYVCYIRNNQNKWFKVDDSTVTAMDVKNVLTRGAYMLFYARCSPRAPRLI  911

Query  3071  RSLTSHDPRGQ  3103
             R+  + D R +
Sbjct  912   RNKITTDSRNR  922


 Score = 99.0 bits (245),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 71/132 (54%), Gaps = 33/132 (25%)
 Frame = +2

Query  386  LVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsV  565
            +  + P++G  +R KW+   AR+EEI+RLL+ ASEEAAR E                   
Sbjct  18   VCLVXPIIGSFLRHKWQLGMARKEEINRLLMFASEEAARVEL------------------  59

Query  566  VGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIH  745
                            ++   +P    L + CA C S  +TRC+RCKAVRYCSG+CQIIH
Sbjct  60   ---------------QASFGCIPAPISLNHHCALCLSPTTTRCARCKAVRYCSGRCQIIH  104

Query  746  WRLGHKDECHPP  781
            WR GHK+EC PP
Sbjct  105  WRQGHKNECQPP  116



>ref|XP_006841208.1| hypothetical protein AMTR_s00135p00021060 [Amborella trichopoda]
 gb|ERN02883.1| hypothetical protein AMTR_s00135p00021060 [Amborella trichopoda]
Length=1083

 Score =   520 bits (1339),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 271/455 (60%), Positives = 335/455 (74%), Gaps = 19/455 (4%)
 Frame = +2

Query  1715  DTLKVNSPPKASDKSIEGLKNVSQTPKARQVESLSTKAPNGHPSSNNRRHDSQGAKSAKI  1894
             D++KV S PK S+   EG     + PK R     S+    GH S      D +G+ S+K 
Sbjct  408   DSVKVFSLPKESND--EG-----RVPKFRWQRFTSS----GHSSYG----DGRGSASSKA  452

Query  1895  DSAQV--TACssdsggdsqssksglkssvskvvdQLKASK-SRHNSLGAWSEIGGRYNNK  2065
             +  +V  T  S  +   S     GL++SV KVV Q + SK S+HN +   +E+  R  +K
Sbjct  453   NYTEVLSTGSSQAASPVSNGISGGLRTSVRKVVQQFRVSKLSKHNPMFLANEVA-RKPSK  511

Query  2066  GLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCA  2245
              LFPY++F KL+N ++VEL P GLTNCGNSCYANAVLQCL FT P TAY LQG HS+ C 
Sbjct  512   MLFPYDMFAKLYNWERVELWPCGLTNCGNSCYANAVLQCLTFTRPLTAYLLQGLHSRTCQ  571

Query  2246  KKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQ  2425
             KKDWCF CEFE LVL A+ G S +SPI+I+S ++NIGS+LG GREEDAHEFLRY I+ MQ
Sbjct  572   KKDWCFTCEFEGLVLSAREGKSSVSPIKILSQIQNIGSNLGYGREEDAHEFLRYAIDKMQ  631

Query  2426  SVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             SVCL+EAG      L E+T+LI LTFGG+L S I+C+RC  KSERHER+MDLTVEI GDI
Sbjct  632   SVCLEEAGKNAMGPLMEETTLIQLTFGGYLHSDIKCLRCQAKSERHERMMDLTVEIQGDI  691

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              +LE AL QFT  EIL+G+NKY C RCKSY KARK+L + EAPN+LTI LKRFQSGKFGK
Sbjct  692   GTLEEALTQFTTPEILEGDNKYKCDRCKSYAKARKRLTVYEAPNILTIVLKRFQSGKFGK  751

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK++ FPE L+L+ YM+G SDKSP+Y+LY V+ H D+MNA+FSGHYVCYV++ Q KW+K
Sbjct  752   LNKSVRFPETLDLSPYMTGESDKSPLYKLYAVVVHLDIMNASFSGHYVCYVRSLQGKWYK  811

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             ++DSKVKPV+++ VLSKGAYMLLYSR SPR P LI
Sbjct  812   IDDSKVKPVDLDRVLSKGAYMLLYSRFSPRLPSLI  846


 Score = 94.0 bits (232),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 76/123 (62%), Gaps = 33/123 (27%)
 Frame = +2

Query  413  FLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaav  592
            F++RQKWR + AR+EEI +L+VLA+EEAARAE EA+ EY                     
Sbjct  21   FVIRQKWRTSVARKEEIRKLVVLAAEEAARAELEASVEYN--------------------  60

Query  593  papapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
                      + V V RQ   +CA CFS  +TRCSRCKAV+YCSGKCQIIHWR GHK+ C
Sbjct  61   ----------SVVSVCRQ---RCAVCFSPTTTRCSRCKAVKYCSGKCQIIHWRQGHKEGC  107

Query  773  HPP  781
            HPP
Sbjct  108  HPP  110



>ref|XP_006466293.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X1 [Citrus sinensis]
Length=904

 Score =   514 bits (1324),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 249/422 (59%), Positives = 310/422 (73%), Gaps = 9/422 (2%)
 Frame = +2

Query  1991  QLKASKS-RHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q + SK  +  SLG+  E+ G+ N K LFPY+LF+KL++  KVEL PFGL NCGNSCYAN
Sbjct  336   QFRVSKPLKSYSLGSEDEVVGKSNEKPLFPYDLFMKLYSYDKVELYPFGLINCGNSCYAN  395

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFT P T+Y +QG HSK C KK WCF CEFE L+L AK+G+ P+SPI I+S ++
Sbjct  396   AVLQCLAFTRPLTSYLVQGLHSKACQKKGWCFICEFECLILNAKDGSYPVSPIGILSKIQ  455

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG+GREEDAHEFLR  ++TMQSVCLKE G +    + E+T+LIGLTFGG+LRSKI
Sbjct  456   KIGSHLGHGREEDAHEFLRCAVDTMQSVCLKEFGAKGK--IAEETTLIGLTFGGYLRSKI  513

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +C++C GKSE +ER+MDLTVEIDGDI +LE AL QFT +EIL GENKY+CSRCKSYEKA+
Sbjct  514   KCLKCLGKSELYERMMDLTVEIDGDIGTLEEALAQFTASEILVGENKYYCSRCKSYEKAK  573

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL +LE PN+LTI LKRF+SG FGKLNK++ FPE+LN+A YMS T D SP+Y LY V+ 
Sbjct  574   KKLTVLEEPNILTIVLKRFESGNFGKLNKSVWFPEVLNMAPYMSRTGDGSPMYSLYAVVV  633

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DV NA FSGHYVCYVKN   +WF+++DS V PV++E VLS+ AYMLLY+R SPR P L
Sbjct  634   HLDVTNATFSGHYVCYVKNSHEEWFRIDDSTVIPVKLERVLSEEAYMLLYARHSPRPPAL  693

Query  3068  IRSLTSHDPRGQKY------VNCKSSSHTNSWDLSKGDSTNDPACRECFNSVQASSWPHR  3229
             IR+  SH  + +K       +N  S   +NS+  S         C +         W  R
Sbjct  694   IRNNVSHGVKSKKKSLEAVGLNNTSKIRSNSYIPSLDSKAQQKPCTDSNQLFDRDEWKFR  753

Query  3230  TI  3235
             ++
Sbjct  754   SM  755


 Score = 92.0 bits (227),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 61/121 (50%), Gaps = 31/121 (26%)
 Frame = +2

Query  416  LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaavp  595
            L+RQK ++A AR+EE+ +L+                             V  +E      
Sbjct  23   LIRQKCKNAVARKEEVTKLMA----------------------------VAAEESLMEEF  54

Query  596  apapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
              A   S L S P      YQCA CF S +TRCSRCKAVRYCSGKCQI HWR GHKDEC 
Sbjct  55   QAANQHSFLPSSPPRL---YQCAVCFRSTTTRCSRCKAVRYCSGKCQIFHWRQGHKDECR  111

Query  776  P  778
            P
Sbjct  112  P  112



>ref|XP_008359211.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Malus 
domestica]
Length=839

 Score =   511 bits (1317),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 238/362 (66%), Positives = 288/362 (80%), Gaps = 4/362 (1%)
 Frame = +2

Query  1991  QLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANA  2170
             Q ++SK    +  +  +  G+Y  K LFPY+LFVKL+++   +L PFGL NCGNSCYANA
Sbjct  326   QFRSSKQLKCNPSSHGDETGKY--KVLFPYDLFVKLYSNNSADLYPFGLMNCGNSCYANA  383

Query  2171  VLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLEN  2350
             VLQCLAFT P  +Y LQG HS+ C KKDWCF CEFE L+LKA+ G S LSPIRI+S +  
Sbjct  384   VLQCLAFTRPLVSYLLQGLHSRACRKKDWCFICEFEVLLLKAREGKSLLSPIRILSKIHK  443

Query  2351  IGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIE  2530
             IG  LG GREEDAHEFLRY ++TMQSVCLKEAG      L E+T+L+G+TFGG+LRSKI+
Sbjct  444   IGIHLGQGREEDAHEFLRYAVDTMQSVCLKEAGAVGP--LAEETTLVGMTFGGYLRSKIK  501

Query  2531  CMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARK  2710
             CM+C GKSE+ ER+MDLTVEIDG I +LE AL QFT TE LDG N+YHCSRCKSYEKARK
Sbjct  502   CMKCLGKSEQIERMMDLTVEIDGQIGTLEEALAQFTATETLDGNNRYHCSRCKSYEKARK  561

Query  2711  KLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEH  2890
             KL +LEAPN+LTI LKRFQS  F KLNK+I FPE+LN++ YM  TSDKSP+Y LY V+ H
Sbjct  562   KLTVLEAPNILTIVLKRFQSRNFEKLNKSIRFPEVLNMSPYMGETSDKSPLYSLYAVVVH  621

Query  2891  EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
              D+MNAA+SGHYVCYVKN Q +WFK++DS V+PVE++ VLS+GAYMLLY+RC+PR P L+
Sbjct  622   LDIMNAAYSGHYVCYVKNNQGEWFKIDDSSVEPVELKRVLSQGAYMLLYARCTPRPPALL  681

Query  3071  RS  3076
              S
Sbjct  682   GS  683


 Score = 91.3 bits (225),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 35/128 (27%)
 Frame = +2

Query  413  FLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaav  592
            F++  KW++A A++EEI RL+ +ASEE A AEF                           
Sbjct  22   FVICHKWKNAAAKKEEILRLVAMASEETAVAEF---------------------------  54

Query  593  papapvSSTLTSVPVAR--QLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKD  766
                   +T    PV +    PY CA C++S + RCS+CKAVRYCSGKCQIIHWR GHKD
Sbjct  55   ------QATAFFAPVVQPASWPYHCAVCYASTTMRCSKCKAVRYCSGKCQIIHWRQGHKD  108

Query  767  ECHPPVNN  790
            EC P +++
Sbjct  109  ECQPSIDS  116



>ref|XP_008385675.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Malus domestica]
Length=839

 Score =   511 bits (1317),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 238/362 (66%), Positives = 288/362 (80%), Gaps = 4/362 (1%)
 Frame = +2

Query  1991  QLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANA  2170
             Q ++SK    +  +  +  G+Y  K LFPY+LFVKL+++   +L PFGL NCGNSCYANA
Sbjct  326   QFRSSKQLKCNPSSHGDETGKY--KVLFPYDLFVKLYSNNSADLYPFGLMNCGNSCYANA  383

Query  2171  VLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLEN  2350
             VLQCLAFT P  +Y LQG HS+ C KKDWCF CEFE L+LKA+ G S LSPIRI+S +  
Sbjct  384   VLQCLAFTRPLVSYLLQGLHSRACRKKDWCFICEFEVLLLKAREGKSLLSPIRILSKIHK  443

Query  2351  IGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIE  2530
             IG  LG GREEDAHEFLRY ++TMQSVCLKEAG      L E+T+L+G+TFGG+LRSKI+
Sbjct  444   IGIHLGQGREEDAHEFLRYAVDTMQSVCLKEAGAVGP--LAEETTLVGMTFGGYLRSKIK  501

Query  2531  CMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARK  2710
             CM+C GKSE+ ER+MDLTVEIDG I +LE AL QFT TE LDG N+YHCSRCKSYEKARK
Sbjct  502   CMKCLGKSEQIERMMDLTVEIDGQIGTLEEALAQFTATETLDGNNRYHCSRCKSYEKARK  561

Query  2711  KLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEH  2890
             KL +LEAPN+LTI LKRFQS  F KLNK+I FPE+LN++ YM  TSDKSP+Y LY V+ H
Sbjct  562   KLTVLEAPNILTIVLKRFQSRNFEKLNKSIRFPEVLNMSPYMGETSDKSPLYSLYAVVVH  621

Query  2891  EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
              D+MNAA+SGHYVCYVKN Q +WFK++DS V+PVE++ VLS+GAYMLLY+RC+PR P L+
Sbjct  622   LDIMNAAYSGHYVCYVKNNQGEWFKIDDSSVEPVELKRVLSQGAYMLLYARCTPRPPALL  681

Query  3071  RS  3076
              S
Sbjct  682   GS  683


 Score = 91.3 bits (225),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 35/128 (27%)
 Frame = +2

Query  413  FLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaav  592
            F++  KW++A A++EEI RL+ +ASEE A AEF                           
Sbjct  22   FVICHKWKNAAAKKEEILRLVAMASEETAVAEF---------------------------  54

Query  593  papapvSSTLTSVPVAR--QLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKD  766
                   +T    PV +    PY CA C++S + RCS+CKAVRYCSGKCQIIHWR GHKD
Sbjct  55   ------QATAFFAPVVQPASWPYHCAVCYASTTMRCSKCKAVRYCSGKCQIIHWRQGHKD  108

Query  767  ECHPPVNN  790
            EC P +++
Sbjct  109  ECQPSIDS  116



>ref|XP_009387155.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Musa 
acuminata subsp. malaccensis]
Length=1015

 Score =   517 bits (1331),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 239/344 (69%), Positives = 282/344 (82%), Gaps = 1/344 (0%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPY+ FVKL+N  KV LRP GL NC NSCYANAVLQCLAFTPP TAY LQG HSK C
Sbjct  460   KMLFPYDYFVKLYNFDKVVLRPSGLINCHNSCYANAVLQCLAFTPPLTAYLLQGLHSKTC  519

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
              K++WCF CE E+L++KAK G SPLSP  I+SH+  IGS LG+GREEDAHEFLRY I+ M
Sbjct  520   PKREWCFTCELENLLMKAKLGESPLSPAGILSHMHEIGSHLGHGREEDAHEFLRYAIDAM  579

Query  2423  QSVCLKEAGVR-TSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QSVCLKEAG         E+T+LI LTFGG+L+SKI+CM+C  +SER+ER+MDLTVEI+G
Sbjct  580   QSVCLKEAGAHAVDHYWAEETTLIQLTFGGYLQSKIKCMKCHSRSERYERLMDLTVEIEG  639

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
              + +LE ALR+FT TEILDGENKYHC RCKSYE+A+KKL I++APN+LTIALKRFQSGKF
Sbjct  640   HVGTLEEALRRFTTTEILDGENKYHCLRCKSYERAKKKLTIVDAPNILTIALKRFQSGKF  699

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GKLNK + FPE L+LA YM G++DKSP+Y+LY V+ H DVMNA+FSGHYVCYVKN Q KW
Sbjct  700   GKLNKAVCFPEYLDLAPYMHGSNDKSPMYKLYAVVVHLDVMNASFSGHYVCYVKNRQGKW  759

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHD  3091
             +K +DS VKPV++E+VLSK AYMLLY+RCSP  P LI S  S D
Sbjct  760   YKTDDSTVKPVDLETVLSKNAYMLLYARCSPHPPSLISSTLSPD  803


 Score = 70.9 bits (172),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNH  796
            CA C S  +TRCSRCKAVRYCS  CQIIHWR GHK+ C  P  ++H
Sbjct  74   CAVCRSPTTTRCSRCKAVRYCSRTCQIIHWRQGHKNVCCSPSVDDH  119



>ref|XP_009381476.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Musa 
acuminata subsp. malaccensis]
Length=1020

 Score =   515 bits (1327),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 240/341 (70%), Positives = 278/341 (82%), Gaps = 1/341 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ F+KL+NS K+ELRP GL NCGNSCYANAVLQCLAFT P TAYFL+G HSK C K
Sbjct  465   LFPYDRFIKLYNSDKIELRPCGLINCGNSCYANAVLQCLAFTRPLTAYFLEGLHSKICPK  524

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             K+WCF CE E L +KAK GNSPLSPI I+SHL NIGS+ G+G+EEDAHEFLRY I+ MQS
Sbjct  525   KEWCFTCELERLAMKAKEGNSPLSPIGILSHLHNIGSNFGHGQEEDAHEFLRYAIDAMQS  584

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VCL EAG +    L E+T+LI  TFGG+LRSKI C RC  KSER ER+MDLTVEIDG+I+
Sbjct  585   VCLMEAGKKPDGPLAEETTLIQQTFGGYLRSKIRCSRCKSKSERCERMMDLTVEIDGNIS  644

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             +L+ AL +FT  EILDGENKY C RCKSYE+A+K+L ILEAPNVLTI LKRFQSG FGKL
Sbjct  645   TLDEALLRFTSPEILDGENKYECGRCKSYERAKKRLTILEAPNVLTIVLKRFQSGMFGKL  704

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             NK + F E L+LA YMSG  DKSP+Y+LY  I H DV NA+FSGHYVCYVK+ Q KW+K+
Sbjct  705   NKPVRFHEYLDLAPYMSG-DDKSPVYRLYAAIVHIDVKNASFSGHYVCYVKDTQGKWYKI  763

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHD  3091
             NDSKV PVE+E VLSKGAYMLLY+RCSPRAP  +R   +H+
Sbjct  764   NDSKVNPVELEEVLSKGAYMLLYARCSPRAPTSVRKALAHE  804


 Score = 87.4 bits (215),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +2

Query  656  QCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP-VNNNHD  799
            +C  C S A+ RC+RCKAVRYCSGKCQIIHWR GHKDECHPP V+++H+
Sbjct  87   ECPVCLSPATARCARCKAVRYCSGKCQIIHWRQGHKDECHPPQVSDDHN  135



>ref|XP_009410122.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Musa 
acuminata subsp. malaccensis]
Length=1050

 Score =   516 bits (1328),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 239/347 (69%), Positives = 281/347 (81%), Gaps = 2/347 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ F+KL+NS K+ELRP GL NCGNSCYAN VLQCL FT P TAY L+G HS+ C K
Sbjct  495   LFPYDRFIKLYNSDKIELRPCGLINCGNSCYANVVLQCLTFTRPLTAYLLEGLHSRICPK  554

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             K+WCF CEFESLV+  KNG SPLSPI I+SHL NIGS+ G+G+EEDAHEFLRY I+ MQS
Sbjct  555   KEWCFTCEFESLVMLVKNGRSPLSPIGILSHLHNIGSNFGHGQEEDAHEFLRYAIDCMQS  614

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
              CLKEA  +    L ++T+LI   FGG+LRSKI C RC GKSER ER+MD+TVEIDG+IA
Sbjct  615   ACLKEARKKPDGLLADETTLIQQIFGGYLRSKIRCSRCKGKSERCERMMDVTVEIDGNIA  674

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             +L+ AL +FT  EILDGENKY C RCKSYE+A+K+L ILEAPNVLTI LKRFQSGKFGKL
Sbjct  675   TLDEALLRFTSIEILDGENKYECDRCKSYERAKKRLTILEAPNVLTIVLKRFQSGKFGKL  734

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             NK + FPE LNLA YMSG  DKSP+Y+LY VI H DVMNA+FSGHYVCYVK+ Q KW++ 
Sbjct  735   NKDVRFPEYLNLAPYMSG-DDKSPVYRLYAVIVHIDVMNASFSGHYVCYVKDTQGKWYET  793

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHD-PRGQK  3106
             NDS+VKP+E++ VLSKGAYMLLY+RCSPRAP  +R   + D P  +K
Sbjct  794   NDSEVKPMELDKVLSKGAYMLLYARCSPRAPSSVRKAMAQDLPHAKK  840


 Score = 90.9 bits (224),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 70/111 (63%), Gaps = 5/111 (5%)
 Frame = +2

Query  656  QCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVF  835
            +C  CFS A+ RC+RCKAVRYCSGKCQIIHWR GHKDECHPP  ++H  +G  +N   + 
Sbjct  100  ECPVCFSPATARCARCKAVRYCSGKCQIIHWRQGHKDECHPPPVSDH--HGGESNISGLE  157

Query  836  RQEAN-EGYAE-GIETEERNTPGSIDASFAEPTCSEPSISGAE-NTEDVME  979
             ++A+  G  +  +E +E  +  + +A    P  S+P+ S +  N ED  E
Sbjct  158  GEQADCSGLPKRDLEHKEELSTKAAEAFSKRPAASDPTFSSSGFNREDKHE  208



>ref|XP_010525656.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Tarenaya 
hassleriana]
Length=1043

 Score =   515 bits (1327),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 239/351 (68%), Positives = 285/351 (81%), Gaps = 3/351 (1%)
 Frame = +2

Query  2024  LGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPF  2203
             L A +EI  +  +KGLFPYE FVKL+N  K+ELR  GL NCGNSC+AN V QCL FTPP 
Sbjct  538   LLARNEITRKRTHKGLFPYEFFVKLYNWNKLELRACGLVNCGNSCFANVVFQCLMFTPPL  597

Query  2204  TAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREE  2383
             TAYFLQG HSK C  ++ CF C FE+LVL AK G  PL P  +++ L+NIG  LGNG+EE
Sbjct  598   TAYFLQGLHSKTCPDREQCFTCGFENLVLMAKEGKYPLYPSGVLAQLQNIGMCLGNGKEE  657

Query  2384  DAHEFLRYVIETMQSVCLKEAG--VRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSE  2557
             DAHEFLR+V++TMQS+C+KE+G  +  +  L+E T+LIGLTFGG+LRSKI+CM+C GKSE
Sbjct  658   DAHEFLRFVVDTMQSICIKESGYAMLETAKLDE-TTLIGLTFGGYLRSKIKCMKCQGKSE  716

Query  2558  RHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPN  2737
             RHER+MDLTVEIDGD+++L+ ALR+FT TEILDGENKY C RCKSYE+A+KKLKILE PN
Sbjct  717   RHERMMDLTVEIDGDVSTLDDALRRFTRTEILDGENKYKCGRCKSYERAKKKLKILEPPN  776

Query  2738  VLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFS  2917
             VLTIALKRFQSGKFGKLNK I FPE L+LA Y+S  SDKS +Y+LYGVI H D+MNAAFS
Sbjct  777   VLTIALKRFQSGKFGKLNKLIRFPETLDLAPYVSRRSDKSHVYKLYGVIVHLDIMNAAFS  836

Query  2918  GHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             GHYVCY+KN QNKW+K +DS V   EIE VL+KGAYML Y+RC PR P+ I
Sbjct  837   GHYVCYIKNSQNKWYKADDSTVVISEIERVLTKGAYMLFYARCYPRPPRSI  887


 Score = 89.7 bits (221),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVFR  838
            C  C+  A+TRC++CKAVRYCSGKCQIIHWR GHKDECHPP    +   G+  +  KV  
Sbjct  74   CPVCYVPATTRCAKCKAVRYCSGKCQIIHWRQGHKDECHPPPITCNTGNGRSDSGLKVI-  132

Query  839  QEANEGYAEGIETEERNT  892
            ++  E   E  ET  R T
Sbjct  133  EKNEETILESAETAIRET  150



>emb|CBI18698.3| unnamed protein product [Vitis vinifera]
Length=669

 Score =   503 bits (1294),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 236/361 (65%), Positives = 283/361 (78%), Gaps = 12/361 (3%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
               +ASK S+   LG  S I G+YN+K LFPYELF++L++ +KVEL PFGL NCGNSCYAN
Sbjct  311   HFRASKQSKPQLLGIGSGIAGKYNHKMLFPYELFMELYSWEKVELSPFGLMNCGNSCYAN  370

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCA---------KKDWCFNCEFESLVLKAKNGNSPLS  2320
             AVLQCL FT P  +Y LQG HSK C          K+DWCF CEFE L+L+A+ G SPLS
Sbjct  371   AVLQCLTFTRPLASYLLQGLHSKACKFLFMTPLCPKEDWCFICEFECLILEAREGKSPLS  430

Query  2321  PIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLT  2500
             P+ I+S ++ IGS LG+GREEDAHEFLRY ++TMQSVCLK+ GV     L E T+L+GLT
Sbjct  431   PMGILSQIQRIGSHLGHGREEDAHEFLRYAVDTMQSVCLKDTGVVGP--LAEDTTLVGLT  488

Query  2501  FGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCS  2680
             FGG+L SKI+CM+C GKSER ER+MDLTVEIDGDI +LE AL QFT TEILDGENKY C 
Sbjct  489   FGGYLLSKIKCMKCQGKSERCERMMDLTVEIDGDIGTLEEALAQFTATEILDGENKYQCG  548

Query  2681  RCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSP  2860
             RC+SYEKA+KKL +LEAPN+LTI LKRFQS  FGKLNK++ FPE LNL  YMSGT D+ P
Sbjct  549   RCRSYEKAKKKLMVLEAPNILTIVLKRFQSSNFGKLNKSVRFPETLNLTPYMSGTDDRYP  608

Query  2861  IYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYS  3040
             +Y LY V+ H D+MNAAFSGHYVC+VKNF   WF+++DS V PVE++ VL +GAYMLLY+
Sbjct  609   VYSLYAVVVHLDIMNAAFSGHYVCFVKNFLGDWFRIDDSTVTPVELDRVLLEGAYMLLYA  668

Query  3041  R  3043
             R
Sbjct  669   R  669


 Score = 98.2 bits (243),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 75/146 (51%), Gaps = 36/146 (25%)
 Frame = +2

Query  380  AFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            + +VF+   +G ++RQKWR+A  R+EEI RL                             
Sbjct  11   SLVVFV---VGVILRQKWRNAAERKEEIMRL-----------------------------  38

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
              V      A       +   +S+PVAR+  YQCA C+  A+TRCS+CKAVRYCSGKCQI
Sbjct  39   --VAMASEEAAAVELEAAVEYSSIPVARR--YQCAACYGPATTRCSQCKAVRYCSGKCQI  94

Query  740  IHWRLGHKDECHPPVNNNHDSYGKGA  817
             HWR GHK+EC PP   +   +  G+
Sbjct  95   KHWRQGHKNECVPPTPTSAMQFNDGS  120



>ref|XP_008235462.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Prunus mume]
Length=826

 Score =   506 bits (1304),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 283/572 (49%), Positives = 376/572 (66%), Gaps = 50/572 (9%)
 Frame = +2

Query  1499  DEQGPKAKPSDAAQLLQVKDNVD-------LKRSSLRPDSHNTIDLNKASV--------R  1633
             D+    + PS  A+L  +++++        +K S +  +  +T  + KA           
Sbjct  164   DQLENMSSPSGCAKLANIQEDISHANKLSKMKSSHIDKEVESTPKIPKAKKNISGDAQPE  223

Query  1634  STSSFKESRRSLST---ASDACKVEHLVNNDTLKVNSPPKASDKSIEGLKNVSQTPKARQ  1804
             +  S K +RR +S+    +DACK +   +NDT                        ++++
Sbjct  224   NIGSKKLTRRPISSEKKLTDACKSKSSSSNDT----------------------EDESKE  261

Query  1805  VESLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsgg---dsqssksglkssv  1975
              ESLS       PSS    H    ++  KI++      +   G      Q++++GLK+SV
Sbjct  262   EESLSHSVSIDRPSSTTGEHMYSSSRYEKIEAYHALPANEKVGSIPNLPQNARNGLKTSV  321

Query  1976  skvvdQLKASKSRHNSL-GAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGN  2152
              KVV Q K+SK   ++L G   EI G+Y  K +FPYELFVKL++   V+L PFGL NCGN
Sbjct  322   RKVVQQFKSSKQLKSNLSGHGEEIVGKY--KVIFPYELFVKLYSYNNVDLCPFGLMNCGN  379

Query  2153  SCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             SCYANAVLQCLAFT P  +Y LQG HS+ C K DWCF CEFE L++KA+ G S LSPIRI
Sbjct  380   SCYANAVLQCLAFTRPLASYLLQGLHSRACQKHDWCFICEFEILLMKAREGKSLLSPIRI  439

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGF  2512
             +S +  IGS LG+GREEDAHEF RY ++TMQSVCLKEAG      L E+T+L+G+TFGG+
Sbjct  440   LSKIHKIGSHLGHGREEDAHEFFRYAVDTMQSVCLKEAGAVG--PLAEETTLVGMTFGGY  497

Query  2513  LRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKS  2692
             L+SKI CM+C GKSER E++MDLTVEIDG+I +LE AL QFT TE LDG+N+YHCSRCKS
Sbjct  498   LQSKITCMKCLGKSERFEQMMDLTVEIDGEIGTLEEALAQFTATETLDGKNRYHCSRCKS  557

Query  2693  YEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQL  2872
             YEKA+KKL ++EAPN+LTI LKRFQS  F KLNK++ FPE+LN++ YM GTSD+S +Y L
Sbjct  558   YEKAKKKLTVMEAPNILTIVLKRFQSRNFEKLNKSVRFPEVLNMSPYMGGTSDRSVLYSL  617

Query  2873  YGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSP  3052
             Y V+ H D+MNAA+SGHYVCYVKN Q +WFK++DS V+PV+++ VLS+GAYMLLY+R +P
Sbjct  618   YAVVVHLDIMNAAYSGHYVCYVKNNQGEWFKIDDSSVEPVDLKRVLSQGAYMLLYARRTP  677

Query  3053  RAPKLIRSLTSHDPRGQKYVNCKS--SSHTNS  3142
             R P  + S    +    K  N ++  SSHT S
Sbjct  678   RPPAFLGSTAVSNGEKLKRRNLEAVPSSHTKS  709


 Score = 92.4 bits (228),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 68/125 (54%), Gaps = 35/125 (28%)
 Frame = +2

Query  419  VRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaavpa  598
            +R KW++A   +EEI RLL +ASEE A AEF                             
Sbjct  24   IRHKWKNAVINKEEIMRLLAMASEETAVAEF-----------------------------  54

Query  599  papvSSTLTSVPVAR--QLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
                 +T    PV +   LPY CA C++S + RCS+CKAVRYCSGKCQIIHWR GHKDEC
Sbjct  55   ----QATSPYAPVVQPVSLPYHCAVCYASTTMRCSKCKAVRYCSGKCQIIHWRQGHKDEC  110

Query  773  HPPVN  787
             P ++
Sbjct  111  QPSID  115



>ref|XP_008444940.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X2 [Cucumis melo]
Length=901

 Score =   508 bits (1309),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 237/351 (68%), Positives = 281/351 (80%), Gaps = 0/351 (0%)
 Frame = +2

Query  1991  QLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANA  2170
             +L+ SKS    +   +   G+ NNKG  PYELFV L+N  KVEL+P GL NCGNSCYAN 
Sbjct  551   ELRRSKSHRGYVANGAGNAGKCNNKGDSPYELFVNLYNWNKVELQPSGLVNCGNSCYANV  610

Query  2171  VLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLEN  2350
             VLQCL FTPP TAYFLQG HSK CAK+ WCF CEFESL+L+AK G SPLSP RIIS L  
Sbjct  611   VLQCLTFTPPLTAYFLQGLHSKACAKEKWCFTCEFESLILEAKEGKSPLSPFRIISQLRK  670

Query  2351  IGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIE  2530
             IGS L NG+EEDAHEFLR  I+TMQS+C  EA    +  +EE+T+LIGLTFGG+L SKI+
Sbjct  671   IGSQLVNGKEEDAHEFLRCAIDTMQSICPMEAQASRTGPVEEETTLIGLTFGGYLLSKIK  730

Query  2531  CMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARK  2710
             C RC  KSER ERI+DLTVEI GDI ++E AL+Q+T  EILDG+N+YHC+RC SY KARK
Sbjct  731   CTRCENKSERIERILDLTVEISGDIETIEEALQQYTSPEILDGDNRYHCTRCNSYVKARK  790

Query  2711  KLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEH  2890
             +L ILEAPN+LTIALKRFQSGKFGKLNK + F EIL+LA YMS  SDKSP+Y+LYGVI H
Sbjct  791   RLSILEAPNILTIALKRFQSGKFGKLNKPVIFSEILDLAPYMSSRSDKSPVYRLYGVIVH  850

Query  2891  EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSR  3043
              DVMNAAFSGHYVCY++N QNKWFKV+DS V  +++++VL++GAYML Y+R
Sbjct  851   LDVMNAAFSGHYVCYIRNNQNKWFKVDDSTVTAMDVKNVLTRGAYMLFYAR  901


 Score =   106 bits (265),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 75/135 (56%), Gaps = 35/135 (26%)
 Frame = +2

Query  377  AAFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysf  556
            A  LVF  P++G  +R KW+   AR++EI+RLLV ASEEAAR E                
Sbjct  15   AVCLVF--PIIGLFLRHKWQLGMARKDEINRLLVFASEEAARVEL---------------  57

Query  557  gsVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQ  736
                               ++   +P    L + CA CFS  +TRC+RCKAVRYCSG+CQ
Sbjct  58   ------------------QASFGHIPAPISLNHHCALCFSPTTTRCARCKAVRYCSGRCQ  99

Query  737  IIHWRLGHKDECHPP  781
            IIHWR GHK+ECHPP
Sbjct  100  IIHWRQGHKNECHPP  114



>ref|XP_004489806.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Cicer 
arietinum]
Length=936

 Score =   508 bits (1308),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 249/397 (63%), Positives = 302/397 (76%), Gaps = 10/397 (3%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q ++SK S+ N + + +E+ G       FPYELFV+L+   KV+L PFGLTNCGNSCYAN
Sbjct  383   QFRSSKESKSNLISSENEVLG-------FPYELFVELYCYDKVKLIPFGLTNCGNSCYAN  435

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLA+T P T+Y LQGFHS+ C KK WCF CEFE L  KAK GNSPLSPI I+S + 
Sbjct  436   AVLQCLAYTRPLTSYLLQGFHSRRCQKKGWCFICEFEYLFQKAKEGNSPLSPIGILSKIH  495

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG+GREEDAHEFLR  ++TMQS+CLKEAGV  S  L E+T+LIG TFGG+LRSKI
Sbjct  496   KIGSHLGHGREEDAHEFLRGAVDTMQSICLKEAGV--SSPLTEETTLIGYTFGGYLRSKI  553

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +C+RC GKSER+ER+MDLTVEIDGDI +LE AL QFT  EILD +NKY+C RCKSYEKA+
Sbjct  554   KCLRCLGKSERYERMMDLTVEIDGDIETLEEALGQFTAPEILDKDNKYNCGRCKSYEKAK  613

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL +LEAPN+LTI LKRFQSG F KLNK++ FPE+LN+A YMSGT DKSP+Y LY V+ 
Sbjct  614   KKLTVLEAPNILTIVLKRFQSGNFEKLNKSVQFPEVLNMAPYMSGTKDKSPLYSLYAVVV  673

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H D+MNAAFSGHY+CYVKN + +WF+ +DSKV+PVE+  VLS+ AYMLLYSR SP++   
Sbjct  674   HLDIMNAAFSGHYICYVKNNRGEWFRTDDSKVEPVELSRVLSERAYMLLYSRHSPKSLGS  733

Query  3068  IRSLTSHDPRGQKYVNCKSSSHTNSWDLSKGDSTNDP  3178
             + S         K  N  S + +NS   S G  +  P
Sbjct  734   VSSSAGFSTGKFKRRNAVSKTRSNSMVTSAGSLSLQP  770


 Score = 86.3 bits (212),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 63/118 (53%), Gaps = 19/118 (16%)
 Frame = +2

Query  419  VRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaavpa  598
            +RQ WR+AEA++EEI RL+                    + ++ +          +   +
Sbjct  24   IRQIWRNAEAKKEEIMRLV-------------------QDTAAMAEMEAAALASNSNSNS  64

Query  599  papvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
             +   S    +PV+    YQCA C+S  + RCSRCKAVRYCSGKCQI HWR GHKDEC
Sbjct  65   VSASISASNLIPVSVSQWYQCAVCYSPTTMRCSRCKAVRYCSGKCQISHWRQGHKDEC  122



>ref|XP_010520756.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Tarenaya 
hassleriana]
Length=1054

 Score =   510 bits (1313),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 236/356 (66%), Positives = 287/356 (81%), Gaps = 3/356 (1%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             S    L   +EI  ++++KGLFPY+ F+KL+N  K+EL+P GL NCGNSC+AN V QCL 
Sbjct  547   SNQYKLLTGNEITRKHSHKGLFPYDFFIKLYNWNKLELQPCGLINCGNSCFANVVFQCLM  606

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FTPP TAYFLQG HSK C  ++ CF C FE+LVLKAK G SPL P  +++ L+NIG  LG
Sbjct  607   FTPPLTAYFLQGIHSKTCPNREQCFTCGFENLVLKAKEGKSPLYPSGLLAQLQNIGICLG  666

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEA--GVRTSCSLEEQTSLIGLTFGGFLRSKIECMRC  2542
             NG+EEDAHEFLRYV++TMQSVCLKE+   +  +  LEE T+LIGLTFGG+LRSK++CM+C
Sbjct  667   NGKEEDAHEFLRYVVDTMQSVCLKESKHAMLETAKLEE-TTLIGLTFGGYLRSKVKCMKC  725

Query  2543  GGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKI  2722
              GKSER E++MDLTVE+DGD+++L+ ALR+FT TEILDGENKY C RCKSYE+A+KKLKI
Sbjct  726   QGKSERCEKMMDLTVEVDGDVSTLDDALRRFTRTEILDGENKYKCGRCKSYERAKKKLKI  785

Query  2723  LEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVM  2902
             LE PNVLTIALKRFQSGKFGKLNK I F E L+LA Y+SG SDK  +Y+LYGVI H D+M
Sbjct  786   LEPPNVLTIALKRFQSGKFGKLNKLIRFSETLDLAPYVSGRSDKPHVYKLYGVIVHLDIM  845

Query  2903  NAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             NAAFSGHYVCY+KN QNKW+K +DS V   E+E VL+KGAYML Y+RCSPR P  +
Sbjct  846   NAAFSGHYVCYIKNSQNKWYKADDSTVVTSELERVLTKGAYMLFYARCSPRPPSTV  901


 Score = 92.4 bits (228),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 89/178 (50%), Gaps = 50/178 (28%)
 Frame = +2

Query  377  AAFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysf  556
            A  +  + PL+GF+V ++WR A  RREEI RLL+ ASEEAARAE EA+ E          
Sbjct  13   ALVVCLVVPLIGFVVGRQWRLAAQRREEIRRLLIRASEEAARAELEASLE----------  62

Query  557  gsVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQ  736
                                  +SV V+    Y C  C+  A+TRC+RCKAVRYCSGKCQ
Sbjct  63   ---------------------YSSVSVSNG--YYCPVCYVPATTRCARCKAVRYCSGKCQ  99

Query  737  IIHWRLGHKDECHP-PVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSID  907
            + HWR GHK+EC P P+  N                  NE    G++  E+N    +D
Sbjct  100  VYHWRQGHKNECRPAPITCN----------------TGNEKSDSGLKVAEKNEVAILD  141



>ref|XP_007208087.1| hypothetical protein PRUPE_ppa001429mg [Prunus persica]
 gb|EMJ09286.1| hypothetical protein PRUPE_ppa001429mg [Prunus persica]
Length=830

 Score =   500 bits (1288),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 284/579 (49%), Positives = 375/579 (65%), Gaps = 57/579 (10%)
 Frame = +2

Query  1499  DEQGPKAKPSDAAQLLQVKDNVD-------LKRSSLRPDSHNTIDLNKASV--------R  1633
             D+    + PS  A+L  +++++        +K S +  +  +T  + KA           
Sbjct  161   DQLENMSSPSGCAKLANIQEDISHANKLSKMKSSHIDKEVESTPKIPKAKKNISGDAQPE  220

Query  1634  STSSFKESRRSLST---ASDACKVEHLVNNDTLKVNSPPKASDKSIEGLKNVSQTPKARQ  1804
             +  S K +RR +S+    +DACK +   +NDT                        ++++
Sbjct  221   NIGSRKLTRRPISSEKKLTDACKSKSSSSNDT----------------------EDESKE  258

Query  1805  VESLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsgg---dsqssksglkssv  1975
              ESLS       PSS    H    ++  KI++      +   G      Q++++GLK+SV
Sbjct  259   EESLSHSVSIDRPSSTTGEHMYSSSRYEKIEAYHALPANEKVGSIPNLPQNARNGLKTSV  318

Query  1976  skvvdQLKASKSRHNSL-GAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGN  2152
              KVV Q K+SK   ++L G   EI G+Y  K +FPYELFVKL++   VEL PFGL NCGN
Sbjct  319   KKVVQQFKSSKQLKSNLSGRGEEIVGKY--KVIFPYELFVKLYSYDNVELCPFGLMNCGN  376

Query  2153  SCYANAVLQCLAFTPPFTAYFLQGFHSKGC-------AKKDWCFNCEFESLVLKAKNGNS  2311
             SCYANAVLQCLAFT P  +Y LQG HS+ C          DWCF CEFE L++KA+ G S
Sbjct  377   SCYANAVLQCLAFTRPLASYLLQGLHSRACKFLFMTPTHHDWCFICEFEILLVKAREGKS  436

Query  2312  PLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLI  2491
              LSPIRI+S +  IGS LG+GREEDAHEFLRY ++TMQ VCLKEAG      L E+T+L+
Sbjct  437   LLSPIRILSKIHKIGSHLGHGREEDAHEFLRYAVDTMQFVCLKEAGAVG--PLAEETTLV  494

Query  2492  GLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKY  2671
             G+TFGG+LRSKI CM+C GKSER E++MDLTVEIDG+I +LE AL QFT TE LDG+N+Y
Sbjct  495   GMTFGGYLRSKITCMKCLGKSERFEQMMDLTVEIDGEIGTLEEALAQFTATETLDGKNRY  554

Query  2672  HCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSD  2851
             HCSRCKSYEKA+KKL ++EAPN+LTI LKRFQS  F KLNK++ FPE+LN++ YM GTSD
Sbjct  555   HCSRCKSYEKAKKKLTVMEAPNILTIVLKRFQSRNFEKLNKSVRFPEVLNMSPYMGGTSD  614

Query  2852  KSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYML  3031
             +S +Y LY V+ H D+MNAA+SGHYVCYVKN Q +WFK++DS V+PV+++ VLS+GAYML
Sbjct  615   RSALYSLYAVVVHLDIMNAAYSGHYVCYVKNNQGEWFKIDDSSVEPVDLKRVLSQGAYML  674

Query  3032  LYSRCSPRAPKLIRSLTSHDPRGQKYVNCKS--SSHTNS  3142
             LY+R +PR P  + S    +    K  N ++  SSHT S
Sbjct  675   LYARRTPRPPAFLGSTAVSNGEKLKRRNLEAVPSSHTKS  713


 Score = 92.0 bits (227),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 62/125 (50%), Gaps = 31/125 (25%)
 Frame = +2

Query  413  FLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaav  592
             ++R KW++A   +EEI RL+ +                               E  A  
Sbjct  19   LVIRHKWKNAVVNKEEIMRLVAM-----------------------------ASEETAVA  49

Query  593  papapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
               A         PV+  LPY CA C++S + RCS+CKAVRYCSGKCQIIHWR GHKDEC
Sbjct  50   EFQATSPYGPVVQPVS--LPYHCAVCYASTTMRCSKCKAVRYCSGKCQIIHWRQGHKDEC  107

Query  773  HPPVN  787
             P ++
Sbjct  108  QPSID  112



>ref|XP_003519843.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Glycine 
max]
Length=938

 Score =   503 bits (1296),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 241/365 (66%), Positives = 289/365 (79%), Gaps = 13/365 (4%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q ++SK SR NS+ A +E+G        FPYELFV+L+   K++L PFGLTNCGNSCYAN
Sbjct  375   QFRSSKESRSNSISAENEMG--------FPYELFVELYCYDKMKLFPFGLTNCGNSCYAN  426

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLA+T P T+Y  QGFHSK C KK WCF CEFE L+ KAK G SPLSPI I+S + 
Sbjct  427   AVLQCLAYTRPLTSYLFQGFHSKRCQKKGWCFTCEFEYLIQKAKEGISPLSPIGILSKIH  486

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG GREEDAHEFLR V++TMQS+CLKE GV  S  L E+T+L+  TFGG+LRSKI
Sbjct  487   KIGSHLGRGREEDAHEFLRCVVDTMQSICLKEVGV--SSPLAEETTLVSYTFGGYLRSKI  544

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +C+RC GKSER+ER+MDLTVEIDGDI +LE AL QFT  EILD +NKY+CSRCK+Y KAR
Sbjct  545   KCLRCLGKSERYERMMDLTVEIDGDIGTLEEALGQFTAPEILDKDNKYNCSRCKTYVKAR  604

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL +LEAPN+LTI LKRFQSG F KLNK++ FPE+LN+A YMSGT DKSP+Y LY V+ 
Sbjct  605   KKLTVLEAPNILTIVLKRFQSGNFEKLNKSVQFPEVLNMAPYMSGTKDKSPLYSLYAVVV  664

Query  2888  H--EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             H   D+MNAAFSGHYVCYVKN Q +WF+ +DS+V+PVE+  VLS+ AYMLLY+R SP+  
Sbjct  665   HLDLDIMNAAFSGHYVCYVKNIQGEWFRTDDSRVEPVELSRVLSERAYMLLYARHSPKPL  724

Query  3062  KLIRS  3076
              L+ S
Sbjct  725   GLVSS  729


 Score = 84.7 bits (208),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  629  VPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP  781
            VPV     +QCA C +  + RCSRCKAVRYCSGKCQI HWRLGHKDEC PP
Sbjct  75   VPVDGSRWFQCAVCCAPTTMRCSRCKAVRYCSGKCQISHWRLGHKDECCPP  125



>ref|XP_009340982.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Pyrus x 
bretschneideri]
 ref|XP_009340983.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Pyrus x 
bretschneideri]
Length=839

 Score =   500 bits (1288),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 256/423 (61%), Positives = 315/423 (74%), Gaps = 5/423 (1%)
 Frame = +2

Query  1811  SLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQ-VTACssdsggdsqssksglkssvskvv  1987
             SLS  A    PSS    H    ++S KI++   + A         Q+S +GLK+S+ KVV
Sbjct  265   SLSNGASVDEPSSTTEGHLDSISRSEKIEAYHALPAKFGSIPSLPQNSSNGLKTSMRKVV  324

Query  1988  dQLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
              Q  +SK    +     +  G+Y  K LFPY+LFVKL+++   +L PFGL NCGNSCYAN
Sbjct  325   QQFISSKQLKCNPSVHGDETGKY--KVLFPYDLFVKLYSNDSADLYPFGLMNCGNSCYAN  382

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFT P  +Y LQG HS+ C KKDWCF CEFE L+LKA+ G S LSPIRI+S + 
Sbjct  383   AVLQCLAFTRPLVSYLLQGLHSRTCRKKDWCFICEFEVLLLKAREGKSLLSPIRILSKIH  442

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IG  LG GREEDAHEFLRY ++TMQSVCLKEAG      L E+T+L+G+TFGG+LRSKI
Sbjct  443   KIGIHLGQGREEDAHEFLRYAVDTMQSVCLKEAGAVG--PLAEETTLVGMTFGGYLRSKI  500

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+C GKSE+ ER+MDLTVEIDG I +LE AL QFT TE L+G N+YHCSRCKSYEKAR
Sbjct  501   KCMKCLGKSEQIERMMDLTVEIDGQIGTLEEALAQFTATETLEGNNRYHCSRCKSYEKAR  560

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL +LEAPN+LTI LKRFQS  F KLNK+I FP++LN++ YM  TSDKSP+Y LY V+ 
Sbjct  561   KKLTVLEAPNILTIVLKRFQSRNFEKLNKSIRFPKVLNMSPYMDETSDKSPLYSLYAVVV  620

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H D+MNAA+SGHYVCYVKN Q +WFK++DS V+PVE++ VLS+GAYMLLY+R +PR P L
Sbjct  621   HLDIMNAAYSGHYVCYVKNNQEEWFKIDDSSVEPVELKRVLSQGAYMLLYARHTPRPPAL  680

Query  3068  IRS  3076
             + S
Sbjct  681   LGS  683


 Score = 91.7 bits (226),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 35/128 (27%)
 Frame = +2

Query  413  FLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaav  592
            F++  KW++A A++EEI RL+ +ASEE A AEF                           
Sbjct  22   FVICHKWKNAAAKKEEILRLVAMASEETAVAEF---------------------------  54

Query  593  papapvSSTLTSVPVAR--QLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKD  766
                   +T    PV +    PY CA C++S + RCS+CKAVRYCSGKCQIIHWR GHKD
Sbjct  55   ------QATAFFAPVVQPASWPYHCAVCYASTTMRCSKCKAVRYCSGKCQIIHWRQGHKD  108

Query  767  ECHPPVNN  790
            EC P +++
Sbjct  109  ECQPSIDS  116



>ref|XP_007158378.1| hypothetical protein PHAVU_002G148100g [Phaseolus vulgaris]
 gb|ESW30372.1| hypothetical protein PHAVU_002G148100g [Phaseolus vulgaris]
Length=925

 Score =   501 bits (1291),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 239/362 (66%), Positives = 288/362 (80%), Gaps = 13/362 (4%)
 Frame = +2

Query  1991  QLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANA  2170
             Q ++SK   +S  A +E+G        FPYELFV+L+   K++L PFGLTNCGNSCYANA
Sbjct  370   QFRSSK---DSRSAENEMG--------FPYELFVELYCYDKMKLFPFGLTNCGNSCYANA  418

Query  2171  VLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLEN  2350
             VLQCLA+T P T+Y  QGFHSK C KK WCF CEFE L+ KAK G SPLSPI I+S +  
Sbjct  419   VLQCLAYTRPLTSYLFQGFHSKRCQKKGWCFTCEFEYLIQKAKEGISPLSPIGILSKIHK  478

Query  2351  IGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIE  2530
             IGS LG+GREEDAHEFLR  ++TMQSVCLKEA V  S  L E+T+L+G TFGG+LRSKI+
Sbjct  479   IGSHLGHGREEDAHEFLRCAVDTMQSVCLKEASV--SSPLAEETTLVGYTFGGYLRSKIK  536

Query  2531  CMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARK  2710
             C+RC GKSER+ER+MDLTVEIDGDI +LE AL QFT  EILD +NKY+CSRCK+YEKARK
Sbjct  537   CLRCLGKSERYERMMDLTVEIDGDIGTLEEALGQFTAPEILDKDNKYNCSRCKTYEKARK  596

Query  2711  KLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEH  2890
             KL +LEAPN+LTI LKRFQSG F KLNK++ FPE+L++A YMSGT DKSP+Y LY V+ H
Sbjct  597   KLTVLEAPNILTIVLKRFQSGNFEKLNKSVQFPEVLDMAPYMSGTKDKSPLYSLYAVVVH  656

Query  2891  EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
              D+MNAAFSGHYVCYVKN Q +WF+ +DS+V+PVE+  VLS+ AYMLLY+R SP+   L+
Sbjct  657   LDIMNAAFSGHYVCYVKNIQGEWFRTDDSRVEPVELSRVLSERAYMLLYARHSPKPLGLV  716

Query  3071  RS  3076
              S
Sbjct  717   SS  718


 Score = 89.4 bits (220),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 76/146 (52%), Gaps = 31/146 (21%)
 Frame = +2

Query  386  LVFIGPLLGF-LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgs  562
            LV++    GF ++R  WR+AEA+RE  D +++   E+A                      
Sbjct  12   LVYVVLAFGFAVIRHVWRNAEAKRE--DSIMMRLPEDAGV--------------------  49

Query  563  VVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQII  742
               +E+  A           + VPV     YQCA C++  + RC+RCKAVRYCSGKCQI 
Sbjct  50   ---EEMEVAAAVAPSPVEYSSPVPVNVSRWYQCAVCYAPTTMRCARCKAVRYCSGKCQIS  106

Query  743  HWRLGHKDECHPP-----VNNNHDSY  805
            HWR GHKDEC PP     +N+++ SY
Sbjct  107  HWRQGHKDECCPPTTTMEINDDNISY  132



>gb|KCW68483.1| hypothetical protein EUGRSUZ_F02136 [Eucalyptus grandis]
Length=899

 Score =   500 bits (1287),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 238/333 (71%), Positives = 270/333 (81%), Gaps = 3/333 (1%)
 Frame = +2

Query  1991  QLKAS-KSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q K S  S+H  LG  S++ GR N+KG+FPYELFV L+  K VEL P GL NCGNSCYAN
Sbjct  527   QFKGSVMSKHQRLGVGSDVPGRCNDKGIFPYELFVTLYTWKGVELHPRGLINCGNSCYAN  586

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFTPP TAYFLQG HSK C +KDWCF CEFESL+L+   G SP+SPI I+S L 
Sbjct  587   AVLQCLAFTPPLTAYFLQGLHSKACVRKDWCFTCEFESLILRMNEGKSPISPIGIVSQLR  646

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             NIG  LGNG+EEDAHEFLR  I+ MQS CL ++G + S S EE T LIGLTFGG+LRSKI
Sbjct  647   NIGRQLGNGKEEDAHEFLRCAIDKMQSDCLVDSGKKVSRSKEEAT-LIGLTFGGYLRSKI  705

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +C RC GKSERHER+MDLTVEI GDI +LE ALRQFT TE LDGENKY C+RC SYEKAR
Sbjct  706   QCTRCNGKSERHERMMDLTVEIGGDIRTLEEALRQFTSTETLDGENKYQCTRCNSYEKAR  765

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSG-TSDKSPIYQLYGVI  2884
             KKL +LEAPN+LTIALKRFQSGKFGKLNK+I F EIL+L+ YM G TSD+S +Y+LYGVI
Sbjct  766   KKLTVLEAPNILTIALKRFQSGKFGKLNKSIRFSEILDLSPYMKGTTSDRSAVYRLYGVI  825

Query  2885  EHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKV  2983
              H D+MNAAFSGHYVCYVKN  NKWFK++DS V
Sbjct  826   VHLDIMNAAFSGHYVCYVKNMHNKWFKIDDSTV  858


 Score = 79.0 bits (193),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  653  YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNH  796
            Y CA C+   +TRCS+CKAVRYCSGKCQIIHWR GHK+EC P    +H
Sbjct  88   YYCAVCYCPTTTRCSQCKAVRYCSGKCQIIHWRQGHKEECRPVEAGSH  135



>gb|AES96032.2| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=943

 Score =   501 bits (1290),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 236/356 (66%), Positives = 281/356 (79%), Gaps = 11/356 (3%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q ++SK SR N     +E+G        FPYELFV+L+   KV+L PFGLTNCGNSCYAN
Sbjct  385   QFRSSKESRSNLTSVENELG--------FPYELFVELYCYDKVKLFPFGLTNCGNSCYAN  436

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             A LQCLA+T P T+Y LQGFHSK C KK WCF CEFE L+ KAK G SPLSPI I+S + 
Sbjct  437   AALQCLAYTQPLTSYLLQGFHSKRCQKKGWCFMCEFEYLIQKAKEGTSPLSPIGILSKIH  496

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG+GREEDAHEFLR  +ETMQ +CLKEAGV  S  L E+T+LIG TFGG+LRSKI
Sbjct  497   KIGSHLGHGREEDAHEFLRGAVETMQYICLKEAGV--SSPLTEETTLIGYTFGGYLRSKI  554

