BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22214_g3_i1 len=1925 path=[5132:0-818 5951:819-878 8080:879-1029
8231:1030-1057 8259:1058-1156 8358:1157-1635 8837:1636-1663
8865:1664-1740 8942:1741-1799 10618:1800-1924]

Length=1925
                                                                      Score     E

ref|XP_009774931.1|  PREDICTED: probable glycosyltransferase At5g...    595   0.0      
ref|XP_009774930.1|  PREDICTED: probable glycosyltransferase At5g...    595   0.0      
ref|XP_009631064.1|  PREDICTED: probable glycosyltransferase At5g...    593   0.0      
emb|CDP15333.1|  unnamed protein product                                589   0.0      
gb|EYU38594.1|  hypothetical protein MIMGU_mgv1a021350mg                568   0.0      
ref|XP_011101498.1|  PREDICTED: probable glycosyltransferase At5g...    566   0.0      
ref|XP_002528630.1|  catalytic, putative                                569   0.0      Ricinus communis
ref|XP_009779883.1|  PREDICTED: probable glycosyltransferase At5g...    567   0.0      
ref|XP_004249790.2|  PREDICTED: probable glycosyltransferase At5g...    564   0.0      
ref|XP_006339310.1|  PREDICTED: probable glycosyltransferase At5g...    561   0.0      
ref|XP_009617933.1|  PREDICTED: probable glycosyltransferase At5g...    566   0.0      
ref|XP_009617934.1|  PREDICTED: probable glycosyltransferase At5g...    565   0.0      
gb|KDP29231.1|  hypothetical protein JCGZ_16620                         558   0.0      
ref|XP_010543482.1|  PREDICTED: probable glycosyltransferase At5g...    558   0.0      
ref|XP_004246587.1|  PREDICTED: probable glycosyltransferase At5g...    557   0.0      
ref|XP_010325948.1|  PREDICTED: probable glycosyltransferase At5g...    557   0.0      
ref|XP_006366795.1|  PREDICTED: probable glycosyltransferase At5g...    554   0.0      
ref|XP_002284018.2|  PREDICTED: probable glycosyltransferase At5g...    554   0.0      Vitis vinifera
ref|XP_004494122.1|  PREDICTED: probable glycosyltransferase At5g...    551   0.0      
gb|KEH24081.1|  glycosyltransferase                                     544   0.0      
ref|XP_010098868.1|  putative glycosyltransferase                       543   0.0      
ref|XP_007162830.1|  hypothetical protein PHAVU_001G184500g             544   0.0      
ref|XP_009122667.1|  PREDICTED: probable glycosyltransferase At5g...    543   0.0      
ref|XP_004156325.1|  PREDICTED: probable glycosyltransferase At5g...    542   0.0      
dbj|BAB08605.1|  unnamed protein product                                538   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010242926.1|  PREDICTED: probable glycosyltransferase At5g...    542   0.0      
ref|XP_010039055.1|  PREDICTED: probable glycosyltransferase At5g...    543   0.0      
ref|XP_004143371.1|  PREDICTED: probable glycosyltransferase At5g...    541   0.0      
ref|XP_011094446.1|  PREDICTED: probable glycosyltransferase At5g...    542   0.0      
ref|XP_010039041.1|  PREDICTED: probable glycosyltransferase At5g...    542   0.0      
emb|CDY42006.1|  BnaC04g00840D                                          540   0.0      
ref|NP_001031828.1|  Exostosin family protein                           539   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398838.1|  hypothetical protein EUTSA_v10016080mg             539   0.0      
ref|XP_006287392.1|  hypothetical protein CARUB_v10000598mg             539   0.0      
gb|EYU41561.1|  hypothetical protein MIMGU_mgv1a004154mg                538   0.0      