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +C+RC GKSER+ER+MDLTVEIDGDI +LE AL QFT  EILD +NKY+C RCKSYEKA+
Sbjct  555   KCLRCLGKSERYERMMDLTVEIDGDIETLEEALGQFTAPEILDKDNKYNCGRCKSYEKAK  614

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL +LEAPN+LTI LKRFQSG F KLNK++ FPE+L++  YMSG  DKSP Y LY V+ 
Sbjct  615   KKLTVLEAPNILTIVLKRFQSGNFEKLNKSVQFPEVLDMTPYMSGRKDKSPFYSLYAVVV  674

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             H D+MNA+FSGHYVCYVKN Q +WF+ +DS+V+PVE+  VLS+ AYMLLY+R SP+
Sbjct  675   HLDIMNASFSGHYVCYVKNIQGEWFRTDDSRVEPVELSRVLSESAYMLLYARHSPK  730


 Score = 84.7 bits (208),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 64/122 (52%), Gaps = 19/122 (16%)
 Frame = +2

Query  419  VRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaavpa  598
            +R  WR+AE +REE+ RL+                    + ++         +      +
Sbjct  24   IRYVWRNAEEKREEVMRLV-------------------QDTTASMTHMEAYSDSDEISFS  64

Query  599  papvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            P+  +S  +S  V+    YQCA C+S  + RC+RCKAVRYCSGKCQI HWR GHKDEC P
Sbjct  65   PSNSASFESSNSVSFSHGYQCAVCYSPTTMRCARCKAVRYCSGKCQISHWRQGHKDECCP  124

Query  779  PV  784
             +
Sbjct  125  SI  126



>ref|XP_003574640.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Brachypodium 
distachyon]
Length=970

 Score =   501 bits (1290),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 229/343 (67%), Positives = 278/343 (81%), Gaps = 3/343 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYELF+KL++  KVELRPFGL N GNSCYANAVLQCL FT P TAYFL G HSK C+ 
Sbjct  434   LFPYELFIKLYD--KVELRPFGLHNLGNSCYANAVLQCLMFTRPLTAYFLGGLHSKNCSN  491

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             K+WCF CEFE LV++ K+G + LSP  I+SHL  IGSS G G++EDAHEFLR+ I+ MQS
Sbjct  492   KEWCFMCEFEKLVVEGKHGKTALSPTGILSHLHEIGSSFGPGKQEDAHEFLRHSIDAMQS  551

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VC+KEA    +  L E+T+L+ L FGG+LRSKI+C RC G SE+ ER++DLTVEIDGDI+
Sbjct  552   VCMKEARKSGAHRLAEETTLVQLIFGGYLRSKIKCTRCHGSSEQSERMLDLTVEIDGDIS  611

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             SLE AL++FT TE+LDG N+Y C+RCKSYE+A+KKL I EAPNVLTIALKR+QSGKFGK+
Sbjct  612   SLEEALQRFTSTEVLDGNNRYQCTRCKSYERAKKKLTISEAPNVLTIALKRYQSGKFGKI  671

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             +K I FPE LNL+SYMS T D SP+Y LYGV+ H DVMNAAFSGHYVCYVK+   KW+K 
Sbjct  672   SKAIRFPETLNLSSYMSTTDDNSPVYSLYGVVVHHDVMNAAFSGHYVCYVKDTHGKWYKT  731

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR-SLTSHDP  3094
             +DS+VK V +E+V+SK AYMLLY+RCSPRAP  +R ++   DP
Sbjct  732   DDSQVKSVSLENVMSKCAYMLLYARCSPRAPSSVRHAIMVQDP  774


 Score = 75.9 bits (185),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNN  790
            CA CF   + RC +CKAV+YCS KCQI HWR GHKDECHPP  N
Sbjct  114  CAVCFKPTTFRCKQCKAVKYCSFKCQIAHWRQGHKDECHPPSVN  157



>ref|XP_004289526.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Fragaria 
vesca subsp. vesca]
Length=860

 Score =   497 bits (1279),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 229/338 (68%), Positives = 277/338 (82%), Gaps = 3/338 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             +FPYELFVKL++   V+L PFGLTNCGNSCYANAVLQCLAFT P T+Y LQG HS+ C K
Sbjct  356   IFPYELFVKLYSYNNVDLCPFGLTNCGNSCYANAVLQCLAFTQPLTSYLLQGLHSRACQK  415

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             KDWCF CEFE L+ KA+ G S LSPIRI+S +  IGS LG+G+EEDAHEFLRY ++TMQ 
Sbjct  416   KDWCFICEFEILLQKAREGKSSLSPIRILSKIHKIGSHLGHGKEEDAHEFLRYAVDTMQY  475

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VCLKEAG      L EQT+L+G+TFGG LRSKI+CM+C GK+E+ ER+MDLTVEIDG I 
Sbjct  476   VCLKEAGAIG--PLAEQTTLVGMTFGGHLRSKIKCMKCLGKTEQFERMMDLTVEIDGAIG  533

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             +LE AL QFT TE LDG+N++HC+RCKSYEKARKKL ILEAPN+LTI LKRFQS  F KL
Sbjct  534   TLEEALAQFTATETLDGDNRFHCNRCKSYEKARKKLTILEAPNILTIVLKRFQSRNFEKL  593

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             +K++ FPE+LNL+ YM   SDKSP+Y LY V+ H D+MNAA+SGHY+CYVKN +  WFK+
Sbjct  594   DKSVRFPEVLNLSPYMD-RSDKSPLYNLYAVVVHLDIMNAAYSGHYICYVKNSRGNWFKI  652

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLT  3082
             +DS V+PVE++ VLS+GAYMLLY+R SPR+P L+ S T
Sbjct  653   DDSSVEPVELKRVLSEGAYMLLYARRSPRSPPLVGSNT  690


 Score = 88.2 bits (217),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 75/139 (54%), Gaps = 31/139 (22%)
 Frame = +2

Query  380  AFLVFIGPLLG------FLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfey  541
              L F G L G      F++R KWR+A A++EEI RL+ +AS+EAA AEF++        
Sbjct  5    GILGFQGLLFGVVLASFFVIRHKWRNAVAKKEEIMRLVAMASQEAAMAEFQSTT------  58

Query  542  ssysfgsVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYC  721
                    + D   AA        +            + CA C+S  + RCS+CK+VRYC
Sbjct  59   -------ALYDSSAAAAAPVPVTGA------------FHCAVCYSQTTMRCSKCKSVRYC  99

Query  722  SGKCQIIHWRLGHKDECHP  778
            SGKCQIIHWR GHKDEC P
Sbjct  100  SGKCQIIHWRQGHKDECQP  118



>ref|XP_010277575.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Nelumbo 
nucifera]
Length=742

 Score =   493 bits (1268),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 221/320 (69%), Positives = 263/320 (82%), Gaps = 0/320 (0%)
 Frame = +2

Query  2147  GNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPI  2326
             G +CYANAVLQCLAFT P   Y LQG HSK C KK+WCF CEFE+L+L+A+ G SPLSPI
Sbjct  175   GYNCYANAVLQCLAFTRPLACYLLQGHHSKACPKKEWCFTCEFEALILRAREGKSPLSPI  234

Query  2327  RIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFG  2506
              I+S ++NIGS LG+GREEDAHEFLRY I+ MQS+CL+EAG        E+T+LIGL FG
Sbjct  235   GILSQIQNIGSHLGHGREEDAHEFLRYAIDAMQSICLREAGSNVDVPYAEETTLIGLIFG  294

Query  2507  GFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRC  2686
             G+LRSKI C++C GKSER ER++DLTVEI+GDI +LE AL +FT  EILDGENKY C RC
Sbjct  295   GYLRSKIRCLKCQGKSERIERMLDLTVEIEGDIGTLEEALAKFTTAEILDGENKYQCERC  354

Query  2687  KSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIY  2866
             KSYEKA+KKL +LEAPNVLTIALKRFQ+GKFGKLNK + FPE+LNL  YM+ TSDKSP+Y
Sbjct  355   KSYEKAKKKLTVLEAPNVLTIALKRFQTGKFGKLNKLVRFPEVLNLTPYMNATSDKSPVY  414

Query  2867  QLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRC  3046
              LY V+ H D+MNAAFSGHY+CY+KNFQ KWFK++DS VKPVE E VLSKGAYML Y+RC
Sbjct  415   TLYAVVVHLDIMNAAFSGHYICYIKNFQGKWFKIDDSMVKPVEPEKVLSKGAYMLFYARC  474

Query  3047  SPRAPKLIRSLTSHDPRGQK  3106
             SPRAP L+R+   HD + ++
Sbjct  475   SPRAPSLVRNSLIHDDKVKR  494



>gb|EEE68872.1| hypothetical protein OsJ_27681 [Oryza sativa Japonica Group]
Length=897

 Score =   492 bits (1266),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 228/343 (66%), Positives = 274/343 (80%), Gaps = 4/343 (1%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             FPYELF+KL+  +KVEL+PFGL N GNSCYANAVLQCL FT P T+Y L G HSK C+KK
Sbjct  352   FPYELFIKLY--EKVELQPFGLHNLGNSCYANAVLQCLMFTRPLTSYLLGGLHSKNCSKK  409

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
             +WCF CEFE LV + + G   LSP  I+SHL +IGSS G G++EDAHEFLRY I+ MQSV
Sbjct  410   EWCFMCEFEKLVGEGRQGKIALSPTGILSHLPDIGSSFGPGKQEDAHEFLRYAIDAMQSV  469

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
             C+KEA    +  L E+T+L+ L FGG+LRSKI C RC   SE+HERI+DLTVEIDGDI+S
Sbjct  470   CMKEARKSGTHRLHEETTLMQLIFGGYLRSKIRCTRCDATSEQHERILDLTVEIDGDISS  529

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LEGAL +FT TE+LDG+NKY CSRCKS+E+A+KKL I EAPNVLTIALKR+QSGKFGK+N
Sbjct  530   LEGALERFTSTEVLDGDNKYKCSRCKSHERAKKKLTISEAPNVLTIALKRYQSGKFGKIN  589

Query  2792  KTITFPEILNLASYMSGTSDK-SPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             K I FPE LNL  YMS  +D  SP+Y LY V+ H D+MNAAFSGHYVCYVK+   KW+K 
Sbjct  590   KAIRFPETLNLQRYMSPKADDTSPVYSLYAVVVHHDIMNAAFSGHYVCYVKDTHGKWYKT  649

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR-SLTSHDP  3094
             +DS+VKPV +E+V+SK AYMLLY+RCSPRAP  +R +L + DP
Sbjct  650   DDSQVKPVSLENVMSKCAYMLLYARCSPRAPSSVRPALMAQDP  692


 Score = 72.8 bits (177),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP-VNNNHD  799
            CA CF   + RC +CKAV+YCS KCQI HWR GHK+EC PP  + NHD
Sbjct  42   CAVCFRPTTFRCKQCKAVKYCSFKCQIAHWRQGHKNECRPPSTDANHD  89



>gb|EEC84719.1| hypothetical protein OsI_31685 [Oryza sativa Indica Group]
Length=927

 Score =   492 bits (1266),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 227/337 (67%), Positives = 269/337 (80%), Gaps = 0/337 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FVKL+N  KVELRPFGL N GNSCYANAVLQCLAFT P TAY  +G HS+ C+K
Sbjct  362   LFPYEHFVKLYNFDKVELRPFGLVNLGNSCYANAVLQCLAFTRPLTAYLTEGLHSRNCSK  421

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             K+WCF CEFE L+L+ + G S LSP  I+SHL +IGSS G GREEDAHEFLRY I+TMQS
Sbjct  422   KEWCFMCEFEKLILEGRRGKSHLSPTGILSHLRDIGSSFGPGREEDAHEFLRYAIDTMQS  481

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
               +KEA       L E+T+L+ L FGG+LRSKI+C  C G SE+ ERI+DLTVEIDGDI 
Sbjct  482   ASMKEAKKNGVYGLPEETTLVQLIFGGYLRSKIKCTMCQGSSEQCERILDLTVEIDGDIN  541

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             +LE AL +FT TEILDG+N+Y+CSRCKSYE+A+KKL I EAPN+LTIALKR+QSG FGK+
Sbjct  542   TLEEALHRFTSTEILDGDNRYNCSRCKSYERAKKKLTISEAPNILTIALKRYQSGNFGKI  601

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             NK + F E LNL++YMS   D SP+YQLY V+ H DVMNAAFSGHYVCYVK+ Q KW K+
Sbjct  602   NKAVRFTEYLNLSNYMSTADDISPVYQLYAVVVHHDVMNAAFSGHYVCYVKDTQGKWHKM  661

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSL  3079
             +DS+VKPV +E VLSK AYML Y+RCSPRAP  +R +
Sbjct  662   DDSQVKPVSLEKVLSKCAYMLFYARCSPRAPNSVRKM  698


 Score = 72.4 bits (176),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 55/118 (47%), Gaps = 17/118 (14%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP-VNNNHD------SYGKGA  817
            C  C    + RC RCK V+YC+ KCQI HWR GHKDECHPP V+   D      S  KG 
Sbjct  118  CVVCRRPTTFRCKRCKGVKYCTFKCQISHWRQGHKDECHPPRVDARPDNITVVSSVKKGV  177

Query  818  NDFKVFRQEANEGYAEGIETEERNTPGSIDASFAEPTCSEPSI--SGAENTEDVMEGK  985
              +  F Q A       +E  +        +  A P  SE ++   G +N    M G+
Sbjct  178  GMYNSFEQSAKSSIEPAVEVNK--------SVAAVPELSEANLVSDGVDNERKKMRGQ  227



>ref|XP_006413414.1| hypothetical protein EUTSA_v10024307mg [Eutrema salsugineum]
 ref|XP_006413415.1| hypothetical protein EUTSA_v10024307mg [Eutrema salsugineum]
 gb|ESQ54867.1| hypothetical protein EUTSA_v10024307mg [Eutrema salsugineum]
 gb|ESQ54868.1| hypothetical protein EUTSA_v10024307mg [Eutrema salsugineum]
Length=1001

 Score =   493 bits (1270),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 253/428 (59%), Positives = 320/428 (75%), Gaps = 9/428 (2%)
 Frame = +2

Query  1793  KARQVESLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkss  1972
             K  +V+ L++KAPN    ++  +H   GAKS ++   Q     +    +S   ++GLK+S
Sbjct  432   KVGEVQILASKAPNTSECADVEKHSPLGAKSGRVLDHQKQNGVAVHHINSLHGRNGLKAS  491

Query  1973  vskvvdQLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGN  2152
             V KVVDQ    KS      A +E+ GR+ +KGLFPYELF KL+ + K+E +P GL NCGN
Sbjct  492   VLKVVDQWTRPKS-----SAENEMAGRHGHKGLFPYELFAKLY-TNKIEFQPCGLINCGN  545

Query  2153  SCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             SC+AN V QCL  TPP T+YFLQ FHS+ C  K+ CF C FE+LVL AK G SPLSP  +
Sbjct  546   SCFANVVFQCLMLTPPLTSYFLQQFHSRACPNKEQCFTCGFENLVLLAKEGKSPLSPNGL  605

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLK--EAGVRTSCSLEEQTSLIGLTFG  2506
             +S L+N G  LGNG++EDAHEFLR+V++ MQSVC+K  E  ++ +  LE+ T+LIGLTFG
Sbjct  606   LSQLQNNGIYLGNGKQEDAHEFLRFVVDIMQSVCIKASEYDMQKTRKLED-TTLIGLTFG  664

Query  2507  GFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRC  2686
             G+LRSKI+CM+C   SER E++MDLTVEIDGDI++LE ALR+FT TEILDGENKY C RC
Sbjct  665   GYLRSKIKCMKCQETSERREKMMDLTVEIDGDISTLEDALRRFTRTEILDGENKYKCGRC  724

Query  2687  KSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIY  2866
             KSYE+A+KKLKI + PNVLTIALKRFQSGKFGKLNK + FPE L+LA Y+SG S+KS  Y
Sbjct  725   KSYERAKKKLKITDPPNVLTIALKRFQSGKFGKLNKLVRFPETLDLAPYVSGGSEKSHDY  784

Query  2867  QLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRC  3046
             +LYGVI H D+MNAAFSGHYVCY++N  NKW+K +DS V   ++E VL+KGAYML YSRC
Sbjct  785   KLYGVIVHLDIMNAAFSGHYVCYIRNSLNKWYKADDSTVVTYDVERVLTKGAYMLFYSRC  844

Query  3047  SPRAPKLI  3070
             SP  P+L+
Sbjct  845   SPMPPRLV  852


 Score =   106 bits (264),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 96/203 (47%), Gaps = 42/203 (21%)
 Frame = +2

Query  386  LVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsV  565
            +  + PL  F VR+KWR A  RR+EI RLL+                             
Sbjct  16   ISLVLPLFAFFVRRKWRLAAVRRQEIQRLLI-----------------------------  46

Query  566  VGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIH  745
                   A  A    S   +SVPV+    +QC  CF  A+TRCSRCKAVRYCSGKCQIIH
Sbjct  47   --HASEEAARAELEASFEFSSVPVSNN--FQCPVCFCLATTRCSRCKAVRYCSGKCQIIH  102

Query  746  WRLGHKDECHPP--VNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSI-DASF  916
            WR GHKDEC     + N  D   K   D+K    E N+G  E +       P  + +A F
Sbjct  103  WRQGHKDECRLASIIYNTDDE--KSDTDWKF--SEENKGNTEALLVYPEPVPIPVREAIF  158

Query  917  AEPTCSEPSISG--AENTEDVME  979
            + P  S    +G  A+N +D+++
Sbjct  159  SNPARSPEDENGDSADNKDDLID  181



>gb|KFK28990.1| hypothetical protein AALP_AA7G074400 [Arabis alpina]
Length=1023

 Score =   493 bits (1270),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 230/352 (65%), Positives = 283/352 (80%), Gaps = 2/352 (1%)
 Frame = +2

Query  2030  AWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTA  2209
             A +E+ GR+ +KGLFPYELF KL+  K +E +P GL NCGNSC+AN V QCL FTPP  A
Sbjct  508   AENEMAGRHGHKGLFPYELFAKLYKDK-IEFQPSGLINCGNSCFANVVFQCLMFTPPLIA  566

Query  2210  YFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDA  2389
             YFLQ FHSK C  K+ CF C FE+LV+KA++G SPLSP  ++S L+++G  LGNG++EDA
Sbjct  567   YFLQQFHSKACLNKEKCFTCGFENLVVKARDGKSPLSPNGLLSQLQSMGIFLGNGKQEDA  626

Query  2390  HEFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHE  2566
             HEFLR+V++TMQSV +K +   T  + + E T+LIGLTFGG+LRSKI+CM+C GKSER E
Sbjct  627   HEFLRFVVDTMQSVSIKASEYDTLKTRKLEDTTLIGLTFGGYLRSKIKCMKCQGKSERRE  686

Query  2567  RIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLT  2746
             ++MDLTVEIDGDI++L+ ALR+FT TEILDGENKY C RCKSYE+A+KKLKI E PN+LT
Sbjct  687   KMMDLTVEIDGDISTLDDALRRFTRTEILDGENKYRCGRCKSYERAKKKLKITEPPNILT  746

Query  2747  IALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHY  2926
             IALKRFQSGKFGKLNK I FPE L+LA Y+SG S+KS  Y+LYGVI H DVMN  FSGHY
Sbjct  747   IALKRFQSGKFGKLNKLIRFPENLDLAPYVSGGSEKSHDYKLYGVIVHLDVMNETFSGHY  806

Query  2927  VCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLT  3082
             VCY++N QNKWFK +DS V   E+E VL+KGAYML Y+RC+P  P+L+ S T
Sbjct  807   VCYIRNSQNKWFKADDSTVVTSEVERVLTKGAYMLFYARCTPMPPRLVCSKT  858


 Score = 81.6 bits (200),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  653  YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            + C  C+  A+TRCSRCKAVRYCSGKCQIIHWR GHKDEC P
Sbjct  74   FHCPVCYIPATTRCSRCKAVRYCSGKCQIIHWRQGHKDECRP  115



>ref|NP_001062051.1| Os08g0478500 [Oryza sativa Japonica Group]
 dbj|BAD09009.1| putative ubiquitin-specific protease [Oryza sativa Japonica Group]
 dbj|BAF23965.1| Os08g0478500 [Oryza sativa Japonica Group]
Length=978

 Score =   492 bits (1266),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 228/343 (66%), Positives = 274/343 (80%), Gaps = 4/343 (1%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             FPYELF+KL+  +KVEL+PFGL N GNSCYANAVLQCL FT P T+Y L G HSK C+KK
Sbjct  433   FPYELFIKLY--EKVELQPFGLHNLGNSCYANAVLQCLMFTRPLTSYLLGGLHSKNCSKK  490

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
             +WCF CEFE LV + + G   LSP  I+SHL +IGSS G G++EDAHEFLRY I+ MQSV
Sbjct  491   EWCFMCEFEKLVGEGRQGKIALSPTGILSHLPDIGSSFGPGKQEDAHEFLRYAIDAMQSV  550

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
             C+KEA    +  L E+T+L+ L FGG+LRSKI C RC   SE+HERI+DLTVEIDGDI+S
Sbjct  551   CMKEARKSGTHRLHEETTLMQLIFGGYLRSKIRCTRCDATSEQHERILDLTVEIDGDISS  610

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LEGAL +FT TE+LDG+NKY CSRCKS+E+A+KKL I EAPNVLTIALKR+QSGKFGK+N
Sbjct  611   LEGALERFTSTEVLDGDNKYKCSRCKSHERAKKKLTISEAPNVLTIALKRYQSGKFGKIN  670

Query  2792  KTITFPEILNLASYMSGTSDK-SPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             K I FPE LNL  YMS  +D  SP+Y LY V+ H D+MNAAFSGHYVCYVK+   KW+K 
Sbjct  671   KAIRFPETLNLQRYMSPKADDTSPVYSLYAVVVHHDIMNAAFSGHYVCYVKDTHGKWYKT  730

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR-SLTSHDP  3094
             +DS+VKPV +E+V+SK AYMLLY+RCSPRAP  +R +L + DP
Sbjct  731   DDSQVKPVSLENVMSKCAYMLLYARCSPRAPSSVRPALMAQDP  773


 Score = 72.8 bits (177),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP-VNNNHD  799
            CA CF   + RC +CKAV+YCS KCQI HWR GHK+EC PP  + NHD
Sbjct  123  CAVCFRPTTFRCKQCKAVKYCSFKCQIAHWRQGHKNECRPPSTDANHD  170



>gb|EPS68694.1| hypothetical protein M569_06073, partial [Genlisea aurea]
Length=777

 Score =   485 bits (1248),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 225/343 (66%), Positives = 273/343 (80%), Gaps = 7/343 (2%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             +GLF YE FVKL+N   +EL P GL NCGNSCYANAVLQCLAFTPP TAYFLQG HSK C
Sbjct  435   EGLFSYEQFVKLYNWNGIELCPRGLINCGNSCYANAVLQCLAFTPPLTAYFLQGLHSKAC  494

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
              +KDWCF+CE+E+LV+K      P+SP RI+S ++ IG  L  GREEDAHEFLRY I++M
Sbjct  495   QQKDWCFSCEYEALVIKVNAAKFPISPERIMSEVDRIGRHLVIGREEDAHEFLRYAIDSM  554

Query  2423  QSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGD  2602
             QSVCLKEAGV+    ++E+T+L+G TFGG +RSKIECMRCGGKSE+HER+MDL VEI G+
Sbjct  555   QSVCLKEAGVKVPKPVDEETTLLGFTFGGHIRSKIECMRCGGKSEQHERMMDLAVEIVGE  614

Query  2603  IASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFG  2782
             +A+LE AL +FT +EILDGENKY C RCKSYEKA+KKLK++EAPN+LTI LKRFQ  K+G
Sbjct  615   VATLEDALNRFTRSEILDGENKYLCGRCKSYEKAKKKLKVMEAPNILTIVLKRFQDRKYG  674

Query  2783  KLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHED-VMNAA------FSGHYVCYVK  2941
             K+NK + FP ILN+A YMSGT+DKSP+YQLYGV+ H D V N A       SGHY+ YVK
Sbjct  675   KINKGLKFPAILNMAPYMSGTTDKSPVYQLYGVVVHVDFVTNNASSSSSSSSGHYISYVK  734

Query  2942  NFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             N Q +WF+ ND+ V+ V +E  LS+ AYML Y+RCSPRAP+ I
Sbjct  735   NNQGRWFEANDTMVEEVRLEKALSRDAYMLFYARCSPRAPRSI  777


 Score = 72.0 bits (175),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  632  PVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            PV +Q  ++C  C +  STRC +CKAVRYCS KCQII+WR GHKDEC
Sbjct  69   PVRQQSLHRCVVCSNPTSTRCKQCKAVRYCSSKCQIINWRQGHKDEC  115



>ref|XP_004973705.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X2 [Setaria italica]
Length=978

 Score =   489 bits (1258),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 225/343 (66%), Positives = 273/343 (80%), Gaps = 3/343 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYELFVKL++  KVEL PFGL N GNSCYANAVLQCL FT P T Y L G HSK C+K
Sbjct  427   LFPYELFVKLYD--KVELHPFGLHNLGNSCYANAVLQCLMFTRPLTTYLLGGLHSKNCSK  484

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             ++WCF CEFE L+++ K   + LSP  I+SHL +IGSS G G++EDAHEFLRY I+ MQS
Sbjct  485   REWCFMCEFEKLIVEGKRRKTALSPTGILSHLHDIGSSFGPGKQEDAHEFLRYAIDAMQS  544

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VC+KEA    +    E+T+L+ L FGG+LRSKI+C RC   SE+ ER++DLTVEIDGDI+
Sbjct  545   VCMKEARKGGALRSAEETTLVQLIFGGYLRSKIKCSRCHISSEQCERMLDLTVEIDGDIS  604

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             SL+ AL +FT TE+LDGEN+YHCSRCKSYE+A+KKL I EAPNVLTIALKR+QSGKFGK+
Sbjct  605   SLDEALVRFTSTEVLDGENRYHCSRCKSYERAKKKLTIEEAPNVLTIALKRYQSGKFGKI  664

Query  2789  NKTITFPEILNLASYMS-GTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             NK I FPE LN+  YM+  T D+SP+Y LY V+ H DVMNAAFSGHYVCYVK+ Q KWFK
Sbjct  665   NKAIRFPETLNMVRYMNPETDDRSPVYSLYAVVVHHDVMNAAFSGHYVCYVKDTQGKWFK  724

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDP  3094
              +DS+VKPV +++V+SK AYMLLY+RCSPRAP  +R +   DP
Sbjct  725   ADDSQVKPVSLDNVMSKCAYMLLYARCSPRAPSSVRKVMVQDP  767


 Score = 79.0 bits (193),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 50/84 (60%), Gaps = 7/84 (8%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP-VNNNHDSYGKGANDFKVF  835
            CA CF   + RC +CKAV+YCS KCQI HWR GHKDECHPP VN   D  G+   +    
Sbjct  115  CAVCFRPTTFRCKQCKAVKYCSFKCQIAHWRQGHKDECHPPSVNTRPDDEGRVEQE----  170

Query  836  RQEANEGYAEGIE-TEERNTPGSI  904
             + A E  + G++   E N P +I
Sbjct  171  -RAAEENVSVGVKPIAETNKPVTI  193



>ref|XP_004973704.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X1 [Setaria italica]
Length=993

 Score =   488 bits (1257),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 225/343 (66%), Positives = 273/343 (80%), Gaps = 3/343 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYELFVKL++  KVEL PFGL N GNSCYANAVLQCL FT P T Y L G HSK C+K
Sbjct  442   LFPYELFVKLYD--KVELHPFGLHNLGNSCYANAVLQCLMFTRPLTTYLLGGLHSKNCSK  499

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             ++WCF CEFE L+++ K   + LSP  I+SHL +IGSS G G++EDAHEFLRY I+ MQS
Sbjct  500   REWCFMCEFEKLIVEGKRRKTALSPTGILSHLHDIGSSFGPGKQEDAHEFLRYAIDAMQS  559

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VC+KEA    +    E+T+L+ L FGG+LRSKI+C RC   SE+ ER++DLTVEIDGDI+
Sbjct  560   VCMKEARKGGALRSAEETTLVQLIFGGYLRSKIKCSRCHISSEQCERMLDLTVEIDGDIS  619

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             SL+ AL +FT TE+LDGEN+YHCSRCKSYE+A+KKL I EAPNVLTIALKR+QSGKFGK+
Sbjct  620   SLDEALVRFTSTEVLDGENRYHCSRCKSYERAKKKLTIEEAPNVLTIALKRYQSGKFGKI  679

Query  2789  NKTITFPEILNLASYMS-GTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             NK I FPE LN+  YM+  T D+SP+Y LY V+ H DVMNAAFSGHYVCYVK+ Q KWFK
Sbjct  680   NKAIRFPETLNMVRYMNPETDDRSPVYSLYAVVVHHDVMNAAFSGHYVCYVKDTQGKWFK  739

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDP  3094
              +DS+VKPV +++V+SK AYMLLY+RCSPRAP  +R +   DP
Sbjct  740   ADDSQVKPVSLDNVMSKCAYMLLYARCSPRAPSSVRKVMVQDP  782


 Score = 78.6 bits (192),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 50/84 (60%), Gaps = 7/84 (8%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP-VNNNHDSYGKGANDFKVF  835
            CA CF   + RC +CKAV+YCS KCQI HWR GHKDECHPP VN   D  G+   +    
Sbjct  115  CAVCFRPTTFRCKQCKAVKYCSFKCQIAHWRQGHKDECHPPSVNTRPDDEGRVEQE----  170

Query  836  RQEANEGYAEGIE-TEERNTPGSI  904
             + A E  + G++   E N P +I
Sbjct  171  -RAAEENVSVGVKPIAETNKPVTI  193



>gb|KDP29752.1| hypothetical protein JCGZ_18687 [Jatropha curcas]
Length=822

 Score =   482 bits (1240),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 226/341 (66%), Positives = 273/341 (80%), Gaps = 3/341 (1%)
 Frame = +2

Query  2054  YNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHS  2233
             ++++ +FPYELF KL++  + EL PFGL NCGNSCYAN VLQCLAFT P T+YF++  HS
Sbjct  325   HSHERIFPYELFEKLYSCDE-ELSPFGLRNCGNSCYANTVLQCLAFTRPLTSYFVRRLHS  383

Query  2234  KGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVI  2413
               C KK+WCF CEFESL+LKA+ G SPLSPIRI+S +E IGS LG+G+EEDAHEFLRY +
Sbjct  384   GTCRKKEWCFICEFESLILKAREGESPLSPIRILSKIEKIGSHLGHGKEEDAHEFLRYAV  443

Query  2414  ETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEI  2593
             +TMQSVCLKEAG      L E+T+L+GLTFGG+LRSKI CM+C GKSER ERIMDLTVEI
Sbjct  444   DTMQSVCLKEAGALGV--LAEETTLVGLTFGGYLRSKITCMKCFGKSERFERIMDLTVEI  501

Query  2594  DGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSG  2773
             DGDI +LE AL QFT  E+LDG NKY CSRCKSY KA+KKL +LEAPN+LTI LKRFQSG
Sbjct  502   DGDIDTLEEALMQFTACEMLDGGNKYICSRCKSYVKAKKKLSLLEAPNILTIVLKRFQSG  561

Query  2774  KFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQN  2953
              FGKLNK++ FPE+L++A YM G SDKSP Y LY V+ H D++N   +GHYVCY+K    
Sbjct  562   NFGKLNKSVRFPEVLDMAPYMCGKSDKSPQYSLYAVVVHRDMLNDTSTGHYVCYIKTSHG  621

Query  2954  KWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS  3076
             +WF VNDS V PVE+E VL + AYMLLY+R  PRAP +++S
Sbjct  622   EWFGVNDSIVMPVELERVLLEEAYMLLYARHHPRAPSVLKS  662


 Score = 81.3 bits (199),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 56/124 (45%), Gaps = 35/124 (28%)
 Frame = +2

Query  425  QKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaavpapa  604
             KWR+A AR+EEI RL+ L                            V  E         
Sbjct  26   HKWRNAVARKEEIRRLVDL----------------------------VSKESALVEFEAV  57

Query  605  pvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPV  784
               S+          P+QCA CF   +TRCS+CK+V YCSGKCQI+HWR GHKD+C P  
Sbjct  58   YEYSSFPK-------PHQCAVCFCPTTTRCSQCKSVHYCSGKCQIVHWRRGHKDQCRPLT  110

Query  785  NNNH  796
               H
Sbjct  111  TAMH  114



>gb|EMS47345.1| Ubiquitin carboxyl-terminal hydrolase 17 [Triticum urartu]
Length=967

 Score =   486 bits (1251),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 221/343 (64%), Positives = 276/343 (80%), Gaps = 3/343 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY++F+KL++  KVELRPFGL N GNSCYAN VLQCL FT P T Y L G HSK C+K
Sbjct  446   LFPYDVFIKLYD--KVELRPFGLHNLGNSCYANVVLQCLMFTRPLTTYLLGGLHSKNCSK  503

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             K WCF CEFE L+++ K G + LSP  I+SHL  IGSS G G++EDAHEFLR+ I+ MQS
Sbjct  504   KAWCFMCEFERLIVEGKQGKTALSPTGILSHLHEIGSSFGPGKQEDAHEFLRHSIDAMQS  563

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VC+KEA    +  L E+T+L+ L FGG+LRSKI+C RC   SE++ER++DLTVEIDGDI+
Sbjct  564   VCIKEARKGGAHCLAEETTLVQLIFGGYLRSKIKCTRCHISSEQYERMLDLTVEIDGDIS  623

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             SLE AL++FT TE+LDG+N+Y CSRC SYE+A+KKL I EAPNVLTIALKR+QSGKFGK+
Sbjct  624   SLEEALQRFTSTEVLDGDNRYQCSRCNSYERAKKKLTISEAPNVLTIALKRYQSGKFGKI  683

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             +K I FPE LNL+ YM+ T D SP+Y LYG++ H DVMNAAFSGHYVCYVK+   KW+K+
Sbjct  684   SKAIRFPETLNLSCYMNSTDDNSPVYSLYGMVVHHDVMNAAFSGHYVCYVKDTHGKWYKI  743

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR-SLTSHDP  3094
             +DS+VKPV +E+V+SK AYMLLY+RCSPRAP  +R ++  +DP
Sbjct  744   DDSQVKPVSLENVMSKCAYMLLYARCSPRAPNSVRHAMMVNDP  786


 Score = 78.6 bits (192),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 49/100 (49%), Gaps = 9/100 (9%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVFR  838
            CA CF   + RC +CKAV+YCS KCQI HWR GHKDECHPP  N     G   +      
Sbjct  116  CAVCFRPTTFRCKQCKAVKYCSFKCQISHWRKGHKDECHPPSANAKPDDGAAIS------  169

Query  839  QEANEGYAEGIETEERNTPGSID--ASFAEPTCSEPSISG  952
              A EG  E     E N    +   A  + P  +E   SG
Sbjct  170  -VAKEGNVEHRRASEENVVAGVQPVAEISVPVAAESETSG  208



>ref|NP_567705.1| ubiquitin carboxyl-terminal hydrolase 16 [Arabidopsis thaliana]
 sp|Q9SB51.1|UBP16_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 16; AltName: 
Full=Deubiquitinating enzyme 16; Short=AtUBP16; AltName: 
Full=Ubiquitin thioesterase 16; AltName: Full=Ubiquitin-specific-processing 
protease 16 [Arabidopsis thaliana]
 emb|CAA23007.1| putative protein [Arabidopsis thaliana]
 emb|CAB79366.1| putative protein [Arabidopsis thaliana]
 gb|AEE84926.1| ubiquitin carboxyl-terminal hydrolase 16 [Arabidopsis thaliana]
Length=1008

 Score =   487 bits (1253),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 263/480 (55%), Positives = 336/480 (70%), Gaps = 12/480 (3%)
 Frame = +2

Query  1631  RSTSSFKESRRSLSTASDACKVEHLVNNDTLKVNSPPKASDKSIEGLKNVSQTPKARQVE  1810
             R+   F E+  +L  +S    +  L +++   V  P   S  S  G  ++    K  +V+
Sbjct  386   RNAKRFDEAEIALPISSSTDALSPLDSSNLSHVTLPKSKSASSENG--SMLAPLKVGEVQ  443

Query  1811  SLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkssvskvvd  1990
              L++KA N    ++  +H   GAKS ++   Q    +     +S   +SGLK+SV KVVD
Sbjct  444   LLASKASNTKKCADLMKHSPLGAKSVRVLDHQKQNGAVVQHINSLHGRSGLKASVLKVVD  503

Query  1991  QLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANA  2170
             Q    KS +       E+ GR+ +KGLFPYE+F KL+ + K+E +P GL N GNSC+AN 
Sbjct  504   QWTRPKSEN-------EMAGRHGHKGLFPYEVFAKLY-TYKIEFQPCGLINVGNSCFANV  555

Query  2171  VLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLEN  2350
             V QCL FTPP T YFLQ FHS+ C KK+ CF C FE LV+KAK   SPLSP  ++S L+N
Sbjct  556   VFQCLMFTPPLTTYFLQQFHSRACTKKEQCFTCGFEKLVVKAKEEKSPLSPNGLLSQLQN  615

Query  2351  IGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGV-RTSCSLEEQTSLIGLTFGGFLRSKI  2527
             IG  LGNG+EEDAHEFLR+V++TMQSVC+K +    T  S  E T+LIGLTFGG+LRSKI
Sbjct  616   IGIFLGNGKEEDAHEFLRFVVDTMQSVCIKASEYDMTKSSKLEDTTLIGLTFGGYLRSKI  675

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+C  KSE  E++MDLTVEIDGDI++L+ ALR+FT TEILDGENKY C  CKSYE+A+
Sbjct  676   KCMKCQVKSELREKMMDLTVEIDGDISTLDDALRRFTRTEILDGENKYRCGSCKSYERAK  735

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKLKI E PNVLTIALKRFQ+GKFGKLNK I FPE L+LA Y+SG S+KS  Y+LYGVI 
Sbjct  736   KKLKITEPPNVLTIALKRFQAGKFGKLNKLIRFPETLDLAPYVSGGSEKSHDYKLYGVIV  795

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DVMNAAFSGHYVCY++N QNKW+K +DS V   ++E +L+KGAYML Y+RC+P  P+L
Sbjct  796   HLDVMNAAFSGHYVCYIRN-QNKWYKADDSTVVTSDVERILTKGAYMLFYARCTPTPPRL  854


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 72/144 (50%), Gaps = 34/144 (24%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            PL+G  VR KWR A  RREEI RLL+                                  
Sbjct  21   PLIGLFVRHKWRVAAQRREEIRRLLI-------------------------------HAS  49

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
              A  A    S   +SV V+    + C  C+  A+TRCSRCKAVRYCSGKCQIIHWR GH
Sbjct  50   EEAARAELEASVEFSSVAVSNV--FHCPVCYCLATTRCSRCKAVRYCSGKCQIIHWRQGH  107

Query  761  KDECHPPVNNNHDSYGKGANDFKV  832
            KDECH P +  +DS  +  +D ++
Sbjct  108  KDECH-PASIVYDSEDESDSDLRL  130



>gb|AAG42757.1|AF302666_1 ubiquitin-specific protease 16 [Arabidopsis thaliana]
Length=1008

 Score =   487 bits (1253),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 263/480 (55%), Positives = 336/480 (70%), Gaps = 12/480 (3%)
 Frame = +2

Query  1631  RSTSSFKESRRSLSTASDACKVEHLVNNDTLKVNSPPKASDKSIEGLKNVSQTPKARQVE  1810
             R+   F E+  +L  +S    +  L +++   V  P   S  S  G  ++    K  +V+
Sbjct  386   RNAKRFDEAEIALPISSSTDALSPLDSSNLSHVTLPKSKSASSENG--SMLAPLKVGEVQ  443

Query  1811  SLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkssvskvvd  1990
              L++KA N    ++  +H   GAKS ++   Q    +     +S   +SGLK+SV KVVD
Sbjct  444   LLASKASNTKKCADLMKHSPLGAKSVRVLDHQKQNGAVVQHINSLHGRSGLKASVLKVVD  503

Query  1991  QLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANA  2170
             Q    KS +       E+ GR+ +KGLFPYE+F KL+ + K+E +P GL N GNSC+AN 
Sbjct  504   QWTRPKSEN-------EMAGRHGHKGLFPYEVFAKLY-TYKIEFQPCGLINVGNSCFANV  555

Query  2171  VLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLEN  2350
             V QCL FTPP T YFLQ FHS+ C KK+ CF C FE LV+KAK   SPLSP  ++S L+N
Sbjct  556   VFQCLMFTPPLTTYFLQQFHSRACTKKEQCFTCGFEKLVVKAKEEKSPLSPNGLLSQLQN  615

Query  2351  IGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGV-RTSCSLEEQTSLIGLTFGGFLRSKI  2527
             IG  LGNG+EEDAHEFLR+V++TMQSVC+K +    T  S  E T+LIGLTFGG+LRSKI
Sbjct  616   IGIFLGNGKEEDAHEFLRFVVDTMQSVCIKASEYDMTKSSKLEDTTLIGLTFGGYLRSKI  675

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+C  KSE  E++MDLTVEIDGDI++L+ ALR+FT TEILDGENKY C  CKSYE+A+
Sbjct  676   KCMKCQVKSELREKMMDLTVEIDGDISTLDDALRRFTRTEILDGENKYRCGSCKSYERAK  735

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKLKI E PNVLTIALKRFQ+GKFGKLNK I FPE L+LA Y+SG S+KS  Y+LYGVI 
Sbjct  736   KKLKITEPPNVLTIALKRFQAGKFGKLNKLIRFPETLDLAPYVSGGSEKSHDYKLYGVIV  795

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DVMNAAFSGHYVCY++N QNKW+K +DS V   ++E +L+KGAYML Y+RC+P  P+L
Sbjct  796   HLDVMNAAFSGHYVCYIRN-QNKWYKADDSTVVTSDVERILTKGAYMLFYARCTPTPPRL  854


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 72/144 (50%), Gaps = 34/144 (24%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            PL+G  VR KWR A  RREEI RLL+                                  
Sbjct  21   PLIGLFVRHKWRVAAQRREEIRRLLI-------------------------------HAS  49

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
              A  A    S   +SV V+    + C  C+  A+TRCSRCKAVRYCSGKCQIIHWR GH
Sbjct  50   EEAARAELEASVEFSSVAVSNV--FHCPVCYCLATTRCSRCKAVRYCSGKCQIIHWRQGH  107

Query  761  KDECHPPVNNNHDSYGKGANDFKV  832
            KDECH P +  +DS  +  +D ++
Sbjct  108  KDECH-PASIVYDSEDESDSDLRL  130



>ref|XP_006660217.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Oryza 
brachyantha]
Length=992

 Score =   486 bits (1251),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 229/360 (64%), Positives = 279/360 (78%), Gaps = 6/360 (2%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             FPYELF+KL++  KVEL+PFGL N GNSCYANAVLQCL FT P  +Y L G HSK C+K 
Sbjct  443   FPYELFIKLYD--KVELQPFGLHNLGNSCYANAVLQCLMFTRPLASYLLGGLHSKNCSKM  500

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
             +WCF CEFE LV + + G   LSP  I+SHL +IGSS G G++EDAHEFLRY I+ MQSV
Sbjct  501   EWCFMCEFEKLVAEGRQGKPALSPTGILSHLPDIGSSFGPGKQEDAHEFLRYAIDAMQSV  560

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
             C+KEA    +  L E+T+L+ L FGG+LRSKI+C  C   SE+ ER++DLTVEIDGDI+S
Sbjct  561   CMKEARKNGAHRLHEETTLMQLIFGGYLRSKIKCTSCDAISEQCERMLDLTVEIDGDISS  620

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LEGAL +FT TE+LDG+NKY CSRCKS+E+A+KKL I EAPNVLTIALKR+QSGKFGK+N
Sbjct  621   LEGALERFTSTEVLDGDNKYQCSRCKSHERAKKKLTIWEAPNVLTIALKRYQSGKFGKIN  680

Query  2792  KTITFPEILNLASYMSGTS-DKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             K I FPE LNL  YMS  + D SP+Y LY V+ H DVMNAAFSGHYVCYVK+ Q KW+K 
Sbjct  681   KAIRFPETLNLKRYMSAKADDTSPVYSLYAVVVHHDVMNAAFSGHYVCYVKDTQGKWYKT  740

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR-SLTSHDPRGQKYVNCKSSSHTNSW  3145
             +DS+VKPV +E+V+SK AYMLLY+RCSPRAP+ +R +L + DP   K    KS  ++  W
Sbjct  741   DDSQVKPVSLENVMSKCAYMLLYARCSPRAPRSVRPALMAQDPARVK--KAKSRVNSGRW  798


 Score = 74.7 bits (182),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 55/109 (50%), Gaps = 5/109 (5%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVFR  838
            CA CF   + RC +CKAV+YCS KCQI HWR GHK+EC PP  +     G   +  KV  
Sbjct  119  CAVCFRPTTFRCKQCKAVKYCSFKCQIAHWRQGHKNECRPPSADVKHDDGAEVSVVKVKN  178

Query  839  QEANEGYAEGIETEERNTPGSIDASFAEPTCSEPSISGAENTEDVMEGK  985
             E      E I TE        + + A  T SE   SGA +T + +  K
Sbjct  179  IEQRSASEENIVTEVETI---AETNIAATTSSE--TSGANHTVENLNDK  222



>gb|EMT33844.1| Ubiquitin carboxyl-terminal hydrolase 17 [Aegilops tauschii]
Length=911

 Score =   483 bits (1242),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 220/343 (64%), Positives = 275/343 (80%), Gaps = 3/343 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY++F+KL++  KVELRPFGL N GNSCYAN VLQCL FT P T Y L G HSK C+K
Sbjct  360   LFPYDVFIKLYD--KVELRPFGLHNLGNSCYANVVLQCLMFTRPLTTYLLGGLHSKNCSK  417

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             K WCF CEFE L+++ K G + LSP  I+SHL  IGSS G G++EDAHEFLR+ I+ MQS
Sbjct  418   KAWCFMCEFERLIVEGKQGKTALSPTGILSHLHEIGSSFGPGKQEDAHEFLRHSIDAMQS  477

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VC+KEA    +    E+T+L+ L FGG+LRSKI+C RC   SE++ER++DLTVEIDGDI+
Sbjct  478   VCIKEARKGGAHCSAEETTLVQLIFGGYLRSKIKCTRCHISSEQYERMLDLTVEIDGDIS  537

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             SLE AL++FT TE+LDG+N+Y CSRC SYE+A+KKL I EAPNVLTIALKR+QSGKFGK+
Sbjct  538   SLEEALQRFTSTEVLDGDNRYQCSRCNSYERAKKKLTISEAPNVLTIALKRYQSGKFGKI  597

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             +K I FPE LNL+ YM+ T D SP+Y LYG++ H DVMNAAFSGHYVCYVK+   KW+K+
Sbjct  598   SKAIRFPETLNLSCYMNSTDDNSPVYSLYGMVVHHDVMNAAFSGHYVCYVKDTHGKWYKI  657

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR-SLTSHDP  3094
             +DS+VKPV +E+V+SK AYMLLY+RCSPRAP  +R ++  +DP
Sbjct  658   DDSQVKPVSLENVMSKCAYMLLYARCSPRAPNSVRHAMMVNDP  700


 Score = 78.2 bits (191),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 49/100 (49%), Gaps = 9/100 (9%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVFR  838
            CA CF   + RC +CKAV+YCS KCQI HWR GHKDECHPP  N     G   +      
Sbjct  31   CAVCFRPTTFRCKQCKAVKYCSFKCQISHWRKGHKDECHPPSANAKPDDGAAIS------  84

Query  839  QEANEGYAEGIETEERNTPGSID--ASFAEPTCSEPSISG  952
              A EG  E     E N    +   A  + P  +E   SG
Sbjct  85   -VAKEGNVEHRRASEENVVAGVQPVAEISVPVAAESETSG  123



>ref|XP_002867659.1| ubiquitin-specific protease 16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43918.1| ubiquitin-specific protease 16 [Arabidopsis lyrata subsp. lyrata]
Length=1007

 Score =   486 bits (1250),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 251/427 (59%), Positives = 318/427 (74%), Gaps = 12/427 (3%)
 Frame = +2

Query  1793  KARQVESLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkss  1972
             K  +V+ L++KA N    ++  +H   GAKS ++   Q    ++     S + +SGLK+S
Sbjct  436   KVGEVQLLASKASNTKECADLMKHSPLGAKSVRVLDHQKQNGAAVHRISSLNGRSGLKAS  495

Query  1973  vskvvdQLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGN  2152
             V KVVDQ    KS +       E+ GR+ +KGLFPYE+F KL+ + K+E +P GL N GN
Sbjct  496   VLKVVDQWTRPKSEN-------EMAGRHGHKGLFPYEVFAKLY-TNKIEFQPCGLINVGN  547

Query  2153  SCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             SC+AN V QCL FTPP T YFLQ  HS+ C KK+ CF C FE LVLKAK G SPLSP  +
Sbjct  548   SCFANVVFQCLMFTPPLTTYFLQQLHSRACTKKEQCFTCGFEKLVLKAKEGKSPLSPNGL  607

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLK--EAGVRTSCSLEEQTSLIGLTFG  2506
             +S L+NIG  LGNG+EEDAHEFLR+V++TMQSVC+K  E  +  S  LE+ T+LIGLTFG
Sbjct  608   LSQLQNIGIFLGNGKEEDAHEFLRFVVDTMQSVCIKASEYDMPKSSKLED-TTLIGLTFG  666

Query  2507  GFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRC  2686
             G+LRSKI+CM+C  KSE  E++MDLTVEIDGDI++L+ ALR+FT TEILDG+NKY C  C
Sbjct  667   GYLRSKIKCMKCQVKSELREKMMDLTVEIDGDISTLDDALRRFTRTEILDGDNKYRCGSC  726

Query  2687  KSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIY  2866
             KSYE+A+KKLKI + PNVLTIALKRFQ+GKFGKLNK I FPE L+LA Y+SG S+KS  Y
Sbjct  727   KSYERAKKKLKITDPPNVLTIALKRFQAGKFGKLNKLIRFPETLDLAPYVSGGSEKSHDY  786

Query  2867  QLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRC  3046
             +LYGVI H D+MNAAFSGHYVCY++N QNKW+K +DS V   ++E +++KGAYML Y+RC
Sbjct  787   KLYGVIVHLDIMNAAFSGHYVCYIRN-QNKWYKADDSTVVTSDVERIMTKGAYMLFYARC  845

Query  3047  SPRAPKL  3067
             +P  PKL
Sbjct  846   TPMPPKL  852


 Score =   100 bits (250),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 91/208 (44%), Gaps = 53/208 (25%)
 Frame = +2

Query  386  LVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsV  565
            +  + PL+G  VR KWR A  RREEI RLL+                             
Sbjct  16   ISLVLPLIGLFVRHKWRVAAQRREEIRRLLI-----------------------------  46

Query  566  VGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIH  745
                   A  A    S   +SV ++    + C  C+  A+TRCSRCK+VRYCSGKCQIIH
Sbjct  47   --HASQEAARAELEASVEFSSVAISNI--FHCPVCYCIATTRCSRCKSVRYCSGKCQIIH  102

Query  746  WRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNT--------PGS  901
            WR GHKDEC  P +  +DS  + ++    FR+E            ERNT        P  
Sbjct  103  WRQGHKDECR-PASIVYDSEDEKSDSDLRFREE-----------NERNTLEETLLLDPQP  150

Query  902  IDASFAEPTCSEPSISGAENTEDVMEGK  985
            +     E   S P+ S  +   D+ + K
Sbjct  151  VIIPIGETILSNPARSPEDGNGDIADNK  178



>ref|XP_010439011.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Camelina 
sativa]
Length=1014

 Score =   486 bits (1250),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 252/427 (59%), Positives = 317/427 (74%), Gaps = 10/427 (2%)
 Frame = +2

Query  1793  KARQVESLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkss  1972
             K  +V+ L++KA N    ++  +H   GAK+ ++   Q     +    +S   +SGLK+S
Sbjct  440   KVGEVQLLASKASNTRECTDVMKHSPLGAKTGRVLDHQKQNGVTVHHINSLHGRSGLKAS  499

Query  1973  vskvvdQLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGN  2152
               KVVDQ +  KS      A +E+ GR+  KGLFPYE F KL+ + K+E +P GL N GN
Sbjct  500   ALKVVDQWRRPKS-----SAENEMVGRHGRKGLFPYEDFAKLY-ANKIEFQPCGLINVGN  553

Query  2153  SCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             SC+AN V QCL FTPP T YFLQ FHS+ C  K+ CF C FE LVLKAK G SPLSP  +
Sbjct  554   SCFANVVFQCLMFTPPLTTYFLQQFHSRACQNKEQCFTCGFEKLVLKAKEGKSPLSPNGL  613

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLK--EAGVRTSCSLEEQTSLIGLTFG  2506
             +S L++IG  LGNG+EEDAHEFLR+V++TMQSVC+K  E  +  +  LE+ T+LIGLTFG
Sbjct  614   LSQLQSIGIFLGNGKEEDAHEFLRFVVDTMQSVCVKASEYDMPKTSKLED-TTLIGLTFG  672

Query  2507  GFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRC  2686
             G+LRSKI+CM+C GKSE  E++MDLTVEIDGDI++L+ ALR+FT TEILDGENKY C  C
Sbjct  673   GYLRSKIKCMKCQGKSELREKMMDLTVEIDGDISTLDDALRRFTRTEILDGENKYRCDSC  732

Query  2687  KSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIY  2866
             KSYE+A+KKLKI E PNVLTIALKRFQ+GKFGKLNK I FPE L+LA Y+SG S+KS  Y
Sbjct  733   KSYERAKKKLKITEPPNVLTIALKRFQAGKFGKLNKFIRFPETLDLAPYVSGGSEKSHDY  792

Query  2867  QLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRC  3046
             +LYGVI H D+MNAAFSGHYVCY++N QNKW+K +DS V   ++E +L+KGAYML Y+RC
Sbjct  793   KLYGVIVHLDIMNAAFSGHYVCYIRN-QNKWYKADDSTVVSSDVERILTKGAYMLFYARC  851

Query  3047  SPRAPKL  3067
             SP  P+L
Sbjct  852   SPMPPRL  858


 Score = 80.5 bits (197),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 67/115 (58%), Gaps = 11/115 (10%)
 Frame = +2

Query  656  QCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP--VNNNHDSYGKGANDFK  829
             C  C+  A+TRCSRCK+VRYCSGKCQIIHWR GHKDEC P   + +N D   K  +D  
Sbjct  73   HCPVCYCLATTRCSRCKSVRYCSGKCQIIHWRQGHKDECRPAAIIYDNEDE--KSDSDLS  130

Query  830  VFRQEANEGYAEG---IETEERNTPGSIDASFAEPTCSEPSISG--AENTEDVME  979
               +E  E  A+    +  E  + P S +A F+ P  S    +G  A+N +D+++
Sbjct  131  CI-EENEESTADETLLVHPEPVSMP-SKEAIFSNPAKSPEDGNGDIADNKDDLID  183



>ref|NP_001063411.2| Os09g0464400 [Oryza sativa Japonica Group]
 dbj|BAF25325.2| Os09g0464400 [Oryza sativa Japonica Group]
Length=918

 Score =   482 bits (1241),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 227/350 (65%), Positives = 269/350 (77%), Gaps = 13/350 (4%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC--  2242
             LFPYE FVKL+N  KVELRPFGL N GNSCYANAVLQCLAFT P TAY  +G HS+ C  
Sbjct  362   LFPYEHFVKLYNFDKVELRPFGLVNLGNSCYANAVLQCLAFTRPLTAYLTEGLHSRNCNL  421

Query  2243  -----------AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDA  2389
                        +KK+WCF CEFE L+L+ + G S LSP  I+SHL +IGSS G GREEDA
Sbjct  422   ILSQNCVTYHGSKKEWCFMCEFEKLILEGRRGKSHLSPTGILSHLRDIGSSFGPGREEDA  481

Query  2390  HEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHER  2569
             HEFLRY I+TMQS  +KEA       L E+T+L+ L FGG+LRSKI+C  C G SE+ ER
Sbjct  482   HEFLRYAIDTMQSASMKEAKKNGVYGLPEETTLVQLIFGGYLRSKIKCTMCQGSSEQCER  541

Query  2570  IMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTI  2749
             I+DLTVEIDGDI +LE AL +FT TEILDG+N+Y+CSRCKSYE+A+KKL I EAPN+LTI
Sbjct  542   ILDLTVEIDGDINTLEEALHRFTSTEILDGDNRYNCSRCKSYERAKKKLTISEAPNILTI  601

Query  2750  ALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYV  2929
             ALKR+QSG FGK+NK + F E LNL++YMS   D SP+YQLY V+ H DVMNAAFSGHYV
Sbjct  602   ALKRYQSGNFGKINKAVRFTEYLNLSNYMSTADDISPVYQLYAVVVHHDVMNAAFSGHYV  661

Query  2930  CYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSL  3079
             CYVK+ Q KW K++DS+VKPV +E VLSK AYML Y+RCSPRAP  +R +
Sbjct  662   CYVKDTQGKWHKMDDSQVKPVSLEKVLSKCAYMLFYARCSPRAPNSVRKM  711


 Score = 71.2 bits (173),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 54/118 (46%), Gaps = 17/118 (14%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP-VNNNHD------SYGKGA  817
            C  C    + RC RCK V+YC+ KCQI HWR GHKDECHPP V+   D      S  KG 
Sbjct  118  CVVCRRPTTFRCKRCKGVKYCTFKCQISHWRQGHKDECHPPRVDARPDNITVVSSVKKGV  177

Query  818  NDFKVFRQEANEGYAEGIETEERNTPGSIDASFAEPTCSEPSI--SGAENTEDVMEGK  985
              +  F Q         +E  +        +  A P  SE ++   G +N    M G+
Sbjct  178  GMYNSFEQSVKSSVEPAVEVNK--------SVAAVPELSEANLVSDGVDNERKKMRGQ  227



>emb|CDX92643.1| BnaC07g39010D [Brassica napus]
Length=1013

 Score =   485 bits (1248),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 252/427 (59%), Positives = 312/427 (73%), Gaps = 7/427 (2%)
 Frame = +2

Query  1793  KARQVESLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkss  1972
             K  +V+ LS+KA +    ++  +H + GAKS ++   Q           S + +SG+K+S
Sbjct  443   KVGEVQRLSSKASDTREFADVMKHSALGAKSGRVLDHQKQNGLDVHRISSLNGRSGMKAS  502

Query  1973  vskvvdQLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGN  2152
             V KVVDQ    KS      A +EI G +++KGLF YELF KL+ SK +E +P GL NCGN
Sbjct  503   VLKVVDQWTRPKSL-----AENEIAGNHSHKGLFSYELFSKLYTSK-IEFQPCGLINCGN  556

Query  2153  SCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             SC+AN V QCL FT P T YFLQ  HS+ C  K+ CF C FE LVLKAK G S LSP  +
Sbjct  557   SCFANVVFQCLMFTAPLTTYFLQQLHSRTCLNKEQCFTCGFEKLVLKAKEGKSSLSPNGL  616

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGG  2509
             +S L++IG  LGNG++EDAHEFLR+V++ MQSVC+K +G     + + E T+LIGLTFGG
Sbjct  617   LSQLQSIGIRLGNGKQEDAHEFLRFVVDIMQSVCIKASGYDMPKTKKLEDTTLIGLTFGG  676

Query  2510  FLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCK  2689
             +LRSKI+CM+C  KSER E++MDLTVEIDGDI++LE ALR+FT TEILDGENKY C RCK
Sbjct  677   YLRSKIKCMKCQEKSERREKMMDLTVEIDGDISTLEEALRRFTRTEILDGENKYKCGRCK  736

Query  2690  SYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQ  2869
             SYE+A+KKLKI E PNVLTIALKRFQSGKFGKLNK I FPE L+L  Y+SG S+KS  Y+
Sbjct  737   SYERAKKKLKITEPPNVLTIALKRFQSGKFGKLNKLIRFPETLDLTPYVSGGSEKSHDYK  796

Query  2870  LYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCS  3049
             LYGVI H D MNAAFSGHYVCYV+N QNKW+K +DS V   ++E VL+ GAYML Y RCS
Sbjct  797   LYGVIVHLDTMNAAFSGHYVCYVRNSQNKWYKADDSTVVTSDVERVLTMGAYMLFYERCS  856

Query  3050  PRAPKLI  3070
             P  P+L+
Sbjct  857   PMPPRLV  863


 Score =   108 bits (269),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 96/199 (48%), Gaps = 41/199 (21%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            P++ F+VR+KWR A  RREEI RLL+                                  
Sbjct  21   PVVAFVVRRKWRLAALRREEIRRLLI-------------------------------HAS  49

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
              A  A    S   +SV V     +QC  C+S ASTRCSRCKAVRYCSGKCQIIHWR GH
Sbjct  50   EEAARAELESSVEFSSVYVPNS--FQCPVCYSPASTRCSRCKAVRYCSGKCQIIHWRQGH  107

Query  761  KDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEG----IETEERNTPGSIDASFAEPT  928
            +DECHP     +    K   D K FR E +EG        + TE+  T    +A  ++P 
Sbjct  108  RDECHPASVLYNTDDEKSDCDLK-FR-EGSEGLTPDETLLLHTEQATTVQVREAILSDPV  165

Query  929  CSEPSISG--AENTEDVME  979
             S     G  A+N +++M+
Sbjct  166  SSPEDGGGESADNKDELMD  184



>dbj|BAD33960.1| putative ubiquitin-specific protease [Oryza sativa Japonica Group]
 gb|EEE69864.1| hypothetical protein OsJ_29670 [Oryza sativa Japonica Group]
Length=940

 Score =   483 bits (1243),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 227/350 (65%), Positives = 269/350 (77%), Gaps = 13/350 (4%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC--  2242
             LFPYE FVKL+N  KVELRPFGL N GNSCYANAVLQCLAFT P TAY  +G HS+ C  
Sbjct  362   LFPYEHFVKLYNFDKVELRPFGLVNLGNSCYANAVLQCLAFTRPLTAYLTEGLHSRNCNL  421

Query  2243  -----------AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDA  2389
                        +KK+WCF CEFE L+L+ + G S LSP  I+SHL +IGSS G GREEDA
Sbjct  422   ILSQNCVTYHGSKKEWCFMCEFEKLILEGRRGKSHLSPTGILSHLRDIGSSFGPGREEDA  481

Query  2390  HEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHER  2569
             HEFLRY I+TMQS  +KEA       L E+T+L+ L FGG+LRSKI+C  C G SE+ ER
Sbjct  482   HEFLRYAIDTMQSASMKEAKKNGVYGLPEETTLVQLIFGGYLRSKIKCTMCQGSSEQCER  541

Query  2570  IMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTI  2749
             I+DLTVEIDGDI +LE AL +FT TEILDG+N+Y+CSRCKSYE+A+KKL I EAPN+LTI
Sbjct  542   ILDLTVEIDGDINTLEEALHRFTSTEILDGDNRYNCSRCKSYERAKKKLTISEAPNILTI  601

Query  2750  ALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYV  2929
             ALKR+QSG FGK+NK + F E LNL++YMS   D SP+YQLY V+ H DVMNAAFSGHYV
Sbjct  602   ALKRYQSGNFGKINKAVRFTEYLNLSNYMSTADDISPVYQLYAVVVHHDVMNAAFSGHYV  661

Query  2930  CYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSL  3079
             CYVK+ Q KW K++DS+VKPV +E VLSK AYML Y+RCSPRAP  +R +
Sbjct  662   CYVKDTQGKWHKMDDSQVKPVSLEKVLSKCAYMLFYARCSPRAPNSVRKM  711


 Score = 70.9 bits (172),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 54/118 (46%), Gaps = 17/118 (14%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP-VNNNHD------SYGKGA  817
            C  C    + RC RCK V+YC+ KCQI HWR GHKDECHPP V+   D      S  KG 
Sbjct  118  CVVCRRPTTFRCKRCKGVKYCTFKCQISHWRQGHKDECHPPRVDARPDNITVVSSVKKGV  177

Query  818  NDFKVFRQEANEGYAEGIETEERNTPGSIDASFAEPTCSEPSI--SGAENTEDVMEGK  985
              +  F Q         +E  +        +  A P  SE ++   G +N    M G+
Sbjct  178  GMYNSFEQSVKSSVEPAVEVNK--------SVAAVPELSEANLVSDGVDNERKKMRGQ  227



>ref|XP_010433753.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Camelina 
sativa]
Length=1014

 Score =   484 bits (1245),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 251/427 (59%), Positives = 317/427 (74%), Gaps = 10/427 (2%)
 Frame = +2

Query  1793  KARQVESLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkss  1972
             K  +V+ L++KA N    ++  +H   GAK+ ++   Q     +    +S   +SGLK+S
Sbjct  440   KVGEVQLLASKASNTRECTDVMKHSPLGAKTGRVLDHQKQNGLTLHHINSLHGRSGLKAS  499

Query  1973  vskvvdQLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGN  2152
               KVVDQ +  KS      A +E+ GR+  KGLFPYE F KL+ + K+E +P GL N GN
Sbjct  500   ALKVVDQWRRPKS-----SAENEMVGRHGRKGLFPYEDFAKLY-ANKIEFQPCGLINVGN  553

Query  2153  SCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             SC+AN V QCL FTPP T YFLQ FHS+ C  K+ CF C FE LVLKAK G SPLSP  +
Sbjct  554   SCFANVVFQCLMFTPPLTTYFLQQFHSRACPNKEQCFTCGFEKLVLKAKEGKSPLSPNGL  613

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLK--EAGVRTSCSLEEQTSLIGLTFG  2506
             +S L++IG  LGNG+EEDAHEFLR+V++TMQSVC+K  E  +  +  LE+ T+LIGLTFG
Sbjct  614   LSQLQSIGIFLGNGKEEDAHEFLRFVVDTMQSVCIKASEYDMPKTSKLED-TTLIGLTFG  672

Query  2507  GFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRC  2686
             G+LRSKI+CM+C GKSE  E++MDLTVEIDGDI++L+ ALR+FT TEILDGENKY C  C
Sbjct  673   GYLRSKIKCMKCQGKSELCEKMMDLTVEIDGDISTLDDALRRFTRTEILDGENKYRCDSC  732

Query  2687  KSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIY  2866
             KSYE+A+KKLKI E PNVLTIALKRFQ+GKFGKLNK I FPE L+LA Y+SG S+KS  Y
Sbjct  733   KSYERAKKKLKITEPPNVLTIALKRFQAGKFGKLNKFIRFPETLDLAPYVSGGSEKSHDY  792

Query  2867  QLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRC  3046
             +LYGVI H D+MNAAFSGHYVCY++N QNKW+K +DS +   ++E +L+KGAYML Y+RC
Sbjct  793   KLYGVIVHLDIMNAAFSGHYVCYIRN-QNKWYKADDSTIVTSDVERILTKGAYMLFYARC  851

Query  3047  SPRAPKL  3067
             SP  P+L
Sbjct  852   SPMPPRL  858


 Score = 97.8 bits (242),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 66/129 (51%), Gaps = 33/129 (26%)
 Frame = +2

Query  386  LVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsV  565
            + F+ PL+GF+VR KWR A  RREEI RLL+                             
Sbjct  16   ISFVLPLIGFVVRHKWRVAAQRREEIRRLLI-----------------------------  46

Query  566  VGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIH  745
                  +   A A   ++L    VA    + C  C+  A+TRCSRCK+VRYCSGKCQIIH
Sbjct  47   ----HASEEAARAEQEASLEFSSVAVSNVFHCPVCYCLATTRCSRCKSVRYCSGKCQIIH  102

Query  746  WRLGHKDEC  772
            WR GHKDEC
Sbjct  103  WRQGHKDEC  111



>ref|XP_010448548.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Camelina 
sativa]
Length=1014

 Score =   484 bits (1245),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 250/427 (59%), Positives = 316/427 (74%), Gaps = 10/427 (2%)
 Frame = +2

Query  1793  KARQVESLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkss  1972
             K  +V+ L++KA N    ++  +H   GAK+ ++   Q     +    +S   + GLK+S
Sbjct  440   KVGEVQLLASKASNTRECTDVMKHSPLGAKTGRVLDHQKQNGVTVHHINSLHGRCGLKAS  499

Query  1973  vskvvdQLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGN  2152
               KVVDQ +  KS      + +E+ GR+  KGLFPYE F KL+ + K+E +P GL N GN
Sbjct  500   AQKVVDQWRRPKS-----SSENEMVGRHGRKGLFPYEDFAKLY-TNKIEFQPCGLINVGN  553

Query  2153  SCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             SC+AN V QCL FTPP T YFLQ FHS+ C  K+ CF C FE LVLKAK G SPLSP  +
Sbjct  554   SCFANVVFQCLMFTPPLTTYFLQQFHSRACPNKEQCFTCGFEKLVLKAKEGKSPLSPNGL  613

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLK--EAGVRTSCSLEEQTSLIGLTFG  2506
             +S L++IG  LGNG+EEDAHEFLR+V++TMQSVC+K  E  +  +  LE+ T+LIGLTFG
Sbjct  614   LSQLQSIGIFLGNGKEEDAHEFLRFVVDTMQSVCIKASENDMPKTSKLED-TTLIGLTFG  672

Query  2507  GFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRC  2686
             G+LRSKI+CM+C GKSE  E++MDLTVEIDGDI++L+ ALR+FT TEILDGENKY C  C
Sbjct  673   GYLRSKIKCMKCQGKSELREKMMDLTVEIDGDISTLDDALRRFTRTEILDGENKYRCDSC  732

Query  2687  KSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIY  2866
             KSYE+A+KKLKI E PNVLTIALKRFQ+GKFGKLNK I FPE L+LA Y+SG S+KS  Y
Sbjct  733   KSYERAKKKLKITEPPNVLTIALKRFQAGKFGKLNKFIRFPETLDLAPYVSGGSEKSHDY  792

Query  2867  QLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRC  3046
             +LYGVI H D+MNAAFSGHYVCY++N QNKW+K +DS V   ++E +L+KGAYML Y+RC
Sbjct  793   KLYGVIVHLDIMNAAFSGHYVCYIRN-QNKWYKADDSTVVTSDVERILTKGAYMLFYARC  851

Query  3047  SPRAPKL  3067
             SP  P+L
Sbjct  852   SPMPPRL  858


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 67/131 (51%), Gaps = 33/131 (25%)
 Frame = +2

Query  386  LVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsV  565
            + F+ PL+GF+VR KWR A  RREEI RLL+                             
Sbjct  16   ISFVLPLIGFVVRHKWRVAAQRREEIRRLLI-----------------------------  46

Query  566  VGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIH  745
                   A  A    S   +SV V+    + C  C+  A+TRCSRCK+VRYCSGKCQIIH
Sbjct  47   --HASEEAARAEQEASFEFSSVAVSNV--FHCPVCYCLATTRCSRCKSVRYCSGKCQIIH  102

Query  746  WRLGHKDECHP  778
            WR GHKDEC P
Sbjct  103  WRQGHKDECRP  113



>ref|XP_002445647.1| hypothetical protein SORBIDRAFT_07g023330 [Sorghum bicolor]
 gb|EES15142.1| hypothetical protein SORBIDRAFT_07g023330 [Sorghum bicolor]
Length=998

 Score =   482 bits (1240),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 231/369 (63%), Positives = 278/369 (75%), Gaps = 7/369 (2%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYELFVKL+   KVEL PFGL N GNSCYANAVLQCL FT P T Y L+G HSK C++
Sbjct  447   LFPYELFVKLYG--KVELNPFGLHNVGNSCYANAVLQCLMFTRPLTTYLLEGLHSKNCSQ  504

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             K WCF CEFE L+++ K   + LSP  I+SHL +IGSSLG G++EDAHEFLRY I+ MQS
Sbjct  505   KGWCFMCEFEKLIVEGKRRKTALSPTGILSHLHDIGSSLGPGKQEDAHEFLRYAIDAMQS  564

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VC+KEA         E+T+L+ L FGG+LRSKI+C RC   SE+ E ++DLTVEIDGDI+
Sbjct  565   VCMKEASKGGVIQSMEETTLVQLIFGGYLRSKIKCSRCHVSSEQCEPMLDLTVEIDGDIS  624

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             SL+ AL +FT TE+LDGENKYHCSRCKSYE+A+KKL I EAPNVLTIALKR+QSGKFGK+
Sbjct  625   SLDEALERFTSTEVLDGENKYHCSRCKSYERAKKKLTIEEAPNVLTIALKRYQSGKFGKI  684

Query  2789  NKTITFPEILNLASYMS-GTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +K I FP+ LN+  YM+  T D SP+Y LY V+ H DVMNAAFSGHYVCYVK+ Q KWFK
Sbjct  685   SKAIRFPDTLNMGHYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVKDTQGKWFK  744

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSSSHTNSW  3145
              +DS+VKPV +++V+SK AYMLLY+RCSPRAP  +R     DP   K    K  S   +W
Sbjct  745   ADDSQVKPVSLDNVMSKCAYMLLYARCSPRAPSSVRQAMG-DPAHPKKAKQKVVSGGTTW  803

Query  3146  DLSKGDSTN  3172
                +G S N
Sbjct  804   ---RGGSLN  809


 Score = 78.2 bits (191),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 47/81 (58%), Gaps = 7/81 (9%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP-VNNNHDSYGKGANDFKVF  835
            CA CF   + RC +CKAV+YCS KCQI HWR GHKD+CHPP VN   D  GK        
Sbjct  121  CAVCFKPTTFRCKQCKAVKYCSFKCQIAHWRQGHKDDCHPPSVNTRPDDEGKAEQG----  176

Query  836  RQEANEGYAEGI-ETEERNTP  895
             + A E  + G+ +  E N P
Sbjct  177  -RAAEENVSVGVKQVAEMNKP  196



>emb|CDY34291.1| BnaA01g13940D [Brassica napus]
Length=1020

 Score =   481 bits (1239),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 227/349 (65%), Positives = 280/349 (80%), Gaps = 4/349 (1%)
 Frame = +2

Query  2030  AWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTA  2209
             A +E+ GR+ +K LF YELFVKL+ + K EL+P GL N GNSC+AN V+QCL FTPP T 
Sbjct  521   AENEMAGRHGHKWLFSYELFVKLY-TNKTELQPCGLINSGNSCFANVVVQCLMFTPPLTT  579

Query  2210  YFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDA  2389
             YFLQ +HS+ C  K+ CF C FE+LVLKA  G S LSP  ++  L+NIG SLGNG++EDA
Sbjct  580   YFLQRYHSRACPNKEQCFTCGFENLVLKATEGKSSLSPNGLLLQLQNIGISLGNGKQEDA  639

Query  2390  HEFLRYVIETMQSVCLK--EAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERH  2563
             HEFLR+V++TMQS+C+K  E  +  +  LE+ T+LIGLTFGG+LRSKI+CM+C  KSER 
Sbjct  640   HEFLRFVVDTMQSLCIKASEYDMPKTRKLED-TTLIGLTFGGYLRSKIKCMKCQEKSERR  698

Query  2564  ERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVL  2743
             E++MDLTVEIDGDI++LE ALR+FT TEILDGENKY C  CKSYE+A+KKLKI E PNVL
Sbjct  699   EKMMDLTVEIDGDISTLEDALRRFTRTEILDGENKYKCGSCKSYERAKKKLKITEPPNVL  758

Query  2744  TIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGH  2923
             TIALKRFQSGKFGKLNK + FPE L+LA Y+SG S+KS  Y+LYGVI H DVMNAAFSGH
Sbjct  759   TIALKRFQSGKFGKLNKLVRFPETLDLAPYVSGGSEKSHDYKLYGVIVHLDVMNAAFSGH  818

Query  2924  YVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             YVCY++N QNKW+K +D+ V   ++E VL+KGAYML Y+RCSP  P+L+
Sbjct  819   YVCYIRNSQNKWYKADDNTVVTSDVERVLTKGAYMLFYARCSPMPPRLV  867


 Score =   106 bits (264),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 92/199 (46%), Gaps = 41/199 (21%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            PL+GF+VR++WR A  RREEI RLL+                                  
Sbjct  22   PLVGFVVRRQWRLAALRREEIRRLLI-------------------------------HAS  50

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
              A       S   +  PV     + C  C+  A TRCSRCKAVRYCSGKCQIIHWR GH
Sbjct  51   EEAARVEREASVEFSFAPVVAN-SFYCPVCYCPALTRCSRCKAVRYCSGKCQIIHWRQGH  109

Query  761  KDECHPPVNNNHDSYGKGANDFKVFRQEANEGY----AEGIETEERNTPGSIDASFAEPT  928
            KDEC P     +    K  +D K    E NEG     A  + +E    P   +A  +EP 
Sbjct  110  KDECQPASITYNTDDEKSDSDLKF--GEGNEGLTRDEAVLLHSEAATVPIR-EAIISEPA  166

Query  929  CSEPSISG--AENTEDVME  979
             S   +SG  A+N +D+++
Sbjct  167  RSSEDVSGESADNKDDLID  185



>ref|XP_006466294.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X2 [Citrus sinensis]
Length=888

 Score =   478 bits (1229),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 238/422 (56%), Positives = 296/422 (70%), Gaps = 25/422 (6%)
 Frame = +2

Query  1991  QLKASKS-RHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q + SK  +  SLG+  E+ G+ N K LFPY+LF+KL++  KVEL PFGL NCGNSCYAN
Sbjct  336   QFRVSKPLKSYSLGSEDEVVGKSNEKPLFPYDLFMKLYSYDKVELYPFGLINCGNSCYAN  395

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFT P T+Y +QG HSK C KK WCF CEFE L+L AK+G+ P+SPI I+S ++
Sbjct  396   AVLQCLAFTRPLTSYLVQGLHSKACQKKGWCFICEFECLILNAKDGSYPVSPIGILSKIQ  455

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG+GREEDAHEFLR  ++TMQSVCLKE G +    + E+T+LIGLTFGG+LRSKI
Sbjct  456   KIGSHLGHGREEDAHEFLRCAVDTMQSVCLKEFGAKG--KIAEETTLIGLTFGGYLRSKI  513

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +C++C GKSE +ER+MDLTVEIDGDI +LE AL QFT +EIL GENKY+CSRCKSYEKA+
Sbjct  514   KCLKCLGKSELYERMMDLTVEIDGDIGTLEEALAQFTASEILVGENKYYCSRCKSYEKAK  573

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL                 SG FGKLNK++ FPE+LN+A YMS T D SP+Y LY V+ 
Sbjct  574   KKL----------------TSGNFGKLNKSVWFPEVLNMAPYMSRTGDGSPMYSLYAVVV  617

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DV NA FSGHYVCYVKN   +WF+++DS V PV++E VLS+ AYMLLY+R SPR P L
Sbjct  618   HLDVTNATFSGHYVCYVKNSHEEWFRIDDSTVIPVKLERVLSEEAYMLLYARHSPRPPAL  677

Query  3068  IRSLTSHDPRGQKY------VNCKSSSHTNSWDLSKGDSTNDPACRECFNSVQASSWPHR  3229
             IR+  SH  + +K       +N  S   +NS+  S         C +         W  R
Sbjct  678   IRNNVSHGVKSKKKSLEAVGLNNTSKIRSNSYIPSLDSKAQQKPCTDSNQLFDRDEWKFR  737

Query  3230  TI  3235
             ++
Sbjct  738   SM  739


 Score = 92.0 bits (227),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 61/121 (50%), Gaps = 31/121 (26%)
 Frame = +2

Query  416  LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaavp  595
            L+RQK ++A AR+EE+ +L+                             V  +E      
Sbjct  23   LIRQKCKNAVARKEEVTKLMA----------------------------VAAEESLMEEF  54

Query  596  apapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
              A   S L S P      YQCA CF S +TRCSRCKAVRYCSGKCQI HWR GHKDEC 
Sbjct  55   QAANQHSFLPSSPPRL---YQCAVCFRSTTTRCSRCKAVRYCSGKCQIFHWRQGHKDECR  111

Query  776  P  778
            P
Sbjct  112  P  112



>ref|XP_009138224.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 [Brassica 
rapa]
Length=1020

 Score =   481 bits (1238),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 227/349 (65%), Positives = 279/349 (80%), Gaps = 4/349 (1%)
 Frame = +2

Query  2030  AWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTA  2209
             A +E+ GR+ +K LF YELFVKL+ + K EL+P GL N GNSC+AN V QCL FTPP T 
Sbjct  521   AENEMAGRHGHKWLFSYELFVKLY-TNKTELQPCGLINSGNSCFANVVFQCLMFTPPLTT  579

Query  2210  YFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDA  2389
             YFLQ +HS+ C  K+ CF C FE+LVLKA  G S LSP  ++  L+NIG SLGNG++EDA
Sbjct  580   YFLQRYHSRACPNKEQCFTCGFENLVLKATEGKSSLSPNGLLLQLQNIGISLGNGKQEDA  639

Query  2390  HEFLRYVIETMQSVCLK--EAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERH  2563
             HEFLR+V++TMQS+C+K  E  +  +  LE+ T+LIGLTFGG+LRSKI+CM+C  KSER 
Sbjct  640   HEFLRFVVDTMQSLCIKASEYDMPKTRKLED-TTLIGLTFGGYLRSKIKCMKCQEKSERR  698

Query  2564  ERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVL  2743
             E++MDLTVEIDGDI++LE ALR+FT TEILDGENKY C  CKSYE+A+KKLKI E PNVL
Sbjct  699   EKMMDLTVEIDGDISTLEDALRRFTRTEILDGENKYKCGSCKSYERAKKKLKITEPPNVL  758

Query  2744  TIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGH  2923
             TIALKRFQSGKFGKLNK + FPE L+LA Y+SG S+KS  Y+LYGVI H DVMNAAFSGH
Sbjct  759   TIALKRFQSGKFGKLNKLVRFPETLDLAPYVSGGSEKSHDYKLYGVIVHLDVMNAAFSGH  818

Query  2924  YVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             YVCY++N QNKW+K +D+ V   ++E VL+KGAYML Y+RCSP  P+L+
Sbjct  819   YVCYIRNSQNKWYKADDNTVVTSDVERVLTKGAYMLFYARCSPMPPRLV  867


 Score =   103 bits (258),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 91/199 (46%), Gaps = 41/199 (21%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            PL+GF+VR++WR A  RREEI RLL+                                  
Sbjct  22   PLVGFVVRRQWRLAALRREEIRRLLI-------------------------------HAS  50

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
              A       S   +  PV     + C  C+  A TRCSRCKAVRYCSGKCQIIHWR GH
Sbjct  51   EEAARVEREASVEFSFAPVVAN-SFYCPVCYCPALTRCSRCKAVRYCSGKCQIIHWRQGH  109

Query  761  KDECHPPVNNNHDSYGKGANDFKVFRQEANEGY----AEGIETEERNTPGSIDASFAEPT  928
            KDEC P     +    K  +D      E NEG     A  + +E    P   +A  +EP 
Sbjct  110  KDECQPASITYNTDDEKSDSDLNF--GEGNEGLTRDEAVLLHSEAATVPIR-EAIISEPA  166

Query  929  CSEPSISG--AENTEDVME  979
             S   +SG  A+N +D+++
Sbjct  167  RSSEDVSGESADNKDDLID  185



>ref|XP_010239389.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Brachypodium 
distachyon]
Length=909

 Score =   476 bits (1225),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 217/337 (64%), Positives = 266/337 (79%), Gaps = 0/337 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYELF KL+N  KVELRPFGL N GNSCY NAVLQCLAFT P TAY  +G HSK C+K
Sbjct  387   LFPYELFTKLYNFDKVELRPFGLCNLGNSCYVNAVLQCLAFTRPLTAYLFEGLHSKKCSK  446

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             K+WCF CEFE L+++ K G SPLSP  I+SHL +IGSS G G+EEDAHEFLRY I+T+Q 
Sbjct  447   KEWCFLCEFEKLIVEGKAGKSPLSPTGILSHLHDIGSSFGLGKEEDAHEFLRYAIDTIQR  506

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
               +KEA       L E+T+L+ L FGGF+RS+I+C +C   S + ERI+DLTVEIDGDI+
Sbjct  507   ASMKEAEKNGVGKLAEETTLMQLMFGGFVRSQIKCTKCQVSSGQCERILDLTVEIDGDIS  566

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             +LE AL QFT TE+LDG+NKYHCSRC SYE+A+KKL I EAPN+LTIALKR+Q+G  GK+
Sbjct  567   TLEEALHQFTSTEVLDGDNKYHCSRCNSYERAKKKLTIYEAPNILTIALKRYQTGSSGKI  626

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             NK I+FPE LNL+SYMS T+D SP+Y+LY V+ H DV NAAFSGHYVCYVK+   KW ++
Sbjct  627   NKAISFPECLNLSSYMSTTNDYSPVYRLYAVVVHHDVQNAAFSGHYVCYVKDSHEKWHEM  686

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSL  3079
             +D +VK V +E VL+K AYML Y+RCSPR P+ +R +
Sbjct  687   DDRQVKSVSLEKVLTKCAYMLFYARCSPRTPRSLRKV  723



>emb|CBI35523.3| unnamed protein product [Vitis vinifera]
Length=723

 Score =   468 bits (1204),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 219/338 (65%), Positives = 264/338 (78%), Gaps = 12/338 (4%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
               +ASK S+   LG  + I G+YN+K LFPYELF++L++ +KVEL PFGL NCGNSCYAN
Sbjct  310   HFRASKQSKPQLLGIGNGIAGKYNHKMLFPYELFMELYSWEKVELSPFGLMNCGNSCYAN  369

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCA---------KKDWCFNCEFESLVLKAKNGNSPLS  2320
             AVLQCL FT P  +Y LQG HSK C          K+DWCF CEFE L+L+A+ G SPLS
Sbjct  370   AVLQCLTFTRPLASYLLQGLHSKACKFLFMTPLCPKEDWCFICEFECLILEAREGKSPLS  429

Query  2321  PIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLT  2500
             P+ I+S ++ IGS LG+GREEDAHEFLRY ++TMQSVCLK+ GV     L E T+L+GLT
Sbjct  430   PMGILSQIQRIGSHLGHGREEDAHEFLRYAVDTMQSVCLKDTGVVGP--LAEDTTLVGLT  487

Query  2501  FGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCS  2680
             FGG+L SKI+CM+C GKSER ER+MDLTVEIDGDI +LE AL QFT TEILDGENKY C 
Sbjct  488   FGGYLLSKIKCMKCRGKSERCERMMDLTVEIDGDIGTLEEALAQFTATEILDGENKYQCG  547

Query  2681  RCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSP  2860
             RC+SYEKA+KKL +LEAPN+LTI LKRFQS  FGKLNK++ FPE LN+  YMSGT D+ P
Sbjct  548   RCRSYEKAKKKLMVLEAPNILTIVLKRFQSSNFGKLNKSVRFPETLNMTPYMSGTDDRYP  607

Query  2861  IYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVND  2974
             +Y LY V+ H D+MNAAFSGHYVC+VKNF   WF+++D
Sbjct  608   VYSLYAVVVHLDIMNAAFSGHYVCFVKNFLGDWFRIDD  645


 Score = 97.4 bits (241),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 75/146 (51%), Gaps = 36/146 (25%)
 Frame = +2

Query  380  AFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            + +VF+   +G ++RQKWR+A  R+EEI RL+                            
Sbjct  11   SLVVFV---VGVILRQKWRNAAERKEEIMRLVA---------------------------  40

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                     A       +   +S+PVAR+  YQCA C+  A+TRCS+CKAVRYCSGKCQI
Sbjct  41   ----MASEEAAAVELEAAVEYSSIPVARR--YQCAACYGPATTRCSQCKAVRYCSGKCQI  94

Query  740  IHWRLGHKDECHPPVNNNHDSYGKGA  817
             HWR GHK+EC PP   +   +  G+
Sbjct  95   KHWRQGHKNECVPPTPTSAMQFNDGS  120



>gb|EAZ07363.1| hypothetical protein OsI_29613 [Oryza sativa Indica Group]
Length=978

 Score =   476 bits (1224),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 225/343 (66%), Positives = 269/343 (78%), Gaps = 4/343 (1%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             FPYELF+KL+  +KVEL+PFGL N GNSCYANAVLQCL FT P T+Y L G HSK C+KK
Sbjct  433   FPYELFIKLY--EKVELQPFGLHNLGNSCYANAVLQCLMFTRPLTSYLLGGLHSKNCSKK  490

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
             +WCF CEFE LV + + G   LSP  I+SHL +IGSS G G++EDAHEFLRY I+ MQSV
Sbjct  491   EWCFMCEFEKLVGEGRQGKIALSPTGILSHLPDIGSSFGPGKQEDAHEFLRYAIDAMQSV  550

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
             C+KEA    +  L E+T+L+ L FGG+LRSKI C RC   SE+HERI+DLTVEIDGDI+S
Sbjct  551   CMKEARKSGTHRLHEETTLMQLIFGGYLRSKIRCTRCDATSEQHERILDLTVEIDGDISS  610

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LEGAL +FT TE+LDG+NKY CSRCKS+E+A+KKL I EAPNVLTIALKR+QSGKFGK+N
Sbjct  611   LEGALERFTSTEVLDGDNKYKCSRCKSHERAKKKLTISEAPNVLTIALKRYQSGKFGKIN  670

Query  2792  KTITFPEILNLASYMSGTSDK-SPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             K I FPE LNL  YMS  +D  SP  Q      H D+MNAAFSGHYVCYVK+   KW+K 
Sbjct  671   KAIRFPETLNLQRYMSPKADDTSPGLQPVCSGVHHDIMNAAFSGHYVCYVKDTHGKWYKT  730

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR-SLTSHDP  3094
             +DS+VKPV +E+V+SK AYMLLY+RCSPRAP  +R +L + DP
Sbjct  731   DDSQVKPVSLENVMSKCAYMLLYARCSPRAPSSVRPALMAQDP  773


 Score = 72.8 bits (177),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP-VNNNHD  799
            CA CF   + RC +CKAV+YCS KCQI HWR GHK+EC PP  + NHD
Sbjct  123  CAVCFRPTTFRCKQCKAVKYCSFKCQIAHWRQGHKNECRPPSTDANHD  170



>tpg|DAA48490.1| TPA: putative ubiquitin carboxyl-terminal hydrolase superfamily 
protein [Zea mays]
Length=973

 Score =   475 bits (1222),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 224/343 (65%), Positives = 267/343 (78%), Gaps = 4/343 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYELFVKL++  KVEL PFGL N GNSCYANAV QCL FT P T Y L+G HSK C++
Sbjct  442   LFPYELFVKLYS--KVELHPFGLHNLGNSCYANAVFQCLMFTRPLTTYLLEGLHSKNCSQ  499

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
               WCF CEFE L+++ K     LSP  I+SHL +IGSS G G++EDAHEFLRY I+ MQS
Sbjct  500   NGWCFMCEFEKLIVEGKRRKIALSPTGILSHLNDIGSSFGPGKQEDAHEFLRYAIDAMQS  559

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VC+KEA         E+T+L+ L FGG+LRSKI+C RC   SE+ E ++DLTVEIDGDI+
Sbjct  560   VCMKEARKGGVLQSAEETTLVQLIFGGYLRSKIKCSRCHVSSEQCEPMLDLTVEIDGDIS  619

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             SL  AL +FT TE+LDGENKYHCSRCKSYE+A+KKL I EAPN+LTIALKR+QSGKFGK+
Sbjct  620   SLGEALVRFTSTEVLDGENKYHCSRCKSYERAKKKLTIEEAPNILTIALKRYQSGKFGKI  679

Query  2789  NKTITFPEILNLASYMS-GTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +K I FPE LNLA YM+  T D SP+Y LY V+ H DVMNAAFSGHYVCYVK+ Q KWFK
Sbjct  680   SKAIRFPETLNLARYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVKDTQGKWFK  739

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDP  3094
              +DS+VKPV +++V+SK AYMLLY+RCSPRAP  +R   S DP
Sbjct  740   ADDSQVKPVSLDNVMSKCAYMLLYARCSPRAPSSVRQAMS-DP  781


 Score = 77.8 bits (190),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 60/122 (49%), Gaps = 15/122 (12%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP-VNNNHDSYGKGANDFKVF  835
            CA CF   + RC +CKAV+YCS KCQI HWR GHKDECHPP VN   D   + A   K  
Sbjct  115  CAVCFRPTTFRCKQCKAVKYCSFKCQIAHWRQGHKDECHPPSVNTRPDDEEEKAEVGKSA  174

Query  836  RQEANEGY---------AEGIETEERN-----TPGSIDASFAEPTCSEPSISGAENTEDV  973
            ++ A+ G          A G ET + N     + G      +E  C+   I G   +   
Sbjct  175  KENASVGVKQDAQMNKPAVGSETSDANHDLKSSNGKSKHMPSEAVCTSAEIPGGHKSNST  234

Query  974  ME  979
            +E
Sbjct  235  VE  236



>ref|XP_008678623.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X2 [Zea mays]
Length=886

 Score =   472 bits (1215),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 222/347 (64%), Positives = 266/347 (77%), Gaps = 3/347 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYELFV+L+   KVELRPFGL N GNSCYANAVLQCL FT P T Y L+G HSK C++
Sbjct  315   LFPYELFVRLY--VKVELRPFGLHNLGNSCYANAVLQCLMFTRPLTTYLLEGLHSKNCSQ  372

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
               WCF CEFE L+++ K     LSP  I+SHL +IGSS G G++EDAHEFLRY I+ MQS
Sbjct  373   NGWCFMCEFEKLIVEGKRRKIALSPTGILSHLNDIGSSFGPGKQEDAHEFLRYAIDAMQS  432

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VC KEA         E+T+L+ L FGG+LRSKI+C RC   SE+ E ++DLTVEIDGDI+
Sbjct  433   VCTKEARKGGVLRSAEETTLVQLIFGGYLRSKIKCSRCHVSSEQCEPMLDLTVEIDGDIS  492

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             SL+ AL +FT TE LDGENKYHCSRCKSYE+A+KKL I EAPN+LTIALKR+QSGKFGK+
Sbjct  493   SLDEALVRFTSTEALDGENKYHCSRCKSYERAKKKLTIEEAPNILTIALKRYQSGKFGKI  552

Query  2789  NKTITFPEILNLASYMS-GTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +K I FPE LN+  YM+  T D SP+Y LY V+ H DVMNAAFSGHYVCYVK+   KWFK
Sbjct  553   SKAIRFPETLNIVCYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVKDTHGKWFK  612

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQK  3106
              +DS+VKPV +++V+SK AYMLLY+RCSPRAP  +R   S   R +K
Sbjct  613   ADDSQVKPVSLDNVMSKCAYMLLYARCSPRAPSSVRQAISDPARPKK  659



>gb|KHG26104.1| Ubiquitin carboxyl-terminal hydrolase 17 [Gossypium arboreum]
Length=960

 Score =   474 bits (1220),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 232/368 (63%), Positives = 281/368 (76%), Gaps = 18/368 (5%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q+K SK S+ +  G  +E   ++N K +FPYELF++L++   VEL PFGL NCGNSCYAN
Sbjct  430   QIKTSKQSKSHLFGFGNEGDKKHNYKIIFPYELFMELYSYDAVELCPFGLNNCGNSCYAN  489

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFT P T+Y ++G HSK C                 AK G SPLSPIRI+S ++
Sbjct  490   AVLQCLAFTRPLTSYLVKGLHSKACK--------------FLAKEGESPLSPIRILSKIQ  535

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS+LG G+EEDAHEFLRY ++ MQSVCLKEA  R +  L E+TSLIGLTFGG+L SKI
Sbjct  536   KIGSNLGPGKEEDAHEFLRYAVDAMQSVCLKEA--RAAGPLAEETSLIGLTFGGYLHSKI  593

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +CM+C GKSE +ER+MDLTVEIDGDI SLE AL QFT  EILDGENKYHC RCKSY KA 
Sbjct  594   KCMKCLGKSELYERMMDLTVEIDGDIGSLEEALAQFTAREILDGENKYHCIRCKSYVKAS  653

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL +LE+PN+LTI LKRFQSG FGKLNK++ FPE+L+LA YMSG+S K+ IY LY V+ 
Sbjct  654   KKLTVLESPNILTIVLKRFQSGNFGKLNKSVQFPEVLDLAPYMSGSSSKAVIYNLYAVVV  713

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DVM+ AFSGHYVCYVKNF+ +WF+++DS V PV +E VL + AYMLLY+R SP AP L
Sbjct  714   HLDVMDTAFSGHYVCYVKNFRGEWFRIDDSTVIPVSLERVLLERAYMLLYARRSPIAPAL  773

Query  3068  IR-SLTSH  3088
             +R +L SH
Sbjct  774   VRKNLDSH  781


 Score = 85.5 bits (210),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 59/124 (48%), Gaps = 36/124 (29%)
 Frame = +2

Query  416  LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaavp  595
            ++R K ++A AR+EE+ RLL                             +V  E      
Sbjct  78   IIRHKLKNAAARKEEVTRLL----------------------------EMVSHETAYVEA  109

Query  596  apapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
                      +V       +QCA CF+  +TRCS+CK+VRYCSGKCQI+HWR GHK ECH
Sbjct  110  Q--------ATVEYGYYPKFQCAVCFAPTTTRCSQCKSVRYCSGKCQIVHWRQGHKGECH  161

Query  776  PPVN  787
            P  +
Sbjct  162  PATD  165



>ref|XP_008678622.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X1 [Zea mays]
Length=888

 Score =   472 bits (1214),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 222/347 (64%), Positives = 266/347 (77%), Gaps = 3/347 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYELFV+L+   KVELRPFGL N GNSCYANAVLQCL FT P T Y L+G HSK C++
Sbjct  317   LFPYELFVRLY--VKVELRPFGLHNLGNSCYANAVLQCLMFTRPLTTYLLEGLHSKNCSQ  374

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
               WCF CEFE L+++ K     LSP  I+SHL +IGSS G G++EDAHEFLRY I+ MQS
Sbjct  375   NGWCFMCEFEKLIVEGKRRKIALSPTGILSHLNDIGSSFGPGKQEDAHEFLRYAIDAMQS  434

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VC KEA         E+T+L+ L FGG+LRSKI+C RC   SE+ E ++DLTVEIDGDI+
Sbjct  435   VCTKEARKGGVLRSAEETTLVQLIFGGYLRSKIKCSRCHVSSEQCEPMLDLTVEIDGDIS  494

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             SL+ AL +FT TE LDGENKYHCSRCKSYE+A+KKL I EAPN+LTIALKR+QSGKFGK+
Sbjct  495   SLDEALVRFTSTEALDGENKYHCSRCKSYERAKKKLTIEEAPNILTIALKRYQSGKFGKI  554

Query  2789  NKTITFPEILNLASYMS-GTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +K I FPE LN+  YM+  T D SP+Y LY V+ H DVMNAAFSGHYVCYVK+   KWFK
Sbjct  555   SKAIRFPETLNIVCYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVKDTHGKWFK  614

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQK  3106
              +DS+VKPV +++V+SK AYMLLY+RCSPRAP  +R   S   R +K
Sbjct  615   ADDSQVKPVSLDNVMSKCAYMLLYARCSPRAPSSVRQAISDPARPKK  661



>ref|XP_008664540.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
17-like [Zea mays]
Length=998

 Score =   475 bits (1222),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 224/343 (65%), Positives = 267/343 (78%), Gaps = 4/343 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYELFVKL++  KVEL PFGL N GNSCYANAV QCL FT P T Y L+G HSK C++
Sbjct  442   LFPYELFVKLYS--KVELHPFGLHNLGNSCYANAVFQCLMFTRPLTTYLLEGLHSKNCSQ  499

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
               WCF CEFE L+++ K     LSP  I+SHL +IGSS G G++EDAHEFLRY I+ MQS
Sbjct  500   NGWCFMCEFEKLIVEGKRRKIALSPTGILSHLNDIGSSFGPGKQEDAHEFLRYAIDAMQS  559

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
             VC+KEA         E+T+L+ L FGG+LRSKI+C RC   SE+ E ++DLTVEIDGDI+
Sbjct  560   VCMKEARKGGVLQSAEETTLVQLIFGGYLRSKIKCSRCHVSSEQCEPMLDLTVEIDGDIS  619

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             SL  AL +FT TE+LDGENKYHCSRCKSYE+A+KKL I EAPN+LTIALKR+QSGKFGK+
Sbjct  620   SLGEALVRFTSTEVLDGENKYHCSRCKSYERAKKKLTIEEAPNILTIALKRYQSGKFGKI  679

Query  2789  NKTITFPEILNLASYMS-GTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +K I FPE LNLA YM+  T D SP+Y LY V+ H DVMNAAFSGHYVCYVK+ Q KWFK
Sbjct  680   SKAIRFPETLNLARYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVKDTQGKWFK  739

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDP  3094
              +DS+VKPV +++V+SK AYMLLY+RCSPRAP  +R   S DP
Sbjct  740   ADDSQVKPVSLDNVMSKCAYMLLYARCSPRAPSSVRQAMS-DP  781


 Score = 77.8 bits (190),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 60/122 (49%), Gaps = 15/122 (12%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPP-VNNNHDSYGKGANDFKVF  835
            CA CF   + RC +CKAV+YCS KCQI HWR GHKDECHPP VN   D   + A   K  
Sbjct  115  CAVCFRPTTFRCKQCKAVKYCSFKCQIAHWRQGHKDECHPPSVNTRPDDEEEKAEVGKSA  174

Query  836  RQEANEGY---------AEGIETEERN-----TPGSIDASFAEPTCSEPSISGAENTEDV  973
            ++ A+ G          A G ET + N     + G      +E  C+   I G   +   
Sbjct  175  KENASVGVKQDAQMNKPAVGSETSDANHDLKSSNGKSKHMPSEAVCTSAEIPGGHKSNST  234

Query  974  ME  979
            +E
Sbjct  235  VE  236



>emb|CDY11021.1| BnaA03g46800D [Brassica napus]
Length=1009

 Score =   473 bits (1217),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 251/427 (59%), Positives = 312/427 (73%), Gaps = 7/427 (2%)
 Frame = +2

Query  1793  KARQVESLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkss  1972
             K  +V+ LS+K  +    ++  +H + GAKS ++   Q           S + +SG+K+S
Sbjct  437   KVEEVQRLSSKTSDTREFADVMKHSALGAKSGRVLDHQKQNSVDVHRIHSLNGRSGMKAS  496

Query  1973  vskvvdQLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGN  2152
             V K VDQ    KS      A +EI G +++KGLF YELF KL+ SK +E +P GL NCGN
Sbjct  497   VLKDVDQWTKPKSL-----AENEIAGNHSHKGLFSYELFSKLYTSK-IEFQPCGLINCGN  550

Query  2153  SCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             SC+AN V QCL FT P T YFLQ  HS+ C  K+ CF C FE LVL AK G S LSP  +
Sbjct  551   SCFANVVFQCLMFTAPLTTYFLQQLHSRTCPNKEQCFTCGFEKLVLMAKEGKSSLSPSGL  610

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGG  2509
             +S L+NIG  LGNG++EDAHEFLR+V++TMQSVC+K +G     + + E T+LIGLTFGG
Sbjct  611   LSQLQNIGIRLGNGKQEDAHEFLRFVVDTMQSVCIKASGYDMPKTKKLEDTTLIGLTFGG  670

Query  2510  FLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCK  2689
             +LRSKI+CM+C  KSER E++MDLTVEIDGDI++LE AL +FT TEILDGENKY C RCK
Sbjct  671   YLRSKIKCMKCQEKSERREKMMDLTVEIDGDISTLEEALHRFTRTEILDGENKYKCGRCK  730

Query  2690  SYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQ  2869
             SYE+A+KKLKI E PNVLTIALKRFQSGKFGKLNK + FPE L+L  Y+SG S+KS  Y+
Sbjct  731   SYERAKKKLKITEPPNVLTIALKRFQSGKFGKLNKLVRFPETLDLTPYVSGGSEKSHDYK  790

Query  2870  LYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCS  3049
             LYGVI H D MNAAFSGHYVCYV+N QNKW+K +DS V   ++ESVL+KGAYML Y+RCS
Sbjct  791   LYGVIVHLDTMNAAFSGHYVCYVRNSQNKWYKADDSTVVTSDVESVLTKGAYMLFYARCS  850

Query  3050  PRAPKLI  3070
             P  P+L+
Sbjct  851   PTPPRLV  857


 Score =   107 bits (266),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 96/200 (48%), Gaps = 42/200 (21%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            P++ F+VR+KWR A  RREEI RLL+                                  
Sbjct  21   PVVAFVVRRKWRLAALRREEIRRLLI-------------------------------HAS  49

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
              A  A    S   +SV V     +QC  C+S ASTRCSRCKAVRYCSGKCQIIHWR GH
Sbjct  50   QEAARAELESSVEFSSVYVPSS--FQCPVCYSPASTRCSRCKAVRYCSGKCQIIHWRQGH  107

Query  761  KDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEG----IETEERNTPGSI-DASFAEP  925
            +DECHP     +    K   D K FR E NEG        + TE+  T   + +A  + P
Sbjct  108  RDECHPASVLYNTDDEKSDCDLK-FR-EGNEGLTPDETLLLHTEQVTTNVQVREAILSNP  165

Query  926  TCSEPSISG--AENTEDVME  979
              S     G  A+N +++M+
Sbjct  166  VISPEDGGGESADNKDELMD  185



>emb|CDY03441.1| BnaC01g16410D [Brassica napus]
Length=1013

 Score =   471 bits (1213),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 251/427 (59%), Positives = 318/427 (74%), Gaps = 7/427 (2%)
 Frame = +2

Query  1793  KARQVESLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkss  1972
             K  +V+ L++K      S +  +H + GA S ++   Q     +    +S + KSGLK+S
Sbjct  440   KVGEVQVLASKTTKARESPDVVKHSAVGADSGRVIDHQKKNGVAVRRINSLNGKSGLKAS  499

Query  1973  vskvvdQLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGN  2152
             V KVVDQ    KS      A +E+ GR+ +KGLF YELFVKL+ + K EL+P GL N GN
Sbjct  500   VLKVVDQWTKPKSL-----AENEMAGRHGHKGLFSYELFVKLY-TNKTELQPCGLINSGN  553

Query  2153  SCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             SC+AN V QCL FTPP T YFLQ  HS+ C  K+ CF C FE+LVL+A  G S LSP  +
Sbjct  554   SCFANVVFQCLMFTPPLTTYFLQQHHSRACPNKEQCFTCGFENLVLEATEGKSSLSPSGL  613

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGG  2509
             +S L+NIG SLGNG++EDAHEFLR+V++TMQ++C+K +      + + E T+LIGLTFGG
Sbjct  614   LSRLQNIGISLGNGKQEDAHEFLRFVVDTMQTLCIKASEYDEPKTRKLEDTTLIGLTFGG  673

Query  2510  FLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCK  2689
             +LRSKI+CM+C  KSER E++MDLTVEIDGDI++LE ALR+FT TEILDGENKY C RCK
Sbjct  674   YLRSKIKCMKCQEKSERREKMMDLTVEIDGDISTLEDALRRFTRTEILDGENKYKCGRCK  733

Query  2690  SYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQ  2869
             SYE+A+KKLKI+E PNVLTIALKRFQSGKFGKLNK + FPE L+LA Y+SG S+KS  Y+
Sbjct  734   SYERAKKKLKIIEPPNVLTIALKRFQSGKFGKLNKLVRFPETLDLAPYVSGGSEKSHDYK  793

Query  2870  LYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCS  3049
             LYGVI H DVMNAAFSGHYVCY++N QNKW+K +D+ V   ++E VL+KGAYML Y+RCS
Sbjct  794   LYGVIVHLDVMNAAFSGHYVCYIRNSQNKWYKADDNTVVTSDVERVLTKGAYMLFYARCS  853

Query  3050  PRAPKLI  3070
             P  P+L+
Sbjct  854   PMPPRLV  860


 Score =   108 bits (271),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 92/198 (46%), Gaps = 40/198 (20%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            PL+GF+VR++WR A  RREEI RLL+                                  
Sbjct  22   PLIGFVVRRQWRLAALRREEIRRLLI-------------------------------HAS  50

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
              A       S   +  PVA    + C  C+  A TRCSRCKAVRYCSGKCQIIHWR GH
Sbjct  51   EEAARVEREASVEFSFAPVANS--FYCPVCYCPAFTRCSRCKAVRYCSGKCQIIHWRQGH  108

Query  761  KDECHPPVNNNHDSYGKGANDFKVFRQEANEGYA--EGIETEERNTPGSI-DASFAEPTC  931
            KDEC P     +    K  +D K    E NEG    E +        G I +A  +EP  
Sbjct  109  KDECQPASITYNTDDEKSDSDLKC--GEGNEGLTRDETVLLHSEAATGPIREAIISEPAR  166

Query  932  SEPSISG--AENTEDVME  979
            S   +SG  A+N +D+++
Sbjct  167  SSEDVSGESADNKDDLID  184



>ref|XP_011100001.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Sesamum 
indicum]
Length=868

 Score =   464 bits (1193),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 212/342 (62%), Positives = 268/342 (78%), Gaps = 8/342 (2%)
 Frame = +2

Query  2048  GRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGF  2227
             G YN+K +FP++LF++L+    VEL PFGL NCGNSCYANAVLQCL FT P ++Y LQG 
Sbjct  415   GNYNHKVIFPFKLFIQLYACDDVELHPFGLLNCGNSCYANAVLQCLTFTRPISSYLLQGL  474

Query  2228  HSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY  2407
             HSK C K+DWCF C+FE L+ K +  NSPLSP+ ++S ++ IG      REEDAHEFLR 
Sbjct  475   HSKTCRKRDWCFICKFEHLIQKGQEMNSPLSPVGLLSQIQPIG------REEDAHEFLRN  528

Query  2408  VIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTV  2587
             V++ MQSVCL+EAGV  S SL E ++LIGLTFGGFLRSKI+CM+C G+SER +R+MDLTV
Sbjct  529   VVDKMQSVCLEEAGV--SGSLAEDSTLIGLTFGGFLRSKIQCMKCLGRSERCDRMMDLTV  586

Query  2588  EIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQ  2767
             EIDG+I +LE AL+QFT +E L G++KY CSRCKSYEKA+KKL +LEAPN+LTI LKRF+
Sbjct  587   EIDGNIYTLEEALKQFTTSETLGGDDKYKCSRCKSYEKAKKKLTVLEAPNILTIVLKRFR  646

Query  2768  SGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNF  2947
             SG   KLNK + FPE+LNLA YMSG +DK P+Y LY V+ H   MNAA+SGHYV YVK+F
Sbjct  647   SGNLEKLNKIVQFPEVLNLAPYMSGMNDKYPVYDLYAVVVHLGAMNAAYSGHYVSYVKDF  706

Query  2948  QNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR  3073
             Q  WF+++DS+V  V++E+VLS  AY+L Y+R +PR    +R
Sbjct  707   QGDWFRIDDSRVSRVDLETVLSVEAYILFYARQTPRGAFFVR  748


 Score = 87.8 bits (216),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 70/136 (51%), Gaps = 29/136 (21%)
 Frame = +2