ref|XP_007027562.1|  Exostosin family protein                           539   0.0      
ref|XP_002873114.1|  hypothetical protein ARALYDRAFT_487158             536   0.0      
ref|XP_008462519.1|  PREDICTED: probable glycosyltransferase At5g...    536   0.0      
ref|XP_003541440.1|  PREDICTED: probable glycosyltransferase At5g...    534   0.0      
ref|XP_003553575.1|  PREDICTED: probable glycosyltransferase At5g...    536   0.0      
gb|KHN02275.1|  Putative glycosyltransferase                            535   1e-180   
ref|XP_010248410.1|  PREDICTED: probable glycosyltransferase At5g...    539   2e-180   
ref|XP_010490872.1|  PREDICTED: probable glycosyltransferase At5g...    534   2e-180   
ref|XP_006381337.1|  hypothetical protein POPTR_0006s11930g             533   4e-180   
ref|XP_011018855.1|  PREDICTED: probable glycosyltransferase At5g...    533   5e-180   
gb|KHG20191.1|  hypothetical protein F383_08256                         535   6e-180   
ref|XP_010423660.1|  PREDICTED: probable glycosyltransferase At5g...    533   6e-180   
ref|XP_009787886.1|  PREDICTED: probable glycosyltransferase At5g...    530   8e-180   
ref|XP_003537031.2|  PREDICTED: probable glycosyltransferase At5g...    531   1e-179   
gb|AES60658.2|  exostosin family protein                                531   1e-179   
ref|XP_003590407.1|  hypothetical protein MTR_1g061760                  531   2e-179   
ref|XP_010243080.1|  PREDICTED: probable glycosyltransferase At5g...    534   2e-179   
ref|XP_003521429.1|  PREDICTED: probable glycosyltransferase At5g...    532   3e-179   
ref|XP_004303053.1|  PREDICTED: probable glycosyltransferase At5g...    532   3e-179   
gb|KCW48746.1|  hypothetical protein EUGRSUZ_K02385                     525   4e-179   
gb|KHN18714.1|  Putative glycosyltransferase                            532   4e-179   
ref|XP_010243073.1|  PREDICTED: probable glycosyltransferase At5g...    533   1e-178   
gb|KHG04052.1|  hypothetical protein F383_28592                         530   1e-178   
ref|XP_004249828.2|  PREDICTED: probable glycosyltransferase At5g...    525   3e-178   
ref|XP_004497579.1|  PREDICTED: probable glycosyltransferase At5g...    528   5e-178   
gb|KCW48767.1|  hypothetical protein EUGRSUZ_K02411                     521   7e-178   
ref|XP_010247793.1|  PREDICTED: probable glycosyltransferase At5g...    529   3e-177   
ref|XP_006339262.1|  PREDICTED: probable glycosyltransferase At5g...    523   6e-177   
ref|XP_006430348.1|  hypothetical protein CICLE_v10011407mg             526   1e-176   
gb|KDO60990.1|  hypothetical protein CISIN_1g048582mg                   526   1e-176   
ref|XP_006481931.1|  PREDICTED: probable glycosyltransferase At5g...    526   2e-176   
ref|XP_009340969.1|  PREDICTED: probable glycosyltransferase At5g...    524   5e-176   
gb|KFK24839.1|  hypothetical protein AALP_AA8G031400                    521   9e-176   
emb|CDX80888.1|  BnaC03g01420D                                          521   2e-175   
ref|XP_008359607.1|  PREDICTED: probable glycosyltransferase At5g...    522   2e-175   
ref|XP_003542567.1|  PREDICTED: probable glycosyltransferase At5g...    521   3e-175   
emb|CDY11270.1|  BnaA03g01060D                                          516   3e-175   
ref|XP_009130782.1|  PREDICTED: probable glycosyltransferase At5g...    520   5e-175   
ref|XP_008392545.1|  PREDICTED: probable glycosyltransferase At5g...    520   2e-174   
ref|XP_009776098.1|  PREDICTED: probable glycosyltransferase At5g...    518   2e-174   
ref|XP_007202112.1|  hypothetical protein PRUPE_ppa006842mg             513   4e-174   
gb|KEH24082.1|  glycosyltransferase                                     512   1e-173   
ref|XP_009413449.1|  PREDICTED: probable glycosyltransferase At5g...    515   6e-173   
ref|XP_009375632.1|  PREDICTED: probable glycosyltransferase At5g...    516   6e-173   
emb|CBI30213.3|  unnamed protein product                                507   1e-172   
gb|KHN24379.1|  Putative glycosyltransferase                            512   4e-172   
ref|XP_008241335.1|  PREDICTED: probable glycosyltransferase At5g...    513   5e-172   
ref|XP_003535253.1|  PREDICTED: probable glycosyltransferase At5g...    511   2e-171   
ref|XP_010039048.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    506   2e-171   
gb|EPS64188.1|  hypothetical protein M569_10593                         501   3e-169   
gb|KHN45704.1|  Putative glycosyltransferase                            496   6e-168   
ref|XP_010683939.1|  PREDICTED: probable glycosyltransferase At5g...    503   9e-168   
ref|XP_009593673.1|  PREDICTED: probable glycosyltransferase At5g...    498   2e-166   
ref|XP_009593674.1|  PREDICTED: probable glycosyltransferase At5g...    492   1e-165   
gb|EMT30821.1|  Exostosin-2                                             496   3e-165   
ref|XP_007027565.1|  Exostosin family protein, putative                 493   5e-164   
ref|XP_008381668.1|  PREDICTED: probable glycosyltransferase At5g...    492   6e-164   
emb|CBI28483.3|  unnamed protein product                                488   9e-164   
ref|XP_011094445.1|  PREDICTED: probable glycosyltransferase At5g...    489   4e-163   
ref|XP_002320538.2|  hypothetical protein POPTR_0014s16920g             487   6e-163   Populus trichocarpa [western balsam poplar]
ref|XP_002264076.2|  PREDICTED: probable glycosyltransferase At5g...    487   1e-162   Vitis vinifera
ref|XP_010252860.1|  PREDICTED: probable glycosyltransferase At3g...    485   3e-161   
ref|XP_011009812.1|  PREDICTED: probable glycosyltransferase At5g...    484   9e-161   
ref|XP_011009813.1|  PREDICTED: probable glycosyltransferase At5g...    477   5e-160   
ref|XP_002524591.1|  catalytic, putative                                481   7e-160   Ricinus communis
ref|XP_008459522.1|  PREDICTED: probable glycosyltransferase At5g...    481   8e-160   
ref|XP_006447859.1|  hypothetical protein CICLE_v10017948mg             482   8e-160   
ref|XP_009782025.1|  PREDICTED: probable glycosyltransferase At5g...    483   9e-160   
ref|XP_009782027.1|  PREDICTED: probable glycosyltransferase At5g...    481   1e-159   
ref|XP_006469477.1|  PREDICTED: probable glycosyltransferase At5g...    481   2e-159   
ref|XP_009782024.1|  PREDICTED: probable glycosyltransferase At5g...    481   4e-159   
ref|XP_009622709.1|  PREDICTED: probable glycosyltransferase At5g...    480   4e-159   
ref|XP_008794078.1|  PREDICTED: probable glycosyltransferase At5g...    481   4e-159   
ref|XP_009782026.1|  PREDICTED: probable glycosyltransferase At5g...    479   6e-159   
gb|KGN52623.1|  hypothetical protein Csa_5G647450                       479   7e-159   
ref|XP_010048370.1|  PREDICTED: probable glycosyltransferase At3g...    479   7e-159   
ref|XP_010068733.1|  PREDICTED: probable glycosyltransferase At5g...    478   9e-159   
ref|NP_001059081.1|  Os07g0188700                                       482   1e-158   Oryza sativa Japonica Group [Japonica rice]