Query  383  FLVFIGPLL--GFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysf  556
             LV +  LL  G + R KWR+  A++EEI RL+ +AS E                     
Sbjct  1    MLVIVCALLVLGLVARYKWRNGAAKKEEILRLVAVASRE---------------------  39

Query  557  gsVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQ  736
                 +   A + A    +S +  +P   +  Y CA C    +TRCSRCKAVRYCSGKCQ
Sbjct  40   -----EAETAKLQAFEEYNSPMQPLPQLEK-QYYCAVCRCPTTTRCSRCKAVRYCSGKCQ  93

Query  737  IIHWRLGHKDECHPPV  784
            IIHWR GHKD+C P +
Sbjct  94   IIHWRQGHKDDCRPSI  109



>ref|XP_010681055.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Beta vulgaris 
subsp. vulgaris]
Length=792

 Score =   459 bits (1182),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 216/360 (60%), Positives = 277/360 (77%), Gaps = 8/360 (2%)
 Frame = +2

Query  2036  SEIG--GRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTA  2209
             S IG  G +N K +F ++ F+KL++S  VEL PFGLTNCGNSCYANAVLQCLA+T P T 
Sbjct  334   SSIGTSGNHNYKSMFQHDAFLKLYSSNDVELEPFGLTNCGNSCYANAVLQCLAYTRPLTM  393

Query  2210  YFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDA  2389
             Y LQG HSK C K +WCF CEFE L+LK + G +PLSPIRI+S++    S LG+GREEDA
Sbjct  394   YLLQGLHSKECWKDEWCFVCEFEHLILKGREGYTPLSPIRILSNI----SHLGHGREEDA  449

Query  2390  HEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHER  2569
             HEFLRY ++TMQSVC + AG+  +  + E ++L+G+TFGGFL SKI CM+C  KSE +ER
Sbjct  450   HEFLRYAVDTMQSVCAELAGL--TGPVAEHSTLVGMTFGGFLHSKIRCMKCHNKSEIYER  507

Query  2570  IMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTI  2749
             +MDLTVEIDGD+ +LE ALR+FT +E+L+G+NKY+C+RCKSYEKA+KKL + +APN+LTI
Sbjct  508   MMDLTVEIDGDVRTLEQALRRFTASEMLEGDNKYYCNRCKSYEKAKKKLTVFQAPNILTI  567

Query  2750  ALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYV  2929
              LKRFQ+G F KL K + FPE+LN++ YMS +SDK P Y LY V+ H DV +A FSGHYV
Sbjct  568   VLKRFQAGNFTKLKKPVQFPEMLNMSPYMSHSSDKYPQYSLYAVVVHLDVSSAEFSGHYV  627

Query  2930  CYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKY  3109
             CYVKN++ KWFK++DS V  V++E VLS+ AYMLLY+R SP  P   R+  +  P G  +
Sbjct  628   CYVKNYRKKWFKIDDSVVISVDLERVLSEEAYMLLYARDSPMLPASGRNSYNGKPGGVNF  687


 Score = 78.2 bits (191),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +2

Query  653  YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNH--DSYGKGANDF  826
            Y+CA C S  STRCSRCK VRYCS KCQIIHWR GHK EC+P        D   + A   
Sbjct  62   YECAVCSSLTSTRCSRCKTVRYCSSKCQIIHWRQGHKFECNPQGRGAFEGDHLSRNAETT  121

Query  827  KVFRQEANEGYAEGIETEERNTPGSID  907
            +      N    +    +E+NT G +D
Sbjct  122  EQCETYGNYSADDYPRMDEKNTTGQLD  148



>ref|XP_009137457.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Brassica 
rapa]
Length=1012

 Score =   466 bits (1199),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 249/427 (58%), Positives = 312/427 (73%), Gaps = 7/427 (2%)
 Frame = +2

Query  1793  KARQVESLSTKAPNGHPSSNNRRHDSQGAKSAKIDSAQVTACssdsggdsqssksglkss  1972
             K  +V+ LS+KA +    ++  +H + GAKS ++   Q          +S + +SG+K+S
Sbjct  443   KVGEVQRLSSKASDTRECADAMKHSALGAKSGRVLDHQKQNGLDVHRINSLNGRSGMKAS  502

Query  1973  vskvvdQLKASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGN  2152
             V K VDQ    KS      A +EI G +++KGLF YELF KL+ SK +E +P GL NCGN
Sbjct  503   VLKAVDQWTRPKSL-----AENEIAGNHSHKGLFSYELFSKLYTSK-IEFQPCGLINCGN  556

Query  2153  SCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             SC+AN V QCL FT P T YFLQ  HS+ C  K+ CF C FE LVL AK G S LSP  +
Sbjct  557   SCFANVVFQCLMFTAPLTTYFLQQLHSRTCPNKEQCFTCGFEKLVLMAKEGKSSLSPSGL  616

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGG  2509
             +S L++IG  LGNG++EDAHEFLR+V++TMQSVC+K +G     + + E T+LIGLTFGG
Sbjct  617   LSQLQSIGIRLGNGKQEDAHEFLRFVVDTMQSVCIKASGCDMPKTKKLEDTTLIGLTFGG  676

Query  2510  FLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCK  2689
             +LRSKI+CM+C  KSER E++MDLTVEIDGDI++LE AL +FT TEILDGENKY C  CK
Sbjct  677   YLRSKIKCMKCQEKSERREKMMDLTVEIDGDISTLEEALHRFTRTEILDGENKYKCGSCK  736

Query  2690  SYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQ  2869
             SYE+A+KKLKI E PNVLTIALKRFQSGKFGKLNK + FPE L+L  Y+SG S+KS  Y+
Sbjct  737   SYERAKKKLKITEPPNVLTIALKRFQSGKFGKLNKLVRFPETLDLTPYVSGGSEKSHDYK  796

Query  2870  LYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCS  3049
             LYGVI H D MNAAFSGHYVCYV+N QNKW+K +DS V   ++ESV +KGAYML Y+RCS
Sbjct  797   LYGVIVHLDTMNAAFSGHYVCYVRNSQNKWYKADDSTVVTSDVESVWTKGAYMLFYARCS  856

Query  3050  PRAPKLI  3070
             P  P+L+
Sbjct  857   PTPPRLV  863


 Score =   107 bits (266),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 96/200 (48%), Gaps = 42/200 (21%)
 Frame = +2

Query  401  PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEv  580
            P++ F+VR+KWR A  RREEI RLL+                                  
Sbjct  21   PVVAFVVRRKWRLAALRREEIRRLLI-------------------------------HAS  49

Query  581  paavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGH  760
              A  A    S   +SV V     +QC  C+S ASTRCSRCKAVRYCSGKCQIIHWR GH
Sbjct  50   EEAARAELESSVEFSSVYVPNS--FQCPVCYSPASTRCSRCKAVRYCSGKCQIIHWRQGH  107

Query  761  KDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEG----IETEERNTPGSI-DASFAEP  925
            +DECHP     +    K   D K FR E NEG        + TE+  T   + +A  + P
Sbjct  108  RDECHPASVLYNTDDEKSDCDLK-FR-EGNEGLTPDETLLLHTEQVTTNVQVREAILSNP  165

Query  926  TCSEPSISG--AENTEDVME  979
              S     G  A+N +++M+
Sbjct  166  VISPEDGGGESADNKDELMD  185



>ref|XP_004957062.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X2 [Setaria italica]
Length=887

 Score =   458 bits (1179),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 207/336 (62%), Positives = 262/336 (78%), Gaps = 0/336 (0%)
 Frame = +2

Query  2066  GLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCA  2245
              LFPY+ F++L+N +K+EL PFGL N GNSCYANAVLQCLAFT P TAY L+G+HS+ C+
Sbjct  324   ALFPYKHFIELYNFEKLELHPFGLCNLGNSCYANAVLQCLAFTRPLTAYLLEGYHSRNCS  383

Query  2246  KKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQ  2425
             K +WCF CE E ++ + K G +P+SP  I+SHL  IG+S G GREEDAHEFLRY I+TMQ
Sbjct  384   KMEWCFMCELEKVMTEGKCGKAPVSPTGILSHLNEIGTSFGQGREEDAHEFLRYAIDTMQ  443

Query  2426  SVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             S  +KEA       L E+++L+ L FGG+L+SKI C +C   S + ERI+DLTVEIDGDI
Sbjct  444   SASVKEAKKNGVHKLAEESTLVQLIFGGYLQSKIICTKCQVSSAQSERILDLTVEIDGDI  503

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              +LEGALR+FT +E+LDG+N+YHCSRC SYE+A+KKL I EAPN+LTIALKR+QSG +GK
Sbjct  504   NTLEGALRRFTSSEVLDGDNRYHCSRCMSYERAKKKLMISEAPNILTIALKRYQSGVYGK  563

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             ++K + FPE LNL+ +M  T D SP+Y LY V+ H DVMN   SGHYVCYVK+ Q KW +
Sbjct  564   ISKDVKFPEHLNLSQFMCETDDYSPVYSLYAVVVHHDVMNTTISGHYVCYVKDPQGKWHE  623

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR  3073
             ++DSKVKPV ++ VLSK AYMLLY+RCSPR P  +R
Sbjct  624   MDDSKVKPVSLKKVLSKCAYMLLYARCSPRVPDSVR  659


 Score = 67.8 bits (164),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            CA C    + RC RCK+V+YC+ KCQI HWR GHKDECHP
Sbjct  109  CAMCARPTTLRCKRCKSVKYCTFKCQIDHWRKGHKDECHP  148



>ref|XP_002530694.1| cysteine-type endopeptidase, putative [Ricinus communis]
 gb|EEF31689.1| cysteine-type endopeptidase, putative [Ricinus communis]
Length=777

 Score =   454 bits (1168),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 228/387 (59%), Positives = 284/387 (73%), Gaps = 29/387 (7%)
 Frame = +2

Query  2054  YNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHS  2233
             YN + LFPYELF+KL++  + EL PFGL NCGNSCYAN V+QCLAFT P T+YF++G HS
Sbjct  330   YNYEILFPYELFLKLYSCDE-ELSPFGLRNCGNSCYANTVIQCLAFTRPLTSYFVRGLHS  388

Query  2234  KGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVI  2413
             K C KK WCFNCEF+ L+LKA+ G SPLSPIRI+S ++ IGS LG+GREEDAHEFLRY +
Sbjct  389   KSC-KKGWCFNCEFQLLILKAREGESPLSPIRILSKIQKIGSHLGHGREEDAHEFLRYAV  447

Query  2414  ETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEI  2593
             +TMQSV LKEAG  +   L E+++LI            +CMRC GKSER ERIMDLTVEI
Sbjct  448   DTMQSVFLKEAG--SLVPLSEESTLI------------KCMRCLGKSERFERIMDLTVEI  493

Query  2594  DGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSG  2773
             DG+I SLE AL QFT  E+LDGENKY+CSRCKSY KA+KKL ILEAPN+LTI LKRFQS 
Sbjct  494   DGNIESLEQALTQFTADEMLDGENKYNCSRCKSYVKAKKKLTILEAPNILTIVLKRFQSS  553

Query  2774  KFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQN  2953
              FGKLNK++ FPE+L++A YM GTSDKSP Y LY V+ H D M+ A +GHYVCY+K  + 
Sbjct  554   NFGKLNKSVRFPEVLDMAPYMCGTSDKSPQYSLYAVVVHRDTMSDASTGHYVCYIKTSRG  613

Query  2954  KWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTSHDPRGQKYV------  3112
             +WF +NDS VKPVE++ VL + AYMLLY+R  P+AP + +S + +H  + +K +      
Sbjct  614   EWFGINDSIVKPVELKRVLLEEAYMLLYARHCPQAPAVRKSNVETHCTKSKKRILEAVPA  673

Query  3113  ------NCKSSSHTNSWDLSKGDSTND  3175
                     + +SH +S D SK    +D
Sbjct  674   KNLNTSKTRCNSHFSSTDPSKAQLKHD  700


 Score = 66.2 bits (160),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 72/170 (42%), Gaps = 49/170 (29%)
 Frame = +2

Query  398  GPLLGF-LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGD  574
            G +LG   +  KWR+A A++EEI RL+                                 
Sbjct  14   GLILGTGWLHYKWRNAVAKKEEIKRLV---------------------------------  40

Query  575  EvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAV---------RYCSG  727
            ++ +         S    + V R    QCA CFS  +TRCS+  +V         R  SG
Sbjct  41   DMVSKESEMFEFDSVYQCISVPRL--NQCAVCFSPTTTRCSQFFSVIEVPEEGKERLSSG  98

Query  728  KCQIIHWRLGHKDECHPPVNNNHDSYGKGAND-FKVFRQEANEGYAEGIE  874
            KCQIIHWR GHKDEC P     H    KG N+ F+   ++  E + EG E
Sbjct  99   KCQIIHWRRGHKDECRPLTTAMH---SKGKNESFERSSEKKTEMHTEGSE  145



>ref|XP_010523321.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Tarenaya 
hassleriana]
Length=781

 Score =   450 bits (1158),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 217/344 (63%), Positives = 259/344 (75%), Gaps = 2/344 (1%)
 Frame = +2

Query  2030  AWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTA  2209
             A  E+ GRYN K  FPYE FVKL+    VEL PFGL NCGNSCYANAVLQCLAFT P  +
Sbjct  343   AIDEVTGRYNFKMSFPYETFVKLYFCDGVELHPFGLVNCGNSCYANAVLQCLAFTRPLMS  402

Query  2210  YFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDA  2389
             Y  +G HSK C KK WCF CEF+ L+LK + G SPLSPI+I+S L+ I   LG GR+EDA
Sbjct  403   YLFRGLHSKACRKKSWCFVCEFQHLILKVREGESPLSPIKILSKLQKIAKHLGPGRQEDA  462

Query  2390  HEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHER  2569
             HEFLR  ++TMQSV LKEA         E T+LIGLTFGG+L SKI+CM C  KSER E 
Sbjct  463   HEFLRCAVDTMQSVFLKEADAANQ--FAEDTTLIGLTFGGYLHSKIKCMHCRHKSERSEL  520

Query  2570  IMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTI  2749
             +MDLTVEI+GDI SLE AL QFT  E+LDG N+Y+C RCKSY+KA+KKL ILEAPN+LTI
Sbjct  521   MMDLTVEIEGDIGSLEEALTQFTAYEVLDGNNRYYCGRCKSYKKAKKKLMILEAPNILTI  580

Query  2750  ALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYV  2929
              LKRFQS  F KL+K I FPE+L++A YM+  +D SP+Y LY V+ H DVMN A+SGHYV
Sbjct  581   VLKRFQSDNFEKLSKRIYFPEVLDIAPYMNSPNDSSPLYSLYAVVVHLDVMNTAYSGHYV  640

Query  2930  CYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             CY+K  Q +WF+++DS V  VE+E+VL + AYMLLY+R SPR P
Sbjct  641   CYIKTLQGEWFRIDDSTVTHVELETVLLEEAYMLLYARHSPRPP  684


 Score = 81.3 bits (199),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 61/134 (46%), Gaps = 33/134 (25%)
 Frame = +2

Query  380  AFLVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
              L+    L+  LVR++WR + AR+EE+ RL+                            
Sbjct  11   VLLIGFVLLVFLLVRRQWRASAARKEEVFRLVAF--------------------------  44

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                 E        A  +    S P      ++CA C    +TRC++CK+VRYCS KCQI
Sbjct  45   ---ATEQSYMAEVRAVANYEYVSAPKV----HRCAVCLYPTTTRCAQCKSVRYCSSKCQI  97

Query  740  IHWRLGHKDECHPP  781
            +HWR GHKDEC PP
Sbjct  98   LHWRQGHKDECCPP  111



>gb|EYU30946.1| hypothetical protein MIMGU_mgv1a004116mg [Erythranthe guttata]
Length=543

 Score =   441 bits (1135),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 203/348 (58%), Positives = 266/348 (76%), Gaps = 8/348 (2%)
 Frame = +2

Query  2045  GGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQG  2224
             GG YN K +FP +LF++L++   VEL PFGL NCGNSCYANAVLQCL FT P T+Y LQG
Sbjct  92    GGNYNQKVIFPLKLFMQLYSCDDVELHPFGLVNCGNSCYANAVLQCLTFTRPITSYLLQG  151

Query  2225  FHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLR  2404
              HSK C K+DWCF C+FE L+ K +   SPLSP+ ++S ++ IG      REEDAHEFLR
Sbjct  152   LHSKTCRKRDWCFICKFEHLIQKGQETRSPLSPVGLLSLIQPIG------REEDAHEFLR  205

Query  2405  YVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLT  2584
              V++ MQS+CL+EAG   S  L E ++L+GLTFGG+LRSK++CM+C G+SER ++IMDL+
Sbjct  206   NVVDKMQSICLEEAGA--SGILAEDSTLMGLTFGGYLRSKVKCMKCLGRSERCDQIMDLS  263

Query  2585  VEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRF  2764
             VEI+G+I +LE AL QFT +E L G++KY CSRCKSYEKA+KKL +LEAPN+L I LKRF
Sbjct  264   VEIEGNIYTLEEALVQFTTSETLGGDDKYKCSRCKSYEKAKKKLTVLEAPNILPIVLKRF  323

Query  2765  QSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKN  2944
             +SG   KLNK + FPE+LNL+ YMSGT+DK P+Y LY V+ H  VM AA+SGHYV YVK+
Sbjct  324   RSGNLEKLNKLVQFPEVLNLSPYMSGTNDKYPVYHLYAVVVHLGVMGAAYSGHYVSYVKD  383

Query  2945  FQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSH  3088
              Q  WF+++DS+V  V +++VLS  AY+L Y+R +PR    +R+ T++
Sbjct  384   LQGDWFRIDDSRVSHVNLQTVLSSEAYILFYARHTPRGSSSVRNSTTY  431



>gb|KHG26103.1| Ubiquitin carboxyl-terminal hydrolase 17 [Gossypium arboreum]
Length=992

 Score =   453 bits (1166),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 229/386 (59%), Positives = 282/386 (73%), Gaps = 22/386 (6%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSC---  2158
             Q+K SK S+ +  G  +E   ++N K +FPYELF++L++   VEL PFGL NCGN C   
Sbjct  430   QIKTSKQSKSHLFGFGNEGDKKHNYKIIFPYELFMELYSYDAVELCPFGLNNCGNRCAFE  489

Query  2159  ---------YANAVLQCLAFTPPFTAYFLQGFHSK------GCAKKDWCFNCEFESLVLK  2293
                      ++  V+  L+F+       L    SK         KK+WCF CEFE L+LK
Sbjct  490   LLIYIFPLKFSAVVMLMLSFSVWLLLGHLPHTLSKDSTPKHASRKKEWCFICEFECLILK  549

Query  2294  AKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLE  2473
             AK G SPLSPIRI+S ++ IGS+LG G+EEDAHEFLRY ++ MQSVCLKEA  R +  L 
Sbjct  550   AKEGESPLSPIRILSKIQKIGSNLGPGKEEDAHEFLRYAVDAMQSVCLKEA--RAAGPLA  607

Query  2474  EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEIL  2653
             E+TSLIGLTFGG+L SKI+CM+C GKSE +ER+MDLTVEIDGDI SLE AL QFT  EIL
Sbjct  608   EETSLIGLTFGGYLHSKIKCMKCLGKSELYERMMDLTVEIDGDIGSLEEALAQFTAREIL  667

Query  2654  DGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASY  2833
             DGENKYHC RCKSY KA KKL +LE+PN+LTI LKRFQSG FGKLNK++ FPE+L+LA Y
Sbjct  668   DGENKYHCIRCKSYVKASKKLTVLESPNILTIVLKRFQSGNFGKLNKSVQFPEVLDLAPY  727

Query  2834  MSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLS  3013
             MSG+S K+ IY LY V+ H DVM+ AFSGHYVCYVKNF+ +WF+++DS V PV +E VL 
Sbjct  728   MSGSSSKAVIYNLYAVVVHLDVMDTAFSGHYVCYVKNFRGEWFRIDDSTVIPVSLERVLL  787

Query  3014  KGAYMLLYSRCSPRAPKLIR-SLTSH  3088
             + AYMLLY+R SP AP L+R +L SH
Sbjct  788   ERAYMLLYARRSPIAPALVRKNLDSH  813


 Score = 85.1 bits (209),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 59/124 (48%), Gaps = 36/124 (29%)
 Frame = +2

Query  416  LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaavp  595
            ++R K ++A AR+EE+ RLL                             +V  E      
Sbjct  78   IIRHKLKNAAARKEEVTRLL----------------------------EMVSHETAYVEA  109

Query  596  apapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
                      +V       +QCA CF+  +TRCS+CK+VRYCSGKCQI+HWR GHK ECH
Sbjct  110  Q--------ATVEYGYYPKFQCAVCFAPTTTRCSQCKSVRYCSGKCQIVHWRQGHKGECH  161

Query  776  PPVN  787
            P  +
Sbjct  162  PATD  165



>ref|XP_011097488.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Sesamum 
indicum]
Length=892

 Score =   450 bits (1157),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/342 (60%), Positives = 267/342 (78%), Gaps = 2/342 (1%)
 Frame = +2

Query  2045  GGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQG  2224
              G YN+K +FP +LF++L++   ++L PFGL NCGNSCYANAVLQCL FT P T+Y LQ 
Sbjct  427   AGTYNHKIVFPPKLFMQLYSCDGMKLHPFGLVNCGNSCYANAVLQCLIFTRPLTSYLLQR  486

Query  2225  FHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLR  2404
              HSK C K+DWC  CEFE L+ K +  NSP SP+ I+S ++ IGS L +GREEDAH+FLR
Sbjct  487   LHSKTCRKRDWCLICEFERLIQKGQEMNSPFSPVGILSQIQKIGSHLSHGREEDAHDFLR  546

Query  2405  YVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLT  2584
              V++ MQS+ L+EAGV  S    E ++L+GLTFGG+LRSKI+CM+C  +SE+ +R+MDLT
Sbjct  547   NVVDRMQSIWLEEAGV--SGQWVEDSTLLGLTFGGYLRSKIKCMKCSVRSEQCDRMMDLT  604

Query  2585  VEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRF  2764
             VEI+GDI +LE AL QFT +E L G++KY CSRCKSY+KA+KKL IL+APN+LTI LKRF
Sbjct  605   VEINGDINTLEEALTQFTVSETLGGDDKYKCSRCKSYQKAKKKLTILDAPNILTIVLKRF  664

Query  2765  QSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKN  2944
             +SG   KLNK + FPEILNLA YMSG SDK PIY LY V+ H + MNAA++GHY+CYVK+
Sbjct  665   RSGNLEKLNKLVQFPEILNLAPYMSGMSDKYPIYDLYAVVVHLNAMNAAYTGHYICYVKD  724

Query  2945  FQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             F+ +WF+++DS+V  V++E+VLS  AY+L Y+R + R P L+
Sbjct  725   FRREWFRIDDSRVTHVDLETVLSAEAYILFYARRTLRLPSLV  766


 Score = 77.8 bits (190),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            CA C+   +TRCS+CKAVRYCSGKCQIIHWR GHKD+C P
Sbjct  76   CAVCYRPTTTRCSQCKAVRYCSGKCQIIHWRQGHKDDCRP  115



>gb|KFK28246.1| hypothetical protein AALP_AA8G491300 [Arabis alpina]
Length=764

 Score =   440 bits (1132),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/330 (62%), Positives = 255/330 (77%), Gaps = 5/330 (2%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             F YE+FVKL+ S +VEL+PFGL N GNSCYANAVLQCLAFT P  +Y ++G HSK C KK
Sbjct  337   FSYEIFVKLY-SDRVELQPFGLVNLGNSCYANAVLQCLAFTRPLMSYLIRGLHSKACRKK  395

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
              WCF CEFE L+LKA+ G SPLSPI+I+S L+ IG  LG G+EEDAHEFLR  ++TMQSV
Sbjct  396   SWCFVCEFEYLILKARGGESPLSPIKILSKLQKIGKHLGPGKEEDAHEFLRCAVDTMQSV  455

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
              LKE  V  +    E+T+L+GLTFGG+L SKI+CM+C  KSE+ E +MDLTVEIDGDI S
Sbjct  456   FLKE--VDATGRFAEETTLVGLTFGGYLHSKIKCMKCLHKSEQPELMMDLTVEIDGDIGS  513

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             L+ AL QFT  E+LDGEN+Y C RCKSY+KA+KKL ILE PN+LT+ LKRFQS  FGKL+
Sbjct  514   LQEALTQFTAYEVLDGENRYFCGRCKSYQKAKKKLMILEGPNILTVVLKRFQSDNFGKLS  573

Query  2792  KTITFPEILNLASYMSGTSD--KSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             K I FPE+L+++ YMS  +     P+Y LY V+ H D M+ +FSGHYVCY+K     WFK
Sbjct  574   KPIHFPELLDISPYMSKPNHGGHHPVYSLYAVVVHLDAMSTSFSGHYVCYIKTLHGDWFK  633

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             ++DS V PV++E+VL +GAYMLLY+R SPR
Sbjct  634   IDDSNVFPVQLETVLLEGAYMLLYARDSPR  663


 Score = 80.9 bits (198),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 67/134 (50%), Gaps = 30/134 (22%)
 Frame = +2

Query  386  LVFIG--PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            L+ IG   L+  L+R++WR A  RR+E+ RL+ LA+EE+   E   ++       S    
Sbjct  14   LLLIGFMILVFLLIRRQWRSASIRRDEVIRLVALATEESYVTEIHQSSVDYRSLESCDDD  73

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
             VV                            ++C  C    +TRCS+CK+VRYCS KCQI
Sbjct  74   VVV----------------------------HRCVVCLYPTTTRCSQCKSVRYCSSKCQI  105

Query  740  IHWRLGHKDECHPP  781
            +HWR GHKDEC  P
Sbjct  106  LHWRRGHKDECRSP  119



>ref|NP_201348.1| ubiquitin-specific protease 17 [Arabidopsis thaliana]
 sp|Q9FKP5.1|UBP17_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 17; AltName: 
Full=Deubiquitinating enzyme 17; Short=AtUBP17; AltName: 
Full=Ubiquitin thioesterase 17; AltName: Full=Ubiquitin-specific-processing 
protease 17 [Arabidopsis thaliana]
 dbj|BAB11567.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED98058.1| ubiquitin-specific protease 17 [Arabidopsis thaliana]
Length=731

 Score =   439 bits (1129),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 208/329 (63%), Positives = 252/329 (77%), Gaps = 4/329 (1%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             F YELFVKL+   +VEL+PFGL N GNSCYANAVLQCLAFT P  +Y ++G HSK C KK
Sbjct  311   FSYELFVKLY-CDRVELQPFGLVNLGNSCYANAVLQCLAFTRPLISYLIRGLHSKTCRKK  369

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
              WCF CEFE L+LKA+ G SPLSPI+I+S L+ IG  LG G+EEDAHEFLR  ++TMQSV
Sbjct  370   SWCFVCEFEHLILKARGGESPLSPIKILSKLQKIGKHLGPGKEEDAHEFLRCAVDTMQSV  429

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
              LKEA    +    E+T+L+GLTFGG+L SKI+CM C  KSER E +MDLTVEIDGDI S
Sbjct  430   FLKEAP--AAGPFAEETTLVGLTFGGYLHSKIKCMACLHKSERPELMMDLTVEIDGDIGS  487

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LE AL QFT  E+LDGEN+Y C RCKSY+KA+KKL ILE PN+LT+ LKRFQS  FGKL+
Sbjct  488   LEEALAQFTAYEVLDGENRYFCGRCKSYQKAKKKLMILEGPNILTVVLKRFQSDNFGKLS  547

Query  2792  KTITFPEILNLASYMSGTSD-KSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             K I FPE+L+++ YMS  +    P+Y LY V+ H D M+  FSGHYVCY+K     WFK+
Sbjct  548   KPIHFPELLDISPYMSDPNHGDHPVYSLYAVVVHLDAMSTLFSGHYVCYIKTLDGDWFKI  607

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             +DS V PV++E+VL +GAYMLLY+R SPR
Sbjct  608   DDSNVFPVQLETVLLEGAYMLLYARDSPR  636


 Score = 81.6 bits (200),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 91/182 (50%), Gaps = 37/182 (20%)
 Frame = +2

Query  404  LLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvp  583
            L+  L+R++WR A  RREE+ RL+ LA+EE+  AE    A   +           GD   
Sbjct  3    LVFLLIRRQWRSASVRREEVIRLIALATEESYLAEEVRPATVDYG----------GD---  49

Query  584  aavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHK  763
                       +++ V       Y+CA C    +TRCS+CK+VRYCS KCQI+HWR GHK
Sbjct  50   -----------SVSDV-------YRCAVCLYPTTTRCSQCKSVRYCSSKCQILHWRRGHK  91

Query  764  DECHPP-VNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDASFAEPTCSEP  940
            +EC  P  +   + Y +   D K    E+N  +       E ++  S+D +  + + S P
Sbjct  92   EECRSPDYDEEKEEYVQSDYDAK----ESNVDFPSRGTAYESSSNVSVDVA-CDMSTSRP  146

Query  941  SI  946
            SI
Sbjct  147  SI  148



>ref|XP_006282127.1| hypothetical protein CARUB_v10028379mg [Capsella rubella]
 gb|EOA15025.1| hypothetical protein CARUB_v10028379mg [Capsella rubella]
Length=733

 Score =   439 bits (1129),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/329 (63%), Positives = 252/329 (77%), Gaps = 4/329 (1%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             F YELFVKL+   +VEL+PFGL N GNSCYAN VLQCLAFT P  +Y ++G HSK C KK
Sbjct  314   FSYELFVKLY-CDRVELQPFGLVNLGNSCYANTVLQCLAFTRPLISYLIRGLHSKTCRKK  372

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
              WCF CEFE L+LKA+ G SPLSPI+I+S L+ IG  LG G+EEDAHEFLR  ++TMQSV
Sbjct  373   SWCFVCEFEYLILKARGGESPLSPIKILSKLQKIGKHLGPGKEEDAHEFLRCAVDTMQSV  432

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
              LKEA    +    E+T+L+GLTF G+L SKI+CM+C  KSER E +MDLTVEIDGDI S
Sbjct  433   FLKEAD--AAAPFAEETTLVGLTFSGYLHSKIKCMKCLHKSERSELMMDLTVEIDGDIGS  490

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LE A  QFT  EILDGEN+Y C RCKSY+KA+KKL ILE PN+LT+ LKRFQS  FGKL+
Sbjct  491   LEEAFAQFTAYEILDGENRYFCGRCKSYQKAKKKLMILEGPNILTVVLKRFQSDNFGKLS  550

Query  2792  KTITFPEILNLASYMSGTSD-KSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             K I FPE+L+++ YMS  +  + P+Y LY V+ H D M+ +FSGHYVCY+K     WFK+
Sbjct  551   KPIHFPELLDISPYMSDPNHGEHPVYSLYAVVVHLDAMSTSFSGHYVCYIKTLHGDWFKI  610

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             +DS V PV++E+VL +GAYMLLY+R SPR
Sbjct  611   DDSNVFPVQLETVLLEGAYMLLYARDSPR  639


 Score = 79.3 bits (194),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 64/126 (51%), Gaps = 31/126 (25%)
 Frame = +2

Query  404  LLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvp  583
            L+  L+R++WR A  +RE++ RL+ LA+EE+                       + DE  
Sbjct  2    LVFLLIRRQWRSAALKREQVIRLIALATEES----------------------YLADEEV  39

Query  584  aavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHK  763
                      +T+          Y+CA C    STRC++CK+VRYCS KCQI+HWR GHK
Sbjct  40   R---------ATVADYDGGDSDVYRCAVCLHPTSTRCAKCKSVRYCSSKCQILHWRRGHK  90

Query  764  DECHPP  781
            +EC  P
Sbjct  91   EECRSP  96



>ref|XP_002864957.1| hypothetical protein ARALYDRAFT_332761 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41216.1| hypothetical protein ARALYDRAFT_332761 [Arabidopsis lyrata subsp. 
lyrata]
Length=731

 Score =   439 bits (1129),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 207/329 (63%), Positives = 252/329 (77%), Gaps = 4/329 (1%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             F YELFVKL+   KVEL+PFGL N GNSCYAN+VLQCLAFT P  +Y ++G HSK C KK
Sbjct  311   FSYELFVKLY-CDKVELQPFGLVNLGNSCYANSVLQCLAFTRPLMSYLIRGLHSKTCRKK  369

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
              WCF CEFE L+LKA+ G SPLSPI+I+S L+ IG  LG G+EEDAHEFLR  +ETMQSV
Sbjct  370   SWCFVCEFEHLILKARGGESPLSPIKILSKLQKIGKHLGPGKEEDAHEFLRCAVETMQSV  429

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
              LKEA    +    E+T+L+GLTFGG+L SKI+CM+C  KSE+ E +MDLTVEIDGDI S
Sbjct  430   FLKEAS--AAGPFAEETTLVGLTFGGYLHSKIKCMKCLHKSEQSELMMDLTVEIDGDIGS  487

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LE AL QFT  E+LDGEN+Y C RCKSY+KA+KKL ILE PN+LT+ LKRFQS  FGKL+
Sbjct  488   LEEALAQFTAYEVLDGENRYFCGRCKSYQKAKKKLMILEGPNILTVVLKRFQSDNFGKLS  547

Query  2792  KTITFPEILNLASYMSGTSD-KSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             K I FPE+L++  YMS  +    P+Y LY V+ H D M+ +FSGHYVCY+K     WFK+
Sbjct  548   KPIHFPELLDIGPYMSDPNHGDHPVYSLYAVVVHLDAMSTSFSGHYVCYIKTLHGDWFKI  607

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             +DS V  V++E+VL +GAYMLLY+R SPR
Sbjct  608   DDSNVFRVQLETVLLEGAYMLLYARNSPR  636


 Score = 84.3 bits (207),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 68/126 (54%), Gaps = 35/126 (28%)
 Frame = +2

Query  404  LLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvp  583
            L+  L+R++WR A  RREE+ RL+ LA+EE+                       + +EV 
Sbjct  3    LVFLLIRRQWRSASVRREEVIRLIALATEES----------------------YLAEEVR  40

Query  584  aavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHK  763
                     +ST+ SV       Y+CA C    +TRCS+CK+VRYCS KCQI+HWR GHK
Sbjct  41   ---------ASTVDSVSDV----YRCAVCLYPTTTRCSQCKSVRYCSSKCQILHWRRGHK  87

Query  764  DECHPP  781
            +EC  P
Sbjct  88   EECRSP  93



>ref|XP_010463054.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Camelina 
sativa]
Length=758

 Score =   439 bits (1130),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 209/330 (63%), Positives = 255/330 (77%), Gaps = 5/330 (2%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             F YELFVKL+   +VEL+PFGL N GNSCYANAVLQCLAFT P  +Y ++G HSK C KK
Sbjct  337   FSYELFVKLY-CDRVELQPFGLVNLGNSCYANAVLQCLAFTRPLISYLIRGLHSKTCRKK  395

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
              WCF CEFE L+LKA+ G SPLSPI+I+S L+ IG  LG G+EEDAHEFLR  ++TMQSV
Sbjct  396   SWCFVCEFEYLILKARGGESPLSPIKILSKLQKIGKHLGPGKEEDAHEFLRCAVDTMQSV  455

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
              LKEA    +    E+T+L+GLTFGG+L SKI+CMRC  KSER E +MDLTVEIDGDI S
Sbjct  456   FLKEAD--AAGPFAEETTLVGLTFGGYLHSKIKCMRCLHKSERSELMMDLTVEIDGDIGS  513

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LE AL QFT  E+LDGEN+Y C RCKSY+KA+KKL ILE PN+LT+ LKRFQS  FGKL+
Sbjct  514   LEEALAQFTAYEVLDGENRYFCGRCKSYQKAKKKLMILEGPNILTVVLKRFQSDNFGKLS  573

Query  2792  KTITFPEILNLASYMSGTSD-KSPIYQLYGVIEHEDVMNAAFSGHYVCYVKN-FQNKWFK  2965
             K I FPE+L+++ YMS   + + P+Y LY V+ H D M+ +FSGHYVCY+K      WFK
Sbjct  574   KPIHFPELLDISPYMSDQKNGEHPVYSLYAVVVHLDAMSTSFSGHYVCYIKTPLHGDWFK  633

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             ++DS V PV++E+VL +GAYMLLY+R SPR
Sbjct  634   IDDSNVFPVQLETVLLEGAYMLLYARDSPR  663


 Score = 83.2 bits (204),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 98/209 (47%), Gaps = 42/209 (20%)
 Frame = +2

Query  386  LVFIGPLL--GFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
             + IG +L    L+R++WR A  +R+++ RL+ LA+EE+  A                  
Sbjct  12   FILIGFILLVFLLIRRQWRSASVKRDQVLRLIALATEESYLA------------------  53

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                 E           +++++ V       ++CA C    STRCS+CK+VRYCS KCQI
Sbjct  54   -----EEVHVRSPTDAAANSVSDV-------HRCAVCLYPTSTRCSKCKSVRYCSSKCQI  101

Query  740  IHWRLGHKDECHPPVNNNHD---------SYGKGANDFKVFRQEANEGYAEGIETEERNT  892
            +HWR GHKDEC  P   ++D         S G   ++F++  +      +   E    + 
Sbjct  102  LHWRRGHKDECKSPSLPDYDEEEKDDSVHSNGAKESNFELPSRMTGIESSSSSEIPSNDN  161

Query  893  PGSIDASFAEPTCSEPSISGAENTEDVME  979
              S+D SF   T + PSI   + T + ++
Sbjct  162  GKSVDVSFDMST-TRPSIHKVQATSEAVD  189



>ref|XP_006394032.1| hypothetical protein EUTSA_v10003706mg [Eutrema salsugineum]
 gb|ESQ31318.1| hypothetical protein EUTSA_v10003706mg [Eutrema salsugineum]
Length=740

 Score =   438 bits (1127),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 204/331 (62%), Positives = 254/331 (77%), Gaps = 5/331 (2%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             F YE+FVKL+   +VEL+PFGL N GNSCYANAVLQCLAFT P  +Y ++G HSK C KK
Sbjct  326   FSYEMFVKLY-CDRVELQPFGLVNLGNSCYANAVLQCLAFTRPLMSYLIRGIHSKACRKK  384

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
              WCF CEFE L+LK++ G SPLSP++I+S L+ IG  LG G+EEDAHEFLR  ++TMQSV
Sbjct  385   SWCFVCEFEFLILKSRVGGSPLSPVKILSRLQKIGKHLGPGKEEDAHEFLRCAVDTMQSV  444

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
              LKEAG   +    E+T+L+G TFGG+L SKI+CM+   KSER E +MDLTVEI GDI S
Sbjct  445   FLKEAG--AAGPFAEETTLVGFTFGGYLHSKIKCMKGLHKSERSELMMDLTVEIGGDIGS  502

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LE AL QFT  E+LDGEN+Y C RC+SY+KA+KKL ILE PN+LT+ LKRFQS  FGKL+
Sbjct  503   LEDALAQFTAYEVLDGENRYFCGRCRSYQKAKKKLMILEGPNILTVVLKRFQSDNFGKLS  562

Query  2792  KTITFPEILNLASYMSGTS--DKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             K I FPE+L+++ YMS  +  D  P+Y LY V+ H D M+ +FSGHYVCY+K     WFK
Sbjct  563   KPIHFPELLDISPYMSKPNHRDHHPVYSLYAVVVHLDAMSTSFSGHYVCYIKTLHGDWFK  622

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRA  3058
             ++DS V PV++E+VL +GAYMLLY+R SPRA
Sbjct  623   IDDSNVFPVQLETVLLEGAYMLLYARDSPRA  653


 Score = 75.9 bits (185),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 64/132 (48%), Gaps = 32/132 (24%)
 Frame = +2

Query  404  LLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvp  583
            L+  L+R++WR A  +REE+ RL+                             +  +E  
Sbjct  3    LVFLLIRRQWRSAAVKREEVIRLIA----------------------------LATEESY  34

Query  584  aavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHK  763
                     SS+ +SV  A    Y+CA C    +TRC +CK+VRYCS KCQI+HWR GHK
Sbjct  35   LRANVEYASSSSSSSVSDA----YRCAVCLYPTTTRCVQCKSVRYCSSKCQILHWRRGHK  90

Query  764  DECHPPVNNNHD  799
            +EC  P   ++D
Sbjct  91   EECRSPSLPDYD  102



>ref|XP_010444522.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X1 [Camelina sativa]
Length=753

 Score =   439 bits (1128),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 207/329 (63%), Positives = 253/329 (77%), Gaps = 4/329 (1%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             F YELFVKL+   +VEL+PFGL N GNSCYANAVLQCLAFT P  +Y ++G HSK C KK
Sbjct  337   FSYELFVKLY-CDRVELQPFGLVNLGNSCYANAVLQCLAFTRPLISYLIRGLHSKTCRKK  395

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
              WCF CEFE L+LKA+   SPLSPI+I+S L+ IG  LG G+EEDAHEFLR  ++TMQSV
Sbjct  396   SWCFVCEFEYLILKARGVESPLSPIKILSKLQKIGKHLGPGKEEDAHEFLRCAVDTMQSV  455

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
              LKEA    +    E+T+L+GLTFGG+L SKI+CM+C  KSER E +MDLTVEIDGDI S
Sbjct  456   FLKEAD--AAGPFAEETTLVGLTFGGYLHSKIKCMKCLHKSERSELMMDLTVEIDGDIGS  513

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LE AL QFT  E+LDGEN+Y C RCKSY+KA+KKL ILE PN+LT+ LKRFQS  FGKL+
Sbjct  514   LEEALAQFTAYEVLDGENRYFCGRCKSYQKAKKKLMILEGPNILTVVLKRFQSDNFGKLS  573

Query  2792  KTITFPEILNLASYMSGTSD-KSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             K I FPE+L+++ YMS     + P+Y LY V+ H D M+ +FSGHYVCY+K     WFK+
Sbjct  574   KPIHFPELLDISPYMSDQKHGEHPVYSLYAVVVHLDAMSTSFSGHYVCYIKTLHGDWFKI  633

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             +DS V PV++E+VL +GAYMLLY+R SPR
Sbjct  634   DDSNVFPVQLETVLLEGAYMLLYARDSPR  662


 Score = 89.0 bits (219),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 92/210 (44%), Gaps = 44/210 (21%)
 Frame = +2

Query  386  LVFIG--PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
             + IG   L+  L+R++WR A  RR+++ RL+ L                          
Sbjct  12   FILIGFILLVFLLIRRQWRSASVRRDQVIRLIAL--------------------------  45

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                 E           S T+ +      + Y+CA C    STRC++CK+VRYCS KCQI
Sbjct  46   ---ATEESYLAEEVRVRSPTVAAADSVSDV-YRCAVCLYPTSTRCAKCKSVRYCSSKCQI  101

Query  740  IHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAE------GIETEERNTPGS  901
            +HWR GHK+EC  P   ++D   +   D  V   +A E + E      GIE+     P +
Sbjct  102  LHWRRGHKEECKSPSLPDYDE--EEGRDDSVHSDDAKESHFELPSRVAGIESSSLAIPSN  159

Query  902  IDASFAEPTC----SEPSISGAENTEDVME  979
             +    + +C    S PSI   + T + ++
Sbjct  160  DNGKSVDVSCDMSTSRPSIHKVQATSEAVD  189



>ref|XP_004957061.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X1 [Setaria italica]
Length=914

 Score =   443 bits (1140),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 207/363 (57%), Positives = 262/363 (72%), Gaps = 27/363 (7%)
 Frame = +2

Query  2066  GLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCA  2245
              LFPY+ F++L+N +K+EL PFGL N GNSCYANAVLQCLAFT P TAY L+G+HS+ C+
Sbjct  324   ALFPYKHFIELYNFEKLELHPFGLCNLGNSCYANAVLQCLAFTRPLTAYLLEGYHSRNCS  383

Query  2246  ---------------------------KKDWCFNCEFESLVLKAKNGNSPLSPIRIISHL  2344
                                        K +WCF CE E ++ + K G +P+SP  I+SHL
Sbjct  384   LHSTYIFFVTFCISSVNNVALLYFLGSKMEWCFMCELEKVMTEGKCGKAPVSPTGILSHL  443

Query  2345  ENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSK  2524
               IG+S G GREEDAHEFLRY I+TMQS  +KEA       L E+++L+ L FGG+L+SK
Sbjct  444   NEIGTSFGQGREEDAHEFLRYAIDTMQSASVKEAKKNGVHKLAEESTLVQLIFGGYLQSK  503

Query  2525  IECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKA  2704
             I C +C   S + ERI+DLTVEIDGDI +LEGALR+FT +E+LDG+N+YHCSRC SYE+A
Sbjct  504   IICTKCQVSSAQSERILDLTVEIDGDINTLEGALRRFTSSEVLDGDNRYHCSRCMSYERA  563

Query  2705  RKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVI  2884
             +KKL I EAPN+LTIALKR+QSG +GK++K + FPE LNL+ +M  T D SP+Y LY V+
Sbjct  564   KKKLMISEAPNILTIALKRYQSGVYGKISKDVKFPEHLNLSQFMCETDDYSPVYSLYAVV  623

Query  2885  EHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPK  3064
              H DVMN   SGHYVCYVK+ Q KW +++DSKVKPV ++ VLSK AYMLLY+RCSPR P 
Sbjct  624   VHHDVMNTTISGHYVCYVKDPQGKWHEMDDSKVKPVSLKKVLSKCAYMLLYARCSPRVPD  683

Query  3065  LIR  3073
              +R
Sbjct  684   SVR  686


 Score = 67.8 bits (164),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            CA C    + RC RCK+V+YC+ KCQI HWR GHKDECHP
Sbjct  109  CAMCARPTTLRCKRCKSVKYCTFKCQIDHWRKGHKDECHP  148



>ref|XP_010484359.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X1 [Camelina sativa]
Length=757

 Score =   438 bits (1126),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 206/329 (63%), Positives = 252/329 (77%), Gaps = 4/329 (1%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             F Y+LFVKL+    VEL+PFGL N GNSCYANAVLQCLAFT P  +Y ++G HSK C KK
Sbjct  337   FSYDLFVKLY-CDGVELQPFGLVNLGNSCYANAVLQCLAFTRPLISYLIRGLHSKTCRKK  395

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
              WCF CEFE L+LKA+ G SPLSPI+I+S L+ IG  LG G+EEDAHEFLR  ++TMQSV
Sbjct  396   SWCFVCEFEYLILKARGGESPLSPIKILSKLQKIGKQLGPGKEEDAHEFLRCAVDTMQSV  455

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
              LKEA    +    E+T+L+GLTFGG+L SKI+CM+C  KSER E +MDLTVEIDGDI S
Sbjct  456   FLKEAD--AAGPFAEETTLVGLTFGGYLHSKIKCMKCLHKSERSELMMDLTVEIDGDIGS  513

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LE AL QFT  E+LDGEN+Y C RCKSY+KA+KKL ILE PN+L + LKRFQS  FGKL+
Sbjct  514   LEEALAQFTAYEVLDGENRYFCGRCKSYQKAKKKLMILEGPNILNVVLKRFQSDNFGKLS  573

Query  2792  KTITFPEILNLASYMSGTSD-KSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             K I FPE+L+++ YMS     + P+Y LY V+ H D M+ +FSGHYVCY+K     WFK+
Sbjct  574   KPIHFPELLDISPYMSDQKHGEHPVYSLYAVVVHLDAMSTSFSGHYVCYIKTLHGDWFKI  633

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             +DS V PV++E+VL +GAYMLLY+R SPR
Sbjct  634   DDSNVFPVQLETVLLEGAYMLLYARDSPR  662


 Score = 85.9 bits (211),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 92/211 (44%), Gaps = 46/211 (22%)
 Frame = +2

Query  386  LVFIG--PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
             + IG   L+  L+R++WR A  RR+++ RL+ L                          
Sbjct  12   FILIGFILLVFLLIRRQWRSASVRRDQVIRLIAL--------------------------  45

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                 E           S T+ +      + Y+CA C    STRC++CK+VRYCS KCQI
Sbjct  46   ---ATEESHLAEEVRVRSPTVAADDSVSDV-YRCAVCLYPTSTRCAKCKSVRYCSSKCQI  101

Query  740  IHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAE------GIETEERNTPG-  898
            +HWR GHKDEC  P  +  D   +   +  V   +A E + E      GIE+     P  
Sbjct  102  LHWRRGHKDECRSP--SLPDYDEEEEREDSVHSDDAKESHFELLSRMTGIESSLSEIPSN  159

Query  899  ----SIDASFAEPTCSEPSISGAENTEDVME  979
                S+D SF   T S PSI   + T + ++
Sbjct  160  DNGKSVDVSFDMST-SRPSIHKVQATSEAVD  189



>ref|XP_002462507.1| hypothetical protein SORBIDRAFT_02g026980 [Sorghum bicolor]
 gb|EER99028.1| hypothetical protein SORBIDRAFT_02g026980 [Sorghum bicolor]
Length=867

 Score =   440 bits (1132),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/335 (61%), Positives = 256/335 (76%), Gaps = 0/335 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LF Y+ FV+L++  K+EL PFGL N GNSCYAN VLQCLAFT P TAY L+G HS+ C+K
Sbjct  334   LFSYKNFVELYSFNKLELHPFGLYNLGNSCYANVVLQCLAFTRPLTAYLLEGHHSQNCSK  393

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              +WCF CE E ++++ K+G S +SP  I+ HL  IG S G+G EEDAHEFLRY I+ MQS
Sbjct  394   NEWCFMCELEKVLIEGKHGKSLVSPTGILCHLNEIGVSFGHGAEEDAHEFLRYAIDKMQS  453

Query  2429  VCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIA  2608
               +KEA       L E+T+L+   FGG+LRSKI+C +C   S++ ERI+DLTVEIDGDI 
Sbjct  454   ASIKEAKKNGIQQLAEETTLVHFIFGGYLRSKIKCTKCQVSSKQSERILDLTVEIDGDIN  513

Query  2609  SLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKL  2788
             +L+GALR+FT +E+LDG+N+YHCSRC SYE+A+KKL ILEAPN+LTIALKR+QSG  G+ 
Sbjct  514   TLDGALRRFTSSEVLDGDNRYHCSRCNSYERAQKKLTILEAPNILTIALKRYQSGVLGET  573

Query  2789  NKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             +K + FPE LNL+ YMS T D SP+Y LY V+ H +V NA  SGHYVCYVK+ Q KW ++
Sbjct  574   SKVVKFPEHLNLSQYMSRTDDSSPVYTLYAVVVHHNVSNATVSGHYVCYVKDSQGKWHEM  633

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIR  3073
             +D+KVKPV I+ VLSK AYMLLY+R SPRAP   R
Sbjct  634   DDNKVKPVSIQKVLSKCAYMLLYARISPRAPTGAR  668


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 40/77 (52%), Gaps = 14/77 (18%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVFR  838
            CA C    + RC RCK+ +YC+ KCQI HWR GHKDECHP         G+GA       
Sbjct  123  CAMCSKPTTLRCKRCKSAKYCTVKCQIDHWRNGHKDECHP--------LGQGAT------  168

Query  839  QEANEGYAEGIETEERN  889
            Q+A E    G   E  N
Sbjct  169  QDAPENVMAGPSKESTN  185



>ref|XP_006426286.1| hypothetical protein CICLE_v10024864mg [Citrus clementina]
 gb|ESR39526.1| hypothetical protein CICLE_v10024864mg [Citrus clementina]
Length=882

 Score =   439 bits (1130),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 223/422 (53%), Positives = 282/422 (67%), Gaps = 31/422 (7%)
 Frame = +2

Query  1991  QLKASKS-RHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q + SK  +  SLG+  E+ G+ N K LFPY+LF+KL++  KVEL PFGL NCGNSCYAN
Sbjct  336   QFRVSKPLKSYSLGSEDEVVGKSNEKPLFPYDLFMKLYSYDKVELYPFGLINCGNSCYAN  395

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFT P T+Y +QG HSK C KK WCF CEFE L+L AK+G+ P+SPI I+S ++
Sbjct  396   AVLQCLAFTQPLTSYLVQGLHSKACQKKGWCFICEFERLILNAKDGSYPVSPIGILSKIQ  455

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
              IGS LG+GREEDAHEFL +                   +L +  S + L+   +   +I
Sbjct  456   KIGSHLGHGREEDAHEFLSF-------------------ALLKYYSFLLLSEFNYWDFQI  496

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +C++C GKSE +ER+MDLTVEIDGDI +LE AL QFT +EIL GENK     CKSYEKA+
Sbjct  497   KCLKCLGKSELYERMMDLTVEIDGDIGTLEEALAQFTASEILVGENK-----CKSYEKAK  551

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL +LE PN+LTI LKRF+SG FGKLNK++ FPE LN+A YMS T D SP+Y LY V+ 
Sbjct  552   KKLTVLEEPNILTIVLKRFESGNFGKLNKSVWFPEFLNMAPYMSRTGDGSPMYSLYAVVV  611

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H DV NA FSGHYVCYVKN   +WF+++DS V PV++E VLS+ AYMLLY+R SPR P L
Sbjct  612   HLDVTNATFSGHYVCYVKNSHEEWFRIDDSTVIPVKLERVLSEEAYMLLYARHSPRPPAL  671

Query  3068  IRSLTSHDPRGQKY------VNCKSSSHTNSWDLSKGDSTNDPACRECFNSVQASSWPHR  3229
             IR+  SH  + +K       +N  S   +NS+  S         C +         W  R
Sbjct  672   IRNNVSHGVKSKKKNLEAVDLNNTSKVRSNSYIPSLDSKAQQKPCTDSNQLFDRDEWKFR  731

Query  3230  TI  3235
             ++
Sbjct  732   SM  733


 Score = 92.4 bits (228),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 61/121 (50%), Gaps = 31/121 (26%)
 Frame = +2

Query  416  LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsVVGDEvpaavp  595
            L+RQK ++A AR+EE+ +L+                             V  +E      
Sbjct  23   LIRQKCKNAVARKEEVTKLMA----------------------------VAAEESLMEEF  54

Query  596  apapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
              A   S L S P      YQCA CF S +TRCSRCKAVRYCSGKCQI HWR GHKDEC 
Sbjct  55   QAANQHSFLPSSPPRL---YQCAVCFRSTTTRCSRCKAVRYCSGKCQIFHWRQGHKDECR  111

Query  776  P  778
            P
Sbjct  112  P  112



>ref|XP_009150635.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Brassica 
rapa]
Length=767

 Score =   429 bits (1103),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 202/334 (60%), Positives = 254/334 (76%), Gaps = 7/334 (2%)
 Frame = +2

Query  2060  NKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKG  2239
             N+  F YE+FVKL+  + +EL+PFGL N GNSCYAN VLQCLAFT P  +Y ++G HSK 
Sbjct  343   NEMSFSYEMFVKLYRDR-IELQPFGLVNLGNSCYANVVLQCLAFTRPLISYLIRGIHSKA  401

Query  2240  CAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIET  2419
             C KK WCF CEFE L+LK++ G SPLSPI+I+S L+ IG  LG G++EDAHEFLR  ++T
Sbjct  402   CRKKSWCFVCEFEFLILKSRGGESPLSPIKILSRLQKIGKHLGPGKQEDAHEFLRCAVDT  461

Query  2420  MQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             MQSV LKEA    +  L E+T+L+GLTFGG+L SKI+CM+C  KSER E +MDLTVEI G
Sbjct  462   MQSVFLKEAD--AAGPLAEETTLVGLTFGGYLHSKIKCMKCLHKSERTELMMDLTVEIGG  519

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
             DI SLE AL QFT  E+LDGEN+Y C RCKSY+KA+KKL ILE PN+LT+ LKRF+S  F
Sbjct  520   DIGSLEEALAQFTAYEVLDGENRYLCDRCKSYQKAKKKLMILEGPNILTVVLKRFESDNF  579

Query  2780  GKLNKTITFPEILNLASYMSGTS--DKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQN  2953
             GKL+K I FPE+L+++ YMS  +  D  P+Y LY V+ H D    ++SGHYVCY+KN   
Sbjct  580   GKLSKPIHFPELLDISPYMSNPNHGDHHPMYSLYAVVVHLDA--TSYSGHYVCYIKNLHG  637

Query  2954  KWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
              WFK++DS V PV +++VL +GAYMLLY+R SPR
Sbjct  638   DWFKIDDSNVFPVPLQTVLLEGAYMLLYARDSPR  671


 Score = 84.0 bits (206),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 94/198 (47%), Gaps = 40/198 (20%)
 Frame = +2

Query  383  FLVFIGPLLGFL-VRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            FL+    +L FL +R++WR A  +REE+ RL+ LA+EE+  A  +               
Sbjct  4    FLLIGCLMLAFLLIRRQWRSAAVKREEVLRLISLATEESYLAAEKK--------------  49

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                +E   A       SS    V       Y CA C    +TRC++CK+VRYCS KCQI
Sbjct  50   ----EEEARATVDYYGSSSVPPDV-------YSCAVCHYPTTTRCAQCKSVRYCSSKCQI  98

Query  740  IHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAEGIETEERNTPGSIDASFA  919
            +HWR GHK+EC PP  ++ D       D  V   ++++G    IE   R T         
Sbjct  99   LHWRRGHKEECRPPPLHDFDR----EEDKSV---KSDDGEETNIELPSRGTE-------F  144

Query  920  EPTCSEPSISGAENTEDV  973
            E + ++  ++G E  E V
Sbjct  145  ESSAADDGLTGIETNERV  162



>ref|XP_010444523.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X2 [Camelina sativa]
Length=748

 Score =   427 bits (1097),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 204/329 (62%), Positives = 249/329 (76%), Gaps = 9/329 (3%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             F YELFVKL+   +VEL+PFGL N GNSCYANAVLQCLAFT P  +Y ++G HSK C KK
Sbjct  337   FSYELFVKLY-CDRVELQPFGLVNLGNSCYANAVLQCLAFTRPLISYLIRGLHSKTCRKK  395

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
              WCF CEFE L+LKA+   SPLSPI+I+S L+ IG  LG G+EEDAHEFLR  ++TMQSV
Sbjct  396   SWCFVCEFEYLILKARGVESPLSPIKILSKLQKIGKHLGPGKEEDAHEFLRCAVDTMQSV  455

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
              LKEA    +    E+T+L+GLTFGG+L SKI+CM+C  KSER E +MDLTVEIDGDI S
Sbjct  456   FLKEAD--AAGPFAEETTLVGLTFGGYLHSKIKCMKCLHKSERSELMMDLTVEIDGDIGS  513

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LE AL QFT  E+LDGEN+Y C RCKSY+KA+KKL ILE PN+LT+ LKRFQS  FGKL+
Sbjct  514   LEEALAQFTAYEVLDGENRYFCGRCKSYQKAKKKLMILEGPNILTVVLKRFQSDNFGKLS  573

Query  2792  KTITFPEILNLASYMSGTSD-KSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             K I FPE+L+++ YMS     + P+Y LY V+ H D M+ +FSGHYVCY+K     WFK+
Sbjct  574   KPIHFPELLDISPYMSDQKHGEHPVYSLYAVVVHLDAMSTSFSGHYVCYIKTLHGDWFKI  633

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             +DS      +E+VL +GAYMLLY+R SPR
Sbjct  634   DDSN-----LETVLLEGAYMLLYARDSPR  657


 Score = 89.0 bits (219),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 92/210 (44%), Gaps = 44/210 (21%)
 Frame = +2

Query  386  LVFIG--PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
             + IG   L+  L+R++WR A  RR+++ RL+ L                          
Sbjct  12   FILIGFILLVFLLIRRQWRSASVRRDQVIRLIAL--------------------------  45

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                 E           S T+ +      + Y+CA C    STRC++CK+VRYCS KCQI
Sbjct  46   ---ATEESYLAEEVRVRSPTVAAADSVSDV-YRCAVCLYPTSTRCAKCKSVRYCSSKCQI  101

Query  740  IHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAE------GIETEERNTPGS  901
            +HWR GHK+EC  P   ++D   +   D  V   +A E + E      GIE+     P +
Sbjct  102  LHWRRGHKEECKSPSLPDYDE--EEGRDDSVHSDDAKESHFELPSRVAGIESSSLAIPSN  159

Query  902  IDASFAEPTC----SEPSISGAENTEDVME  979
             +    + +C    S PSI   + T + ++
Sbjct  160  DNGKSVDVSCDMSTSRPSIHKVQATSEAVD  189



>ref|XP_010484360.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X2 [Camelina sativa]
Length=752

 Score =   426 bits (1096),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/329 (62%), Positives = 248/329 (75%), Gaps = 9/329 (3%)
 Frame = +2

Query  2072  FPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKK  2251
             F Y+LFVKL+    VEL+PFGL N GNSCYANAVLQCLAFT P  +Y ++G HSK C KK
Sbjct  337   FSYDLFVKLY-CDGVELQPFGLVNLGNSCYANAVLQCLAFTRPLISYLIRGLHSKTCRKK  395

Query  2252  DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSV  2431
              WCF CEFE L+LKA+ G SPLSPI+I+S L+ IG  LG G+EEDAHEFLR  ++TMQSV
Sbjct  396   SWCFVCEFEYLILKARGGESPLSPIKILSKLQKIGKQLGPGKEEDAHEFLRCAVDTMQSV  455

Query  2432  CLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIAS  2611
              LKEA    +    E+T+L+GLTFGG+L SKI+CM+C  KSER E +MDLTVEIDGDI S
Sbjct  456   FLKEAD--AAGPFAEETTLVGLTFGGYLHSKIKCMKCLHKSERSELMMDLTVEIDGDIGS  513

Query  2612  LEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLN  2791
             LE AL QFT  E+LDGEN+Y C RCKSY+KA+KKL ILE PN+L + LKRFQS  FGKL+
Sbjct  514   LEEALAQFTAYEVLDGENRYFCGRCKSYQKAKKKLMILEGPNILNVVLKRFQSDNFGKLS  573

Query  2792  KTITFPEILNLASYMSGTSD-KSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKV  2968
             K I FPE+L+++ YMS     + P+Y LY V+ H D M+ +FSGHYVCY+K     WFK+
Sbjct  574   KPIHFPELLDISPYMSDQKHGEHPVYSLYAVVVHLDAMSTSFSGHYVCYIKTLHGDWFKI  633

Query  2969  NDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             +DS      +E+VL +GAYMLLY+R SPR
Sbjct  634   DDSN-----LETVLLEGAYMLLYARDSPR  657


 Score = 85.9 bits (211),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 92/211 (44%), Gaps = 46/211 (22%)
 Frame = +2

Query  386  LVFIG--PLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
             + IG   L+  L+R++WR A  RR+++ RL+ L                          
Sbjct  12   FILIGFILLVFLLIRRQWRSASVRRDQVIRLIAL--------------------------  45

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                 E           S T+ +      + Y+CA C    STRC++CK+VRYCS KCQI
Sbjct  46   ---ATEESHLAEEVRVRSPTVAADDSVSDV-YRCAVCLYPTSTRCAKCKSVRYCSSKCQI  101

Query  740  IHWRLGHKDECHPPVNNNHDSYGKGANDFKVFRQEANEGYAE------GIETEERNTPG-  898
            +HWR GHKDEC  P  +  D   +   +  V   +A E + E      GIE+     P  
Sbjct  102  LHWRRGHKDECRSP--SLPDYDEEEEREDSVHSDDAKESHFELLSRMTGIESSLSEIPSN  159

Query  899  ----SIDASFAEPTCSEPSISGAENTEDVME  979
                S+D SF   T S PSI   + T + ++
Sbjct  160  DNGKSVDVSFDMST-SRPSIHKVQATSEAVD  189



>gb|EPS64787.1| hypothetical protein M569_09988, partial [Genlisea aurea]
Length=336

 Score =   411 bits (1057),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/330 (58%), Positives = 247/330 (75%), Gaps = 3/330 (1%)
 Frame = +2

Query  2084  LFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCF  2263
             LF +L++   +E RPFGLTNCGNSCYANAVLQCLAFT P T+YFLQG HSK C K+DWC 
Sbjct  6     LFQQLYSFNPIEFRPFGLTNCGNSCYANAVLQCLAFTRPLTSYFLQGLHSKTCRKRDWCL  65

Query  2264  NCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKE  2443
              CEFE L+ K +  N PLSPI IIS ++ IGS L  GR+EDAH+FLR V+E MQSV L+E
Sbjct  66    VCEFEYLIRKGRQTNYPLSPIGIISQVKRIGSHLNPGRQEDAHDFLRNVVEKMQSVWLEE  125

Query  2444  AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGA  2623
              G   S S  E ++L+GL+FGG+++SKI+C++C G+SER +R+MD++VEI+GDI SLE A
Sbjct  126   VGF--SGSFAEDSTLLGLSFGGYVQSKIKCLKCSGRSERFDRVMDISVEINGDIDSLEAA  183

Query  2624  LRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF-GKLNKTI  2800
             L QFT +E L G++KY C RCKSYE A+KKL ++EAPN+LT+ LKRFQSG    KLNK +
Sbjct  184   LAQFTVSETLGGDDKYKCGRCKSYENAKKKLTVVEAPNILTVILKRFQSGNVEKKLNKVV  243

Query  2801  TFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSK  2980
              FPE L+L  Y S +SDK+PIY LY V+ H D  N+++SGHYV +VK+    WF+++DS+
Sbjct  244   RFPEALDLTPYTSRSSDKNPIYGLYAVVVHSDAANSSYSGHYVSFVKDASGDWFRIDDSR  303

Query  2981  VKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             V   E+E VLS  AYML Y+R   R P  +
Sbjct  304   VGRAEVEDVLSAEAYMLFYARRRARIPSFL  333



>emb|CDY08792.1| BnaA06g24320D [Brassica napus]
Length=749

 Score =   426 bits (1094),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 202/335 (60%), Positives = 255/335 (76%), Gaps = 8/335 (2%)
 Frame = +2

Query  2060  NKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKG  2239
             N+  F YE+FVKL+  + +EL+PFGL N GNSCYAN VLQCLAFT P  +Y ++G HSK 
Sbjct  323   NEMSFSYEMFVKLYRDR-IELQPFGLVNLGNSCYANVVLQCLAFTRPLISYLIRGIHSKA  381

Query  2240  CAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY-VIE  2416
             C KK WCF CEFE L+LK++ G SPLSPI+I+S L+ IG  LG G++EDAHEFLR+  ++
Sbjct  382   CRKKSWCFVCEFEFLILKSRGGESPLSPIKILSRLQKIGKHLGPGKQEDAHEFLRWCAVD  441

Query  2417  TMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEID  2596
             TMQSV LKEA    +  L E+T+L+GLTFGG+L SKI+CM+C  KSER E +MDLTVEI 
Sbjct  442   TMQSVFLKEAD--AAGPLAEETTLVGLTFGGYLHSKIKCMKCLHKSERTELMMDLTVEIG  499

Query  2597  GDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGK  2776
             GDI SLE AL QFT  E+LDGEN+Y C RCKSY+KA+KKL ILE PN+LT+ LKRF+S  
Sbjct  500   GDIGSLEEALAQFTAYEVLDGENRYLCDRCKSYQKAKKKLMILEGPNILTVVLKRFESDN  559

Query  2777  FGKLNKTITFPEILNLASYMSGTS--DKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQ  2950
             FGKL+K I FPE+L+++ YMS  +  D  P+Y LY V+ H D    ++SGHYVCY+KN  
Sbjct  560   FGKLSKPIHFPELLDISPYMSNPNHGDHDPMYSLYAVVVHLDA--TSYSGHYVCYIKNLH  617

Query  2951  NKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
               WFK++DS V PV +++VL +GAYMLLY+R SPR
Sbjct  618   GDWFKIDDSNVFPVPLQTVLLEGAYMLLYARDSPR  652


 Score = 82.4 bits (202),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 74/142 (52%), Gaps = 25/142 (18%)
 Frame = +2

Query  377  AAFLVFIGPLLGFL-VRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssys  553
            + FL+    +L FL +R++WR A   REE+ RL+ LA+EE+  A  +   E       Y 
Sbjct  2    SPFLLIGFLMLAFLLIRRQWRSAAVNREEVLRLISLATEESYLAAEKKEEEEARATVDYY  61

Query  554  fgsVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKC  733
              S V  +V                        Y CA C    +TRCS+CK+VRYCS KC
Sbjct  62   GSSSVPPDV------------------------YSCAVCHYPTTTRCSQCKSVRYCSSKC  97

Query  734  QIIHWRLGHKDECHPPVNNNHD  799
            QI+HWR GHK+EC PP  +++D
Sbjct  98   QILHWRRGHKEECRPPPLHDYD  119



>gb|EPS59868.1| hypothetical protein M569_14935, partial [Genlisea aurea]
Length=373

 Score =   411 bits (1056),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 188/321 (59%), Positives = 250/321 (78%), Gaps = 2/321 (1%)
 Frame = +2

Query  2081  ELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWC  2260
             ++FV+L++S  +ELRPFGL NCGNSCYANAVLQCLAFT P T+YFLQG HS+ C KKDWC
Sbjct  55    QMFVQLYSSNTMELRPFGLLNCGNSCYANAVLQCLAFTRPLTSYFLQGLHSRTCRKKDWC  114

Query  2261  FNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLK  2440
               CEFE L+ K +  N PLSP+ IISH++ IG+ L  GR+EDAH+FLR V+E MQS+ L+
Sbjct  115   LICEFEHLMQKGRETNYPLSPVGIISHVKRIGNHLIPGRQEDAHDFLRNVVEKMQSIWLE  174

Query  2441  EAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEG  2620
             E+G   S SL E ++L GL+FGG++RSKI+C++C G+S + +R+MD+ VEI GDI +L  
Sbjct  175   ESGF--SGSLAEDSTLFGLSFGGYVRSKIKCLKCSGRSVQCDRLMDIAVEISGDIDTLNE  232

Query  2621  ALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTI  2800
             AL QFT +E L G++KY CSRCKSYE+A+KKL ++EAPN+LT+ LKRFQSG   KL K +
Sbjct  233   ALAQFTISETLGGDDKYKCSRCKSYERAKKKLTVVEAPNILTLVLKRFQSGNSEKLKKFV  292

Query  2801  TFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSK  2980
              F EIL+LA YMS  SD+ PIY LY  + H ++MN ++SGHY+ YVKN + +WF+++DS+
Sbjct  293   RFHEILDLAPYMSSLSDEFPIYDLYATVVHSNMMNDSYSGHYISYVKNVKGEWFRMDDSR  352

Query  2981  VKPVEIESVLSKGAYMLLYSR  3043
             V  V++E+VLS  AYML Y+R
Sbjct  353   VSRVDVETVLSTEAYMLFYAR  373



>emb|CDY14564.1| BnaC03g48950D [Brassica napus]
Length=762

 Score =   424 bits (1091),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 202/335 (60%), Positives = 254/335 (76%), Gaps = 8/335 (2%)
 Frame = +2

Query  2060  NKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKG  2239
             N+  F YE+FVKL+  + +EL PFGL N GNSCYAN VLQCLAFT P  +Y ++G HSK 
Sbjct  336   NEMSFSYEMFVKLYRDR-IELHPFGLVNLGNSCYANVVLQCLAFTRPLISYLIRGIHSKA  394

Query  2240  CAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY-VIE  2416
             C KK WCF CEFE L+LK++ G SPLSPI+I+S L+ IG  LG G++EDAHEFLR+  ++
Sbjct  395   CRKKSWCFVCEFEFLILKSRGGESPLSPIKILSRLQKIGKHLGPGKQEDAHEFLRWCAVD  454

Query  2417  TMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEID  2596
             TMQSV LKEA    +  L E+T+L+GLTFGG+L SKI+CM+C  KSER E +MDLTVEI 
Sbjct  455   TMQSVFLKEAD--AADPLAEETTLVGLTFGGYLHSKIKCMKCLHKSERTELMMDLTVEIG  512

Query  2597  GDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGK  2776
             GDI SLE AL QFT  E+LDGEN+Y C RCKSY+KA+KKL ILE PN+LT+ LKRF+S  
Sbjct  513   GDIGSLEEALAQFTAYEVLDGENRYLCDRCKSYQKAKKKLVILEGPNILTVVLKRFESDN  572

Query  2777  FGKLNKTITFPEILNLASYMSGTS--DKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQ  2950
             FGKL+K I FPE+L+++ YMS  +  D  P+Y LY V+ H D    ++SGHYVCY+KN  
Sbjct  573   FGKLSKPIHFPELLDISPYMSNPNHGDHHPMYSLYAVVVHLDA--TSYSGHYVCYIKNLH  630

Query  2951  NKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
               WFK++DS V PV +++VL +GAYMLLY+R SPR
Sbjct  631   GDWFKIDDSNVFPVPLQTVLLEGAYMLLYARDSPR  665


 Score = 84.0 bits (206),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 97/205 (47%), Gaps = 36/205 (18%)
 Frame = +2

Query  383  FLVFIGPLLGFL-VRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            FL+    +L FL +R++WR A  +REE+ RL+ LA+EE+  A  E   E       Y   
Sbjct  4    FLLIGFLMLAFLLIRRQWRSAAVKREEVLRLISLATEESYLAAEEKEKEEARATVDYYGS  63

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
            S                    +SVP      Y CA C    +TRC++CK+VRYCS KCQI
Sbjct  64   S--------------------SSVPPDV---YSCAVCHYPTTTRCAQCKSVRYCSSKCQI  100

Query  740  IHWRLGHKDECHPPVNNNHD-------SYGKGANDFKVFRQEANEGYA----EGIETEER  886
            +HWR GHK+EC PP  +++D           G++    FR    E  A     G+ET ER
Sbjct  101  LHWRRGHKEECRPPPLHDYDREEDKSVKSDDGSHIEMPFRGTEFESSAADGLTGLETNER  160

Query  887  NTPGSIDASFA-EPTCSEPSISGAE  958
                 +    A + + S PS+   +
Sbjct  161  VNNDGVSVDLASDISTSRPSVQKVQ  185



>gb|ACF83022.1| unknown [Zea mays]
Length=495

 Score =   407 bits (1045),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/303 (64%), Positives = 234/303 (77%), Gaps = 2/303 (1%)
 Frame = +2

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
             FT P T Y L+G HSK C++  WCF CEFE L+++ K     LSP  I+SHL +IGSS G
Sbjct  2     FTRPLTTYLLEGLHSKNCSQNGWCFMCEFEKLIVEGKRRKIALSPTGILSHLNDIGSSFG  61

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
              G++EDAHEFLRY I+ MQSVC+KEA         E+T+L+ L FGG+LRSKI+C RC  
Sbjct  62    PGKQEDAHEFLRYAIDAMQSVCMKEARKGGVLQSAEETTLVQLIFGGYLRSKIKCSRCHV  121

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
              SE+ E ++DLTVEIDGDI+SL  AL +FT TE+LDGENKYHCSRCKSYE+A+KKL I E
Sbjct  122   SSEQCEPMLDLTVEIDGDISSLGEALVRFTSTEVLDGENKYHCSRCKSYERAKKKLTIEE  181

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMS-GTSDKSPIYQLYGVIEHEDVMN  2905
             APN+LTIALKR+QSGKFGK++K I FPE LNLA YM+  T D SP+Y LY V+ H DVMN
Sbjct  182   APNILTIALKRYQSGKFGKISKAIRFPETLNLARYMNPDTDDISPVYSLYAVVVHHDVMN  241

Query  2906  AAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTS  3085
             AAFSGHYVCYVK+ Q KWFK +DS+VKPV +++V+SK AYMLLY+RCSPRAP  +R   S
Sbjct  242   AAFSGHYVCYVKDTQGKWFKADDSQVKPVSLDNVMSKCAYMLLYARCSPRAPSSVRQAMS  301

Query  3086  HDP  3094
              DP
Sbjct  302   -DP  303



>ref|XP_010274759.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010274766.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
Length=998

 Score =   408 bits (1048),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 191/353 (54%), Positives = 244/353 (69%), Gaps = 3/353 (1%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             SR    GA  +   R  NK LFPYE FVK F  +  +L P GL NCGNSCYANAVLQCL 
Sbjct  435   SRQGVTGATRDTHKR--NKVLFPYEEFVKFFQCEIWDLYPRGLLNCGNSCYANAVLQCLT  492

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
              T P   Y LQ +HS+ C  KDWC  CE E  V+       PLSP RI+ H+ NIGS +G
Sbjct  493   CTKPLIVYLLQKYHSRTCFVKDWCLMCELEQHVMMLGEAGGPLSPNRILLHMRNIGSQMG  552

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSC-SLEEQTSLIGLTFGGFLRSKIECMRCG  2545
              G +EDAHEFLR ++ +MQS+CL+  G      S  ++T+ I  TFGG LRSK++C+RC 
Sbjct  553   GGSQEDAHEFLRLLVTSMQSICLEAVGGEKHVDSRLQETTFIQHTFGGSLRSKVKCLRCH  612

Query  2546  GKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKIL  2725
              +SER+E IMDLT+EI G + SLE AL QFT  E LDGEN Y C RC +Y KARK+L I 
Sbjct  613   HESERYENIMDLTLEILGWVESLEDALAQFTAAEDLDGENMYRCGRCATYVKARKQLSIH  672

Query  2726  EAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMN  2905
             EAPN+LTI LKRFQ+GK+GK+NK ITFP++L++  +M+G  D  P+Y LY V+ H D +N
Sbjct  673   EAPNILTIVLKRFQTGKYGKINKCITFPDMLDMIPFMTGIGDSPPLYLLYAVVVHLDTLN  732

Query  2906  AAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPK  3064
             A+FSGHYV YVK+ Q  W +++D++V+PV +  V+S+GAY+L YSR  PR P+
Sbjct  733   ASFSGHYVAYVKDLQGIWLRIDDTEVQPVPMSQVMSEGAYILFYSRSCPRPPR  785


 Score = 80.5 bits (197),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  611  SSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            +S + ++P ++   ++CA+CFS A TRCSRCK+VRYCSGKCQI+HWR GH+ +C+
Sbjct  60   ASVIPTLPSSKIGFHECARCFSPAITRCSRCKSVRYCSGKCQILHWRQGHRQDCY  114



>ref|XP_011044935.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X4 [Populus euphratica]
Length=700

 Score =   399 bits (1024),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 184/338 (54%), Positives = 239/338 (71%), Gaps = 3/338 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             + LFPYE FV LFNS+ ++L P GL NCGNSCYANAVLQCL  T P   + L+  HS+ C
Sbjct  228   RMLFPYEEFVNLFNSEVIDLTPRGLVNCGNSCYANAVLQCLTCTKPLIVFLLRRSHSRAC  287

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
              + DWC  CE E  V+  +    PLSP RI+ H+  I   +GNG +EDAHEFLR +I +M
Sbjct  288   CEIDWCLMCELEQHVMMIRECGGPLSPSRILLHMRKINHQIGNGSQEDAHEFLRLLIASM  347

Query  2423  QSVCLKEAG--VRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEID  2596
             QS+CL++ G   R    L+E T+ I  TFGG LRSK++C+RC  +SER+E IMDLT+EI 
Sbjct  348   QSICLEKLGGEDRVDPRLQE-TTFIQHTFGGRLRSKVKCLRCHHESERYENIMDLTLEIF  406

Query  2597  GDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGK  2776
             G + SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPNVLTI LKRFQ GK
Sbjct  407   GWVESLEDALTQFTTPEELDGENMYRCGRCAAYVRARKQLSIHEAPNVLTIVLKRFQEGK  466

Query  2777  FGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNK  2956
             +GK+NK +TFP++L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  
Sbjct  467   YGKINKCVTFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKDLQGS  526

Query  2957  WFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             WF+++D++V PV +  V+ +GAY+L Y+R  PR  K I
Sbjct  527   WFRIDDTEVHPVSMSQVMLEGAYILFYTRSCPRPEKAI  564


 Score = 76.6 bits (187),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            CA+CFS A+TRCSRCK+VRYCSGKCQIIHWR  HK+EC 
Sbjct  76   CARCFSPATTRCSRCKSVRYCSGKCQIIHWRQVHKEECQ  114



>ref|XP_010279646.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010279647.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010279649.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010279650.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010279651.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
Length=1013

 Score =   407 bits (1047),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 191/352 (54%), Positives = 244/352 (69%), Gaps = 3/352 (1%)
 Frame = +2

Query  2012  RHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAF  2191
             R +  GA S+   R  NK LFPYE FVK F  +  +L P GL NCGNSCYANAVLQCL  
Sbjct  439   RQSVTGAISDTHKR--NKVLFPYEEFVKFFQYEVWDLSPRGLLNCGNSCYANAVLQCLTC  496

Query  2192  TPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGN  2371
             T P   Y L+  HS+ C  KDWC  CE E  V+    G  PLSP RI+ H+ NI S +G 
Sbjct  497   TKPLIVYLLRKSHSRTCCVKDWCLMCELEHHVMMLTEGGGPLSPNRILLHMRNIASRMGG  556

Query  2372  GREEDAHEFLRYVIETMQSVCLKEAGVRTSC-SLEEQTSLIGLTFGGFLRSKIECMRCGG  2548
             G +EDAHEFLR ++ +MQS+CL+  G      S  ++T+ I  TFGG LRSK++C++C  
Sbjct  557   GSQEDAHEFLRLLVASMQSICLEVVGGEKHVDSRLQETTFIQHTFGGRLRSKVKCLKCHH  616

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             +SER+E IMDLT+EI G + SLE AL QFT  E LDGEN Y C RC +Y KARK+L I E
Sbjct  617   ESERYENIMDLTLEILGWVESLEDALTQFTAAEDLDGENMYRCGRCATYVKARKQLSIHE  676

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APN+LTI LKRFQ GK+GK+NK ITFP++L++  +M+GT D  P+Y LYGV+ H D +NA
Sbjct  677   APNILTIVLKRFQKGKYGKINKCITFPDMLDMIPFMTGTGDSPPLYMLYGVVVHLDTLNA  736

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPK  3064
             +FSGHYV YVK+    W +++D++V+PV I  V+S+GAY+L YSR  PR P+
Sbjct  737   SFSGHYVSYVKDMHGTWLRIDDTEVQPVPISQVMSEGAYILFYSRSCPRPPR  788


 Score = 80.1 bits (196),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  614  STLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            S +  VP  +   ++CA+CF  A+TRCSRCK+VRYCSGKCQIIHWR GH+ EC 
Sbjct  61   SVIPVVPSLKVGFHECARCFGPATTRCSRCKSVRYCSGKCQIIHWRQGHRQECQ  114



>gb|EMT11184.1| Ubiquitin carboxyl-terminal hydrolase 16 [Aegilops tauschii]
Length=692

 Score =   397 bits (1019),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 242/338 (72%), Gaps = 22/338 (7%)
 Frame = +2

Query  2066  GLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCA  2245
              LFPYE FVKL+N  KVELRPFGL N GNSCYAN VLQCLAFT P TAYFL+G HSK   
Sbjct  189   ALFPYERFVKLYNFDKVELRPFGLCNLGNSCYANVVLQCLAFTRPLTAYFLEGLHSK---  245

Query  2246  KKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQ  2425
                        SL L+         P  ++  L  +  +   G          Y I+TMQ
Sbjct  246   --------HSHSLELQYITTVFSRFPKGMVL-LVRVSKTHCRG----------YAIDTMQ  286

Query  2426  SVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             S  +KEA    +  L E+T+LI L FGG+LRSKI+C +CG  SE  ERI+DLTVEIDGDI
Sbjct  287   SASMKEANANGAHKLAEETTLIQLMFGGYLRSKIKCTKCGVSSEHCERILDLTVEIDGDI  346

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
             ++LE AL +FT +E+LDG+N+YHC+RCKSYE+ +KKL I EAPN+LTIALKR+QSG FGK
Sbjct  347   STLEEALHRFTSSEVLDGDNRYHCTRCKSYERGKKKLTISEAPNILTIALKRYQSGMFGK  406

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +NK I FPE LNL+SYMS T D SP+Y+LY V+ H DVMN++ SGHYVCYVK+ Q KW++
Sbjct  407   INKAIRFPEYLNLSSYMSTTDDCSPVYRLYAVVVHRDVMNSSVSGHYVCYVKDSQGKWYE  466

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSL  3079
             ++DS+VKPV +++V S+ AYMLLY+RCSPRAP+ +R L
Sbjct  467   MDDSQVKPVSLKNVRSECAYMLLYARCSPRAPRSLRKL  504



>ref|XP_006450208.1| hypothetical protein CICLE_v10007658mg [Citrus clementina]
 gb|ESR63448.1| hypothetical protein CICLE_v10007658mg [Citrus clementina]
Length=675

 Score =   395 bits (1014),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 239/340 (70%), Gaps = 1/340 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ F+KLFN  K    P GL NCGNSC+AN VLQCL +T P  AY L+  H K C +
Sbjct  102   LFPYDEFLKLFNWDKPGFAPCGLLNCGNSCFANVVLQCLTYTRPLVAYLLEKGHRKECGR  161

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEF++ V KA   + P SP+ I+S L NIG +LG GR+EDAHEF+R+ I+TMQS
Sbjct  162   DDWCFLCEFQTHVEKASQSSHPFSPMSILSRLPNIGGNLGYGRQEDAHEFMRFAIDTMQS  221

Query  2429  VCLKEAGVRTSCSLEEQ-TSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
              CL E G   +     Q T+LI   FGG L+S++ C +C   S ++E +MDLTVEI GD 
Sbjct  222   TCLDEFGGEKAVPPRSQETTLIQHIFGGHLQSQVICSKCNNISNQYENMMDLTVEIHGDA  281

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
             ASLE  L QFT  E LDG+N Y C  C  Y KA K+L +  APN+LTIALKRFQSG+FGK
Sbjct  282   ASLEECLDQFTAKEWLDGDNMYKCDGCNDYVKAWKRLTVRRAPNILTIALKRFQSGRFGK  341

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK +TFPE L+L+ YMS   D++ +Y+LY V+ H D++NA+F GHY+CYVK+F+  W++
Sbjct  342   LNKRVTFPETLDLSPYMSDGGDRTDVYKLYAVVVHVDMLNASFFGHYICYVKDFRGHWYR  401

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTS  3085
             V+D KV  V++E VLS+GAYMLLY+R S R   L+ + +S
Sbjct  402   VDDCKVTSVDLEEVLSQGAYMLLYNRVSARPSYLVDTESS  441


 Score = 55.1 bits (131),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            C  C +  S +CSRCK+VRYCS KCQ  HW+ GHK +C
Sbjct  15   CIVCGNPGSKKCSRCKSVRYCSSKCQTSHWQSGHKRKC  52



>emb|CBI33027.3| unnamed protein product [Vitis vinifera]
Length=894

 Score =   401 bits (1030),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/370 (51%), Positives = 251/370 (68%), Gaps = 5/370 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPYE FV+ F  +   + P GL NCGNSCYANAVLQCL  T P   Y LQ  HS+ C
Sbjct  386   KMLFPYEEFVRFFQCEVFNISPRGLLNCGNSCYANAVLQCLTCTKPLIIYLLQRSHSRTC  445

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
                +WC  CE E  V+  +    PLSP RI+SH+ +I   +G+G +EDAHEFLR ++ +M
Sbjct  446   CVTNWCLMCELEKHVMMLRESGGPLSPSRILSHMRSINCQIGDGSQEDAHEFLRLLVTSM  505

Query  2423  QSVCL-KEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QS+CL K  G R   +  ++T+ I  TFGG LRSK++C+RC  +SER+E IMDLT+EI G
Sbjct  506   QSICLEKLGGEREVDARLQETTFIQHTFGGRLRSKVKCLRCHLESERYENIMDLTLEIFG  565

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
              + SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPN+LTI LKRFQ G++
Sbjct  566   WVESLEDALTQFTTPEDLDGENMYRCRRCTTYVRARKQLSIHEAPNILTIVLKRFQEGRY  625

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GK+NK ITFP++L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  W
Sbjct  626   GKINKCITFPDMLDMIPFMTGTYDVPPLYMLYAVVVHMDTLNASFSGHYVAYVKDLQGNW  685

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL--IRSLTSHDPRGQKYVNCKSSSH  3133
             F+V+D++V+PV    V+S+GAY+L Y R  PR P+   ++++    P   K+  C S +H
Sbjct  686   FRVDDAEVQPVSTNQVMSEGAYILFYMRSWPRPPRAFPVKAIQQQAPASAKH--CSSKTH  743

Query  3134  TNSWDLSKGD  3163
              +S    +GD
Sbjct  744   KSSRSKPRGD  753


 Score = 76.3 bits (186),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  653  YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            ++CA+CF  A+TRCSRCK+VRYCSGKCQIIHWR  HK+EC 
Sbjct  12   HECARCFGPATTRCSRCKSVRYCSGKCQIIHWRQVHKEECQ  52



>ref|XP_006483493.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like isoform 
X2 [Citrus sinensis]
Length=713

 Score =   395 bits (1016),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 240/340 (71%), Gaps = 1/340 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ F+KLFN  K    P GL NCGNSC+AN VLQCL +T P  AY L+  H K C +
Sbjct  160   LFPYDEFLKLFNWDKPGFAPCGLLNCGNSCFANVVLQCLTYTRPLVAYLLEKGHRKECGR  219

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEF++ V KA   + P SP+ I+S L NIG +LG GR+EDAHEF+R+ I+TMQS
Sbjct  220   DDWCFLCEFQTHVEKASQSSHPFSPMSILSRLPNIGGNLGYGRQEDAHEFMRFAIDTMQS  279

Query  2429  VCLKEAGVRTSCSLEEQ-TSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             +CL E G   +     Q T+LI   FGG L+S++ C +C   S ++E +MDLTVEI GD 
Sbjct  280   ICLDEFGGEKAVPPRSQETTLIQHIFGGHLQSQVICSKCNNISNQYENMMDLTVEIHGDA  339

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
             ASLE  L QFT  E LDG+N Y C  C  Y KA K+L +  APN+LTIALKRFQSG+FGK
Sbjct  340   ASLEECLDQFTAKEWLDGDNMYKCDGCNDYVKAWKRLTVQRAPNILTIALKRFQSGRFGK  399

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK +TFPE L+L+ YMS   D++ +Y+LY V+ H D++NA+F GHY+CYVK+F+  W++
Sbjct  400   LNKRVTFPETLDLSPYMSDGGDRTDVYKLYAVVVHVDMLNASFFGHYICYVKDFRGHWYR  459

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTS  3085
             V+D KV  V++E VLS+GAYMLLY+R S R   L+ + +S
Sbjct  460   VDDCKVTSVDLEEVLSQGAYMLLYNRVSARPSYLVDTESS  499


 Score = 55.1 bits (131),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            C  C +  S +CSRCK+VRYCS KCQ  HW+ GHK +C
Sbjct  73   CIVCGNPGSKKCSRCKSVRYCSSKCQTSHWQSGHKRKC  110



>gb|KHN19658.1| Ubiquitin carboxyl-terminal hydrolase 19 [Glycine soja]
Length=671

 Score =   394 bits (1012),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 239/335 (71%), Gaps = 3/335 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LF Y+ FVK FN  K    P GL NCGNSC+AN VLQCL+FT P  AY L+  H + C+ 
Sbjct  105   LFSYDEFVKFFNWDKPGFPPCGLLNCGNSCFANVVLQCLSFTKPLVAYLLEKGHRRECSC  164

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ V + +  +   SP+ I+S L NIG +LG GR+EDAHEF+R+ I+TMQS
Sbjct  165   NDWCFLCEFENHVERTRLSSQAFSPMNILSRLPNIGGTLGYGRQEDAHEFMRFSIDTMQS  224

Query  2429  VCLKEAGVRTSC--SLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGD  2602
             VCL E G   +   +L+E T+LI   FGG L+S++ C +C   S ++E +MDLTVEI GD
Sbjct  225   VCLDEFGGEKAVPPNLQE-TTLIQHIFGGRLQSEVICTKCNKISNQYENMMDLTVEIHGD  283

Query  2603  IASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFG  2782
              ASLE  L QFT  E LDGEN Y C  CK Y KA K+L +  APN+LTIALKRFQSG+FG
Sbjct  284   AASLEECLDQFTARERLDGENMYKCEGCKDYVKAWKRLTVKCAPNILTIALKRFQSGRFG  343

Query  2783  KLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWF  2962
             KLNK I+FPE LNL+ YMS   D S IY+LYGV+ H D++NA+F GHY+CY+K+FQ  W+
Sbjct  344   KLNKRISFPETLNLSPYMSEAGDGSDIYKLYGVVVHIDMLNASFFGHYICYIKDFQGNWY  403

Query  2963  KVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             +++D KV  VE+E VLS+GAYMLLYSRCS R   L
Sbjct  404   RIDDWKVMTVEVEEVLSQGAYMLLYSRCSARPSGL  438



>ref|XP_011044934.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Populus euphratica]
Length=803

 Score =   398 bits (1023),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/338 (54%), Positives = 239/338 (71%), Gaps = 3/338 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             + LFPYE FV LFNS+ ++L P GL NCGNSCYANAVLQCL  T P   + L+  HS+ C
Sbjct  331   RMLFPYEEFVNLFNSEVIDLTPRGLVNCGNSCYANAVLQCLTCTKPLIVFLLRRSHSRAC  390

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
              + DWC  CE E  V+  +    PLSP RI+ H+  I   +GNG +EDAHEFLR +I +M
Sbjct  391   CEIDWCLMCELEQHVMMIRECGGPLSPSRILLHMRKINHQIGNGSQEDAHEFLRLLIASM  450

Query  2423  QSVCLKEAGV--RTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEID  2596
             QS+CL++ G   R    L+E T+ I  TFGG LRSK++C+RC  +SER+E IMDLT+EI 
Sbjct  451   QSICLEKLGGEDRVDPRLQE-TTFIQHTFGGRLRSKVKCLRCHHESERYENIMDLTLEIF  509

Query  2597  GDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGK  2776
             G + SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPNVLTI LKRFQ GK
Sbjct  510   GWVESLEDALTQFTTPEELDGENMYRCGRCAAYVRARKQLSIHEAPNVLTIVLKRFQEGK  569

Query  2777  FGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNK  2956
             +GK+NK +TFP++L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  
Sbjct  570   YGKINKCVTFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKDLQGS  629

Query  2957  WFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             WF+++D++V PV +  V+ +GAY+L Y+R  PR  K I
Sbjct  630   WFRIDDTEVHPVSMSQVMLEGAYILFYTRSCPRPEKAI  667


 Score = 76.6 bits (187),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 69/132 (52%), Gaps = 31/132 (23%)
 Frame = +2

Query  383  FLVF-IGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            FLV  + PL+ +++  KW  +  +RE I  L  LA+EEA RAE  A              
Sbjct  13   FLVLGVLPLVAYILLGKWSESAKKRERISLLAQLAAEEAFRAEVMAT-------------  59

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                             +  +  +  ++   + CA+CFS A+TRCSRCK+VRYCSGKCQI
Sbjct  60   -----------------ACIIPPMSTSKNGIHFCARCFSPATTRCSRCKSVRYCSGKCQI  102

Query  740  IHWRLGHKDECH  775
            IHWR  HK+EC 
Sbjct  103  IHWRQVHKEECQ  114



>ref|XP_002308728.2| hypothetical protein POPTR_0006s28540g [Populus trichocarpa]
 gb|EEE92251.2| hypothetical protein POPTR_0006s28540g [Populus trichocarpa]
Length=633

 Score =   392 bits (1008),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 188/340 (55%), Positives = 236/340 (69%), Gaps = 2/340 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPY+ F+KL+NS K E  P GL NCGNSC+AN VLQCL +T P  AY L+  H   C
Sbjct  159   KVLFPYDEFIKLYNSDKPEFSPCGLLNCGNSCFANVVLQCLTYTRPLVAYLLKKGHQTEC  218

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
                DWCF CEF+S V +A     P SPI IIS L NIG +LG GR+EDAHEF+R  I+TM
Sbjct  219   KHNDWCFLCEFQSHVERASQSTLPFSPINIISRLPNIGGNLGYGRQEDAHEFMRLAIDTM  278

Query  2423  QSVCLKEAGVRTSCS-LEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QSVCL E G   +     ++T++I   FGG L+S++ C +C   S + E +MDLTVEI G
Sbjct  279   QSVCLDEFGGEKAVEPASQETTIIQHIFGGRLQSQVICTKCNKISNQFENMMDLTVEIHG  338

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
             D ASLE  L QFT  E L GEN Y C RC  Y KA K+L I  APNVLTIALKRFQSG+F
Sbjct  339   DAASLEECLDQFTDKEWLHGENMYKCDRCNDYVKAWKRLTIQRAPNVLTIALKRFQSGRF  398

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GKLNK +TFPE+L+L+ YMS   D + +Y+LY V+ H D++NA+F GHY+CY K+F   W
Sbjct  399   GKLNKRVTFPEMLDLSPYMSEGGDGTDVYKLYAVVVHVDMLNASFFGHYICYTKDFHGNW  458

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSL  3079
              +++D KV  VE++ VLS+GAYML+YSR S R P  +R++
Sbjct  459   HRIDDCKVSSVELDEVLSQGAYMLVYSRVSVR-PSCLRTI  497



>ref|XP_011044933.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Populus euphratica]
Length=830

 Score =   399 bits (1024),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/338 (54%), Positives = 239/338 (71%), Gaps = 3/338 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             + LFPYE FV LFNS+ ++L P GL NCGNSCYANAVLQCL  T P   + L+  HS+ C
Sbjct  358   RMLFPYEEFVNLFNSEVIDLTPRGLVNCGNSCYANAVLQCLTCTKPLIVFLLRRSHSRAC  417

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
              + DWC  CE E  V+  +    PLSP RI+ H+  I   +GNG +EDAHEFLR +I +M
Sbjct  418   CEIDWCLMCELEQHVMMIRECGGPLSPSRILLHMRKINHQIGNGSQEDAHEFLRLLIASM  477

Query  2423  QSVCLKEAGV--RTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEID  2596
             QS+CL++ G   R    L+E T+ I  TFGG LRSK++C+RC  +SER+E IMDLT+EI 
Sbjct  478   QSICLEKLGGEDRVDPRLQE-TTFIQHTFGGRLRSKVKCLRCHHESERYENIMDLTLEIF  536

Query  2597  GDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGK  2776
             G + SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPNVLTI LKRFQ GK
Sbjct  537   GWVESLEDALTQFTTPEELDGENMYRCGRCAAYVRARKQLSIHEAPNVLTIVLKRFQEGK  596

Query  2777  FGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNK  2956
             +GK+NK +TFP++L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  
Sbjct  597   YGKINKCVTFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKDLQGS  656

Query  2957  WFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             WF+++D++V PV +  V+ +GAY+L Y+R  PR  K I
Sbjct  657   WFRIDDTEVHPVSMSQVMLEGAYILFYTRSCPRPEKAI  694


 Score = 76.6 bits (187),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            CA+CFS A+TRCSRCK+VRYCSGKCQIIHWR  HK+EC 
Sbjct  76   CARCFSPATTRCSRCKSVRYCSGKCQIIHWRQVHKEECQ  114



>ref|XP_009390669.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
15-like [Musa acuminata subsp. malaccensis]
Length=960

 Score =   402 bits (1033),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 248/362 (69%), Gaps = 7/362 (2%)
 Frame = +2

Query  2000  ASKSRHNSLGAWSEIGGR-YNNKG-----LFPYELFVKLFNSKKVELRPFGLTNCGNSCY  2161
             A+  + + +  W+ +G + YN K      LFPYE  VK F  K+  + P GL NCGNSCY
Sbjct  404   AAAEKTSKVLKWNLVGSKNYNKKNKVSQMLFPYEDLVKFFQRKEGGIYPRGLLNCGNSCY  463

Query  2162  ANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISH  2341
             ANAVLQCL  T P   Y LQ  HS+ C  K+WC  CE E  V   + G  PLSP RI+S+
Sbjct  464   ANAVLQCLTGTKPLMVYLLQRSHSRTCRVKEWCLMCELEQHVSMLREGGGPLSPSRILSN  523

Query  2342  LENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLR  2518
             + NIG  +G G +EDAHEFLR ++  MQSVCL+  G         ++T+LI   FGG L+
Sbjct  524   MRNIGCRMGGGNQEDAHEFLRLLVMQMQSVCLERLGGEKEIDPRLQETTLIQQIFGGRLK  583

Query  2519  SKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYE  2698
             SK++C+RC  +SER+ERIMDLT+EI G + SLE AL QFT  E LDGEN Y C RC +Y 
Sbjct  584   SKVKCLRCHLESERYERIMDLTLEIHGWVESLEDALTQFTAPEDLDGENMYRCGRCSTYV  643

Query  2699  KARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYG  2878
             KARK+L + E PN+LTI LKRFQ+GK+GK+NK +TFP++L++  +M+GT+D  P+Y LY 
Sbjct  644   KARKQLSVHEVPNILTIVLKRFQTGKYGKINKCVTFPDMLDMIPFMTGTADNPPLYLLYA  703

Query  2879  VIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRA  3058
             V+ H D  NA+FSGHYV YVK+ +  WFK++DS+V+PV +  V+S+GAYML YSR  PR 
Sbjct  704   VVVHLDAFNASFSGHYVSYVKDLEGTWFKIDDSEVQPVPLSQVMSEGAYMLFYSRSFPRP  763

Query  3059  PK  3064
             P+
Sbjct  764   PR  765


 Score = 82.4 bits (202),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 43/57 (75%), Gaps = 6/57 (11%)
 Frame = +2

Query  623  TSVPVARQLP------YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            TSV V   LP      ++CA+CF+ A+TRCSRCK+VRYCSGKCQIIHWR  HK ECH
Sbjct  58   TSVHVPLVLPPSKTGFHECARCFAPATTRCSRCKSVRYCSGKCQIIHWRRAHKHECH  114



>gb|KDO67336.1| hypothetical protein CISIN_1g004724mg [Citrus sinensis]
Length=733

 Score =   395 bits (1016),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 240/340 (71%), Gaps = 1/340 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ F+KLFN  K    P GL NCGNSC+AN VLQCL +T P  AY L+  H K C +
Sbjct  160   LFPYDEFLKLFNWDKPGFAPCGLLNCGNSCFANVVLQCLTYTRPLVAYLLEKGHRKECGR  219

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEF++ V KA   + P SP+ I+S L NIG +LG GR+EDAHEF+R+ I+TMQS
Sbjct  220   DDWCFLCEFQTHVEKASQSSHPFSPMSILSRLPNIGGNLGYGRQEDAHEFMRFAIDTMQS  279

Query  2429  VCLKEAGVRTSCSLEEQ-TSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             +CL E G   +     Q T+LI   FGG L+S++ C +C   S ++E +MDLTVEI GD 
Sbjct  280   ICLDEFGGEKAVPPRSQETTLIQHIFGGHLQSQVICSKCNNISNQYENMMDLTVEIHGDA  339

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
             ASLE  L QFT  E LDG+N Y C  C  Y KA K+L +  APN+LTIALKRFQSG+FGK
Sbjct  340   ASLEECLDQFTAKEWLDGDNMYKCDGCNDYVKAWKRLTVRRAPNILTIALKRFQSGRFGK  399

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK +TFPE L+L+ YMS   D++ +Y+LY V+ H D++NA+F GHY+CYVK+F+  W++
Sbjct  400   LNKRVTFPETLDLSPYMSDGGDRTDVYKLYAVVVHVDMLNASFFGHYICYVKDFRGHWYR  459

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTS  3085
             V+D KV  V++E VLS+GAYMLLY+R S R   L+ + +S
Sbjct  460   VDDCKVTSVDLEEVLSQGAYMLLYNRVSARPSYLVDTESS  499


 Score = 55.1 bits (131),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            C  C +  S +CSRCK+VRYCS KCQ  HW+ GHK +C
Sbjct  73   CIVCGNPGSKKCSRCKSVRYCSSKCQTSHWQSGHKRKC  110



>ref|XP_011044931.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Populus euphratica]
 ref|XP_011044932.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Populus euphratica]
Length=831

 Score =   399 bits (1024),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/338 (54%), Positives = 239/338 (71%), Gaps = 3/338 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             + LFPYE FV LFNS+ ++L P GL NCGNSCYANAVLQCL  T P   + L+  HS+ C
Sbjct  359   RMLFPYEEFVNLFNSEVIDLTPRGLVNCGNSCYANAVLQCLTCTKPLIVFLLRRSHSRAC  418

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
              + DWC  CE E  V+  +    PLSP RI+ H+  I   +GNG +EDAHEFLR +I +M
Sbjct  419   CEIDWCLMCELEQHVMMIRECGGPLSPSRILLHMRKINHQIGNGSQEDAHEFLRLLIASM  478

Query  2423  QSVCLKEAGV--RTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEID  2596
             QS+CL++ G   R    L+E T+ I  TFGG LRSK++C+RC  +SER+E IMDLT+EI 
Sbjct  479   QSICLEKLGGEDRVDPRLQE-TTFIQHTFGGRLRSKVKCLRCHHESERYENIMDLTLEIF  537

Query  2597  GDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGK  2776
             G + SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPNVLTI LKRFQ GK
Sbjct  538   GWVESLEDALTQFTTPEELDGENMYRCGRCAAYVRARKQLSIHEAPNVLTIVLKRFQEGK  597

Query  2777  FGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNK  2956
             +GK+NK +TFP++L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  
Sbjct  598   YGKINKCVTFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKDLQGS  657

Query  2957  WFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             WF+++D++V PV +  V+ +GAY+L Y+R  PR  K I
Sbjct  658   WFRIDDTEVHPVSMSQVMLEGAYILFYTRSCPRPEKAI  695


 Score = 76.6 bits (187),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 69/132 (52%), Gaps = 31/132 (23%)
 Frame = +2

Query  383  FLVF-IGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfg  559
            FLV  + PL+ +++  KW  +  +RE I  L  LA+EEA RAE  A              
Sbjct  13   FLVLGVLPLVAYILLGKWSESAKKRERISLLAQLAAEEAFRAEVMAT-------------  59

Query  560  sVVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
                             +  +  +  ++   + CA+CFS A+TRCSRCK+VRYCSGKCQI
Sbjct  60   -----------------ACIIPPMSTSKNGIHFCARCFSPATTRCSRCKSVRYCSGKCQI  102

Query  740  IHWRLGHKDECH  775
            IHWR  HK+EC 
Sbjct  103  IHWRQVHKEECQ  114



>ref|XP_003550229.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like isoform 
X1 [Glycine max]
Length=735

 Score =   395 bits (1016),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 238/331 (72%), Gaps = 3/331 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ FVK FN  K    P GL NCGNSC+AN VLQCL+FT P  AY L+  H + C+ 
Sbjct  164   LFPYDEFVKFFNWDKPGFPPCGLLNCGNSCFANVVLQCLSFTKPLVAYLLEKGHRRECSC  223

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ V + +  +   SP+ I+S L NIG +LG G++EDAHEF+R+ I+TMQS
Sbjct  224   NDWCFLCEFENHVERTRLSSQAFSPMNILSRLPNIGGTLGYGKQEDAHEFMRFSIDTMQS  283

Query  2429  VCLKEAGVRTSC--SLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGD  2602
             VCL E G   +   +L+E T+LI   FGG L+S++ C +C   S ++E +MDLTVEI GD
Sbjct  284   VCLDEFGGEKAVPPNLQE-TTLIQHIFGGRLQSEVICTKCDKISNQYENMMDLTVEIHGD  342

Query  2603  IASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFG  2782
              ASLE  L QFT  E LDGEN Y C  CK Y KA K+L +  APN+LTIALKRFQSG+FG
Sbjct  343   AASLEECLDQFTAKERLDGENMYKCEGCKDYVKAWKRLTVKCAPNILTIALKRFQSGRFG  402

Query  2783  KLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWF  2962
             KLNK I FPE LNL+ YMS   D S IY+LYGV+ H D++NA+F GHY+CY+K+FQ  W+
Sbjct  403   KLNKRIAFPETLNLSPYMSEAGDGSDIYKLYGVVVHIDMLNASFFGHYICYIKDFQGNWY  462

Query  2963  KVNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             +++D KV  VE+E VLS+GAYMLLYSRCS R
Sbjct  463   RIDDWKVMTVEVEEVLSQGAYMLLYSRCSAR  493



>ref|XP_006483492.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like isoform 
X1 [Citrus sinensis]
Length=733

 Score =   395 bits (1016),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 240/340 (71%), Gaps = 1/340 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ F+KLFN  K    P GL NCGNSC+AN VLQCL +T P  AY L+  H K C +
Sbjct  160   LFPYDEFLKLFNWDKPGFAPCGLLNCGNSCFANVVLQCLTYTRPLVAYLLEKGHRKECGR  219

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEF++ V KA   + P SP+ I+S L NIG +LG GR+EDAHEF+R+ I+TMQS
Sbjct  220   DDWCFLCEFQTHVEKASQSSHPFSPMSILSRLPNIGGNLGYGRQEDAHEFMRFAIDTMQS  279

Query  2429  VCLKEAGVRTSCSLEEQ-TSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             +CL E G   +     Q T+LI   FGG L+S++ C +C   S ++E +MDLTVEI GD 
Sbjct  280   ICLDEFGGEKAVPPRSQETTLIQHIFGGHLQSQVICSKCNNISNQYENMMDLTVEIHGDA  339

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
             ASLE  L QFT  E LDG+N Y C  C  Y KA K+L +  APN+LTIALKRFQSG+FGK
Sbjct  340   ASLEECLDQFTAKEWLDGDNMYKCDGCNDYVKAWKRLTVQRAPNILTIALKRFQSGRFGK  399

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK +TFPE L+L+ YMS   D++ +Y+LY V+ H D++NA+F GHY+CYVK+F+  W++
Sbjct  400   LNKRVTFPETLDLSPYMSDGGDRTDVYKLYAVVVHVDMLNASFFGHYICYVKDFRGHWYR  459

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTS  3085
             V+D KV  V++E VLS+GAYMLLY+R S R   L+ + +S
Sbjct  460   VDDCKVTSVDLEEVLSQGAYMLLYNRVSARPSYLVDTESS  499


 Score = 55.1 bits (131),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            C  C +  S +CSRCK+VRYCS KCQ  HW+ GHK +C
Sbjct  73   CIVCGNPGSKKCSRCKSVRYCSSKCQTSHWQSGHKRKC  110



>ref|NP_565576.1| ubiquitin carboxyl-terminal hydrolase 19 [Arabidopsis thaliana]
 sp|Q9SJA1.2|UBP19_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 19; AltName: 
Full=Deubiquitinating enzyme 19; Short=AtUBP19; AltName: 
Full=Ubiquitin thioesterase 19; AltName: Full=Ubiquitin-specific-processing 
protease 19 [Arabidopsis thaliana]
 gb|AAK26025.1|AF360315_1 putative ubiquitin carboxyl terminal hydrolase [Arabidopsis thaliana]
 gb|AAL07252.1| putative ubiquitin carboxyl terminal hydrolase [Arabidopsis thaliana]
 gb|AAD23896.2| putative ubiquitin carboxyl terminal hydrolase [Arabidopsis thaliana]
 gb|AEC07607.1| ubiquitin carboxyl-terminal hydrolase 19 [Arabidopsis thaliana]
Length=672