gb|KCW89058.1|  hypothetical protein EUGRSUZ_A01384                     479   1e-158   
ref|XP_008237734.1|  PREDICTED: probable glycosyltransferase At5g...    474   1e-158   
ref|XP_009417384.1|  PREDICTED: probable glycosyltransferase At5g...    472   2e-158   
ref|XP_010923285.1|  PREDICTED: probable glycosyltransferase At5g...    478   3e-158   
ref|XP_004955715.1|  PREDICTED: probable glycosyltransferase At5g...    478   5e-158   
ref|XP_006354423.1|  PREDICTED: probable glycosyltransferase At5g...    474   3e-157   
gb|EAZ03045.1|  hypothetical protein OsI_25187                          478   4e-157   Oryza sativa Indica Group [Indian rice]
ref|XP_004292405.1|  PREDICTED: probable glycosyltransferase At5g...    475   4e-157   
gb|EYU41560.1|  hypothetical protein MIMGU_mgv1a005355mg                473   9e-157   
ref|XP_011101497.1|  PREDICTED: probable glycosyltransferase At5g...    469   7e-156   
ref|XP_007049438.1|  Catalytic, putative                                468   4e-154   
ref|XP_004239536.1|  PREDICTED: probable glycosyltransferase At5g...    467   5e-154   
ref|XP_008796633.1|  PREDICTED: probable glycosyltransferase At5g...    465   1e-153   
ref|XP_009379539.1|  PREDICTED: probable glycosyltransferase At5g...    465   2e-153   
ref|XP_010933454.1|  PREDICTED: probable glycosyltransferase At5g...    464   6e-153   
ref|XP_010228257.1|  PREDICTED: probable glycosyltransferase At5g...    464   2e-152   
emb|CDP08577.1|  unnamed protein product                                462   2e-152   
ref|XP_007216463.1|  hypothetical protein PRUPE_ppa024503mg             461   3e-152   
ref|XP_010228256.1|  PREDICTED: probable glycosyltransferase At5g...    463   3e-152   
ref|XP_010657501.1|  PREDICTED: probable glycosyltransferase At3g...    457   4e-152   
ref|XP_007145275.1|  hypothetical protein PHAVU_007G225300g             460   6e-152   
ref|XP_002264111.3|  PREDICTED: probable glycosyltransferase At3g...    459   8e-152   Vitis vinifera
emb|CBI28482.3|  unnamed protein product                                462   9e-151   
ref|XP_008394205.1|  PREDICTED: probable glycosyltransferase At5g...    458   9e-151   
ref|XP_008229804.1|  PREDICTED: probable glycosyltransferase At3g...    457   1e-150   
ref|XP_011085648.1|  PREDICTED: probable glycosyltransferase At5g...    454   3e-150   
ref|XP_004243882.1|  PREDICTED: probable glycosyltransferase At5g...    456   5e-150   
ref|XP_006357695.1|  PREDICTED: probable glycosyltransferase At5g...    455   6e-150   
ref|XP_006856555.1|  hypothetical protein AMTR_s00046p00174470          456   2e-149   
ref|XP_009379540.1|  PREDICTED: probable glycosyltransferase At5g...    454   5e-149   
ref|XP_008227724.1|  PREDICTED: probable glycosyltransferase At3g...    454   5e-149   
ref|XP_011009816.1|  PREDICTED: probable glycosyltransferase At3g...    452   5e-149   
ref|XP_006845223.1|  hypothetical protein AMTR_s00005p00255230          448   6e-149   
gb|KDP22997.1|  hypothetical protein JCGZ_01719                         461   9e-149   
ref|XP_008227680.1|  PREDICTED: probable glycosyltransferase At5g...    452   9e-149   
ref|XP_008227726.1|  PREDICTED: probable glycosyltransferase At5g...    453   1e-148   
ref|XP_002320537.2|  hypothetical protein POPTR_0014s16900g             450   1e-148   Populus trichocarpa [western balsam poplar]
ref|XP_010246563.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    451   2e-148   
gb|KEH35655.1|  exostosin family protein                                451   2e-148   