 Score =   393 bits (1009),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 193/384 (50%), Positives = 256/384 (67%), Gaps = 4/384 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV+ +N  +  + P GLTNCGNSC+AN VLQCL++T P  AY L+  H + C +
Sbjct  154   LFPYESFVRYYNWDRPIMAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECRR  213

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A     P SP+ IIS L NIG +LG GR+EDAHE +R+ I+ MQS
Sbjct  214   NDWCFLCEFENHLDRANYSRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFAIDMMQS  273

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  274   VCLDEFGGEKVVPPRAQETTLIQYIFGGLLQSQVQCTACSNVSDQYENMMDLTVEIHGDA  333

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LTIALKRFQ G+FGK
Sbjct  334   VSLEECLDQFTAKEWLQGDNLYKCDRCDDYVKACKRLSIRCAPNILTIALKRFQGGRFGK  393

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FPE  +L  YMSG  + S +Y+LY VI H D++NA+F GHY+CYVK+F+  W++
Sbjct  394   LNKRISFPETFDLGPYMSGGGEGSDVYKLYAVIVHLDMLNASFFGHYICYVKDFRGNWYR  453

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSSSHTNSW  3145
             ++DS+V+ VE+E VLS+ AYMLLYSR  PR P  +RS  S D +    +N +S+   +  
Sbjct  454   IDDSEVEKVELEDVLSQRAYMLLYSRVQPR-PSNLRSEESQDEKKTDTLNTESNQDGSVE  512

Query  3146  DLSKGDSTNDPACRECFNSVQASS  3217
               S G  TND +     N + + S
Sbjct  513   --SSGVGTNDTSVSSLCNGIISHS  534



>ref|XP_003545417.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Glycine 
max]
Length=729

 Score =   394 bits (1013),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 239/335 (71%), Gaps = 3/335 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LF Y+ FVK FN  K    P GL NCGNSC+AN VLQCL+FT P  AY L+  H + C+ 
Sbjct  163   LFSYDEFVKFFNWDKPGFPPCGLLNCGNSCFANVVLQCLSFTKPLVAYLLEKGHRRECSC  222

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ V + +  +   SP+ I+S L NIG +LG GR+EDAHEF+R+ I+TMQS
Sbjct  223   NDWCFLCEFENHVERTRLSSQAFSPMNILSRLPNIGGTLGYGRQEDAHEFMRFSIDTMQS  282

Query  2429  VCLKEAGVRTSC--SLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGD  2602
             VCL E G   +   +L+E T+LI   FGG L+S++ C +C   S ++E +MDLTVEI GD
Sbjct  283   VCLDEFGGEKAVPPNLQE-TTLIQHIFGGRLQSEVICTKCNKISNQYENMMDLTVEIHGD  341

Query  2603  IASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFG  2782
              ASLE  L QFT  E LDGEN Y C  CK Y KA K+L +  APN+LTIALKRFQSG+FG
Sbjct  342   AASLEECLDQFTARERLDGENMYKCEGCKDYVKAWKRLTVKCAPNILTIALKRFQSGRFG  401

Query  2783  KLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWF  2962
             KLNK I+FPE LNL+ YMS   D S IY+LYGV+ H D++NA+F GHY+CY+K+FQ  W+
Sbjct  402   KLNKRISFPETLNLSPYMSEAGDGSDIYKLYGVVVHIDMLNASFFGHYICYIKDFQGNWY  461

Query  2963  KVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             +++D KV  VE+E VLS+GAYMLLYSRCS R   L
Sbjct  462   RIDDWKVMTVEVEEVLSQGAYMLLYSRCSARPSGL  496



>ref|XP_002298917.2| hypothetical protein POPTR_0001s38800g [Populus trichocarpa]
 gb|EEE83722.2| hypothetical protein POPTR_0001s38800g [Populus trichocarpa]
Length=665

 Score =   392 bits (1008),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 179/335 (53%), Positives = 232/335 (69%), Gaps = 1/335 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FVK+FN + + L P GL NCGNSCYANAVLQCL  T P   + L+  HS+ C  
Sbjct  331   LFPYEEFVKIFNCEVINLTPRGLVNCGNSCYANAVLQCLTCTKPLIIFLLRRSHSRACCG  390

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             KDWC  CE E  V+  +    PLSP RI+ H+  I   +G+G +EDAHEFLR +I +MQS
Sbjct  391   KDWCLMCELEQHVMMLRECGGPLSPSRILLHMRKINCQIGDGSQEDAHEFLRLLIASMQS  450

Query  2429  VCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             +CL+  G         ++T+ I  TFGG LRSK++C+RC  +SER+E IMDLT+EI G +
Sbjct  451   ICLERLGGEDKVDPRLQETTFIQHTFGGLLRSKVKCLRCHHESERYENIMDLTLEIFGWV  510

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPN+LTI LKRFQ GK+GK
Sbjct  511   ESLEDALTQFTTPEELDGENMYRCGRCAAYVRARKQLSIHEAPNILTIVLKRFQEGKYGK  570

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +NK ITFP++L++  +M+G  D  P+Y LY V+ H D +NA+FSGHYV YVK+ +  WFK
Sbjct  571   INKCITFPDMLDMIPFMTGMGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKDLRGSWFK  630

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             ++D++V PV +  V+ +GAY+L Y R   R  KLI
Sbjct  631   IDDTEVHPVSMSQVMLEGAYILFYKRSCTRPQKLI  665


 Score = 77.8 bits (190),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            CA+CFS A+TRCSRCK+VRYCSGKCQIIHWR  HK+EC 
Sbjct  76   CARCFSPATTRCSRCKSVRYCSGKCQIIHWRQAHKEECQ  114



>ref|XP_001772702.1| predicted protein [Physcomitrella patens]
 gb|EDQ62416.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   384 bits (985),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 179/327 (55%), Positives = 238/327 (73%), Gaps = 3/327 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LF Y+ FVKLF    ++  P GL NCGNSC+AN VLQCL +T P TAY L   H + C +
Sbjct  103   LFSYDDFVKLFEWDALD-EPCGLVNCGNSCFANVVLQCLTYTRPLTAYLLNDSHREVCKR  161

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CE +S V K +   +P SPIRI+S + +IGS LG G++EDAHEF+R+ I++MQS
Sbjct  162   NDWCFMCELQSHVRKVRETQNPFSPIRILSRIRSIGSHLGYGKQEDAHEFMRFAIDSMQS  221

Query  2429  VCLKEAGVRTSCS-LEEQTSLIGLTFGGFLRSKI-ECMRCGGKSERHERIMDLTVEIDGD  2602
              CL E G   +     ++T+LI   FGG L+S++ +CM C  +S R+E +MDL VEI G 
Sbjct  222   TCLDEFGGEKAVDPATQETTLIHHIFGGHLQSQVVKCMECHHESNRYESMMDLAVEIHGV  281

Query  2603  IASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFG  2782
             + SLE A+ QFT  E+LDG+NKY C RC +Y +A K+L + EAPN+LTIALKRFQSGKFG
Sbjct  282   VESLEDAIAQFTAAEMLDGDNKYKCDRCNAYVRAGKRLTVHEAPNILTIALKRFQSGKFG  341

Query  2783  KLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWF  2962
             KLNK +TFP+ L+++ YMSGT+D SP+Y LY V+ H D++NA+F GHY+CYVK+    W+
Sbjct  342   KLNKRVTFPKTLDMSPYMSGTNDDSPLYGLYAVVVHVDLLNASFFGHYICYVKDSNGVWY  401

Query  2963  KVNDSKVKPVEIESVLSKGAYMLLYSR  3043
             K++DSKVK VE+E VL++ AYML Y+R
Sbjct  402   KIDDSKVKEVELEKVLAQKAYMLFYTR  428


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 3/78 (4%)
 Frame = +2

Query  659  CAQCFSSAST-RCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKVF  835
            C  C  SA+  RCS+CK+ +YCS +CQ +HWR GH++ECH PV++     G G     V 
Sbjct  2    CVVCQKSATPHRCSKCKSAKYCSSECQKLHWRSGHRNECHVPVSSRPS--GSGGESVAVC  59

Query  836  RQEANEGYAEGIETEERN  889
              +  E    G+ T   N
Sbjct  60   NGKHPETSKSGVSTTVLN  77



>ref|XP_006293755.1| hypothetical protein CARUB_v10022714mg [Capsella rubella]
 gb|EOA26653.1| hypothetical protein CARUB_v10022714mg [Capsella rubella]
Length=736

 Score =   394 bits (1012),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 194/386 (50%), Positives = 256/386 (66%), Gaps = 3/386 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FVK FN  +  + P GLTNCGNSC+AN VLQCL++T P  AY L   H + C +
Sbjct  155   LFPYESFVKYFNWDRPIMAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLDRGHKRECRR  214

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              +WCF CEFES + +A +   P SP+ IIS L NIG +LG GR+EDAHE +R+ I+ MQS
Sbjct  215   NEWCFFCEFESHLDRANHSRDPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFAIDMMQS  274

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  275   VCLDEFGGEKVVPPRAQETTLIQYIFGGLLQSQVQCTACSNVSDQYENMMDLTVEIHGDA  334

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LTIALKRFQ G+FGK
Sbjct  335   VSLEECLDQFTAKEWLQGDNLYKCDRCNDYVKACKRLSIRCAPNILTIALKRFQGGRFGK  394

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FPE  +L  YMS   + S +Y+LY VI H D++NA+F GHY+CYVK+F+  W++
Sbjct  395   LNKRISFPETFDLGPYMSSGGEGSDVYKLYAVIVHLDMLNASFFGHYICYVKDFRGNWYR  454

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSSSHTNSW  3145
             ++D+KV+ VE+E VLS+ AYMLLYSR  PR P  +RS    D +  + +N + SSH  S 
Sbjct  455   IDDAKVEKVELEDVLSQRAYMLLYSRVQPR-PSSLRSEEGQDEKKTELLNTE-SSHEGSV  512

Query  3146  DLSKGDSTNDPACRECFNSVQASSWP  3223
             + S+  + +      C  S+  S  P
Sbjct  513   ESSEVGAIDIKMSSLCNGSISHSDDP  538



>ref|XP_004488653.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Cicer 
arietinum]
Length=936

 Score =   399 bits (1026),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 245/356 (69%), Gaps = 5/356 (1%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRY----NNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVL  2176
             ++H  L +  + G RY    N K LFPYE FVK+F S+   + P GL NCGNSCYANAVL
Sbjct  412   TKHTVLASSEDSGVRYKKAKNVKMLFPYEEFVKIFQSEVFGIFPRGLLNCGNSCYANAVL  471

Query  2177  QCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIG  2356
             QCL  T P   Y L G HSK C  KDWC  CE E  ++  +   +PLSP RI+ H+ +I 
Sbjct  472   QCLTSTKPLVVYLLYGSHSKSCCAKDWCLMCELEQHMMILRENGAPLSPSRILWHMRSIN  531

Query  2357  SSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIEC  2533
               +G+G +EDAHEFLR ++ +MQS+CL+  G         ++T+ I  TFGG L+SK++C
Sbjct  532   CHMGDGSQEDAHEFLRLLVASMQSICLEGLGGEKKVDPRLQETTFIQHTFGGHLQSKVKC  591

Query  2534  MRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKK  2713
             + C  +SER+E IMDLT+EI G + SLE AL QFT  E LDGEN Y C RC +Y +ARK+
Sbjct  592   LNCSHESERYENIMDLTLEILGWVESLEDALTQFTSPEDLDGENMYRCGRCTAYVRARKQ  651

Query  2714  LKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHE  2893
             L I EAPN+LTI LKRFQ G++GK+NK ITFPE L++  +M+GT D  P+Y LY V+ H 
Sbjct  652   LSIHEAPNILTIVLKRFQEGRYGKINKCITFPENLDMIPFMTGTGDIPPLYALYAVVVHL  711

Query  2894  DVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             D +NA+FSGHYV YVK+    WF+++D++V+PV I  V+S+GAY+L Y+R SPR P
Sbjct  712   DTLNASFSGHYVSYVKDLHGNWFRIDDTEVQPVLINQVMSEGAYILFYTRSSPRPP  767


 Score = 76.3 bits (186),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  644  QLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNN  793
            ++ ++CA+C + A TRCSRCK VRYCSG CQIIHWRL HK EC P   +N
Sbjct  72   EVHHECARCSAPAKTRCSRCKFVRYCSGNCQIIHWRLIHKQECQPLETHN  121



>ref|XP_010644793.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Vitis vinifera]
Length=997

 Score =   401 bits (1030),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 188/370 (51%), Positives = 251/370 (68%), Gaps = 5/370 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPYE FV+ F  +   + P GL NCGNSCYANAVLQCL  T P   Y LQ  HS+ C
Sbjct  448   KMLFPYEEFVRFFQCEVFNISPRGLLNCGNSCYANAVLQCLTCTKPLIIYLLQRSHSRTC  507

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
                +WC  CE E  V+  +    PLSP RI+SH+ +I   +G+G +EDAHEFLR ++ +M
Sbjct  508   CVTNWCLMCELEKHVMMLRESGGPLSPSRILSHMRSINCQIGDGSQEDAHEFLRLLVTSM  567

Query  2423  QSVCL-KEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QS+CL K  G R   +  ++T+ I  TFGG LRSK++C+RC  +SER+E IMDLT+EI G
Sbjct  568   QSICLEKLGGEREVDARLQETTFIQHTFGGRLRSKVKCLRCHLESERYENIMDLTLEIFG  627

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
              + SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPN+LTI LKRFQ G++
Sbjct  628   WVESLEDALTQFTTPEDLDGENMYRCRRCTTYVRARKQLSIHEAPNILTIVLKRFQEGRY  687

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GK+NK ITFP++L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  W
Sbjct  688   GKINKCITFPDMLDMIPFMTGTYDVPPLYMLYAVVVHMDTLNASFSGHYVAYVKDLQGNW  747

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL--IRSLTSHDPRGQKYVNCKSSSH  3133
             F+V+D++V+PV    V+S+GAY+L Y R  PR P+   ++++    P   K+  C S +H
Sbjct  748   FRVDDAEVQPVSTNQVMSEGAYILFYMRSWPRPPRAFPVKAIQQQAPASAKH--CSSKTH  805

Query  3134  TNSWDLSKGD  3163
              +S    +GD
Sbjct  806   KSSRSKPRGD  815


 Score = 76.6 bits (187),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  611  SSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            +S +  V  ++   ++CA+CF  A+TRCSRCK+VRYCSGKCQIIHWR  HK+EC 
Sbjct  60   ASVMPLVSSSKSGNHECARCFGPATTRCSRCKSVRYCSGKCQIIHWRQVHKEECQ  114



>ref|XP_002317364.2| UBIQUITIN-SPECIFIC PROTEASE 15 family protein [Populus trichocarpa]
 gb|EEE97976.2| UBIQUITIN-SPECIFIC PROTEASE 15 family protein [Populus trichocarpa]
Length=831

 Score =   396 bits (1018),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 236/337 (70%), Gaps = 1/337 (0%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             + LFPYE FV +FN + ++L P GL NCGNSCYANAVLQCL  T P   + L   HS+ C
Sbjct  359   RMLFPYEEFVNIFNCEVIDLTPRGLVNCGNSCYANAVLQCLTCTKPLIVFLLHRSHSRAC  418

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
              + DWC  CE E  V+  +    PLSP RI+ H+ NI   +G+G +EDAHEFLR +I +M
Sbjct  419   CEIDWCLMCELEQHVMMLRECGGPLSPSRILLHMRNINHQIGDGSQEDAHEFLRLLIASM  478

Query  2423  QSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QS+CL++ G         ++T+ I  TFGG LRSK++C+RC  +SER+E IMDLT+EI G
Sbjct  479   QSICLEKLGGEDKVDPRLQETTFIQHTFGGRLRSKVKCLRCHHESERYENIMDLTLEIFG  538

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
              + SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPN+LTI LKRFQ GK+
Sbjct  539   WVKSLEDALTQFTTPEELDGENMYRCGRCAAYVRARKQLSIHEAPNILTIVLKRFQEGKY  598

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GK+NK ITFP++L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  W
Sbjct  599   GKINKCITFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKDLQGSW  658

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             F+++D++V PV +  V+ +GAY+L Y+R  PR  K I
Sbjct  659   FRIDDTEVHPVSMSQVMLEGAYILFYTRSCPRPQKAI  695


 Score = 77.8 bits (190),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            CA+CFS A+TRCSRCK+VRYCSGKCQIIHWR  HK+EC 
Sbjct  76   CARCFSPATTRCSRCKSVRYCSGKCQIIHWRQAHKEECQ  114



>ref|XP_004498826.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Cicer 
arietinum]
Length=729

 Score =   393 bits (1009),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 235/334 (70%), Gaps = 1/334 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ FVKLFN  K    P GL NCGNSC+AN VLQCL+FT P  AY L+  H K C  
Sbjct  159   LFPYDEFVKLFNWDKPGFPPCGLLNCGNSCFANVVLQCLSFTRPLVAYLLEKGHRKECTC  218

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ V K +  +   SP+ I+S L NIG +LG GR+EDAHEF+R+ I+TMQS
Sbjct  219   NDWCFLCEFENHVDKTRLSSQAFSPMNILSRLPNIGGTLGYGRQEDAHEFMRFSIDTMQS  278

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T++I   FGG L+S++ C +C   S ++E +MDLTVEI GD 
Sbjct  279   VCLDEFGGEKVVPPNLQETTIIQHIFGGRLQSEVICTKCDKTSNQYESMMDLTVEIHGDA  338

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
             ASLE  L QFT  E LDGEN Y C  C+ Y KA K+L +  APN+LTIALKRFQSGKFGK
Sbjct  339   ASLEECLDQFTVKEWLDGENMYKCEGCQDYVKAWKRLTVKCAPNILTIALKRFQSGKFGK  398

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK + FPE LNL+ YMS   D S IY+LY V+ H D++NA++ GHY+CY+K+FQ  W++
Sbjct  399   LNKRVAFPETLNLSPYMSKAGDGSDIYKLYAVVVHIDMLNASYFGHYICYIKDFQGNWYR  458

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             ++DSKV  VE+E VLS+GAYMLLY RC  R   L
Sbjct  459   IDDSKVASVELEEVLSQGAYMLLYRRCIARPSSL  492


 Score = 57.4 bits (137),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            CA C S A+ +CSRCKAVRYCS  CQ  HW  GHK +C
Sbjct  69   CAVCASHATKKCSRCKAVRYCSTACQETHWNSGHKAKC  106



>ref|XP_011044972.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Populus 
euphratica]
Length=725

 Score =   392 bits (1008),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/371 (52%), Positives = 247/371 (67%), Gaps = 2/371 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPY+ F+KL+NS K    P GL NCGNSC+AN VLQCL +T P  AY L+  H + C
Sbjct  159   KVLFPYDEFIKLYNSDKPRFPPCGLLNCGNSCFANVVLQCLTYTRPLVAYLLEKGHQREC  218

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
                DWCF CEF+S V +A     P SP+ I+S L NIG +LG GR+EDAHEF+R  I+TM
Sbjct  219   RHNDWCFLCEFQSHVERASQNALPFSPMNILSRLRNIGGNLGYGRQEDAHEFMRVAIDTM  278

Query  2423  QSVCLKEAGVRTSCS-LEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QSVCL E G   +     ++T++I   FGG L+S++ C +C   S + E +MDLTVEI G
Sbjct  279   QSVCLDEFGGEKAVEPASQETTIIQHIFGGRLQSQVTCTKCKKISNQFENMMDLTVEIHG  338

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
             D  SLE  L QFT  E LDGEN Y C  C  Y KA K+L I  APNVLTIALKRFQSG+F
Sbjct  339   DAESLEECLNQFTDKEGLDGENMYKCDGCNDYVKAWKRLTIQRAPNVLTIALKRFQSGRF  398

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GKLNK +TFPE L+L+ YMS   D + +Y+LY V+ H D++NA+F GHY+CY K+F+  W
Sbjct  399   GKLNKRVTFPETLDLSPYMSEKGDGADVYKLYAVVVHVDMLNASFFGHYICYTKDFRGNW  458

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSSSHTN  3139
              +++DSKV  VE++ VLS+GAYMLLYSR S R P  +R++     +    V   S +   
Sbjct  459   HRIDDSKVSSVELDEVLSQGAYMLLYSRVSVR-PSCLRTIEPSKEQSIVKVELDSCTEKP  517

Query  3140  SWDLSKGDSTN  3172
             +  LS  +ST+
Sbjct  518   AGHLSPTESTD  528


 Score = 55.8 bits (133),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  638  ARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            A +    C  C +S S +CSRCK+VRYCS  CQ  HW+ GHK +C
Sbjct  66   AEEDSLSCVNCGNSGSKKCSRCKSVRYCSQGCQEAHWKAGHKLKC  110



>ref|XP_007161112.1| hypothetical protein PHAVU_001G043700g [Phaseolus vulgaris]
 gb|ESW33106.1| hypothetical protein PHAVU_001G043700g [Phaseolus vulgaris]
Length=718

 Score =   391 bits (1005),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 238/335 (71%), Gaps = 3/335 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ FVK FN  K    P GL NCGNSC+AN VLQCL+FT P  AY L+  H + C  
Sbjct  164   LFPYDEFVKFFNWNKPGFPPCGLLNCGNSCFANVVLQCLSFTRPLVAYLLEKGHRRECTC  223

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ V + +  +   SP+ I+S L NIG +LG GR+EDAHEF+R+ I+TMQS
Sbjct  224   NDWCFLCEFENHVDRTRLSSQVFSPMNILSRLPNIGGTLGYGRQEDAHEFMRFSIDTMQS  283

Query  2429  VCLKEAGVRTSC--SLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGD  2602
             VCL E G   +   +L+E T+LI   FGG L+S++ C +C   S+++E +MDLTVEI GD
Sbjct  284   VCLDEFGGEKAVPPNLQE-TTLIQHIFGGRLQSEVVCTKCEKISKQYENMMDLTVEIHGD  342

Query  2603  IASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFG  2782
              ASLE  L QFT  E LDGEN Y C  CK Y KA K+L +  APN+LTIALKRFQSG+FG
Sbjct  343   AASLEECLDQFTAKERLDGENMYKCEGCKDYVKAWKRLTVKCAPNILTIALKRFQSGRFG  402

Query  2783  KLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWF  2962
             KLNK I FPE LNL+ YMS   D S +Y+LYGV+ H D++NA+F GHY+CY+K+F   W+
Sbjct  403   KLNKRIAFPEALNLSPYMSEAGDGSDVYKLYGVVVHIDMLNASFFGHYICYIKDFLGNWY  462

Query  2963  KVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             +++D KV  VE+E VLS+GAYMLLYSRCS R   L
Sbjct  463   RIDDWKVTTVELEEVLSQGAYMLLYSRCSARPSGL  497


 Score = 54.3 bits (129),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            CA C + +S +CSRCKAV YCS +CQ  HWR GHK  C
Sbjct  73   CAVCATPSSKKCSRCKAVLYCSQECQQSHWRSGHKTVC  110



>ref|XP_010417220.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Camelina 
sativa]
Length=664

 Score =   389 bits (1000),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 242/354 (68%), Gaps = 2/354 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV  FN  +  + P GLTNCGNSC+AN VLQCL++T P  AY L+  H + C +
Sbjct  155   LFPYESFVNYFNWDRPIMAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECRR  214

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A     P SP  IIS L NIG +LG GR+EDAHE +R+ I+ MQS
Sbjct  215   NDWCFFCEFETHLDRANYSRYPFSPTNIISRLPNIGGNLGYGRQEDAHELMRFAIDMMQS  274

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  275   VCLDEFGGEKVVPPRAQETTLIQYIFGGLLKSQVKCTACSNVSDQYENMMDLTVEIHGDA  334

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N+Y C RC  Y KA K+L I  APN+LTIALKRFQ G+FGK
Sbjct  335   VSLEECLDQFTAKEWLQGDNQYKCDRCNDYVKACKRLSISCAPNILTIALKRFQGGRFGK  394

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FPE  +L  YMS     S +Y+LY VI H D++NA+F GHY+CY+K+F+  W++
Sbjct  395   LNKRISFPETFDLGPYMSSGGKGSDVYKLYAVIVHLDMLNASFFGHYICYIKDFRGNWYR  454

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSS  3127
             ++DSKV+ VE+E VLS+ AYMLLYSR  PR P  +RS    D +  + +N +SS
Sbjct  455   IDDSKVESVELEDVLSQRAYMLLYSRVQPR-PASLRSEEVQDEKKTESLNTESS  507



>gb|AES66462.2| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=948

 Score =   398 bits (1022),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 185/356 (52%), Positives = 248/356 (70%), Gaps = 5/356 (1%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGR----YNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVL  2176
             ++H +L +    G R     N K LFPYE FVK+F S+   + P GL NCGNSCYANAVL
Sbjct  420   TKHTALASSESNGVRSKKAKNIKMLFPYEDFVKIFQSEIFGIFPRGLLNCGNSCYANAVL  479

Query  2177  QCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIG  2356
             QCL  T P   Y L G HS+ C  KDWC  CE E  ++  +   +PLSP RI+ H+ +I 
Sbjct  480   QCLTSTKPLVVYLLYGSHSESCCAKDWCLMCELEQHMMILREIGAPLSPSRILWHMRSIN  539

Query  2357  SSLGNGREEDAHEFLRYVIETMQSVCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIEC  2533
              ++G+G +EDAHEFLR ++ +MQS+CL+   G R      ++T+ I  TFGG L+SK++C
Sbjct  540   CNMGDGSQEDAHEFLRLLVASMQSICLEGLGGERKVDPRLQETTFIQHTFGGRLQSKVKC  599

Query  2534  MRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKK  2713
             + C  +SER+E IMDLT+EI G + SLE AL QFT  E LDGEN Y C RC +Y +ARK+
Sbjct  600   LNCSHESERYENIMDLTLEILGWVESLEDALTQFTSPEDLDGENMYRCGRCTAYVRARKQ  659

Query  2714  LKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHE  2893
             L I EAPN+LTI LKRFQ G++GK+NK ITFPE+L++  +M+GT D  P+Y LY V+ H 
Sbjct  660   LSIHEAPNILTIVLKRFQEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYVLYAVVVHL  719

Query  2894  DVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             D +NA+FSGHYV YVK+ Q  WF+++D++V+PV +  V+S+GAY+L Y+R SPR P
Sbjct  720   DTLNASFSGHYVSYVKDLQGNWFRIDDTEVQPVLVNQVMSEGAYILFYTRSSPRPP  775


 Score = 78.6 bits (192),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  644  QLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSY  805
            +L ++CA+C + A TRCSRCK VRYCSG CQIIHWRL HK EC P   +N  S+
Sbjct  82   ELHHECARCSAPAKTRCSRCKLVRYCSGNCQIIHWRLFHKQECLPLETHNSSSF  135



>gb|EPS72742.1| hypothetical protein M569_02015, partial [Genlisea aurea]
Length=404

 Score =   380 bits (976),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 185/338 (55%), Positives = 233/338 (69%), Gaps = 1/338 (0%)
 Frame = +2

Query  2060  NKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKG  2239
             NK LFPYE F++ FN  +    P GL NCGNSC+AN VLQCLA+T P  AY L+  H K 
Sbjct  59    NKILFPYEEFIEYFNWDRFGYPPCGLLNCGNSCFANVVLQCLAYTRPLVAYLLERGHRKD  118

Query  2240  CAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIET  2419
             C + DWCF CEF+S V +A     P SP+ I+S L NIG +LG G++EDAHEF+R+ I+T
Sbjct  119   CRRDDWCFLCEFQSHVERAGQSLHPFSPMNILSRLPNIGGNLGYGKQEDAHEFMRFAIDT  178

Query  2420  MQSVCLKEAGVRTSCS-LEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEID  2596
             MQSVCL E G   +   +  +T+LI   FGG LRS++ C  C   S + E +MDLTVEI 
Sbjct  179   MQSVCLDEFGGEKAVQPIYRETTLIQHIFGGRLRSQVVCAECCNVSNQFENMMDLTVEIH  238

Query  2597  GDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGK  2776
             GD  SLE  L QFT  E L G+N Y C  C  Y  A K L +  APN+LTIALKRFQSG+
Sbjct  239   GDAGSLEECLDQFTAKERLHGDNMYKCDGCNDYVMAWKCLTVERAPNILTIALKRFQSGR  298

Query  2777  FGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNK  2956
             FGKLNK ITFPE L+L  Y+SG  DK+ IY+LY VI H D++NA+F GHY+CY+K+F+  
Sbjct  299   FGKLNKRITFPETLDLRPYVSGLEDKNNIYKLYAVIVHVDMLNASFFGHYICYIKDFRGN  358

Query  2957  WFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             W++V+D KV  VE++ VLS+GAYMLLYSR   R+  L+
Sbjct  359   WYRVDDCKVCSVELDEVLSQGAYMLLYSRICARSSCLL  396



>ref|XP_009396938.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Musa 
acuminata subsp. malaccensis]
Length=902

 Score =   395 bits (1016),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 190/348 (55%), Positives = 239/348 (69%), Gaps = 3/348 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPY  FVKLFN       P GL NCGNSC+AN VLQCLA T P  AY L+  H + C
Sbjct  164   KILFPYNEFVKLFNWDNPGFPPCGLVNCGNSCFANVVLQCLACTRPLVAYLLERGHIREC  223

Query  2243  AKK--DWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIE  2416
              +K  DWCF CE +  + +A     P SPI I+S L NIG +LG GR+EDAHEF+R+ I+
Sbjct  224   VRKQNDWCFLCELQLHIKRASESRHPFSPINILSRLPNIGGNLGYGRQEDAHEFMRFAID  283

Query  2417  TMQSVCLKEAGVRTSCSLEEQ-TSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEI  2593
             TMQSVCL E G   +     Q T+LI   FGG L+S++ C +C   S R+E +MDLTVEI
Sbjct  284   TMQSVCLDEFGGEKALDPSTQDTTLIQHIFGGHLQSQVTCTQCNTISNRYENMMDLTVEI  343

Query  2594  DGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSG  2773
              GD  SLE  L QFT  E LDG+NKY C  C  Y KA K+L + +APN+LTIALKRFQSG
Sbjct  344   LGDAESLEECLDQFTMKEWLDGDNKYKCDGCNDYVKACKRLTVHQAPNILTIALKRFQSG  403

Query  2774  KFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQN  2953
             +FGKLNK +TFPE LNL  YMSG+SD + +Y LY V+ H D++NA+F GHY+CY K++Q 
Sbjct  404   RFGKLNKRVTFPENLNLTPYMSGSSDGTDLYTLYAVVVHVDMLNASFFGHYICYTKDYQG  463

Query  2954  KWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPR  3097
             +W+K++D KV  VE+E VLS+GAYMLLYSR S R    ++ + S + +
Sbjct  464   RWYKIDDCKVTNVEVEDVLSEGAYMLLYSRTSARKEPFVKHVQSQNTK  511



>gb|KFK29759.1| hypothetical protein AALP_AA7G175300 [Arabis alpina]
Length=631

 Score =   387 bits (994),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 232/330 (70%), Gaps = 1/330 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV  FN   ++L P GL NCGNSC+AN +LQCL++T P  AY L+  H + C +
Sbjct  146   LFPYEEFVNYFNWDNLDLAPCGLMNCGNSCFANVILQCLSWTRPLVAYLLEKGHKRECMR  205

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEF++ V +A     P SP+ IIS L NIG +LG GR+EDAHEF+RY I+ MQS
Sbjct  206   NDWCFFCEFQTHVERASRSRFPFSPMNIISRLTNIGGTLGYGRQEDAHEFMRYAIDMMQS  265

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  266   VCLDEYGGEKMVPPRSQETTLIQYIFGGLLQSQVQCTVCNNVSDQYENMMDLTVEIHGDA  325

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT TE L G+N Y C RC  Y KA K+L I  APN+LTIALKRFQ G++GK
Sbjct  326   VSLEECLDQFTATEWLHGDNMYKCDRCSDYVKACKRLTIRRAPNILTIALKRFQGGRYGK  385

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FPE L+L  YMS   + S +Y+LY VI H D++NA+F GHY+CYVK+F   W++
Sbjct  386   LNKRISFPETLDLNPYMSEGGEGSDVYKLYAVIVHLDMLNASFFGHYICYVKDFSRNWYR  445

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             ++DS+++ VE+E VLS+ AYMLLYSR   R
Sbjct  446   IDDSEIESVELEDVLSQRAYMLLYSRIQAR  475



>ref|XP_011031394.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Populus 
euphratica]
Length=633

 Score =   387 bits (994),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 186/340 (55%), Positives = 234/340 (69%), Gaps = 2/340 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPY+ F+KL+NS K E  P GL NCGNSC+AN VLQCL +T P  AY L+  H   C
Sbjct  159   KVLFPYDEFIKLYNSDKPEFSPCGLLNCGNSCFANVVLQCLTYTRPLVAYLLKKGHQTEC  218

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
                DWCF CEF+S V +A     P SPI I+S L NIG +LG GR+EDAHEF+R  I+TM
Sbjct  219   RHNDWCFLCEFQSHVERASQSMLPFSPINILSRLPNIGGNLGYGRQEDAHEFMRLAIDTM  278

Query  2423  QSVCLKEAGVRTSCS-LEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QSVCL E G   +     ++T++I   FGG L+S++ C +C   S + E +MDLTVEI G
Sbjct  279   QSVCLDEFGGEKAVEPASQETTIIQHIFGGRLQSQVICTKCSKISNQFENMMDLTVEIHG  338

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
             D ASLE  L QFT  E L GEN Y C +C  Y KA K L I  APNVLTIALKRFQSG+F
Sbjct  339   DAASLEECLDQFTDKEWLHGENMYKCDKCNDYVKASKSLTIQRAPNVLTIALKRFQSGRF  398

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GKLNK +TFPE+L+L+ YMS   D + +Y+LY V  H D++NA+F GHY+CY K+F   W
Sbjct  399   GKLNKRVTFPEMLDLSPYMSEGGDGTDVYKLYAVAVHVDMLNASFFGHYICYTKDFHGNW  458

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSL  3079
              +++D KV  VE++ VLS+GAYML+YSR S R P  +R++
Sbjct  459   HRIDDCKVSSVELDEVLSQGAYMLVYSRVSVR-PSCLRTI  497



>ref|XP_011045594.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Populus euphratica]
Length=937

 Score =   396 bits (1017),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/337 (53%), Positives = 234/337 (69%), Gaps = 1/337 (0%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             + LFPYE FVK+FN + + L P GL NCGNSCYANAVLQCL  T P   + L+  HS+ C
Sbjct  409   RMLFPYEEFVKIFNCEVINLTPRGLVNCGNSCYANAVLQCLTCTKPLIIFLLRRSHSRAC  468

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
               KDWC  CE E  V+  +    PLSP RI+ H+  I   +G+G +EDAHEFLR +I +M
Sbjct  469   CGKDWCLMCELEQHVMMLRECGGPLSPSRILLHMRKINHQIGDGSQEDAHEFLRLLIASM  528

Query  2423  QSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QS+CL+  G         ++T+ I  TFGG LRSK++C+RC  +SER+E IMDLT+EI G
Sbjct  529   QSICLERLGGEDKVDPRLQETTFIQHTFGGLLRSKVKCLRCHHESERYENIMDLTLEIFG  588

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
              + SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPN+LTI LKRFQ GK+
Sbjct  589   WVESLEDALTQFTTPEELDGENMYRCGRCAAYVRARKQLSIHEAPNILTIVLKRFQEGKY  648

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GK+NK ITFP++L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ +  W
Sbjct  649   GKINKCITFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKDLRGSW  708

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
             FK++D++V PV +  V+ +GAY+L Y R   R  KLI
Sbjct  709   FKIDDTEVHPVSMSQVMLEGAYILFYKRSCTRPQKLI  745


 Score = 78.2 bits (191),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            CA+CFS A+TRCSRCK+VRYCSGKCQIIHWR  HK+EC 
Sbjct  76   CARCFSPATTRCSRCKSVRYCSGKCQIIHWRQAHKEECQ  114



>gb|KHN14516.1| Ubiquitin carboxyl-terminal hydrolase 17 [Glycine soja]
Length=874

 Score =   394 bits (1012),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 245/363 (67%), Gaps = 64/363 (18%)
 Frame = +2

Query  1991  QLKASK-SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q K+SK SR NS+ A +E+G        FPYELFV+L+   K++L PFGLTNCGNSCYAN
Sbjct  373   QFKSSKESRSNSISAENEMG--------FPYELFVELYCYDKMKLFPFGLTNCGNSCYAN  424

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLA+T P T+Y  QGFHSK C     C     +S+ LK    +SPL+         
Sbjct  425   AVLQCLAYTRPLTSYLFQGFHSKRCK----CAVDTMQSVCLKEVGVSSPLA---------  471

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
                                                       E+T+L+G TFGG+LRSKI
Sbjct  472   ------------------------------------------EETTLVGYTFGGYLRSKI  489

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +C+RC GKSER+ER+MDLTVEIDGDI +LE AL QFT  EILD +NKY+CSRCK+YEKAR
Sbjct  490   KCLRCLGKSERYERMMDLTVEIDGDIGTLEEALGQFTAPEILDKDNKYNCSRCKTYEKAR  549

Query  2708  KKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIE  2887
             KKL +LEAPN+LTI LKRFQSG F KLNK++ FPE+LN+A YMSGT DKSP+Y LY V+ 
Sbjct  550   KKLTVLEAPNILTIVLKRFQSGNFEKLNKSVQFPEVLNMAPYMSGTKDKSPLYSLYAVVV  609

Query  2888  HEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             H D+MNAAFSGHYVCYVKN Q +WF+ +DS+V+PVE+  VLS+ AYMLLY+R SP+   L
Sbjct  610   HLDIMNAAFSGHYVCYVKNIQGEWFRTDDSRVEPVELSRVLSERAYMLLYARHSPKPLGL  669

Query  3068  IRS  3076
             + S
Sbjct  670   VSS  672


 Score = 89.0 bits (219),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 67/134 (50%), Gaps = 22/134 (16%)
 Frame = +2

Query  386  LVFIGPLLGF-LVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgs  562
            LV++   LGF ++R  WR+AEA+REE   +++                        +   
Sbjct  12   LVYLVLALGFAVIRHVWRNAEAKREEEAVMMM---------------------RLVADAD  50

Query  563  VVGDEvpaavpapapvSSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQII  742
            V   EV     A A      +  PV     YQCA C +  + RCSRCKAVRYCSGKCQI 
Sbjct  51   VTEMEVAEEAVAVASEVEYSSLAPVNGSRWYQCAMCCAPTTMRCSRCKAVRYCSGKCQIS  110

Query  743  HWRLGHKDECHPPV  784
            HWR GHKDEC PP 
Sbjct  111  HWRQGHKDECCPPT  124



>ref|XP_008782751.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Phoenix dactylifera]
Length=797

 Score =   392 bits (1007),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 177/333 (53%), Positives = 235/333 (71%), Gaps = 1/333 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE  VK F+ K   + P GL NCGNSCYANAVLQCL +T P   Y LQ  HS+ C  
Sbjct  269   LFPYEDLVKFFHCKVGGIAPRGLLNCGNSCYANAVLQCLTYTKPLMVYLLQRPHSRTCRV  328

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             KDWC  CE E  V   + G  P SP RI+S++ NIG  +G G +EDAHEFLR+++ +MQS
Sbjct  329   KDWCLMCELEQHVSMLREGGGPSSPSRILSNMRNIGCRMGGGNQEDAHEFLRFLVMSMQS  388

Query  2429  VCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
              CL+E G       + ++T+L+   FGG L+SK++C+RC  +SER+E IMDLT+EI G +
Sbjct  389   TCLEEFGGEKQVDPKLQETTLVQQIFGGRLKSKVKCLRCHIESERYENIMDLTLEIHGWV  448

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE AL QFT  E LDGEN Y C RC +Y  ARK+L I E PN+LTI LKRFQ+G +GK
Sbjct  449   ESLEDALTQFTAPEDLDGENMYRCGRCSAYVNARKQLTIHEVPNILTIVLKRFQTGNYGK  508

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +NK +TFP++L++  +++GT+D  P+Y LY V+ H D +NA+FSGHY+ YVK+ Q  WF+
Sbjct  509   INKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYISYVKDLQGTWFR  568

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPK  3064
             ++DS+V+ V +  V+S+GAYML YSR  PR P+
Sbjct  569   IDDSEVQAVPLSQVMSEGAYMLFYSRSFPRPPR  601



>ref|XP_002324377.2| hypothetical protein POPTR_0018s03350g [Populus trichocarpa]
 gb|EEF02942.2| hypothetical protein POPTR_0018s03350g [Populus trichocarpa]
Length=726

 Score =   390 bits (1001),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 234/340 (69%), Gaps = 2/340 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPY+ F+KL+NS K    P GL NCGNSC+AN VLQCL +T P  AY L+  H   C
Sbjct  159   KVLFPYDEFIKLYNSDKPRFPPCGLLNCGNSCFANVVLQCLTYTRPLVAYLLEKGHQTEC  218

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
                DWCF CEF+S V +A     P SP+ I+S L NIG +LG GR+EDAHEF+R+ I+TM
Sbjct  219   KHNDWCFLCEFQSHVERASQSALPFSPMNILSRLRNIGGNLGYGRQEDAHEFMRFAIDTM  278

Query  2423  QSVCLKEAGVRTSCS-LEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QSVCL E G   +     ++T++I   FGG L+S++ C +C   S + E +MDLTVEI G
Sbjct  279   QSVCLDEFGGEKAVEPASQETTIIQHIFGGRLQSQVICTKCNKISNQFENMMDLTVEIHG  338

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
             D  SLE  L QFT  E L GEN Y C  C  Y KA K+L I  APNVLTIALKRFQSG+F
Sbjct  339   DAESLEECLNQFTDKEWLHGENMYKCDGCNDYVKAWKRLTIQRAPNVLTIALKRFQSGRF  398

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GKLNK +TFPE L+L+ YMS   D + +Y+LY V+ H D++NA+F GHY+CY K+F   W
Sbjct  399   GKLNKRVTFPETLDLSPYMSEKGDGADVYKLYAVVVHVDMLNASFFGHYICYTKDFHGNW  458

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSL  3079
              +++DSKV  VE++ VLS+GAYMLLYSR S R P  +R++
Sbjct  459   HRIDDSKVSSVELDEVLSQGAYMLLYSRVSVR-PSCLRTI  497



>ref|XP_006477929.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477930.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Citrus sinensis]
 ref|XP_006477931.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Citrus sinensis]
Length=1015

 Score =   398 bits (1022),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 188/384 (49%), Positives = 257/384 (67%), Gaps = 6/384 (2%)
 Frame = +2

Query  1997  KASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVEL-RPFGLTNCGNSCYANAV  2173
             K++K R +S   W +   +   K LFPYE F+KLF  + ++L  P GL NCGNSCYANAV
Sbjct  435   KSTKLRQDSSELWHDQHRKL--KMLFPYEEFLKLFQYEVIDLLSPRGLLNCGNSCYANAV  492

Query  2174  LQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENI  2353
             LQCL  T P   Y L+  HS  C +KDWC  CE E  V+  +    PLSP RI+SH+ +I
Sbjct  493   LQCLTCTKPLVIYLLRRSHSSACCRKDWCLMCELEQHVMMLRESGGPLSPGRILSHMRSI  552

Query  2354  GSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIE  2530
                +G+G +EDAHEFLR ++ +MQS+CL+  G  +      ++T+ I  TFGG L SK++
Sbjct  553   SCQIGDGSQEDAHEFLRLLVASMQSICLERHGGESKVDPRLQETTFIQHTFGGRLWSKVK  612

Query  2531  CMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARK  2710
             C+RC  +SER+E IMDLT+EI G + SLE AL QFT  E LDGEN Y C+RC +Y +ARK
Sbjct  613   CLRCSHESERYENIMDLTLEIYGWVESLEDALTQFTSPEDLDGENMYKCARCATYVRARK  672

Query  2711  KLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEH  2890
             +L I EAPN+LTI LKRFQ G++GK+NK ITFPE+L++  +M+GT D  P+Y LY V+ H
Sbjct  673   QLSIHEAPNILTIVLKRFQEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVH  732

Query  2891  EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
              D  NA+FSGHYV Y+K+ Q  WF+++D++V PV +  V+S+GAYML Y R  PR  + +
Sbjct  733   LDTQNASFSGHYVSYIKDMQGTWFRIDDTQVHPVPMSQVMSEGAYMLFYMRSCPRPRRTL  792

Query  3071  --RSLTSHDPRGQKYVNCKSSSHT  3136
               +++    P   ++   KS  H+
Sbjct  793   SRKAMQQQVPASARHSMPKSQKHS  816


 Score = 75.5 bits (184),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            CA+CF+ A+TRCSRCK+VRYCSGKCQIIHWR  HK EC 
Sbjct  103  CARCFAPATTRCSRCKSVRYCSGKCQIIHWRQVHKQECQ  141



>ref|XP_006601204.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like isoform 
X2 [Glycine max]
Length=737

 Score =   390 bits (1001),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 238/333 (71%), Gaps = 5/333 (2%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ FVK FN  K    P GL NCGNSC+AN VLQCL+FT P  AY L+  H + C+ 
Sbjct  164   LFPYDEFVKFFNWDKPGFPPCGLLNCGNSCFANVVLQCLSFTKPLVAYLLEKGHRRECSC  223

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ V + +  +   SP+ I+S L NIG +LG G++EDAHEF+R+ I+TMQS
Sbjct  224   NDWCFLCEFENHVERTRLSSQAFSPMNILSRLPNIGGTLGYGKQEDAHEFMRFSIDTMQS  283

Query  2429  VCLKEAGVRTSC--SLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGD  2602
             VCL E G   +   +L+E T+LI   FGG L+S++ C +C   S ++E +MDLTVEI GD
Sbjct  284   VCLDEFGGEKAVPPNLQE-TTLIQHIFGGRLQSEVICTKCDKISNQYENMMDLTVEIHGD  342

Query  2603  IASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQ--SGK  2776
              ASLE  L QFT  E LDGEN Y C  CK Y KA K+L +  APN+LTIALKRFQ  SG+
Sbjct  343   AASLEECLDQFTAKERLDGENMYKCEGCKDYVKAWKRLTVKCAPNILTIALKRFQVLSGR  402

Query  2777  FGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNK  2956
             FGKLNK I FPE LNL+ YMS   D S IY+LYGV+ H D++NA+F GHY+CY+K+FQ  
Sbjct  403   FGKLNKRIAFPETLNLSPYMSEAGDGSDIYKLYGVVVHIDMLNASFFGHYICYIKDFQGN  462

Query  2957  WFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             W++++D KV  VE+E VLS+GAYMLLYSRCS R
Sbjct  463   WYRIDDWKVMTVEVEEVLSQGAYMLLYSRCSAR  495



>ref|XP_008378636.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Malus 
domestica]
Length=425

 Score =   379 bits (973),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 205/235 (87%), Gaps = 1/235 (0%)
 Frame = +2

Query  2396  FLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIM  2575
             FLRY I+ MQSVCL E GV +SCSL E+T+LIGLTFGG+LRSKI+C +C GKSER ER+M
Sbjct  3     FLRYAIDMMQSVCLTETGVNSSCSLNEETTLIGLTFGGYLRSKIKCTKCQGKSERQERMM  62

Query  2576  DLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIAL  2755
             DLTVEI+GDI +LE ALR+FT TE LDGENKY CS CKSYEKA+KKL ILEAPN+LTIAL
Sbjct  63    DLTVEIEGDIGTLEEALRRFTGTETLDGENKYQCSSCKSYEKAKKKLTILEAPNILTIAL  122

Query  2756  KRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCY  2935
             KRFQSGKFGK+NK I FPEIL+LA +MSGTSDKSPIY+LYGV+ H D+MNAAFSGHYVCY
Sbjct  123   KRFQSGKFGKINKPIRFPEILDLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCY  182

Query  2936  VKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS-LTSHDPR  3097
             V+N  NKWFKV+DS V PVE+E VL KGAYMLLYSRC PRAP+LIR+ + S+DP+
Sbjct  183   VRNSHNKWFKVDDSTVTPVELEKVLMKGAYMLLYSRCLPRAPRLIRNRIISNDPK  237



>ref|XP_009117107.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Brassica 
rapa]
Length=644

 Score =   387 bits (993),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 239/354 (68%), Gaps = 2/354 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV  FN  K  L P GLTNCGNSC+AN VLQCL++T P  AY L+  H + C +
Sbjct  148   LFPYETFVNYFNWDKPTLAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECRR  207

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A     P SP+ IIS L NIG +LG GR+EDAHE +R+VI+ MQS
Sbjct  208   NDWCFFCEFETHLERANMSRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFVIDMMQS  267

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  268   VCLDEFGGEKAVPPRAQETTLIQHIFGGLLQSQVKCTVCSNVSDQYENMMDLTVEIHGDA  327

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LTIALKRFQ G+FGK
Sbjct  328   VSLEECLDQFTAKEWLQGDNLYKCDRCNDYVKACKRLSIRSAPNILTIALKRFQGGRFGK  387

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I FPE  +L+ Y SG  + S +Y LY VI H D++NA+F GHY+CYVK+ +  W++
Sbjct  388   LNKRIGFPETFDLSPYTSGGGEGSDVYNLYAVIVHLDMLNASFFGHYICYVKDLRGDWYR  447

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSS  3127
             ++DS+V+ VE+E VLS+ AYMLLYSR   R P  +R     D +    +N +SS
Sbjct  448   IDDSEVEKVELEDVLSQRAYMLLYSRVQTR-PSSLRPEEVQDEKKTDTLNTESS  500



>emb|CDY20330.1| BnaC04g36260D [Brassica napus]
Length=643

 Score =   386 bits (992),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 191/370 (52%), Positives = 249/370 (67%), Gaps = 5/370 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV+ FN  K  L P GLTNCGNSC+AN VLQCL++T P  AY L+  H + C +
Sbjct  150   LFPYETFVQYFNWDKPGLAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECER  209

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A     P SP+ IIS L NIG +LG GR+EDAHE +R+VI+ MQS
Sbjct  210   NDWCFLCEFETHLERANISRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFVIDMMQS  269

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  270   VCLDEFGGEKVVPPRAQETTLIQYIFGGLLQSQVQCTVCSNVSDQYENMMDLTVEIHGDA  329

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LT+ALKRFQ G+FGK
Sbjct  330   VSLEECLDQFTAKEWLQGDNLYKCDRCNDYVKACKRLSIRSAPNILTVALKRFQGGRFGK  389

Query  2786  LNKTITFPEILNLASYMSGTSDK-SPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWF  2962
             LNK I+FPE  +L  YMS    K S +Y+LY VI H D++NA+F GHY+CYVK+F+  W+
Sbjct  390   LNKRISFPETFDLGPYMSCCGGKGSDVYKLYAVIVHLDMLNASFFGHYICYVKDFRGDWY  449

Query  2963  KVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSSSHTNS  3142
             +++DS+V+ VE+E VLS+ AYMLLYSR   R P  +RS    D +    V+  S +  + 
Sbjct  450   RIDDSEVEKVELEDVLSQRAYMLLYSRVQAR-PSSLRSEEVQDEKKTDTVD--SEAGEDG  506

Query  3143  WDLSKGDSTN  3172
             +  S G+ TN
Sbjct  507   FVESSGEGTN  516



>ref|XP_011070235.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Sesamum 
indicum]
Length=828

 Score =   392 bits (1007),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 192/360 (53%), Positives = 247/360 (69%), Gaps = 2/360 (1%)
 Frame = +2

Query  2051  RYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFH  2230
             + +NK LFPYE FV+ FN  K    P GL NCGNSC+AN VLQCLA+T P  AY L+  H
Sbjct  147   KQSNKILFPYEEFVQFFNWDKPGYPPCGLLNCGNSCFANVVLQCLAYTRPLVAYLLEKGH  206

Query  2231  SKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYV  2410
              K C   DWCF CEF++ V +A    +P SPI I+S L NIG +LG G++EDAHEF+R+ 
Sbjct  207   KKECQMDDWCFLCEFQNHVERASQSLAPFSPINILSRLPNIGGNLGYGKQEDAHEFMRFA  266

Query  2411  IETMQSVCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTV  2587
             I+TMQSVCL E  G +    L ++T+LI   FGG L+S++ C  C   S + E +MDLTV
Sbjct  267   IDTMQSVCLDEFGGEKAVHPLYQETTLIQHIFGGRLQSQVICTECNNVSNQFENMMDLTV  326

Query  2588  EIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQ  2767
             EI GD  SLE  L QFT  E L G+N Y C  C +Y  A K+L +  APN+LTIALKRFQ
Sbjct  327   EIHGDAGSLEECLDQFTAKEWLHGDNMYKCDNCNTYVMAWKRLNVQRAPNILTIALKRFQ  386

Query  2768  SGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNF  2947
             SG+FGKLNK ITFPE L+L+SYMS  SD + +Y+LY VI H D++NA+F GHY+CYVK+F
Sbjct  387   SGRFGKLNKRITFPETLDLSSYMS-ESDGNDVYKLYAVIVHVDMLNASFFGHYICYVKDF  445

Query  2948  QNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSS  3127
             +  W++V+D KV  V+++ VLS+GAYMLLYSR   R  +   ++   DP  +K V C S+
Sbjct  446   RGNWYRVDDCKVASVDLDEVLSQGAYMLLYSRICVRPKQENGNVKEVDPSLKKSVECLSA  505



>ref|XP_006412571.1| hypothetical protein EUTSA_v10024675mg [Eutrema salsugineum]
 gb|ESQ54024.1| hypothetical protein EUTSA_v10024675mg [Eutrema salsugineum]
Length=630

 Score =   385 bits (990),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 182/340 (54%), Positives = 235/340 (69%), Gaps = 1/340 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE F+  FN    EL P GL NCGNSC+AN +LQCL++T P  AY L+  H + C +
Sbjct  148   LFPYEEFLYYFNWDNPELAPCGLMNCGNSCFANVILQCLSWTRPLVAYLLEKGHKRECMR  207

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFES V +A     P SP+ IIS L NIG + G GR+EDAHEF+RY I+ MQS
Sbjct  208   NDWCFFCEFESHVERASQSRFPFSPMNIISRLTNIGGTFGYGRQEDAHEFMRYAIDMMQS  267

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  268   VCLDEFGGEKLVPPRSQETTLIQHIFGGLLQSQVQCTVCNNVSDQYENLMDLTVEIHGDA  327

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LTIALKRFQ G++GK
Sbjct  328   VSLEECLDQFTAKEWLHGDNMYKCDRCCDYVKACKRLTIRRAPNILTIALKRFQGGRYGK  387

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FPE L+L+ YMS   + S +Y+LY VI H D++NA+F GHY+CY+K+F   W++
Sbjct  388   LNKRISFPETLDLSPYMSEGGEGSDVYKLYAVIVHLDMLNASFFGHYICYIKDFCGNWYR  447

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTS  3085
             ++DS+++ VE+E VLS+ AYMLLYSR   R+  L  SL S
Sbjct  448   IDDSEIESVELEDVLSQRAYMLLYSRIQARSSSLCASLRS  487



>emb|CDY34761.1| BnaA09g41280D [Brassica napus]
Length=644

 Score =   386 bits (992),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 238/354 (67%), Gaps = 2/354 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV  FN  K  L P GLTNCGNSC+AN VLQCL++T P  AY L+  H + C +
Sbjct  148   LFPYETFVNYFNWDKPTLAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECKR  207

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A     P SP+ IIS L NIG +LG GR+EDAHE +R+VI+ MQS
Sbjct  208   NDWCFFCEFETHLERANMSRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFVIDMMQS  267