ref|XP_007137813.1|  hypothetical protein PHAVU_009G157700g             450   6e-148   
ref|XP_011100587.1|  PREDICTED: probable glycosyltransferase At3g...    452   7e-148   
emb|CDP15733.1|  unnamed protein product                                449   1e-147   
ref|XP_003555678.1|  PREDICTED: probable glycosyltransferase At3g...    449   2e-147   
gb|AGV54221.1|  glycosyltransferase                                     449   2e-147   
gb|KHN15414.1|  Putative glycosyltransferase                            449   2e-147   
gb|AAU04753.1|  EXO                                                     442   4e-147   Cucumis melo [Oriental melon]
ref|XP_004503012.1|  PREDICTED: probable glycosyltransferase At5g...    446   2e-146   
gb|AGZ15405.1|  limonene cyclase-like protein                           446   2e-146   
ref|XP_009379541.1|  PREDICTED: probable glycosyltransferase At5g...    446   8e-146   
ref|XP_002524592.1|  catalytic, putative                                441   8e-146   Ricinus communis
ref|XP_004305861.1|  PREDICTED: probable glycosyltransferase At3g...    442   5e-145   
ref|XP_008342266.1|  PREDICTED: probable glycosyltransferase At3g...    442   5e-145   
ref|XP_006856554.1|  hypothetical protein AMTR_s00046p00173940          442   7e-145   
ref|XP_008337560.1|  PREDICTED: probable glycosyltransferase At5g...    438   1e-144   
emb|CDP15735.1|  unnamed protein product                                436   1e-143   
ref|XP_010107365.1|  putative glycosyltransferase                       438   2e-143   
ref|XP_004289488.1|  PREDICTED: probable glycosyltransferase At5g...    434   3e-143   
ref|XP_002459470.1|  hypothetical protein SORBIDRAFT_02g005180          440   9e-143   Sorghum bicolor [broomcorn]
ref|XP_004502077.1|  PREDICTED: probable glycosyltransferase At3g...    435   2e-142   
gb|KHG09514.1|  hypothetical protein F383_01906                         436   2e-142   
ref|XP_010096418.1|  T-complex protein 1 subunit beta                   452   2e-142   
ref|XP_009361503.1|  PREDICTED: probable glycosyltransferase At3g...    436   3e-142   
gb|KHN09672.1|  Putative glycosyltransferase                            431   5e-142   
ref|XP_007200373.1|  hypothetical protein PRUPE_ppa008342mg             428   9e-142   
tpg|DAA59884.1|  TPA: hypothetical protein ZEAMMB73_690759              437   1e-141   
ref|XP_008652150.1|  PREDICTED: probable glycosyltransferase At5g...    436   2e-141   
gb|AES71688.2|  exostosin family protein                                431   4e-141   
ref|XP_007011817.1|  Exostosin family protein                           431   9e-141   
ref|XP_007213348.1|  hypothetical protein PRUPE_ppa1027150mg            427   1e-140   
ref|XP_003601437.1|  hypothetical protein MTR_3g080690                  429   1e-140   
ref|XP_006483712.1|  PREDICTED: probable glycosyltransferase At5g...    428   1e-139   
gb|EYU42789.1|  hypothetical protein MIMGU_mgv1a009597mg                422   2e-139   
ref|XP_006450385.1|  hypothetical protein CICLE_v10008151mg             427   2e-139   
ref|XP_006856553.1|  hypothetical protein AMTR_s00046p00173420          421   5e-139   
gb|KEH35171.1|  exostosin family protein                                425   6e-139   
ref|XP_010250232.1|  PREDICTED: probable glycosyltransferase At5g...    425   1e-138   
ref|XP_002285237.2|  PREDICTED: probable glycosyltransferase At5g...    425   2e-138   Vitis vinifera
ref|XP_010250231.1|  PREDICTED: probable glycosyltransferase At5g...    425   2e-138   
ref|XP_009759830.1|  PREDICTED: probable glycosyltransferase At3g...    425   3e-138   
ref|XP_006856564.1|  hypothetical protein AMTR_s00046p00183980          423   8e-138   
ref|XP_010519637.1|  PREDICTED: probable glycosyltransferase At5g...    421   4e-137   
ref|XP_009346174.1|  PREDICTED: probable glycosyltransferase At5g...    422   4e-137   
ref|XP_008394108.1|  PREDICTED: probable glycosyltransferase At5g...    421   9e-137   
ref|XP_007161196.1|  hypothetical protein PHAVU_001G050100g             420   2e-136   
ref|XP_010519636.1|  PREDICTED: probable glycosyltransferase At5g...    420   2e-136   
ref|XP_009355772.1|  PREDICTED: probable glycosyltransferase At5g...    420   2e-136   
emb|CDP13539.1|  unnamed protein product                                422   3e-136   
ref|XP_006394779.1|  hypothetical protein EUTSA_v10004121mg             419   5e-136   
ref|XP_004501350.1|  PREDICTED: probable glycosyltransferase At5g...    417   2e-135   
ref|XP_011036587.1|  PREDICTED: probable glycosyltransferase At5g...    418   2e-135   
ref|XP_011085421.1|  PREDICTED: probable glycosyltransferase At3g...    415   2e-135   
ref|XP_004288781.1|  PREDICTED: probable glycosyltransferase At5g...    417   2e-135   
ref|XP_010683539.1|  PREDICTED: probable glycosyltransferase At3g...    418   2e-135   
ref|NP_197913.4|  Exostosin family protein                              416   7e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004292977.1|  PREDICTED: probable glycosyltransferase At5g...    414   9e-134   
ref|XP_011085420.1|  PREDICTED: probable glycosyltransferase At3g...    414   9e-134   
ref|XP_010696519.1|  PREDICTED: probable glycosyltransferase At5g...    412   2e-133   
ref|XP_006287596.1|  hypothetical protein CARUB_v10000808mg             412   2e-133   
ref|XP_009407372.1|  PREDICTED: probable glycosyltransferase At5g...    412   3e-133   
ref|XP_002515489.1|  catalytic, putative                                412   3e-133   Ricinus communis
ref|XP_009151056.1|  PREDICTED: probable glycosyltransferase At5g...    411   4e-133   
ref|XP_003549290.1|  PREDICTED: probable glycosyltransferase At5g...    411   5e-133   
ref|XP_003603357.1|  hypothetical protein MTR_3g106690                  407   1e-132   
ref|XP_010418150.1|  PREDICTED: probable glycosyltransferase At3g...    408   1e-132   
ref|XP_011081538.1|  PREDICTED: probable glycosyltransferase At5g...    410   2e-132   
ref|XP_010489710.1|  PREDICTED: probable glycosyltransferase At3g...    409   2e-132   
ref|XP_006594254.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    410   2e-132   
gb|KHN47102.1|  Xylogalacturonan beta-1,3-xylosyltransferase            409   3e-132   
ref|XP_003545455.1|  PREDICTED: probable glycosyltransferase At5g...    409   3e-132   
gb|AHL38775.1|  glycosyltransferase                                     408   4e-132   
ref|NP_187419.1|  putative glycosyltransferase                          409   4e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007137001.1|  hypothetical protein PHAVU_009G091800g             408   4e-132   
ref|XP_009151057.1|  PREDICTED: probable glycosyltransferase At5g...    409   5e-132   
ref|XP_007204886.1|  hypothetical protein PRUPE_ppa017740mg             405   6e-132   
ref|XP_010050741.1|  PREDICTED: probable glycosyltransferase At5g...    408   6e-132   
ref|XP_006407816.1|  hypothetical protein EUTSA_v10020696mg             407   7e-132   