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  268   VCLDEFGGEKAVPPRAQETTLIQHIFGGLLQSQVKCTVCSNVSDQYENMMDLTVEIHGDA  327

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LTIALKRFQ G+FGK
Sbjct  328   VSLEECLDQFTAKEWLQGDNLYKCDRCNDYVKACKRLSIRSAPNILTIALKRFQGGRFGK  387

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I FPE  +L  Y SG  + S +Y LY VI H D++NA+F GHY+CYVK+ +  W++
Sbjct  388   LNKRIGFPETFDLGPYTSGGGEGSDVYNLYAVIVHLDMLNASFFGHYICYVKDLRGDWYR  447

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSS  3127
             ++DS+V+ VE+E VLS+ AYMLLYSR   R P  +R     D +    +N +SS
Sbjct  448   IDDSEVEKVELEDVLSQRAYMLLYSRVQTR-PSSLRPEEVQDEKKTDTLNTESS  500



>ref|XP_010429445.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
19-like [Camelina sativa]
Length=664

 Score =   387 bits (993),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 240/354 (68%), Gaps = 2/354 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV  FN  +  + P GLTNCGNSC+AN VLQCL++T P  AY L+  H + C +
Sbjct  155   LFPYESFVNYFNWDRPIMAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECRR  214

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A     P SP  IIS L NIG +LG GR+EDAHE +R+ I+ MQS
Sbjct  215   NDWCFFCEFETHLDRANYSRYPFSPTNIISRLPNIGGNLGYGRQEDAHELMRFAIDMMQS  274

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  275   VCLDEFGGEKVVPPRAQETTLIQYIFGGLLQSQVKCTACSNVSDQYENMMDLTVEIHGDA  334

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LTIALKRFQ G+FGK
Sbjct  335   VSLEECLDQFTAKEWLQGDNLYKCDRCNDYVKACKRLSISCAPNILTIALKRFQGGRFGK  394

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I FPE  +L  YMS   + S +Y+LY VI H D++NA+F GHY+CY+K+F+  W++
Sbjct  395   LNKRINFPETFDLGPYMSSGGEGSDVYKLYAVIVHLDMLNASFFGHYICYIKDFRGNWYR  454

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSS  3127
             ++DSKV+ VE+E VLS+ AYMLLYSR  PR P  +RS    D +  +  N +SS
Sbjct  455   IDDSKVENVELEDVLSQRAYMLLYSRVQPR-PASLRSEEGQDKKKTESSNTESS  507



>ref|XP_010472472.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Camelina 
sativa]
Length=664

 Score =   387 bits (993),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 190/375 (51%), Positives = 247/375 (66%), Gaps = 4/375 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV  FN  +  + P GLTNCGNSC+AN VLQCL++T P  AY L+  H + C +
Sbjct  155   LFPYESFVNYFNWDRPIMAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECRR  214

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A     P SP  IIS L NIG +LG GR+EDAHE +R+ I+ MQS
Sbjct  215   NDWCFFCEFETHLDRANYSRYPFSPTNIISRLPNIGGNLGYGRQEDAHELMRFAIDMMQS  274

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  275   VCLDEFGGEKVVPPRAQETTLIQYIFGGLLQSQVKCTACSNVSDQYENMMDLTVEIHGDA  334

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G N Y C RC  Y KA K+L I  APN+LTIALKRFQ G+FGK
Sbjct  335   VSLEECLDQFTAKEWLQGNNLYKCDRCNDYVKACKRLSISCAPNILTIALKRFQGGRFGK  394

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FPE  +L  YMS   + S +Y+LY VI H D++NA+F GHY+CY+K+F+ KW++
Sbjct  395   LNKRISFPETFDLGPYMSSGGEGSDVYKLYAVIVHLDMLNASFFGHYICYIKDFRGKWYR  454

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSSSH--TN  3139
             ++DSKV+ VE+E VL + AYMLLYSR  PR P  +RS    D +  + +N +SS      
Sbjct  455   IDDSKVESVELEDVLFQRAYMLLYSRVQPR-PASLRSEEGQDEKKIESLNTESSQEGSVE  513

Query  3140  SWDLSKGDSTNDPAC  3184
             S +L   D+     C
Sbjct  514   SSELGANDTNVSSLC  528



>gb|KDO60602.1| hypothetical protein CISIN_1g039539mg [Citrus sinensis]
Length=484

 Score =   380 bits (976),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 187/324 (58%), Positives = 237/324 (73%), Gaps = 8/324 (2%)
 Frame = +2

Query  2282  LVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTS  2461
             L+L AK+G+ P+SPI I+S ++ IGS LG+GREEDAHEFLR  ++TMQSVCLKE G +  
Sbjct  14    LILNAKDGSYPVSPIGILSKIQKIGSHLGHGREEDAHEFLRCAVDTMQSVCLKEFGAKGK  73

Query  2462  CSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTH  2641
               + E+T+LIGLTFGG+LRSKI+C++C GKSE +ER+MDLTVEIDGDI +LE AL QFT 
Sbjct  74    --IAEETTLIGLTFGGYLRSKIKCLKCLGKSELYERMMDLTVEIDGDIGTLEEALAQFTA  131

Query  2642  TEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILN  2821
             +EIL GENKY+CSRCKSYEKA+KKL +LE PN+LTI LKRF+SG FGKLNK++ FPE+LN
Sbjct  132   SEILVGENKYYCSRCKSYEKAKKKLTVLEEPNILTIVLKRFESGNFGKLNKSVWFPEVLN  191

Query  2822  LASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIE  3001
             +A YMS T D SP+Y LY V+ H DV NA FSGHYVCYVKN   +WF+++DS V PV++E
Sbjct  192   MAPYMSRTGDGSPMYSLYAVVVHLDVTNATFSGHYVCYVKNSHEEWFRIDDSTVIPVKLE  251

Query  3002  SVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKY------VNCKSSSHTNSWDLSKGD  3163
              VLS+ AYMLLY+R SPR P LIR+  SH  + +K       +N  S   +NS+  S   
Sbjct  252   RVLSEEAYMLLYARHSPRPPALIRNNVSHGVKSKKKNLEAVDLNNTSKIRSNSYIPSLDS  311

Query  3164  STNDPACRECFNSVQASSWPHRTI  3235
                   C +         W  R++
Sbjct  312   KAQQKPCTDSNQLFDRDEWKFRSM  335



>ref|XP_006477932.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X4 [Citrus sinensis]
Length=1015

 Score =   396 bits (1018),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 188/384 (49%), Positives = 256/384 (67%), Gaps = 6/384 (2%)
 Frame = +2

Query  1997  KASKSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVEL-RPFGLTNCGNSCYANAV  2173
             K++K R +S   W +   +   K LFPYE F+KLF  + ++L  P GL NCGNSCYANAV
Sbjct  435   KSTKLRQDSSELWHDQHRKL--KMLFPYEEFLKLFQYEVIDLLSPRGLLNCGNSCYANAV  492

Query  2174  LQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENI  2353
             LQCL  T P   Y L+  HS  C +KDWC  CE E  V+  +    PLSP RI+SH+ +I
Sbjct  493   LQCLTCTKPLVIYLLRRSHSSACCRKDWCLMCELEQHVMMLRESGGPLSPGRILSHMRSI  552

Query  2354  GSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIE  2530
                +G+G +EDAHEFLR ++ +MQS+CL+  G  +      ++T+ I  TFGG L SK++
Sbjct  553   SCQIGDGSQEDAHEFLRLLVASMQSICLERHGGESKVDPRLQETTFIQHTFGGRLWSKVK  612

Query  2531  CMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARK  2710
             C+RC  +SER+E IMDLT+EI G + SLE AL QFT  E LDGEN Y C+RC +Y +ARK
Sbjct  613   CLRCSHESERYENIMDLTLEIYGWVESLEDALTQFTSPEDLDGENMYKCARCATYVRARK  672

Query  2711  KLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEH  2890
             +L I EAPN+LTI LKRFQ G++GK+NK ITFPE+L++  +M+GT D  P+Y LY V+ H
Sbjct  673   QLSIHEAPNILTIVLKRFQEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVH  732

Query  2891  EDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI  3070
              D  NA+FSGHYV Y+K+ Q  WF+++D +V PV +  V+S+GAYML Y R  PR  + +
Sbjct  733   LDTQNASFSGHYVSYIKDMQGTWFRIDDMQVHPVPMSQVMSEGAYMLFYMRSCPRPRRTL  792

Query  3071  --RSLTSHDPRGQKYVNCKSSSHT  3136
               +++    P   ++   KS  H+
Sbjct  793   SRKAMQQQVPASARHSMPKSQKHS  816


 Score = 75.5 bits (184),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            CA+CF+ A+TRCSRCK+VRYCSGKCQIIHWR  HK EC 
Sbjct  103  CARCFAPATTRCSRCKSVRYCSGKCQIIHWRQVHKQECQ  141



>ref|XP_007022154.1| Ubiquitin-specific protease 15, putative isoform 2 [Theobroma 
cacao]
 gb|EOY13679.1| Ubiquitin-specific protease 15, putative isoform 2 [Theobroma 
cacao]
Length=851

 Score =   392 bits (1007),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 189/361 (52%), Positives = 244/361 (68%), Gaps = 5/361 (1%)
 Frame = +2

Query  1994  LKASKSRHNSLGAWSEIGG--RYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             ++  KS   S   +S + G  R   K LFPYE FV  F  +  +L P GL NCGNSCYAN
Sbjct  420   MRLRKSSRLSRQDFSALCGERRKKIKMLFPYEEFVNFFQCEFFDLSPRGLLNCGNSCYAN  479

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCL  T P + Y L+  HS+ C  KDWC  CE E  V+  +    PLSP  I++H+ 
Sbjct  480   AVLQCLTCTKPLSIYLLRRSHSRACYGKDWCLMCELEQHVMLLRESGGPLSPSSILTHIR  539

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGV--RTSCSLEEQTSLIGLTFGGFLRS  2521
             +I   +G+G +EDAHEFLR ++ +MQS+CL+  G   +    L+E T+ I  TFGG LRS
Sbjct  540   SINCQMGDGSQEDAHEFLRLLVASMQSICLERLGGEHKVDPRLQE-TTFIQHTFGGHLRS  598

Query  2522  KIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEK  2701
             K++C+RC  +SER E IMDLT+EI G + SLE AL QFT  E LDGEN Y C RC SY +
Sbjct  599   KVKCLRCSHESERFENIMDLTLEIFGWVESLEDALTQFTTPEDLDGENMYRCGRCASYVR  658

Query  2702  ARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGV  2881
             ARK+L I EAPN+LTI LKRFQ GK+GK+NK ITFPE+L++  YM+GT D  P+Y LY V
Sbjct  659   ARKQLCIHEAPNILTIVLKRFQEGKYGKINKCITFPEMLDMVPYMTGTGDIPPLYMLYAV  718

Query  2882  IEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             + H D +NA+FSGHYV YVK+ Q  WF+++D++V PV +  V+S+GAY+L Y RC   A 
Sbjct  719   VVHLDTLNASFSGHYVSYVKDLQGNWFRIDDTEVHPVSMSQVMSEGAYILFYMRCLALAL  778

Query  3062  K  3064
             K
Sbjct  779   K  779


 Score = 74.7 bits (182),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  611  SSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            +S +  V  ++   + CA+CF  A+TRCSRCKAVRYCSG+CQIIHWR  HK EC
Sbjct  60   ASVIPLVASSKNGLHVCARCFGPATTRCSRCKAVRYCSGRCQIIHWRQVHKQEC  113



>ref|XP_007022155.1| Ubiquitin-specific protease 15, putative isoform 3 [Theobroma 
cacao]
 gb|EOY13680.1| Ubiquitin-specific protease 15, putative isoform 3 [Theobroma 
cacao]
Length=990

 Score =   395 bits (1016),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 196/397 (49%), Positives = 254/397 (64%), Gaps = 16/397 (4%)
 Frame = +2

Query  1994  LKASKSRHNSLGAWSEIGG--RYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             ++  KS   S   +S + G  R   K LFPYE FV  F  +  +L P GL NCGNSCYAN
Sbjct  414   MRLRKSSRLSRQDFSALCGERRKKIKMLFPYEEFVNFFQCEFFDLSPRGLLNCGNSCYAN  473

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCL  T P + Y L+  HS+ C  KDWC  CE E  V+  +    PLSP  I++H+ 
Sbjct  474   AVLQCLTCTKPLSIYLLRRSHSRACYGKDWCLMCELEQHVMLLRESGGPLSPSSILTHIR  533

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSK  2524
             +I   +G+G +EDAHEFLR ++ +MQS+CL+  G         ++T+ I  TFGG LRSK
Sbjct  534   SINCQMGDGSQEDAHEFLRLLVASMQSICLERLGGEHKVDPRLQETTFIQHTFGGHLRSK  593

Query  2525  IECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKA  2704
             ++C+RC  +SER E IMDLT+EI G + SLE AL QFT  E LDGEN Y C RC SY +A
Sbjct  594   VKCLRCSHESERFENIMDLTLEIFGWVESLEDALTQFTTPEDLDGENMYRCGRCASYVRA  653

Query  2705  RKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVI  2884
             RK+L I EAPN+LTI LKRFQ GK+GK+NK ITFPE+L++  YM+GT D  P+Y LY V+
Sbjct  654   RKQLCIHEAPNILTIVLKRFQEGKYGKINKCITFPEMLDMVPYMTGTGDIPPLYMLYAVV  713

Query  2885  EHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR---  3055
              H D +NA+FSGHYV YVK+ Q  WF+++D++V PV +  V+S+GAY+L Y R  PR   
Sbjct  714   VHLDTLNASFSGHYVSYVKDLQGNWFRIDDTEVHPVSMSQVMSEGAYILFYMRSCPRPQR  773

Query  3056  ----------APKLIRSLTSHDPRGQKYVNCKSSSHT  3136
                       AP   R  TS   +  +    KSSSH+
Sbjct  774   AFTEKSRQKQAPASTRHPTSKSEKLSRPEQSKSSSHS  810


 Score = 74.7 bits (182),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            CA+CF  A+TRCSRCKAVRYCSG+CQIIHWR  HK EC
Sbjct  76   CARCFGPATTRCSRCKAVRYCSGRCQIIHWRQVHKQEC  113



>ref|XP_009140568.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19 [Brassica 
rapa]
Length=631

 Score =   385 bits (989),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 186/355 (52%), Positives = 243/355 (68%), Gaps = 3/355 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV+ FN  K  L P GLTNCGNSC+AN VLQCL++T P  AY L+  H + C +
Sbjct  138   LFPYETFVQYFNWDKPGLAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECRR  197

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A     P SP+ IIS L NIG +LG GR+EDAHE +R+VI+ MQS
Sbjct  198   NDWCFLCEFETHLERANISRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFVIDMMQS  257

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  258   VCLDEFGGEKVVPPRAQETTLIQYIFGGLLQSQVQCTVCSNVSDQYENMMDLTVEIHGDA  317

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LT+ALKRFQ G+FGK
Sbjct  318   VSLEECLDQFTAKEWLQGDNLYKCDRCNDYVKACKRLSIRSAPNILTVALKRFQGGRFGK  377

Query  2786  LNKTITFPEILNLASYMSGT-SDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWF  2962
             LNK I+FPE  +L  YMS    + S +Y+LY VI H D++NA+F GHY+CYVK+F+  W+
Sbjct  378   LNKRISFPETFDLGPYMSCCGGEGSDVYKLYAVIVHLDMLNASFFGHYICYVKDFRGDWY  437

Query  2963  KVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSS  3127
             +++DS+V+ VE+E VLS+ AYMLLYSR   R P  +RS    D +    V+ ++S
Sbjct  438   RIDDSEVEKVELEDVLSQRAYMLLYSRVQAR-PSSLRSEEVQDEKKTDTVDTEAS  491



>ref|XP_002970813.1| hypothetical protein SELMODRAFT_171601 [Selaginella moellendorffii]
 gb|EFJ28139.1| hypothetical protein SELMODRAFT_171601 [Selaginella moellendorffii]
Length=419

 Score =   377 bits (969),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 179/326 (55%), Positives = 230/326 (71%), Gaps = 2/326 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY  F+K F S  +   P GL NCGNSCYAN VLQCLA T P  AY L G H + C +
Sbjct  95    LFPYRDFLKFF-SCNISKVPCGLINCGNSCYANVVLQCLASTRPLAAYLLHGMHQEACQR  153

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             + WCF CE E  V KA N   P SPI+I+S L +IG+SLG GR+EDAHEF+R  ++ MQ 
Sbjct  154   EGWCFMCELEDHVQKAFNNQMPFSPIKILSRLRSIGNSLGYGRQEDAHEFMRLAVDCMQK  213

Query  2429  VCLKEAGVRTSCSLEEQ-TSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             +CL EAG  T+     Q T+LI   FGG+L+S++ C +C  +S  +E ++DL+V I G++
Sbjct  214   ICLDEAGGETTLDARTQETTLIQHIFGGYLQSQVVCCQCQQRSNLYENMLDLSVGIQGNV  273

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE AL+QFT  E LDG+NKY C RC +Y +A+K+L + EAPN+LTIALKRFQ GKFGK
Sbjct  274   ESLEDALKQFTSPEWLDGDNKYRCDRCNAYVRAKKRLSVHEAPNILTIALKRFQGGKFGK  333

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +NK +TFPE L++  YMSGT D  P Y+LY V+ H D++NA++ GHYVCYV+     WFK
Sbjct  334   INKKVTFPEELDMVPYMSGTVDTPPAYKLYAVVVHVDMLNASYFGHYVCYVRAGNGAWFK  393

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSR  3043
             V+DSKVK V+   V+S+ AYMLLY R
Sbjct  394   VDDSKVKEVDQIRVMSQKAYMLLYRR  419



>emb|CDX75188.1| BnaA01g05140D [Brassica napus]
Length=611

 Score =   384 bits (986),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 181/343 (53%), Positives = 234/343 (68%), Gaps = 7/343 (2%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV+ FN    +L P GL NCGNSC+AN +LQCL++T P  AY L+  H   C +
Sbjct  130   LFPYEEFVRYFNWDNTDLAPCGLMNCGNSCFANVILQCLSWTRPLVAYLLERGHRSECMR  189

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF C F++ V +A     P SP+ IIS L NIG +LG GR+EDAHEF+RY I+TMQS
Sbjct  190   DDWCFFCAFQTHVERASQSRYPFSPVNIISRLTNIGGTLGYGRQEDAHEFMRYAIDTMQS  249

Query  2429  VCLKEAG----VRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEID  2596
             VCL E G    V   C   ++T+L+   FGG L+S+++C  C   SE++E +MDLTVEI 
Sbjct  250   VCLDEFGGEKMVPPRC---QETTLVQYIFGGLLQSQVQCTVCNNVSEQYENMMDLTVEIH  306

Query  2597  GDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGK  2776
             GD  SLE  L QFT  E L G+N Y C RC  Y KA K+L I   PNVLTIALKRF+ G+
Sbjct  307   GDAVSLEECLDQFTAREWLQGDNMYKCDRCSDYVKACKRLTIRRPPNVLTIALKRFKGGR  366

Query  2777  FGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNK  2956
             +GKLNK I+FPE L+L  YMS   + S +Y LY VI H D++NA+F GHY+CY+K+F   
Sbjct  367   YGKLNKRISFPETLDLRPYMSQGGEGSDVYTLYAVIVHLDMLNASFFGHYICYIKDFSGN  426

Query  2957  WFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTS  3085
             W++++DS+++ VE+E VLS+ AYMLLYSR   R+P    S+ S
Sbjct  427   WYRIDDSEIESVELEEVLSQRAYMLLYSRIQARSPLPCESIGS  469



>gb|KEH39885.1| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=831

 Score =   391 bits (1004),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 187/334 (56%), Positives = 234/334 (70%), Gaps = 1/334 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY  FVKLFN       P GL NCGNSC+AN VLQCL+FT P  AY L+  H   C  
Sbjct  161   LFPYHEFVKLFNWDNPGFPPCGLLNCGNSCFANVVLQCLSFTRPLVAYLLEKGHRNECTC  220

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFES V +A+  +   SP+ I+S L NIG +LG GR+EDAHEF+R+ I+TMQS
Sbjct  221   NDWCFLCEFESHVERARLSSQAFSPMNILSRLPNIGGTLGYGRQEDAHEFMRFSIDTMQS  280

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +   S  ++T++I   FGG L+S++ C +C   S ++E +MDLTVEI GD 
Sbjct  281   VCLDEFGGEKAVPSNLQETTIIQHIFGGRLQSEVICTKCDKTSNQYESMMDLTVEIHGDA  340

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
             ASLE  L QFT  E LDGEN Y C  C+ Y KA K+L +  APN+LTIALKRFQSG+FGK
Sbjct  341   ASLEECLDQFTVKEWLDGENMYKCEGCQDYVKAWKRLTVKCAPNILTIALKRFQSGRFGK  400

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK + FPE LNL+ YMS   D S IY LY V+ H D++NA+F GHY+CY+K+F+  W++
Sbjct  401   LNKRVAFPETLNLSPYMSEAGDGSDIYNLYAVVVHIDMLNASFFGHYICYIKDFRGNWYR  460

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             ++DSKV  VE+E VLS+GAYMLLY RC+ R   L
Sbjct  461   IDDSKVVCVELEEVLSQGAYMLLYRRCTARPSSL  494


 Score = 57.4 bits (137),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            CA C S A+ +CSRCK VRYC+ KCQ  HW  GHK++C
Sbjct  70   CAVCASHATKKCSRCKGVRYCTTKCQQSHWNSGHKEKC  107



>ref|XP_007022153.1| Ubiquitin-specific protease 15, putative isoform 1 [Theobroma 
cacao]
 gb|EOY13678.1| Ubiquitin-specific protease 15, putative isoform 1 [Theobroma 
cacao]
Length=1000

 Score =   395 bits (1015),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 196/397 (49%), Positives = 254/397 (64%), Gaps = 16/397 (4%)
 Frame = +2

Query  1994  LKASKSRHNSLGAWSEIGG--RYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             ++  KS   S   +S + G  R   K LFPYE FV  F  +  +L P GL NCGNSCYAN
Sbjct  420   MRLRKSSRLSRQDFSALCGERRKKIKMLFPYEEFVNFFQCEFFDLSPRGLLNCGNSCYAN  479

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCL  T P + Y L+  HS+ C  KDWC  CE E  V+  +    PLSP  I++H+ 
Sbjct  480   AVLQCLTCTKPLSIYLLRRSHSRACYGKDWCLMCELEQHVMLLRESGGPLSPSSILTHIR  539

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSK  2524
             +I   +G+G +EDAHEFLR ++ +MQS+CL+  G         ++T+ I  TFGG LRSK
Sbjct  540   SINCQMGDGSQEDAHEFLRLLVASMQSICLERLGGEHKVDPRLQETTFIQHTFGGHLRSK  599

Query  2525  IECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKA  2704
             ++C+RC  +SER E IMDLT+EI G + SLE AL QFT  E LDGEN Y C RC SY +A
Sbjct  600   VKCLRCSHESERFENIMDLTLEIFGWVESLEDALTQFTTPEDLDGENMYRCGRCASYVRA  659

Query  2705  RKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVI  2884
             RK+L I EAPN+LTI LKRFQ GK+GK+NK ITFPE+L++  YM+GT D  P+Y LY V+
Sbjct  660   RKQLCIHEAPNILTIVLKRFQEGKYGKINKCITFPEMLDMVPYMTGTGDIPPLYMLYAVV  719

Query  2885  EHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR---  3055
              H D +NA+FSGHYV YVK+ Q  WF+++D++V PV +  V+S+GAY+L Y R  PR   
Sbjct  720   VHLDTLNASFSGHYVSYVKDLQGNWFRIDDTEVHPVSMSQVMSEGAYILFYMRSCPRPQR  779

Query  3056  ----------APKLIRSLTSHDPRGQKYVNCKSSSHT  3136
                       AP   R  TS   +  +    KSSSH+
Sbjct  780   AFTEKSRQKQAPASTRHPTSKSEKLSRPEQSKSSSHS  816


 Score = 75.1 bits (183),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  611  SSTLTSVPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            +S +  V  ++   + CA+CF  A+TRCSRCKAVRYCSG+CQIIHWR  HK EC
Sbjct  60   ASVIPLVASSKNGLHVCARCFGPATTRCSRCKAVRYCSGRCQIIHWRQVHKQEC  113



>emb|CDX76801.1| BnaC08g33870D [Brassica napus]
Length=651

 Score =   385 bits (989),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 187/354 (53%), Positives = 237/354 (67%), Gaps = 2/354 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV  FN  K  L P GLTNCGNSC+AN VLQCL++T P  AY L+  H + C +
Sbjct  150   LFPYETFVNYFNWDKPTLAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECKR  209

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A     P SP+ IIS L NIG +LG GR+EDAHE +R+VI+ MQS
Sbjct  210   NDWCFFCEFETHLERANMSRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFVIDMMQS  269

Query  2429  VCLKEAGVRTSCSLEEQ-TSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E G   +     Q T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  270   VCLDEFGGEKAVPPRAQETTLIQHIFGGLLQSQVKCTVCSNVSDQYENMMDLTVEIHGDA  329

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LTIALKRFQ G+FGK
Sbjct  330   VSLEECLDQFTAKEWLQGDNLYKCDRCNDYVKACKRLSIRSAPNILTIALKRFQGGRFGK  389

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I FPE  +L  Y SG  + S +Y LY VI H D++NA+F GHY+CYVK+ +  W++
Sbjct  390   LNKRIGFPETFDLGPYTSGGGEGSDVYNLYAVIVHLDMLNASFFGHYICYVKDLRGDWYR  449

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSS  3127
             ++DS+V+ VE+E VLS+ AYMLLYSR   R P  +R     D +    +N +SS
Sbjct  450   IDDSEVEKVELEDVLSQRAYMLLYSRVQTR-PSSLRPEEVQDEKKTDTLNIESS  502



>gb|KFK32657.1| hypothetical protein AALP_AA6G271600 [Arabis alpina]
Length=668

 Score =   385 bits (990),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 184/354 (52%), Positives = 241/354 (68%), Gaps = 2/354 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV+ FN  +  L P GL NCGNSC+AN VLQCL++T P  AY L+  H + C +
Sbjct  149   LFPYEQFVQYFNWDRPTLAPCGLMNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECRR  208

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A     P SP+ IIS L NIG +LG GR+EDAHE +R+VI+ MQS
Sbjct  209   NDWCFFCEFETHLERANQSRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFVIDMMQS  268

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +   S  ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  269   VCLDEFGGEKVVPSRAQETTLIQYIFGGLLQSEVQCTVCSNVSDQYENMMDLTVEIHGDA  328

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LT+ALKRFQ G+FGK
Sbjct  329   VSLEECLDQFTAKEWLQGDNMYKCDRCNDYVKACKRLSIRCAPNILTVALKRFQGGRFGK  388

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FPE  +L  Y S   + S +Y+LY VI H D++NA+F GHY+CYVK+F+  W++
Sbjct  389   LNKRISFPETFDLGPYTSSGGEGSNVYKLYAVIVHLDMLNASFFGHYICYVKDFRGNWYR  448

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSS  3127
             ++DS+V+ VE+E VLS+ AYMLLYSR   R P  +RS    D +    +  +SS
Sbjct  449   IDDSEVENVELEDVLSQRAYMLLYSRVQTR-PSSLRSDEVQDEKKTDILETESS  501


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  650  PYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP-PVNNNHDSYGKGANDF  826
            P +CA C    + +CSRCK+VRYCSGKCQ   W  GHK +C    V ++    G+   +F
Sbjct  58   PDECAVCGKVTTKKCSRCKSVRYCSGKCQTSDWSSGHKLKCKVFRVTDSSSPVGRDGLEF  117

Query  827  K  829
            K
Sbjct  118  K  118



>ref|XP_010539169.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Tarenaya 
hassleriana]
Length=901

 Score =   392 bits (1008),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 240/350 (69%), Gaps = 3/350 (1%)
 Frame = +2

Query  2009  SRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLA  2188
             +RHN+   + +   +   K LFPYE FVK F S   +L P GL NCGNSCYANAVLQ L 
Sbjct  381   TRHNTAEQYDDRHKKL--KMLFPYEEFVKFFQSDVFDLSPRGLVNCGNSCYANAVLQSLT  438

Query  2189  FTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLG  2368
              T P  A+ L+  HS+ C +KDWC  CE E  V+  +    PLS  RI+SH+ +I   +G
Sbjct  439   CTKPLVAFLLRRLHSRTCCRKDWCLMCELEQHVMMLREIGGPLSASRILSHMRSINCQIG  498

Query  2369  NGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQ-TSLIGLTFGGFLRSKIECMRCG  2545
             +G +EDAHEFLR ++ +MQS+CL+  G  +      Q T+ +  TFGG LRSK++C+RC 
Sbjct  499   DGSQEDAHEFLRLLVASMQSICLERLGGESKVDPRSQETTFVQHTFGGRLRSKVKCLRCH  558

Query  2546  GKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKIL  2725
              +SER+E IMDLT+EI G + SL+ A  QFT  E LDGEN Y CSRC  Y +ARK+L I 
Sbjct  559   HESERYESIMDLTLEIYGWVESLQDAFTQFTTPEDLDGENMYRCSRCAEYVRARKQLSIH  618

Query  2726  EAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMN  2905
             EAPN+LTI LKRFQ G++GK+NK ITFPE+L++  +M+GT D  P+Y LY V+ H D +N
Sbjct  619   EAPNILTIVLKRFQEGRYGKINKCITFPEMLDMTPFMTGTGDIPPLYMLYAVVVHLDTLN  678

Query  2906  AAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             A+FSGHY+ YVK+ +  WF+++DS++ PV +  V+S+GAYML Y R  PR
Sbjct  679   ASFSGHYISYVKDLRGNWFRIDDSEIHPVPMSQVMSEGAYMLFYMRSHPR  728


 Score = 81.6 bits (200),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  653  YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            + CA+CFS A+TRCSRCK+VRYCSGKCQIIHWR  HKDEC P
Sbjct  75   HACARCFSPATTRCSRCKSVRYCSGKCQIIHWRQAHKDECVP  116



>gb|KCW68484.1| hypothetical protein EUGRSUZ_F02136 [Eucalyptus grandis]
Length=786

 Score =   389 bits (999),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 185/260 (71%), Positives = 208/260 (80%), Gaps = 2/260 (1%)
 Frame = +2

Query  1991  QLKAS-KSRHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYAN  2167
             Q K S  S+H  LG  S++ GR N+KG+FPYELFV L+  K VEL P GL NCGNSCYAN
Sbjct  527   QFKGSVMSKHQRLGVGSDVPGRCNDKGIFPYELFVTLYTWKGVELHPRGLINCGNSCYAN  586

Query  2168  AVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLE  2347
             AVLQCLAFTPP TAYFLQG HSK C +KDWCF CEFESL+L+   G SP+SPI I+S L 
Sbjct  587   AVLQCLAFTPPLTAYFLQGLHSKACVRKDWCFTCEFESLILRMNEGKSPISPIGIVSQLR  646

Query  2348  NIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKI  2527
             NIG  LGNG+EEDAHEFLR  I+ MQS CL ++G + S S EE T LIGLTFGG+LRSKI
Sbjct  647   NIGRQLGNGKEEDAHEFLRCAIDKMQSDCLVDSGKKVSRSKEEAT-LIGLTFGGYLRSKI  705

Query  2528  ECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKAR  2707
             +C RC GKSERHER+MDLTVEI GDI +LE ALRQFT TE LDGENKY C+RC SYEKAR
Sbjct  706   QCTRCNGKSERHERMMDLTVEIGGDIRTLEEALRQFTSTETLDGENKYQCTRCNSYEKAR  765

Query  2708  KKLKILEAPNVLTIALKRFQ  2767
             KKL +LEAPN+LTIALKRFQ
Sbjct  766   KKLTVLEAPNILTIALKRFQ  785


 Score = 79.3 bits (194),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  653  YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNH  796
            Y CA C+   +TRCS+CKAVRYCSGKCQIIHWR GHK+EC P    +H
Sbjct  88   YYCAVCYCPTTTRCSQCKAVRYCSGKCQIIHWRQGHKEECRPVEAGSH  135



>ref|XP_009126746.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18 [Brassica 
rapa]
Length=612

 Score =   384 bits (985),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/344 (53%), Positives = 234/344 (68%), Gaps = 7/344 (2%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV+ FN    +L P GL NCGNSC+AN +LQCL++T P  AY L+  H   C +
Sbjct  130   LFPYEEFVRYFNWDNTDLAPCGLMNCGNSCFANVILQCLSWTRPLVAYLLERGHRSECMR  189

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF C F++ V +A     P SP+ IIS L NIG +LG GR+EDAHEF+RY I+TMQS
Sbjct  190   DDWCFFCAFQTHVERASQSRYPFSPVNIISRLTNIGGTLGYGRQEDAHEFMRYAIDTMQS  249

Query  2429  VCLKEAG----VRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEID  2596
             VCL E G    V   C   ++T+L+   FGG L+S+++C  C   SE++E +MDLTVEI 
Sbjct  250   VCLDEFGGEKMVPPRC---QETTLVQYIFGGVLQSQVQCTVCNNVSEQYENMMDLTVEIH  306

Query  2597  GDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGK  2776
             GD  SLE  L QFT  E L G+N Y C RC  Y KA K+L I   PNVLTIALKRF+ G+
Sbjct  307   GDAVSLEECLDQFTAREWLQGDNMYKCDRCSDYVKACKRLTIRRPPNVLTIALKRFKGGR  366

Query  2777  FGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNK  2956
             +GKLNK I+FPE L+L  YMS   + S +Y LY VI H D++NA+F GHY+CY+K+F   
Sbjct  367   YGKLNKRISFPETLDLRPYMSQGGEGSDVYTLYAVIVHLDMLNASFFGHYICYIKDFSGN  426

Query  2957  WFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSH  3088
             W++++DS+++ VE+E VLS+ AYMLLYSR   R+P    +L S 
Sbjct  427   WYRIDDSEIESVELEDVLSQRAYMLLYSRIQARSPLPCATLGSQ  470



>ref|XP_008782673.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Phoenix dactylifera]
Length=888

 Score =   392 bits (1006),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/333 (53%), Positives = 235/333 (71%), Gaps = 1/333 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE  VK F+ K   + P GL NCGNSCYANAVLQCL +T P   Y LQ  HS+ C  
Sbjct  360   LFPYEDLVKFFHCKVGGIAPRGLLNCGNSCYANAVLQCLTYTKPLMVYLLQRPHSRTCRV  419

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             KDWC  CE E  V   + G  P SP RI+S++ NIG  +G G +EDAHEFLR+++ +MQS
Sbjct  420   KDWCLMCELEQHVSMLREGGGPSSPSRILSNMRNIGCRMGGGNQEDAHEFLRFLVMSMQS  479

Query  2429  VCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
              CL+E G       + ++T+L+   FGG L+SK++C+RC  +SER+E IMDLT+EI G +
Sbjct  480   TCLEEFGGEKQVDPKLQETTLVQQIFGGRLKSKVKCLRCHIESERYENIMDLTLEIHGWV  539

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE AL QFT  E LDGEN Y C RC +Y  ARK+L I E PN+LTI LKRFQ+G +GK
Sbjct  540   ESLEDALTQFTAPEDLDGENMYRCGRCSAYVNARKQLTIHEVPNILTIVLKRFQTGNYGK  599

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +NK +TFP++L++  +++GT+D  P+Y LY V+ H D +NA+FSGHY+ YVK+ Q  WF+
Sbjct  600   INKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYISYVKDLQGTWFR  659

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPK  3064
             ++DS+V+ V +  V+S+GAYML YSR  PR P+
Sbjct  660   IDDSEVQAVPLSQVMSEGAYMLFYSRSFPRPPR  692



>ref|XP_011045595.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Populus euphratica]
Length=922

 Score =   392 bits (1007),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 241/358 (67%), Gaps = 3/358 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             + LFPYE FVK+FN + + L P GL NCGNSCYANAVLQCL  T P   + L+  HS+ C
Sbjct  409   RMLFPYEEFVKIFNCEVINLTPRGLVNCGNSCYANAVLQCLTCTKPLIIFLLRRSHSRAC  468

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
               KDWC  CE E  V+  +    PLSP RI+ H+  I   +G+G +EDAHEFLR +I +M
Sbjct  469   CGKDWCLMCELEQHVMMLRECGGPLSPSRILLHMRKINHQIGDGSQEDAHEFLRLLIASM  528

Query  2423  QSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QS+CL+  G         ++T+ I  TFGG LRSK++C+RC  +SER+E IMDLT+EI G
Sbjct  529   QSICLERLGGEDKVDPRLQETTFIQHTFGGLLRSKVKCLRCHHESERYENIMDLTLEIFG  588

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
              + SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPN+LTI LKRFQ GK+
Sbjct  589   WVESLEDALTQFTTPEELDGENMYRCGRCAAYVRARKQLSIHEAPNILTIVLKRFQEGKY  648

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GK+NK ITFP++L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ +  W
Sbjct  649   GKINKCITFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKDLRGSW  708

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSSSH  3133
             FK++D++V PV +  V+ +GAY+L Y R   + P   R  TS   +  +    + SSH
Sbjct  709   FKIDDTEVHPVSMSQVMLEGAYILFYKR--QQVPVSSRQCTSRTQKPSRQEQRRCSSH  764


 Score = 78.2 bits (191),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            CA+CFS A+TRCSRCK+VRYCSGKCQIIHWR  HK+EC 
Sbjct  76   CARCFSPATTRCSRCKSVRYCSGKCQIIHWRQAHKEECQ  114



>ref|XP_010694568.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Beta vulgaris 
subsp. vulgaris]
Length=939

 Score =   392 bits (1008),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 240/348 (69%), Gaps = 3/348 (1%)
 Frame = +2

Query  2030  AWSEI--GGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPF  2203
             A SEI  G  +  K LFP++ F +LF  +   L P GL NCGNSCYANAVLQCL  T P 
Sbjct  401   ATSEIDTGDCHEMKVLFPFKEFTRLFELEVFGLVPRGLLNCGNSCYANAVLQCLTCTKPL  460

Query  2204  TAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREE  2383
               Y L   HS+ C+  +WC  CE E  V   ++   PLSP RI+SH+ +I   +G+G +E
Sbjct  461   VVYLLSRTHSRTCSLNNWCLMCELEQHVHMLRDAEGPLSPSRILSHIRSINCQIGDGSQE  520

Query  2384  DAHEFLRYVIETMQSVCLKEAGVRTSCS-LEEQTSLIGLTFGGFLRSKIECMRCGGKSER  2560
             DAHEFLR ++ +MQS+CL+E G       + ++T+ +  TFGG LRS + C+RC  +SER
Sbjct  521   DAHEFLRLLVASMQSICLEEVGGENQVHPILQETTFVQQTFGGSLRSMVVCLRCRHESER  580

Query  2561  HERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNV  2740
             +E IMDLT+EI G + SLE AL QFT  E LDGEN Y C RC SY +ARK+L I EAPN+
Sbjct  581   YENIMDLTLEIFGWVESLEDALTQFTTPEDLDGENMYRCGRCASYVRARKQLSIDEAPNI  640

Query  2741  LTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSG  2920
             LTI LKRFQ G +GK+NK ITFPE+L++  +M+GT+D  P+Y LYGV+ H D +NA+FSG
Sbjct  641   LTIVLKRFQEGNYGKINKCITFPEMLDMVPFMTGTNDSPPLYMLYGVVVHVDTLNASFSG  700

Query  2921  HYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPK  3064
             HYV YVK+ Q  WF+++D+ V+PV +  V+S+GAY+L Y R  PR P+
Sbjct  701   HYVSYVKDLQGNWFRIDDTVVQPVLMSQVMSEGAYILFYMRSFPRPPR  748


 Score = 76.6 bits (187),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +2

Query  656  QCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSY  805
            +CA+C   A+TRCSRCK+VRYCSG+CQIIHWR GHK++C  P+++ + S+
Sbjct  76   ECARCRGPATTRCSRCKSVRYCSGRCQIIHWRQGHKEQCQ-PIDDIYSSF  124



>gb|EYU39312.1| hypothetical protein MIMGU_mgv1a001469mg [Erythranthe guttata]
Length=813

 Score =   389 bits (999),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 259/362 (72%), Gaps = 17/362 (5%)
 Frame = +2

Query  2054  YNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHS  2233
             YN+K +F  +LF++L++   +EL P GL NCGNSCYANAVLQCLAFT P  +Y LQG HS
Sbjct  375   YNHKMIFSPKLFIQLYSCTGLELHPVGLFNCGNSCYANAVLQCLAFTRPVASYLLQGLHS  434

Query  2234  KGCAK--KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY  2407
             K C    + WC  CEFE L+ K +  NSPLSP+ I+S ++ IGS L +GR+EDAH+FLR 
Sbjct  435   KTCKYLFRGWCLICEFEHLIRKGQETNSPLSPVGILSQIQRIGSHLSHGRQEDAHDFLRN  494

Query  2408  VIETMQSVCLKEAGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTV  2587
             V++TMQS+ L+EA V  S S+ E ++L+G TFGG+LRSKI+CM+C  +SE+ +R+MDLT 
Sbjct  495   VVDTMQSIWLEEACV--SGSIAENSTLLGQTFGGYLRSKIKCMKCSRRSEQCDRMMDLT-  551

Query  2588  EIDGDIASLEGALRQFTHTE-ILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRF  2764
                       G LR   + + +++  N +HC RCKSYEKA+KKL ++EAPN+LTI LKRF
Sbjct  552   ----------GLLRSSPYLKHLVEMTNTFHC-RCKSYEKAKKKLTVIEAPNILTIVLKRF  600

Query  2765  QSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKN  2944
             +SG   KL+K I FPE LNLA YMSG SDK PIY LY V+ H + MNAA+SGHY+ YVK+
Sbjct  601   RSGNSEKLSKPIQFPEFLNLAPYMSGKSDKYPIYNLYAVVVHSNTMNAAYSGHYISYVKD  660

Query  2945  FQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKS  3124
             F+ +WF+++D++V  V++ +VLS  AY+L YSR +PR P L+ ++  +   G+   N ++
Sbjct  661   FRGEWFRIDDTRVSRVDLATVLSVEAYILFYSRHTPRGPSLLTNIDVYSDGGKTKRNTEA  720

Query  3125  SS  3130
              S
Sbjct  721   VS  722


 Score = 79.0 bits (193),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 66/133 (50%), Gaps = 30/133 (23%)
 Frame = +2

Query  386  LVFIGPLLGFLVRQKWRHAEARREEIDRLLVLaseeaaraefeaaaeygfeyssysfgsV  565
            +V I  + G +VR+KW +  A+REEI RL+              AA    E       +V
Sbjct  4    IVVILLIFGAVVRRKWGNEAAKREEILRLV--------------AAASEEEAEIAKIQAV  49

Query  566  VGDEvpaavpapapvSSTLTSVPVARQL--PYQCAQCFSSASTRCSRCKAVRYCSGKCQI  739
             G +                  P  +QL   Y CA C    +TRC++CKAVRYCSGKCQI
Sbjct  50   DGYD--------------FRPEPPPQQLEKKYYCAVCCCPTTTRCAQCKAVRYCSGKCQI  95

Query  740  IHWRLGHKDECHP  778
            IHWR GHKD+C P
Sbjct  96   IHWRQGHKDDCLP  108



>emb|CDP06086.1| unnamed protein product [Coffea canephora]
Length=936

 Score =   392 bits (1007),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 175/332 (53%), Positives = 232/332 (70%), Gaps = 1/332 (0%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPYE FVK F  +   + P GL NCGNSCYANAVLQCL  T P   + LQ  HS+  
Sbjct  382   KMLFPYEDFVKFFQYEVFNMSPRGLINCGNSCYANAVLQCLTCTKPLLVFLLQRLHSRAS  441

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
               +DWC  CE E  V+  +    P+SP RI+SH+  I   +G+G +EDAHEFLR +I +M
Sbjct  442   CIRDWCLVCELEQHVMMLRESGDPISPSRILSHIRGINCQIGDGSQEDAHEFLRLLIASM  501

Query  2423  QSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QS+CL+  G         ++T+ +  TFGG LRSK++C+RC  +SER E IMDLT+EI G
Sbjct  502   QSICLEGLGGENVVDPRLQETTFVQHTFGGSLRSKVKCLRCHHESERSENIMDLTLEIFG  561

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
              + SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPN+LTI LKRFQ G++
Sbjct  562   WVQSLEDALTQFTSPEELDGENMYRCGRCAAYVRARKQLSIQEAPNILTIVLKRFQEGRY  621

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GK+NK ITFP++L++  +M+GT D  P+Y LY V+ H D +NA+FSGHY+ Y+K+ Q  W
Sbjct  622   GKINKCITFPDMLDMVPFMTGTDDIPPLYMLYAVVVHLDTLNASFSGHYIAYIKDLQGNW  681

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             F+++D++V+PVE+  V+S+GAY+L Y R SPR
Sbjct  682   FRIDDTEVQPVEMTQVMSEGAYILFYMRSSPR  713


 Score = 79.0 bits (193),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 65/135 (48%), Gaps = 20/135 (15%)
 Frame = +2

Query  617  TLTSVPVARQLP----YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPV  784
            T T+V     LP    +QCA+CF  ++TRC RCK+V YCSGKCQIIHWR  HK EC    
Sbjct  2    TATTVAPVLCLPNNSTHQCARCFGQSTTRCKRCKSVWYCSGKCQIIHWREVHKHECQELD  61

Query  785  NNNHDSYGK--------------GANDFKVFRQEANEGYAEGIETEERNTPGSIDASFAE  922
            +N   S  K              G+ DF+ F    N+   E  ET   NT  S     A 
Sbjct  62   SNCSISSPKLTLANEFPGGVSLDGSVDFQSFEYNNNQPMLE--ETPSENTSCSPLLPVAV  119

Query  923  PTCSEPSISGAENTE  967
              C+E   SG   TE
Sbjct  120  TACAEVDTSGTPLTE  134



>gb|KDP33469.1| hypothetical protein JCGZ_07040 [Jatropha curcas]
Length=703

 Score =   385 bits (989),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 240/347 (69%), Gaps = 3/347 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPY  F++L+N  K    P GL NCGNSC+AN VLQCL FT P  AY L+  H + C
Sbjct  153   KVLFPYNEFIELYNWDKAVFPPCGLLNCGNSCFANVVLQCLTFTRPLVAYLLEKGHQREC  212

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
              + +WCF CEF++ V +A     P SP+ I+S L NIG +LGNGR+EDAHEF+R+ I+TM
Sbjct  213   RRNEWCFLCEFQAHVERASKSFQPFSPMSILSCLPNIGGNLGNGRQEDAHEFMRFAIDTM  272

Query  2423  QSVCLKEAGVRTSCS-LEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QSVCL E G   +     ++T+L+   FGG L+S++ C +C   S + E +MDLTVEI G
Sbjct  273   QSVCLDEFGGEKAVDPASQETTLVQHIFGGHLQSQVICTKCEKISNQLENMMDLTVEIHG  332

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
             D ASLE  L QFT  E L+GEN Y C  C  Y KA K+L I  APN+LTIALKRFQSG+F
Sbjct  333   DAASLEECLDQFTVKECLNGENMYKCDGCNDYVKAWKRLTIRRAPNILTIALKRFQSGRF  392

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GKLNK +TFPE L+++ Y S   D + +Y+LY V+ H D++NA+F GHY+CYVK+F+  W
Sbjct  393   GKLNKRVTFPETLDISPYTSEEGDGTDLYKLYAVVVHVDMLNASFFGHYICYVKDFRGNW  452

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCS--PRAPKLIRSLTSHDP  3094
             ++V+D KV+ V++E VLS+GAYMLLYSR S  P + +++     H P
Sbjct  453   YRVDDCKVQSVDLEEVLSQGAYMLLYSRFSARPSSLRMMEPSKEHQP  499


 Score = 57.8 bits (138),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  653  YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            + CA C +  + +CSRCK+VRYCS +CQ  HW+ GHK +C
Sbjct  66   FSCANCGNHGNKKCSRCKSVRYCSARCQQAHWKSGHKSKC  105



>ref|XP_010525922.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19 [Tarenaya 
hassleriana]
 ref|XP_010525923.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19 [Tarenaya 
hassleriana]
Length=603

 Score =   382 bits (980),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 189/365 (52%), Positives = 244/365 (67%), Gaps = 14/365 (4%)
 Frame = +2

Query  1994  LKASKSRHNSLGAWSEIGGRYNNKG-------LFPYELFVKLFNSKKVELRPFGLTNCGN  2152
              +AS S ++S    + + G+  NK        LFPY+ FVK FN     L P GL NCGN
Sbjct  121   FRASPSGNSSTSKIALVPGQGQNKTNQKLREILFPYDEFVKYFNWDMPGLVPCGLINCGN  180

Query  2153  SCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRI  2332
             SC+AN VLQCL++T P  AY L+  H + C + DWCF CEF++ V +A     P SP+ I
Sbjct  181   SCFANVVLQCLSWTRPLVAYLLEKGHKRECRRNDWCFFCEFQTHVERASQSRLPFSPMNI  240

Query  2333  ISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKEAG----VRTSCSLEEQTSLIGLT  2500
             IS L NIG +LG GR+EDAHEF+R+VI+TMQSVCL E G    V   C   ++T+LI   
Sbjct  241   ISRLPNIGGNLGYGRQEDAHEFMRFVIDTMQSVCLDEFGGEKLVPPRC---QETTLIQYI  297

Query  2501  FGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCS  2680
             FGG L+S++ C  C   S ++E +MDLTVEI GD  SL   L QFT  E L G+N Y C 
Sbjct  298   FGGHLQSQVMCTVCDNVSNQYENMMDLTVEIHGDAMSLRECLDQFTAKEWLHGDNMYKCD  357

Query  2681  RCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSP  2860
             RC  Y KA K+L I  APN+LTIALKRFQ G+FGKLNK I+FPE L+L+ Y SG  D + 
Sbjct  358   RCNDYVKAWKRLTIRRAPNILTIALKRFQGGRFGKLNKKISFPETLDLSPYSSGGGDSTD  417

Query  2861  IYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYS  3040
             +Y LY VI H D++NA+F GHY+CY+K+F+  W++++DS+V+ VE+E VLS+ AYMLLYS
Sbjct  418   VYMLYAVIVHLDMLNASFFGHYICYIKDFRGNWYRIDDSEVENVELEDVLSQRAYMLLYS  477

Query  3041  RCSPR  3055
             R   R
Sbjct  478   RVQAR  482



>ref|XP_006442255.1| hypothetical protein CICLE_v10018666mg [Citrus clementina]
 ref|XP_006442256.1| hypothetical protein CICLE_v10018666mg [Citrus clementina]
 gb|ESR55495.1| hypothetical protein CICLE_v10018666mg [Citrus clementina]
 gb|ESR55496.1| hypothetical protein CICLE_v10018666mg [Citrus clementina]
Length=1016

 Score =   393 bits (1010),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 183/363 (50%), Positives = 246/363 (68%), Gaps = 5/363 (1%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVEL-RPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKG  2239
             K LFPYE F+KLF  + ++L  P GL NCGNSCYANAVLQCL  T P   Y L+  HS  
Sbjct  455   KMLFPYEEFLKLFQYEVIDLLSPRGLLNCGNSCYANAVLQCLTCTKPLVIYLLRRSHSSA  514

Query  2240  CAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIET  2419
             C  KDWC  CE E  V+  +    PLSP RI+SH+ +I   +G+G +EDAHEFLR ++ +
Sbjct  515   CCGKDWCLMCELEQHVMMLRESGGPLSPGRILSHMRSISCQIGDGSQEDAHEFLRLLVAS  574

Query  2420  MQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEID  2596
             MQS+CL+  G  +      ++T+ I  TFGG L SK++C+RC  +SER+E IMDLT+EI 
Sbjct  575   MQSICLERHGGESKVDPRLQETTFIQHTFGGRLWSKVKCLRCSHESERYENIMDLTLEIY  634

Query  2597  GDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGK  2776
             G + SLE AL QFT  E LDGEN Y C+RC +Y +ARK+L I EAPN+LTI LKRFQ G+
Sbjct  635   GWVESLEDALTQFTSPEDLDGENMYKCARCATYVRARKQLSIHEAPNILTIVLKRFQEGR  694

Query  2777  FGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNK  2956
             +GK+NK ITFPE+L++  +M+GT D  P+Y LY V+ H D  NA+FSGHYV Y+K+ Q  
Sbjct  695   YGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKDMQGT  754

Query  2957  WFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLI---RSLTSHDPRGQKYVNCKSS  3127
             WF+++D++V PV +  V+S+GAYML Y R  PR  + +   +++    P   ++   KS 
Sbjct  755   WFRIDDTQVHPVPMSQVMSEGAYMLFYMRSCPRPRRTLSGGKAMQQQVPASARHSMPKSQ  814

Query  3128  SHT  3136
              H+
Sbjct  815   KHS  817


 Score = 75.5 bits (184),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            CA+CF+ A+TRCSRCK+VRYCSGKCQIIHWR  HK EC 
Sbjct  103  CARCFAPATTRCSRCKSVRYCSGKCQIIHWRQVHKQECQ  141



>ref|XP_006405001.1| hypothetical protein EUTSA_v10000088mg [Eutrema salsugineum]
 gb|ESQ46454.1| hypothetical protein EUTSA_v10000088mg [Eutrema salsugineum]
Length=626

 Score =   382 bits (981),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 185/354 (52%), Positives = 239/354 (68%), Gaps = 2/354 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FVK FN  K  L P GL NCGNSC+AN VLQCL++T P  AY ++  H + C +
Sbjct  144   LFPYETFVKYFNWDKPILAPCGLINCGNSCFANVVLQCLSWTRPLVAYLMERGHKRECRR  203

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A     P SP+ IIS L NIG +LG GR+EDAHE +R+ I+ MQS
Sbjct  204   NDWCFFCEFETHLDRANLSRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFAIDMMQS  263

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  264   VCLDEFGGEKVVPPRAQETTLIQYIFGGILQSQVQCTVCSNVSDQYENMMDLTVEIHGDA  323

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LTIALKRFQ G+FGK
Sbjct  324   VSLEECLDQFTAKEWLQGDNLYKCDRCNDYVKACKRLSIRCAPNILTIALKRFQGGRFGK  383

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FPE  +L  YMS   + S IY+LY VI H D++NA+F GHY+C+VK+F+  W++
Sbjct  384   LNKRISFPETFDLGPYMSSGMEGSDIYKLYAVIVHLDMLNASFFGHYICFVKDFRGNWYR  443

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSS  3127
             ++DS+V  VE+E VLS+ AYMLLYSR   R P  +RS      +    +N +SS
Sbjct  444   IDDSQVAKVELEDVLSQRAYMLLYSRVQTR-PSSLRSEEVQKEKKTDALNTESS  496



>gb|AAD50020.1|AC007651_15 Unknown protein [Arabidopsis thaliana]
Length=891

 Score =   390 bits (1002),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 178/337 (53%), Positives = 236/337 (70%), Gaps = 2/337 (1%)
 Frame = +2

Query  2051  RYNN-KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGF  2227
             RY N K LFPYE F+K F  +  +L P GL NCGNSCYANAVLQ L  T P  AY L+  
Sbjct  378   RYKNLKMLFPYEEFLKFFQCEVFDLSPRGLVNCGNSCYANAVLQSLTCTKPLVAYLLRRS  437

Query  2228  HSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY  2407
             HS+ C+ KDWC  CE E  V+  +    PLS  RI+SH+ +I   +G+G +EDAHEFLR 
Sbjct  438   HSRSCSGKDWCLMCELEQHVMMLRESGGPLSASRILSHMRSINCQIGDGSQEDAHEFLRL  497