ref|XP_007013571.1|  Exostosin family protein                           408   7e-132   
ref|XP_010464397.1|  PREDICTED: probable glycosyltransferase At3g...    408   9e-132   
ref|XP_006299448.1|  hypothetical protein CARUB_v10015613mg             407   1e-131   
ref|XP_008242868.1|  PREDICTED: probable glycosyltransferase At3g...    404   2e-131   
ref|XP_010421383.1|  PREDICTED: probable glycosyltransferase At5g...    407   3e-131   
ref|XP_010493785.1|  PREDICTED: probable glycosyltransferase At5g...    407   3e-131   
ref|XP_010454855.1|  PREDICTED: probable glycosyltransferase At5g...    406   4e-131   
ref|XP_008794982.1|  PREDICTED: probable glycosyltransferase At5g...    407   4e-131   
ref|XP_006594253.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    406   4e-131   
ref|XP_010241628.1|  PREDICTED: probable glycosyltransferase At5g...    406   4e-131   
ref|XP_002884661.1|  predicted protein                                  404   2e-130   
ref|XP_010552074.1|  PREDICTED: probable glycosyltransferase At3g...    404   2e-130   
ref|XP_004138850.1|  PREDICTED: probable glycosyltransferase At5g...    404   3e-130   
ref|XP_008219689.1|  PREDICTED: probable glycosyltransferase At5g...    404   4e-130   
ref|XP_006600735.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    404   6e-130   
ref|XP_010905483.1|  PREDICTED: probable glycosyltransferase At5g...    402   1e-129   
ref|XP_007202437.1|  hypothetical protein PRUPE_ppa014750mg             399   1e-129   
emb|CDX80499.1|  BnaC07g29450D                                          402   2e-129   
ref|XP_010250233.1|  PREDICTED: probable glycosyltransferase At5g...    401   4e-129   
ref|XP_006582483.1|  PREDICTED: probable glycosyltransferase At5g...    400   5e-129   
ref|XP_008242869.1|  PREDICTED: probable glycosyltransferase At3g...    398   8e-129   
ref|XP_009124266.1|  PREDICTED: probable glycosyltransferase At3g...    399   1e-128   
ref|XP_010908761.1|  PREDICTED: probable glycosyltransferase At5g...    400   1e-128   
ref|XP_008242826.1|  PREDICTED: probable glycosyltransferase At5g...    400   1e-128   
gb|KHN15048.1|  Xylogalacturonan beta-1,3-xylosyltransferase            404   1e-128   
ref|XP_010250234.1|  PREDICTED: probable glycosyltransferase At5g...    400   2e-128   
gb|EYU20247.1|  hypothetical protein MIMGU_mgv1a024162mg                396   2e-128   
ref|XP_006600734.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    399   2e-128   
gb|KDP33570.1|  hypothetical protein JCGZ_07141                         399   3e-128   
ref|XP_003542647.2|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    400   3e-128   
ref|XP_003550810.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    399   3e-128   
gb|KHN47101.1|  Putative glycosyltransferase                            400   3e-128   
ref|XP_003550809.2|  PREDICTED: probable glycosyltransferase At3g...    397   6e-128   
ref|XP_006582516.1|  PREDICTED: probable glycosyltransferase At5g...    392   9e-128   
gb|KCW80354.1|  hypothetical protein EUGRSUZ_C01719                     392   1e-127   
ref|XP_008445236.1|  PREDICTED: probable glycosyltransferase At5g...    397   1e-127   
ref|XP_002324871.2|  exostosin family protein                           392   1e-127   Populus trichocarpa [western balsam poplar]
gb|AES91622.2|  glycosyltransferase                                     402   2e-127   
ref|XP_010057604.1|  PREDICTED: probable glycosyltransferase At3g...    393   5e-127   
gb|KHN47103.1|  Putative glycosyltransferase                            395   7e-127   