Query  2408  VIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLT  2584
             ++ +MQS+CL+  G  T      ++T+L+   FGG LRSK++C+RC  +SER+E IMDLT
Sbjct  498   LVASMQSICLERLGGETKVDPRLQETTLVQHMFGGRLRSKVKCLRCDHESERYENIMDLT  557

Query  2585  VEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRF  2764
             +EI G + SL+ AL QFT  E LDGEN Y CSRC  Y +ARK+L I EAPN+LTI LKRF
Sbjct  558   LEIYGWVESLQDALTQFTRPEDLDGENMYRCSRCAGYVRARKELSIHEAPNILTIVLKRF  617

Query  2765  QSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKN  2944
             Q G++GK+NK I+FPE+L++  +M+ T D  P+Y LY VI H D +NA+FSGHY+ YVK+
Sbjct  618   QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  677

Query  2945  FQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
              +  W++++DS++ PV +  V+S+GAYML Y R  PR
Sbjct  678   LRGNWYRIDDSEIHPVPMTQVMSEGAYMLFYMRSYPR  714


 Score = 82.4 bits (202),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  632  PVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            PV     + CA+CF  A TRCSRCK+VRYCSGKCQIIHWR+ HKDEC P
Sbjct  121  PVNNNELHVCARCFGPAKTRCSRCKSVRYCSGKCQIIHWRVAHKDECVP  169



>ref|XP_004141442.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Cucumis 
sativus]
 gb|KGN55401.1| hypothetical protein Csa_4G650200 [Cucumis sativus]
Length=711

 Score =   385 bits (988),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 229/334 (69%), Gaps = 1/334 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ FV LF   K +  P GL NCGNSC+AN VLQCL+FT P  A+ L+  H   C +
Sbjct  168   LFPYDEFVDLFYWDKKDFHPCGLLNCGNSCFANVVLQCLSFTRPLFAFLLEKGHRNECVR  227

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEF++ V +A     P SP  II  L NIG +LG GR+EDAHEF+R+ I+ MQ 
Sbjct  228   DDWCFFCEFQTHVERASQNAQPFSPNNIILRLPNIGGNLGYGRQEDAHEFMRFAIDRMQL  287

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
              CL E  G +  C+   +T++I   FGG L+S++ C  C   S +HE +MDLTVEI GD 
Sbjct  288   ACLDEFGGEKAVCAHSRETTIIQHIFGGQLQSQVICTNCNNVSNQHENMMDLTVEIHGDA  347

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
             ASLE  L QFT  E L G+NKY C  C  Y KA K+L I +APN+LTIALKRFQSG+FGK
Sbjct  348   ASLEECLDQFTKIEWLHGDNKYKCDGCNDYVKASKRLTIKQAPNILTIALKRFQSGRFGK  407

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK + FPE L+L+ YMS   D+  +Y+LY V+ H D++NA+F GHY+CY+K+F   W++
Sbjct  408   LNKKVAFPETLDLSPYMSEAGDRKDVYRLYAVVVHVDMLNASFFGHYICYIKDFSGNWYR  467

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             ++D KV  V++E VLS+GAYM+LYSR  PR+  L
Sbjct  468   IDDCKVFKVDLEEVLSQGAYMILYSRVRPRSSSL  501


 Score = 55.8 bits (133),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            C  C +  S +CSRCKAVRYCS  CQ IHW+ GHK +C
Sbjct  78   CVVCGNLGSKKCSRCKAVRYCSPTCQEIHWKAGHKTKC  115



>ref|XP_002880603.1| ubiquitin carboxyl-terminal hydrolase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56862.1| ubiquitin carboxyl-terminal hydrolase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=650

 Score =   383 bits (983),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 183/354 (52%), Positives = 242/354 (68%), Gaps = 2/354 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE  V+ +N  +  + P GLTNCGNSC+AN VLQCL++T P  AY L+  H + C +
Sbjct  154   LFPYESLVRYYNWDRPIMAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECRR  213

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A +   P SP+ IIS L NIG +LG GR+EDAHE +R  I+ MQS
Sbjct  214   NDWCFFCEFENHLDRANHSRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRSAIDMMQS  273

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  274   VCLDEFGGEKVVPPRAQETTLIQYIFGGLLQSQVQCTACSNVSDQYENMMDLTVEIHGDA  333

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LTIALKRFQ G+FGK
Sbjct  334   VSLEECLDQFTAKEWLQGDNLYKCDRCDDYVKACKRLSIRCAPNILTIALKRFQGGRFGK  393

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FPE  +L  YMS   + S +Y+LY VI H D++NA+F GHY+CYVK+F+  W++
Sbjct  394   LNKRISFPETFDLGPYMSSGVEGSDVYKLYAVIVHLDMLNASFFGHYICYVKDFRGNWYR  453

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSS  3127
             ++DS+V+ VE+E VLS+ AYMLLYSR  PR P  +RS    D +    +N +S+
Sbjct  454   IDDSEVEKVELEDVLSQRAYMLLYSRVQPR-PSNLRSEEGQDEKKTDTLNTESN  506



>ref|XP_004157412.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Cucumis 
sativus]
Length=711

 Score =   385 bits (988),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 229/334 (69%), Gaps = 1/334 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ FV LF   K +  P GL NCGNSC+AN VLQCL+FT P  A+ L+  H   C +
Sbjct  168   LFPYDEFVDLFYWDKKDFHPCGLLNCGNSCFANVVLQCLSFTRPLFAFLLEKGHRNECVR  227

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEF++ V +A     P SP  II  L NIG +LG GR+EDAHEF+R+ I+ MQ 
Sbjct  228   DDWCFFCEFQTHVERASQNAQPFSPNNIILRLPNIGGNLGYGRQEDAHEFMRFAIDRMQL  287

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
              CL E  G +  C+   +T++I   FGG L+S++ C  C   S +HE +MDLTVEI GD 
Sbjct  288   ACLDEFGGEKAVCAHSRETTIIQHIFGGQLQSQVICTNCNNVSNQHENMMDLTVEIHGDA  347

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
             ASLE  L QFT  E L G+NKY C  C  Y KA K+L I +APN+LTIALKRFQSG+FGK
Sbjct  348   ASLEECLDQFTKIEWLHGDNKYKCDGCNDYVKASKRLTIKQAPNILTIALKRFQSGRFGK  407

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK + FPE L+L+ YMS   D+  +Y+LY V+ H D++NA+F GHY+CY+K+F   W++
Sbjct  408   LNKKVAFPETLDLSPYMSEAGDRKDVYRLYAVVVHVDMLNASFFGHYICYIKDFSGNWYR  467

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKL  3067
             ++D KV  V++E VLS+GAYM+LYSR  PR+  L
Sbjct  468   IDDCKVFKVDLEEVLSQGAYMILYSRVRPRSSSL  501


 Score = 55.8 bits (133),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            C  C +  S +CSRCKAVRYCS  CQ IHW+ GHK +C
Sbjct  78   CVVCGNLGSKKCSRCKAVRYCSPTCQEIHWKAGHKTKC  115



>ref|NP_564014.1| ubiquitin carboxyl-terminal hydrolase 15 [Arabidopsis thaliana]
 sp|Q9FPS9.2|UBP15_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 15; AltName: 
Full=Deubiquitinating enzyme 15; Short=AtUBP15; AltName: 
Full=Ubiquitin thioesterase 15; AltName: Full=Ubiquitin-specific-processing 
protease 15 [Arabidopsis thaliana]
 gb|AEE29542.1| ubiquitin carboxyl-terminal hydrolase 15 [Arabidopsis thaliana]
Length=924

 Score =   391 bits (1004),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 178/337 (53%), Positives = 236/337 (70%), Gaps = 2/337 (1%)
 Frame = +2

Query  2051  RYNN-KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGF  2227
             RY N K LFPYE F+K F  +  +L P GL NCGNSCYANAVLQ L  T P  AY L+  
Sbjct  411   RYKNLKMLFPYEEFLKFFQCEVFDLSPRGLVNCGNSCYANAVLQSLTCTKPLVAYLLRRS  470

Query  2228  HSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRY  2407
             HS+ C+ KDWC  CE E  V+  +    PLS  RI+SH+ +I   +G+G +EDAHEFLR 
Sbjct  471   HSRSCSGKDWCLMCELEQHVMMLRESGGPLSASRILSHMRSINCQIGDGSQEDAHEFLRL  530

Query  2408  VIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLT  2584
             ++ +MQS+CL+  G  T      ++T+L+   FGG LRSK++C+RC  +SER+E IMDLT
Sbjct  531   LVASMQSICLERLGGETKVDPRLQETTLVQHMFGGRLRSKVKCLRCDHESERYENIMDLT  590

Query  2585  VEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRF  2764
             +EI G + SL+ AL QFT  E LDGEN Y CSRC  Y +ARK+L I EAPN+LTI LKRF
Sbjct  591   LEIYGWVESLQDALTQFTRPEDLDGENMYRCSRCAGYVRARKELSIHEAPNILTIVLKRF  650

Query  2765  QSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKN  2944
             Q G++GK+NK I+FPE+L++  +M+ T D  P+Y LY VI H D +NA+FSGHY+ YVK+
Sbjct  651   QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  710

Query  2945  FQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
              +  W++++DS++ PV +  V+S+GAYML Y R  PR
Sbjct  711   LRGNWYRIDDSEIHPVPMTQVMSEGAYMLFYMRSYPR  747


 Score = 82.4 bits (202),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  632  PVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            PV     + CA+CF  A TRCSRCK+VRYCSGKCQIIHWR+ HKDEC P
Sbjct  121  PVNNNELHVCARCFGPAKTRCSRCKSVRYCSGKCQIIHWRVAHKDECVP  169



>ref|XP_006598163.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Glycine max]
Length=988

 Score =   392 bits (1007),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 180/334 (54%), Positives = 232/334 (69%), Gaps = 1/334 (0%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPY+ FVK+F S    + P GL NCGNSCYANAVLQCL  T P   Y L   HSK C
Sbjct  446   KMLFPYDEFVKIFQSDVFGIYPRGLLNCGNSCYANAVLQCLTSTKPLVIYLLYRSHSKAC  505

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
               KDWC  CE E  ++  +   +PLSP RI+ H+ +I   +G G +EDAHEFLR +I +M
Sbjct  506   CAKDWCLMCELEQHIMILRENGAPLSPSRILWHMRSINCHMGEGSQEDAHEFLRLLIASM  565

Query  2423  QSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QS+CL+  G         ++T+ I  TFGG L+SK++C+ C  +SER+E IMDLT+EI G
Sbjct  566   QSICLEGLGGEKKVDPRIQETTFIQHTFGGRLQSKVKCLNCNHESERYENIMDLTLEILG  625

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
              + SLE AL QFT  E LDGEN Y C RC SY +ARK+L I EAPN+LTI LKRFQ G++
Sbjct  626   WVESLEDALTQFTSPEDLDGENMYRCGRCTSYVRARKQLSIHEAPNILTIVLKRFQEGRY  685

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GK+NK ITFPE+L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  W
Sbjct  686   GKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKDLQGNW  745

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             F+++D++V+PV I  V+S+GAY+L Y R  PR P
Sbjct  746   FRIDDAEVQPVLINQVMSEGAYILFYMRSCPRPP  779


 Score = 72.8 bits (177),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH---PP  781
            CA+C + A TRCSRCK VRYCSG CQIIHWRL HK EC    PP
Sbjct  76   CARCSAPARTRCSRCKIVRYCSGNCQIIHWRLNHKQECQQLEPP  119



>emb|CDY45587.1| BnaA04g14540D [Brassica napus]
Length=633

 Score =   382 bits (981),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/355 (52%), Positives = 242/355 (68%), Gaps = 3/355 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV+ FN  K  L P GLTNCGNSC+AN VLQCL++T P  AY L+  H + C +
Sbjct  140   LFPYETFVQYFNWDKPGLAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECER  199

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEFE+ + +A     P SP+ IIS L NIG +LG GR+EDAHE +R+VI+ MQS
Sbjct  200   NDWCFLCEFETHLERANISRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFVIDMMQS  259

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD 
Sbjct  260   VCLDEFGGEKVVPPRAQETTLIQYIFGGLLQSQVQCTVCSNVSDQYENMMDLTVEIHGDA  319

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LT+ALKRFQ G+FGK
Sbjct  320   VSLEECLDQFTAKEWLQGDNLYKCDRCNDYVKACKRLSIRSAPNILTVALKRFQGGRFGK  379

Query  2786  LNKTITFPEILNLASYMSGT-SDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWF  2962
             LNK I+FPE  +L  YMS    + S +Y+LY VI H D++NA+F GHY+C VK+F+  W+
Sbjct  380   LNKRISFPETFDLGPYMSCCGGEGSDVYKLYAVIVHLDMLNASFFGHYICCVKDFRGDWY  439

Query  2963  KVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSS  3127
             +++DS+V+ VE+E VLS+ AYMLLYSR   R P  +RS    D +    V+ ++S
Sbjct  440   RIDDSEVEKVELEDVLSQRAYMLLYSRVQAR-PSSLRSEEVQDEKKTDTVDTEAS  493



>ref|XP_006598161.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Glycine max]
 ref|XP_006598162.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Glycine max]
Length=989

 Score =   392 bits (1007),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 180/334 (54%), Positives = 232/334 (69%), Gaps = 1/334 (0%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPY+ FVK+F S    + P GL NCGNSCYANAVLQCL  T P   Y L   HSK C
Sbjct  447   KMLFPYDEFVKIFQSDVFGIYPRGLLNCGNSCYANAVLQCLTSTKPLVIYLLYRSHSKAC  506

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
               KDWC  CE E  ++  +   +PLSP RI+ H+ +I   +G G +EDAHEFLR +I +M
Sbjct  507   CAKDWCLMCELEQHIMILRENGAPLSPSRILWHMRSINCHMGEGSQEDAHEFLRLLIASM  566

Query  2423  QSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QS+CL+  G         ++T+ I  TFGG L+SK++C+ C  +SER+E IMDLT+EI G
Sbjct  567   QSICLEGLGGEKKVDPRIQETTFIQHTFGGRLQSKVKCLNCNHESERYENIMDLTLEILG  626

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
              + SLE AL QFT  E LDGEN Y C RC SY +ARK+L I EAPN+LTI LKRFQ G++
Sbjct  627   WVESLEDALTQFTSPEDLDGENMYRCGRCTSYVRARKQLSIHEAPNILTIVLKRFQEGRY  686

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GK+NK ITFPE+L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  W
Sbjct  687   GKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKDLQGNW  746

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             F+++D++V+PV I  V+S+GAY+L Y R  PR P
Sbjct  747   FRIDDAEVQPVLINQVMSEGAYILFYMRSCPRPP  780


 Score = 72.8 bits (177),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH---PP  781
            CA+C + A TRCSRCK VRYCSG CQIIHWRL HK EC    PP
Sbjct  76   CARCSAPARTRCSRCKIVRYCSGNCQIIHWRLNHKQECQQLEPP  119



>gb|KHN29845.1| Ubiquitin carboxyl-terminal hydrolase 15 [Glycine soja]
Length=989

 Score =   392 bits (1006),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 180/334 (54%), Positives = 232/334 (69%), Gaps = 1/334 (0%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPY+ FVK+F S    + P GL NCGNSCYANAVLQCL  T P   Y L   HSK C
Sbjct  447   KMLFPYDEFVKIFQSDVFGIYPRGLLNCGNSCYANAVLQCLTSTKPLVIYLLYRSHSKAC  506

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
               KDWC  CE E  ++  +   +PLSP RI+ H+ +I   +G G +EDAHEFLR +I +M
Sbjct  507   CAKDWCLMCELEQHIMILRENGAPLSPSRILWHMRSINCHMGEGSQEDAHEFLRLLIASM  566

Query  2423  QSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QS+CL+  G         ++T+ I  TFGG L+SK++C+ C  +SER+E IMDLT+EI G
Sbjct  567   QSICLEGLGGEKKVDPRIQETTFIQHTFGGRLQSKVKCLNCNHESERYENIMDLTLEILG  626

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
              + SLE AL QFT  E LDGEN Y C RC SY +ARK+L I EAPN+LTI LKRFQ G++
Sbjct  627   WVESLEDALTQFTSPEDLDGENMYRCGRCTSYVRARKQLSIHEAPNILTIVLKRFQEGRY  686

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GK+NK ITFPE+L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  W
Sbjct  687   GKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKDLQGNW  746

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             F+++D++V+PV I  V+S+GAY+L Y R  PR P
Sbjct  747   FRIDDAEVQPVLINQVMSEGAYILFYMRSCPRPP  780


 Score = 71.6 bits (174),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH---PP  781
            CA+C   A TRCSRCK VRYCSG CQIIHWRL HK EC    PP
Sbjct  76   CARCSVPARTRCSRCKIVRYCSGNCQIIHWRLNHKQECQQLEPP  119



>ref|XP_009110426.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Brassica 
rapa]
 ref|XP_009110427.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Brassica 
rapa]
Length=892

 Score =   389 bits (1000),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 235/339 (69%), Gaps = 2/339 (1%)
 Frame = +2

Query  2045  GGRYNN-KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQ  2221
             G R+ N + LFPYE FVK F  +   L P GL NCGNSCYANAVLQ L  T P  AY LQ
Sbjct  384   GDRHQNLRMLFPYEEFVKFFQCEVFYLSPRGLVNCGNSCYANAVLQSLTCTKPLVAYLLQ  443

Query  2222  GFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFL  2401
               HS+ C+ KDWC  CE E  V+  +    PLS  RI+S + +I   +G+G +EDAHEFL
Sbjct  444   RSHSRSCSGKDWCLMCELEQHVMMLRESGGPLSASRILSQMRSINCQIGDGSQEDAHEFL  503

Query  2402  RYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMD  2578
             R ++ +MQS+CL+  G  T      ++T+L+   FGG LRSK++C+RCG +SER+E IMD
Sbjct  504   RLLVASMQSICLERLGGETKVDTRLQETTLVQHMFGGRLRSKVKCLRCGHESERYENIMD  563

Query  2579  LTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALK  2758
             LT+EI G + SL+ AL QFT  E LDGEN Y CSRC  Y KARK+L I EAPN+LTI LK
Sbjct  564   LTLEIYGWVESLQDALTQFTRPEDLDGENMYRCSRCAGYVKARKELSIHEAPNILTIVLK  623

Query  2759  RFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYV  2938
             RFQ G++GK+NK I+FPE+L++  +M+ T D  P+Y LY VI H D +NA+FSGHY+ YV
Sbjct  624   RFQEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYV  683

Query  2939  KNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             K+ +  WF+++DS++  V +  V+S+GAYML Y R  PR
Sbjct  684   KDLRGNWFRIDDSEIHQVPMTQVMSEGAYMLFYMRSYPR  722


 Score = 85.5 bits (210),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +2

Query  629  VPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            VPV+ +  + CA+CFS A TRCSRCK+VRYCSG+CQIIHWRL HKDEC P
Sbjct  117  VPVSNEF-HVCARCFSPAKTRCSRCKSVRYCSGQCQIIHWRLAHKDECIP  165



>ref|XP_008781931.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782004.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782081.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782141.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782218.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782299.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782368.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782443.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782523.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782596.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
Length=966

 Score =   391 bits (1004),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/333 (53%), Positives = 235/333 (71%), Gaps = 1/333 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE  VK F+ K   + P GL NCGNSCYANAVLQCL +T P   Y LQ  HS+ C  
Sbjct  438   LFPYEDLVKFFHCKVGGIAPRGLLNCGNSCYANAVLQCLTYTKPLMVYLLQRPHSRTCRV  497

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             KDWC  CE E  V   + G  P SP RI+S++ NIG  +G G +EDAHEFLR+++ +MQS
Sbjct  498   KDWCLMCELEQHVSMLREGGGPSSPSRILSNMRNIGCRMGGGNQEDAHEFLRFLVMSMQS  557

Query  2429  VCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
              CL+E G       + ++T+L+   FGG L+SK++C+RC  +SER+E IMDLT+EI G +
Sbjct  558   TCLEEFGGEKQVDPKLQETTLVQQIFGGRLKSKVKCLRCHIESERYENIMDLTLEIHGWV  617

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE AL QFT  E LDGEN Y C RC +Y  ARK+L I E PN+LTI LKRFQ+G +GK
Sbjct  618   ESLEDALTQFTAPEDLDGENMYRCGRCSAYVNARKQLTIHEVPNILTIVLKRFQTGNYGK  677

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +NK +TFP++L++  +++GT+D  P+Y LY V+ H D +NA+FSGHY+ YVK+ Q  WF+
Sbjct  678   INKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYISYVKDLQGTWFR  737

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPK  3064
             ++DS+V+ V +  V+S+GAYML YSR  PR P+
Sbjct  738   IDDSEVQAVPLSQVMSEGAYMLFYSRSFPRPPR  770


 Score = 84.3 bits (207),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 65/122 (53%), Gaps = 6/122 (5%)
 Frame = +2

Query  653   YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHPPVNNNHDSYGKGANDFKV  832
             ++CA+CF+ A+TRCSRCK+VRYCSGKCQIIHWRLGHK EC        D+    + D  +
Sbjct  74    HECARCFAPATTRCSRCKSVRYCSGKCQIIHWRLGHKQECQ----QWQDTSSNDSGDLSL  129

Query  833   FRQEANEGYAEGIETEERNT--PGSIDASFAEPTCSEPSISGAENTEDVMEGKHFTDDGT  1006
                     + +G+++    +    S+         S+P +   + ++D   G+  +D   
Sbjct  130   TEALQQNSHFDGLKSSVLGSDFEESLHGDLLGNVSSDPCVMKIDASQDPAAGRKLSDKRA  189

Query  1007  TN  1012
              N
Sbjct  190   LN  191



>ref|NP_001189593.1| ubiquitin carboxyl-terminal hydrolase 19 [Arabidopsis thaliana]
 dbj|BAH57217.1| AT2G24640 [Arabidopsis thaliana]
 gb|AEC07608.1| ubiquitin carboxyl-terminal hydrolase 19 [Arabidopsis thaliana]
Length=502

 Score =   377 bits (967),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 185/367 (50%), Positives = 245/367 (67%), Gaps = 4/367 (1%)
 Frame = +2

Query  2120  LRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAK  2299
             + P GLTNCGNSC+AN VLQCL++T P  AY L+  H + C + DWCF CEFE+ + +A 
Sbjct  1     MAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECRRNDWCFLCEFENHLDRAN  60

Query  2300  NGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQSVCLKE-AGVRTSCSLEE  2476
                 P SP+ IIS L NIG +LG GR+EDAHE +R+ I+ MQSVCL E  G +      +
Sbjct  61    YSRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFAIDMMQSVCLDEFGGEKVVPPRAQ  120

Query  2477  QTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDIASLEGALRQFTHTEILD  2656
             +T+LI   FGG L+S+++C  C   S+++E +MDLTVEI GD  SLE  L QFT  E L 
Sbjct  121   ETTLIQYIFGGLLQSQVQCTACSNVSDQYENMMDLTVEIHGDAVSLEECLDQFTAKEWLQ  180

Query  2657  GENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGKLNKTITFPEILNLASYM  2836
             G+N Y C RC  Y KA K+L I  APN+LTIALKRFQ G+FGKLNK I+FPE  +L  YM
Sbjct  181   GDNLYKCDRCDDYVKACKRLSIRCAPNILTIALKRFQGGRFGKLNKRISFPETFDLGPYM  240

Query  2837  SGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSK  3016
             SG  + S +Y+LY VI H D++NA+F GHY+CYVK+F+  W++++DS+V+ VE+E VLS+
Sbjct  241   SGGGEGSDVYKLYAVIVHLDMLNASFFGHYICYVKDFRGNWYRIDDSEVEKVELEDVLSQ  300

Query  3017  GAYMLLYSRCSPRAPKLIRSLTSHDPRGQKYVNCKSSSHTNSWDLSKGDSTNDPACRECF  3196
              AYMLLYSR  PR P  +RS  S D +    +N +S+   +    S G  TND +     
Sbjct  301   RAYMLLYSRVQPR-PSNLRSEESQDEKKTDTLNTESNQDGSVE--SSGVGTNDTSVSSLC  357

Query  3197  NSVQASS  3217
             N + + S
Sbjct  358   NGIISHS  364



>gb|KHN47474.1| Ubiquitin carboxyl-terminal hydrolase 15 [Glycine soja]
Length=986

 Score =   391 bits (1005),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 178/332 (54%), Positives = 230/332 (69%), Gaps = 1/332 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ FVK+F S    + P GL NCGNSCYANAVLQCL  T P   Y L   HSK C  
Sbjct  447   LFPYDEFVKIFQSDVFGIYPRGLLNCGNSCYANAVLQCLTSTKPLVVYLLYRSHSKACCA  506

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             KDWC  CE E  ++  +    PLSP RI+ H+ +I   +G G +EDAHEFLR +I +MQS
Sbjct  507   KDWCLMCELEKHIMVLRENGDPLSPSRILWHMRSINCHMGEGNQEDAHEFLRLLIASMQS  566

Query  2429  VCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             +CL+  G         ++T+ I  TFGG L+SK++C++C  +SER+E IMDLT+EI G +
Sbjct  567   ICLEALGGEKKVDPRLQETTFIQHTFGGRLQSKVKCLKCNHESERYENIMDLTLEILGWV  626

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE AL QFT  E LDGEN Y C RC SY +ARK+L I EAPN+LTI LKRFQ G++GK
Sbjct  627   ESLEDALTQFTSPEDLDGENMYRCGRCTSYVRARKQLSIHEAPNILTIVLKRFQEGRYGK  686

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +NK ITFPE+L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  WF+
Sbjct  687   INKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKDLQGNWFR  746

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             ++D +V+PV +  V+S+GAY+L Y R  PR P
Sbjct  747   IDDIEVQPVLVNQVMSEGAYILFYMRSCPRPP  778


 Score = 71.6 bits (174),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            CA+C + A TRCSRCK VRYCSG CQIIHWRL HK EC
Sbjct  76   CARCSAPARTRCSRCKIVRYCSGNCQIIHWRLIHKQEC  113



>ref|XP_007149328.1| hypothetical protein PHAVU_005G061400g [Phaseolus vulgaris]
 gb|ESW21322.1| hypothetical protein PHAVU_005G061400g [Phaseolus vulgaris]
Length=978

 Score =   391 bits (1004),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 232/334 (69%), Gaps = 1/334 (0%)
 Frame = +2

Query  2063  KGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGC  2242
             K LFPY+ FVK+F S    + P GL NCGNSCYANAVLQCL  T P   Y L   HSK C
Sbjct  437   KMLFPYDEFVKIFQSDIFGICPRGLLNCGNSCYANAVLQCLTSTKPLVVYLLYRSHSKSC  496

Query  2243  AKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETM  2422
               KDWC  CE E  ++  +   +PLSP RI+ H+ +I   +G G +EDAHEFLR +I +M
Sbjct  497   CAKDWCLMCELEQHIMILRENGAPLSPSRILWHMRSINCQMGEGSQEDAHEFLRLLIASM  556

Query  2423  QSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDG  2599
             QS+CL+  G         ++T+ I  TFGG L+SK++C+ C  +SER+E IMDLT+EI G
Sbjct  557   QSICLEGLGGEKKVDPRLQETTFIQHTFGGRLQSKVKCLNCNHESERYENIMDLTLEILG  616

Query  2600  DIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKF  2779
              + SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPN+LTI LKRFQ G++
Sbjct  617   WVESLEDALTQFTSPEDLDGENMYRCGRCTAYVRARKQLSIHEAPNILTIVLKRFQEGRY  676

Query  2780  GKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKW  2959
             GK+NK ITFPE+L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  W
Sbjct  677   GKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKDLQGNW  736

Query  2960  FKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             F+++D++V+PV I  V+S+GAY+L Y R  PR P
Sbjct  737   FRIDDTEVQPVLINQVMSEGAYILFYMRSCPRPP  770


 Score = 72.0 bits (175),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  653  YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            ++CA+C + A TRCS+CK+VRYCSG CQIIHWRL HK EC 
Sbjct  74   HECARCSAPARTRCSKCKSVRYCSGNCQIIHWRLVHKQECQ  114



>dbj|BAD44466.1| unknown protein [Arabidopsis thaliana]
Length=631

 Score =   380 bits (977),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/331 (53%), Positives = 231/331 (70%), Gaps = 1/331 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV+ FN    EL P GL NCGNSC+AN +LQCL++T P  AY L+  H + C +
Sbjct  148   LFPYEEFVEYFNWDNPELAPCGLMNCGNSCFANVILQCLSWTRPLVAYLLEKGHKRECMR  207

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEF++ V +A     P SP+ IIS L NIG +LG GR+EDAHEF+RY I+ MQS
Sbjct  208   NDWCFLCEFQTHVERASQSRFPFSPMNIISRLTNIGGTLGYGRQEDAHEFMRYAIDMMQS  267

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDL VE+ GD 
Sbjct  268   VCLDEFGGEKIVPPRSQETTLIQYIFGGLLQSQVQCTVCNHVSDQYENMMDLIVEMHGDA  327

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LTIALKR+Q G++GK
Sbjct  328   GSLEECLDQFTAEEWLHGDNMYKCDRCSDYVKACKRLTIRRAPNILTIALKRYQGGRYGK  387

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FPE L+L  YMS   D S +Y+LY VI H D++NA+F GHY+CY+K+F   W++
Sbjct  388   LNKRISFPETLDLNPYMSEGGDGSDVYKLYAVIVHLDMLNASFFGHYICYIKDFCGNWYR  447

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRA  3058
             ++DS+++ VE+E VLS+ AYMLLYSR   R+
Sbjct  448   IDDSEIESVELEDVLSQRAYMLLYSRIQARS  478



>ref|NP_194895.1| ubiquitin carboxyl-terminal hydrolase 18 [Arabidopsis thaliana]
 sp|Q67XW5.2|UBP18_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 18; AltName: 
Full=Deubiquitinating enzyme 18; Short=AtUBP18; AltName: 
Full=Ubiquitin thioesterase 18; AltName: Full=Ubiquitin-specific-processing 
protease 18 [Arabidopsis thaliana]
 emb|CAA19756.1| putative protein [Arabidopsis thaliana]
 emb|CAB79885.1| putative protein [Arabidopsis thaliana]
 gb|AAN13075.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85943.1| ubiquitin carboxyl-terminal hydrolase 18 [Arabidopsis thaliana]
Length=631

 Score =   380 bits (977),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/331 (53%), Positives = 231/331 (70%), Gaps = 1/331 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV+ FN    EL P GL NCGNSC+AN +LQCL++T P  AY L+  H + C +
Sbjct  148   LFPYEEFVEYFNWDNPELAPCGLMNCGNSCFANVILQCLSWTRPLVAYLLEKGHKRECMR  207

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEF++ V +A     P SP+ IIS L NIG +LG GR+EDAHEF+RY I+ MQS
Sbjct  208   NDWCFLCEFQTHVERASQSRFPFSPMNIISRLTNIGGTLGYGRQEDAHEFMRYAIDMMQS  267

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDL VE+ GD 
Sbjct  268   VCLDEFGGEKIVPPRSQETTLIQYIFGGLLQSQVQCTVCNHVSDQYENMMDLIVEMHGDA  327

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LTIALKR+Q G++GK
Sbjct  328   GSLEECLDQFTAEEWLHGDNMYKCDRCSDYVKACKRLTIRRAPNILTIALKRYQGGRYGK  387

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FPE L+L  YMS   D S +Y+LY VI H D++NA+F GHY+CY+K+F   W++
Sbjct  388   LNKRISFPETLDLNPYMSEGGDGSDVYKLYAVIVHLDMLNASFFGHYICYIKDFCGNWYR  447

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRA  3058
             ++DS+++ VE+E VLS+ AYMLLYSR   R+
Sbjct  448   IDDSEIESVELEDVLSQRAYMLLYSRIQARS  478



>ref|XP_010092717.1| Ubiquitin carboxyl-terminal hydrolase 15 [Morus notabilis]
 gb|EXB52062.1| Ubiquitin carboxyl-terminal hydrolase 15 [Morus notabilis]
Length=1009

 Score =   391 bits (1005),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 180/349 (52%), Positives = 240/349 (69%), Gaps = 2/349 (1%)
 Frame = +2

Query  2036  SEIGG-RYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAY  2212
             SE+G  R+  K LFPYE FV  F  +  +L P GL NCGNSCYANAVLQCL  T P   Y
Sbjct  456   SEVGADRHKIKMLFPYEEFVTYFQCEVFDLSPRGLLNCGNSCYANAVLQCLTSTKPLIIY  515

Query  2213  FLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAH  2392
              L+  HS+ C  KDWC  CE E  V+  +    PLSP RI+ H+ +I   +G G +EDAH
Sbjct  516   LLRRSHSRACCDKDWCLMCELEQHVIMLREIGGPLSPSRILLHMRSINCHIGEGSQEDAH  575

Query  2393  EFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHER  2569
             EFLR ++ +MQ++CL+  G         ++T+ I  TFGG LRSK++C+RC  +SER+E 
Sbjct  576   EFLRLLVASMQAICLEGLGGEKKVDPRLQETTFIQHTFGGHLRSKVKCLRCHHESERYEN  635

Query  2570  IMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTI  2749
             IMDLT+EI G + SLE AL QFT  E LDGEN Y C RC +Y +ARK+L I EAPN++TI
Sbjct  636   IMDLTLEIFGWVESLEDALTQFTTPEDLDGENMYRCGRCATYVRARKQLSIHEAPNIMTI  695

Query  2750  ALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYV  2929
              LKRFQ G++GK+NK ITFP++L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV
Sbjct  696   VLKRFQEGRYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYAVVVHLDTLNASFSGHYV  755

Query  2930  CYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRS  3076
              YVK+ Q  WF+++D++V+PV +  V+S+GAY+L Y R  PR  + + S
Sbjct  756   SYVKDLQGNWFRIDDTEVQPVPMSQVMSEGAYILFYMRSCPRPQRALSS  804


 Score = 77.8 bits (190),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  653  YQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECH  775
            + CA+CFS A+TRCSRCK+VRYCSGKCQIIHWR  HK EC 
Sbjct  109  HSCARCFSPATTRCSRCKSVRYCSGKCQIIHWREVHKQECQ  149



>ref|XP_006594689.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Glycine max]
Length=989

 Score =   390 bits (1003),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 178/332 (54%), Positives = 230/332 (69%), Gaps = 1/332 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ FVK+F S    + P GL NCGNSCYANAVLQCL  T P   Y L   HSK C  
Sbjct  450   LFPYDEFVKIFQSDVFGIYPRGLLNCGNSCYANAVLQCLTSTKPLVVYLLYRSHSKACCA  509

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             KDWC  CE E  ++  +    PLSP RI+ H+ +I   +G G +EDAHEFLR +I +MQS
Sbjct  510   KDWCLMCELEKHIMVLRENGDPLSPSRILWHMRSINCHMGEGNQEDAHEFLRLLIASMQS  569

Query  2429  VCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             +CL+  G         ++T+ I  TFGG L+SK++C++C  +SER+E IMDLT+EI G +
Sbjct  570   ICLEALGGEKKVDPRLQETTFIQHTFGGRLQSKVKCLKCNHESERYENIMDLTLEILGWV  629

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE AL QFT  E LDGEN Y C RC SY +ARK+L I EAPN+LTI LKRFQ G++GK
Sbjct  630   ESLEDALTQFTSPEDLDGENMYRCGRCTSYVRARKQLSIHEAPNILTIVLKRFQEGRYGK  689

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +NK ITFPE+L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  WF+
Sbjct  690   INKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKDLQGNWFR  749

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             ++D +V+PV +  V+S+GAY+L Y R  PR P
Sbjct  750   IDDIEVQPVLVNQVMSEGAYILFYMRSCPRPP  781


 Score = 71.2 bits (173),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            CA+C + A TRCSRCK VRYCSG CQIIHWRL HK EC
Sbjct  76   CARCSAPARTRCSRCKIVRYCSGNCQIIHWRLIHKQEC  113



>emb|CDX68773.1| BnaC01g06800D [Brassica napus]
Length=614

 Score =   380 bits (975),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 180/340 (53%), Positives = 232/340 (68%), Gaps = 1/340 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV+ FN     L P GL NCGNSC+AN +LQCL++T P  AY L+  H   C +
Sbjct  133   LFPYEEFVRYFNWDNTVLAPCGLMNCGNSCFANVILQCLSWTRPLVAYLLERGHRSECMR  192

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF C F++ V +A     P SP+ IIS L NIG +LG GR+EDAHEF+RY I+TMQS
Sbjct  193   DDWCFFCAFQTHVERASQSRYPFSPVNIISRLTNIGGTLGYGRQEDAHEFMRYAIDTMQS  252

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E  G +      ++T+L+   FGG L+S+++C  C   SE++E +MDLTVEI GD 
Sbjct  253   VCLDEFGGEKMVPPRSQETTLVQYIFGGLLQSQVQCTVCNNVSEQYENMMDLTVEIHGDA  312

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I   PNVLTIALKRF+ G++GK
Sbjct  313   VSLEECLDQFTVKEWLQGDNMYKCDRCNDYVKACKRLTIRRPPNVLTIALKRFKGGRYGK  372

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FPE L+L  YMS   + S +Y+LY VI H D++NA+F GHY+CY+K+F   W++
Sbjct  373   LNKRISFPETLDLRPYMSQGGEGSDVYKLYAVIVHLDMLNASFFGHYICYIKDFSGNWYR  432

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPKLIRSLTS  3085
             V+DS+++ VE+E VLS+ AYMLLYSR   R+     SL S
Sbjct  433   VDDSEIESVELEDVLSQRAYMLLYSRIQTRSSLPCASLGS  472



>ref|XP_003541793.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Glycine max]
 ref|XP_006594688.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Glycine max]
Length=990

 Score =   390 bits (1003),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 178/332 (54%), Positives = 230/332 (69%), Gaps = 1/332 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY+ FVK+F S    + P GL NCGNSCYANAVLQCL  T P   Y L   HSK C  
Sbjct  451   LFPYDEFVKIFQSDVFGIYPRGLLNCGNSCYANAVLQCLTSTKPLVVYLLYRSHSKACCA  510

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             KDWC  CE E  ++  +    PLSP RI+ H+ +I   +G G +EDAHEFLR +I +MQS
Sbjct  511   KDWCLMCELEKHIMVLRENGDPLSPSRILWHMRSINCHMGEGNQEDAHEFLRLLIASMQS  570

Query  2429  VCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             +CL+  G         ++T+ I  TFGG L+SK++C++C  +SER+E IMDLT+EI G +
Sbjct  571   ICLEALGGEKKVDPRLQETTFIQHTFGGRLQSKVKCLKCNHESERYENIMDLTLEILGWV  630

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE AL QFT  E LDGEN Y C RC SY +ARK+L I EAPN+LTI LKRFQ G++GK
Sbjct  631   ESLEDALTQFTSPEDLDGENMYRCGRCTSYVRARKQLSIHEAPNILTIVLKRFQEGRYGK  690

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +NK ITFPE+L++  +M+GT D  P+Y LY V+ H D +NA+FSGHYV YVK+ Q  WF+
Sbjct  691   INKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKDLQGNWFR  750

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPRAP  3061
             ++D +V+PV +  V+S+GAY+L Y R  PR P
Sbjct  751   IDDIEVQPVLVNQVMSEGAYILFYMRSCPRPP  782


 Score = 71.2 bits (173),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDEC  772
            CA+C + A TRCSRCK VRYCSG CQIIHWRL HK EC
Sbjct  76   CARCSAPARTRCSRCKIVRYCSGNCQIIHWRLIHKQEC  113



>emb|CDX96790.1| BnaA08g23330D [Brassica napus]
Length=835

 Score =   386 bits (992),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 181/349 (52%), Positives = 238/349 (68%), Gaps = 6/349 (2%)
 Frame = +2

Query  2012  RHNSLGAWSEIGGRYNNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAF  2191
             RH +L + S I      + +FPYE FVK F  +   L P GL NCGNSCYANAVLQ L  
Sbjct  342   RHQNLRSMSLIF-----QMIFPYEEFVKFFQCEVFYLSPRGLVNCGNSCYANAVLQSLTC  396

Query  2192  TPPFTAYFLQGFHSKGCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGN  2371
             T P  AY LQ  HS+ C+ KDWC  CE E  V+  +    PLS  RI+S + +I   +G+
Sbjct  397   TKPLVAYLLQRSHSRSCSGKDWCLMCELEQHVMMLRESGGPLSASRILSQMRSINCQIGD  456

Query  2372  GREEDAHEFLRYVIETMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGG  2548
             G +EDAHEFLR ++ +MQS+CL+  G  T      ++T+L+   FGG LRSK++C+RCG 
Sbjct  457   GSQEDAHEFLRLLVASMQSICLERLGGETKVDPRLQETTLVQHMFGGRLRSKVKCLRCGH  516

Query  2549  KSERHERIMDLTVEIDGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILE  2728
             +SER+E IMDLT+EI G + SL+ AL QFT  E LDGEN Y CSRC  Y KARK+L I E
Sbjct  517   ESERYENIMDLTLEIYGWVESLQDALTQFTRPEDLDGENMYRCSRCAGYVKARKELSIHE  576

Query  2729  APNVLTIALKRFQSGKFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNA  2908
             APN+LTI LKRFQ G++GK+NK I+FPE+L++  +M+ T D  P+Y LY VI H D +NA
Sbjct  577   APNILTIVLKRFQEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNA  636

Query  2909  AFSGHYVCYVKNFQNKWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             +FSGHY+ YVK+ +  WF+++DS++  V +  V+S+GAYML Y R  PR
Sbjct  637   SFSGHYISYVKDLRGNWFRIDDSEIHQVPMTQVMSEGAYMLFYMRSYPR  685


 Score = 85.5 bits (210),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +2

Query  629  VPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            VPV+ +  + CA+CFS A TRCSRCK+VRYCSG+CQIIHWRL HKDEC P
Sbjct  72   VPVSNEF-HVCARCFSPAKTRCSRCKSVRYCSGQCQIIHWRLAHKDECIP  120



>ref|XP_002867287.1| ubiquitin carboxyl-terminal hydrolase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH43546.1| ubiquitin carboxyl-terminal hydrolase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=618

 Score =   380 bits (975),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 178/350 (51%), Positives = 238/350 (68%), Gaps = 2/350 (1%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FV+ FN    EL P GL NCGNSC+AN +LQCL++T P  AY L+  H + C  
Sbjct  148   LFPYEEFVEYFNWDNPELAPCGLMNCGNSCFANVILQCLSWTRPLVAYLLEKGHKRECMH  207

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CEF++ V +A     P SP+ IIS L NIG +LG GR+EDAHEF+RY I+ MQS
Sbjct  208   NDWCFFCEFQTHVERASQSRFPFSPMNIISRLTNIGGTLGYGRQEDAHEFMRYAIDMMQS  267

Query  2429  VCLKE-AGVRTSCSLEEQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL+E  G +      ++T+LI   FGG L+S+++C  C   S+++E +MDL VE+ GD 
Sbjct  268   VCLEEFGGEKIVPPRSQETTLIQYIFGGLLQSQVQCTVCNHVSDQYENMMDLIVEMHGDA  327

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SLE  L QFT  E L G+N Y C RC  Y KA K+L I  APN+LTIALKR+Q G++GK
Sbjct  328   VSLEECLDQFTAEEWLHGDNMYKCDRCSDYVKACKRLTIWRAPNILTIALKRYQGGRYGK  387

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK I+FP  L+L  YMS   D S +Y+LY VI H D++NA+F GHY+CY+K+F   W++
Sbjct  388   LNKRISFPATLDLNPYMSEGGDGSDVYKLYAVIVHLDMLNASFFGHYICYIKDFCGNWYR  447

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPR-APKLIRSLTSHDPRGQKYV  3112
             ++DS+++ VE+E VLS+ AYMLLYSR   R +   +RS    + + + +V
Sbjct  448   IDDSEIESVELEDVLSQRAYMLLYSRIQARSSSSCLRSEVQDEKKTESFV  497



>gb|KHG15081.1| Ubiquitin carboxyl-terminal hydrolase 19 -like protein [Gossypium 
arboreum]
Length=560

 Score =   377 bits (969),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 237/359 (66%), Gaps = 14/359 (4%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPY  FV+LFN +K   RP GL NCGNSC+AN VLQCLA T P  AY L+  H K C +
Sbjct  70    LFPYNEFVELFNWEKPGFRPCGLLNCGNSCFANVVLQCLASTRPLVAYLLEKGHRKECRR  129

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
              DWCF CE ++ + ++   + P SP  I+S L NIG +LG GR+EDAHEF+R+ I+TMQS
Sbjct  130   NDWCFLCELQTHIERSSQSHHPFSPTNILSRLPNIGGNLGYGRQEDAHEFMRFAIDTMQS  189

Query  2429  VCLKEAGVRTSCSLEEQ-TSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             VCL E G   +     Q T+LI   FGG L+S++ C  C   S + E +MDLTVEI+GD 
Sbjct  190   VCLDEFGGEKAVDHSSQETTLIQHIFGGHLQSQVICTNCNKISNQCENMMDLTVEINGDA  249

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
             +SLE  L QFT  E L GEN Y C  C  Y KA K+L I  APN+LTIALKRF+SG+FGK
Sbjct  250   SSLEECLDQFTVKEWLHGENMYKCDGCNDYVKASKRLTIRWAPNILTIALKRFESGRFGK  309

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             LNK ++FPE L+L SYMSG  D + +Y+LY V+ H D++NA+F GHY+CY ++F   W++
Sbjct  310   LNKRVSFPETLDLTSYMSGDGDDTNVYKLYAVVVHLDMLNASFFGHYICYTQDFNGNWYR  369

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPR-------------APKLIRSLTSHDPRGQ  3103
             ++D KV  VE+  VLS+ AYMLLYSR S R               K I++L  H P+ Q
Sbjct  370   IDDCKVMRVELAEVLSQVAYMLLYSRVSVRPSCLRTSGTQGNDEEKSIKALVEHCPKQQ  428



>ref|XP_010459276.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Camelina sativa]
Length=921

 Score =   389 bits (998),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 178/337 (53%), Positives = 234/337 (69%), Gaps = 1/337 (0%)
 Frame = +2

Query  2057  NNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSK  2236
             N K LFPYE F+K F  +  +L P GL NCGNSCYANAVLQ L  T P  AY L+  HS+
Sbjct  406   NLKMLFPYEEFLKFFQCEVFDLSPRGLVNCGNSCYANAVLQSLTCTKPLVAYLLRRSHSR  465

Query  2237  GCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIE  2416
              C+ KDWC  CE E  V+  +    PLS  RI+SH+ +I   +G+G +EDAHEFLR ++ 
Sbjct  466   SCSGKDWCLMCELEQHVMMLRESGGPLSASRILSHMRSINCQIGDGSQEDAHEFLRLLVA  525

Query  2417  TMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEI  2593
             +MQS+CL+  G  T      ++T+L+   FGG LRSK++C+RC  +SER+E IMDLT+EI
Sbjct  526   SMQSICLERLGGETKVDPRLQETTLVQHMFGGRLRSKVKCLRCDHESERYENIMDLTLEI  585

Query  2594  DGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSG  2773
              G + SL+ AL QFT  E LDGEN Y CSRC  Y +ARK+L I EAPN+LTI LKRFQ G
Sbjct  586   YGWVESLQDALTQFTRPEDLDGENMYRCSRCAGYVRARKELSIHEAPNILTIVLKRFQEG  645

Query  2774  KFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQN  2953
             K+GK+NK ITFPE+L++  +M+ T D  P+Y LY VI H D +NA+FSGHY+ YVK+ + 
Sbjct  646   KYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKDLRG  705

Query  2954  KWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPK  3064
              W++++DS++  V +  V+S+GAYML Y R  PR  K
Sbjct  706   NWYRIDDSEIHRVPMTQVMSEGAYMLFYMRSCPRPQK  742


 Score = 82.4 bits (202),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  632  PVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            P+     + CA+CF  A TRCSRCK+VRYCSGKCQIIHWRL HKDEC P
Sbjct  121  PLNNNELHVCAKCFGPAKTRCSRCKSVRYCSGKCQIIHWRLAHKDECVP  169



>ref|XP_010498051.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Camelina 
sativa]
Length=926

 Score =   389 bits (998),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 178/337 (53%), Positives = 234/337 (69%), Gaps = 1/337 (0%)
 Frame = +2

Query  2057  NNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSK  2236
             N K LFPYE F+K F  +  +L P GL NCGNSCYANAVLQ L  T P  AY L+  HS+
Sbjct  411   NLKMLFPYEEFIKFFQCEVFDLSPRGLVNCGNSCYANAVLQSLTCTKPLVAYLLRRSHSR  470

Query  2237  GCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIE  2416
              C+ KDWC  CE E  V+  +    PLS  RI+SH+ +I   +G+G +EDAHEFLR ++ 
Sbjct  471   SCSGKDWCLMCELEQHVMMLRESGGPLSASRILSHMRSINCQIGDGSQEDAHEFLRLLVA  530

Query  2417  TMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEI  2593
             +MQS+CL+  G  T      ++T+L+   FGG LRSK++C+RC  +SER+E IMDLT+EI
Sbjct  531   SMQSICLERLGGETKVDPRLQETTLVQHMFGGRLRSKVKCLRCDHESERYENIMDLTLEI  590

Query  2594  DGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSG  2773
              G + SL+ AL QFT  E LDGEN Y CSRC  Y +ARK+L I EAPN+LTI LKRFQ G
Sbjct  591   YGWVESLQDALTQFTRPEDLDGENMYRCSRCAGYVRARKELSIHEAPNILTIVLKRFQEG  650

Query  2774  KFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQN  2953
             K+GK+NK ITFPE+L++  +M+ T D  P+Y LY VI H D +NA+FSGHY+ YVK+ + 
Sbjct  651   KYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKDLRG  710

Query  2954  KWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPK  3064
              W++++DS++  V +  V+S+GAYML Y R  PR  K
Sbjct  711   NWYRIDDSEIHRVPMTQVMSEGAYMLFYMRSCPRPQK  747


 Score = 82.4 bits (202),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  659  CAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            CA+CF  A TRCSRCK+VRYCSGKCQIIHWRL HKDEC P
Sbjct  130  CAKCFGPAKTRCSRCKSVRYCSGKCQIIHWRLAHKDECIP  169



>ref|XP_010459274.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Camelina sativa]
 ref|XP_010459275.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Camelina sativa]
Length=931

 Score =   389 bits (998),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 178/337 (53%), Positives = 234/337 (69%), Gaps = 1/337 (0%)
 Frame = +2

Query  2057  NNKGLFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSK  2236
             N K LFPYE F+K F  +  +L P GL NCGNSCYANAVLQ L  T P  AY L+  HS+
Sbjct  416   NLKMLFPYEEFLKFFQCEVFDLSPRGLVNCGNSCYANAVLQSLTCTKPLVAYLLRRSHSR  475

Query  2237  GCAKKDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIE  2416
              C+ KDWC  CE E  V+  +    PLS  RI+SH+ +I   +G+G +EDAHEFLR ++ 
Sbjct  476   SCSGKDWCLMCELEQHVMMLRESGGPLSASRILSHMRSINCQIGDGSQEDAHEFLRLLVA  535

Query  2417  TMQSVCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEI  2593
             +MQS+CL+  G  T      ++T+L+   FGG LRSK++C+RC  +SER+E IMDLT+EI
Sbjct  536   SMQSICLERLGGETKVDPRLQETTLVQHMFGGRLRSKVKCLRCDHESERYENIMDLTLEI  595

Query  2594  DGDIASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSG  2773
              G + SL+ AL QFT  E LDGEN Y CSRC  Y +ARK+L I EAPN+LTI LKRFQ G
Sbjct  596   YGWVESLQDALTQFTRPEDLDGENMYRCSRCAGYVRARKELSIHEAPNILTIVLKRFQEG  655

Query  2774  KFGKLNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQN  2953
             K+GK+NK ITFPE+L++  +M+ T D  P+Y LY VI H D +NA+FSGHY+ YVK+ + 
Sbjct  656   KYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKDLRG  715

Query  2954  KWFKVNDSKVKPVEIESVLSKGAYMLLYSRCSPRAPK  3064
              W++++DS++  V +  V+S+GAYML Y R  PR  K
Sbjct  716   NWYRIDDSEIHRVPMTQVMSEGAYMLFYMRSCPRPQK  752


 Score = 82.8 bits (203),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  632  PVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            P+     + CA+CF  A TRCSRCK+VRYCSGKCQIIHWRL HKDEC P
Sbjct  121  PLNNNELHVCAKCFGPAKTRCSRCKSVRYCSGKCQIIHWRLAHKDECVP  169



>emb|CDX83925.1| BnaC08g17200D [Brassica napus]
Length=847

 Score =   386 bits (992),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 177/330 (54%), Positives = 230/330 (70%), Gaps = 1/330 (0%)
 Frame = +2

Query  2069  LFPYELFVKLFNSKKVELRPFGLTNCGNSCYANAVLQCLAFTPPFTAYFLQGFHSKGCAK  2248
             LFPYE FVK F  +   L P GL NCGNSCYANAVLQ L  T P  AY LQ  HS+ C+ 
Sbjct  348   LFPYEEFVKFFQCEVFYLSPRGLVNCGNSCYANAVLQSLTCTKPLVAYLLQRSHSRSCSG  407

Query  2249  KDWCFNCEFESLVLKAKNGNSPLSPIRIISHLENIGSSLGNGREEDAHEFLRYVIETMQS  2428
             KDWC  CE E  V+  +    PLS  RI+S + +I   +G+G +EDAHEFLR ++ +MQS
Sbjct  408   KDWCLMCELEQHVMMLRESGGPLSASRILSQMRSINCQIGDGSQEDAHEFLRLLVASMQS  467

Query  2429  VCLKEAGVRTSCSLE-EQTSLIGLTFGGFLRSKIECMRCGGKSERHERIMDLTVEIDGDI  2605
             +CL+  G  T      ++T+L+   FGG LRSK++C+RCG +SER+E IMDLT+EI G +
Sbjct  468   ICLERLGGETKVDPRLQETTLVQHMFGGRLRSKVKCLRCGHESERYENIMDLTLEIYGWV  527

Query  2606  ASLEGALRQFTHTEILDGENKYHCSRCKSYEKARKKLKILEAPNVLTIALKRFQSGKFGK  2785
              SL+ AL QFT  E LDGEN Y CSRC  Y KARK+L I EAPN+LTI LKRFQ G++GK
Sbjct  528   ESLQDALTQFTRPEDLDGENMYRCSRCAGYVKARKELSIHEAPNILTIVLKRFQEGRYGK  587

Query  2786  LNKTITFPEILNLASYMSGTSDKSPIYQLYGVIEHEDVMNAAFSGHYVCYVKNFQNKWFK  2965
             +NK I+FPE+L++  +M+ T D  P+Y LY VI H D +NA+FSGHY+ YVK+ +  WF+
Sbjct  588   INKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKDLRGNWFR  647

Query  2966  VNDSKVKPVEIESVLSKGAYMLLYSRCSPR  3055
             ++DS++  V +  V+S+GAYML Y R  PR
Sbjct  648   IDDSEIHQVPMTQVMSEGAYMLFYMRSYPR  677


 Score = 84.7 bits (208),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +2

Query  629  VPVARQLPYQCAQCFSSASTRCSRCKAVRYCSGKCQIIHWRLGHKDECHP  778
            VPV  +  + CA+CFS A TRCSRCK+VRYCSG+CQIIHWRL HKDEC P
Sbjct  65   VPVNNEF-HVCARCFSPAKTRCSRCKSVRYCSGQCQIIHWRLAHKDECIP  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13107462403752