ref|XP_009802043.1|  PREDICTED: probable glycosyltransferase At5g...    395   8e-127   
ref|XP_008336982.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    391   3e-126   
ref|XP_010042007.1|  PREDICTED: probable glycosyltransferase At3g...    390   3e-126   
ref|XP_008337219.1|  PREDICTED: probable glycosyltransferase At5g...    390   3e-126   
ref|XP_007155060.1|  hypothetical protein PHAVU_003G169700g             394   4e-126   
ref|XP_008794981.1|  PREDICTED: probable glycosyltransferase At5g...    390   5e-126   
gb|KCW74792.1|  hypothetical protein EUGRSUZ_E03525                     393   6e-126   
ref|XP_009393729.1|  PREDICTED: probable glycosyltransferase At5g...    392   7e-126   
ref|XP_011020204.1|  PREDICTED: probable glycosyltransferase At5g...    392   8e-126   
ref|XP_007013570.1|  Exostosin family protein                           392   1e-125   
gb|EPS67004.1|  hypothetical protein M569_07774                         387   2e-125   
gb|KCW74795.1|  hypothetical protein EUGRSUZ_E03530                     391   2e-125   
ref|XP_007226606.1|  hypothetical protein PRUPE_ppa023392mg             390   2e-125   
ref|XP_008385236.1|  PREDICTED: probable glycosyltransferase At3g...    392   2e-125   
ref|XP_003541484.1|  PREDICTED: probable glycosyltransferase At3g...    391   2e-125   
ref|XP_009615070.1|  PREDICTED: probable glycosyltransferase At5g...    391   4e-125   
ref|XP_009364050.1|  PREDICTED: probable glycosyltransferase At5g...    392   5e-125   
ref|XP_008352234.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    387   7e-125   
ref|XP_008361205.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    387   8e-125   
ref|XP_008457132.1|  PREDICTED: probable glycosyltransferase At3g...    389   8e-125   
ref|XP_008352110.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    387   9e-125   
gb|AGV54450.1|  glycosyltransferase                                     390   9e-125   
gb|KHN15047.1|  Putative glycosyltransferase                            388   1e-124   
ref|XP_006453093.1|  hypothetical protein CICLE_v10010441mg             389   2e-124   
ref|XP_010059401.1|  PREDICTED: probable glycosyltransferase At3g...    389   2e-124   
ref|XP_009364051.1|  PREDICTED: probable glycosyltransferase At5g...    385   3e-124   
gb|KGN60712.1|  hypothetical protein Csa_2G008045                       387   4e-124   
ref|XP_003549738.1|  PREDICTED: probable glycosyltransferase At3g...    388   4e-124   
ref|XP_006474664.1|  PREDICTED: probable glycosyltransferase At5g...    385   4e-124   
ref|XP_009340668.1|  PREDICTED: probable glycosyltransferase At5g...    392   5e-124   
ref|XP_006389445.1|  hypothetical protein POPTR_0025s00760g             387   8e-124   
ref|XP_003609423.1|  Xylogalacturonan beta-1,3-xylosyltransferase       384   1e-123   
ref|XP_006345657.1|  PREDICTED: probable glycosyltransferase At5g...    387   1e-123   
ref|XP_004508620.1|  PREDICTED: probable glycosyltransferase At3g...    386   1e-123   
ref|XP_007204648.1|  hypothetical protein PRUPE_ppa001571mg             397   1e-123   
ref|XP_007013568.1|  Exostosin family protein, putative isoform 1       387   1e-123   
ref|XP_010533124.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    389   2e-123   
ref|XP_010533123.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    389   2e-123   
ref|XP_004244985.2|  PREDICTED: probable glycosyltransferase At5g...    387   2e-123   
ref|XP_008389683.1|  PREDICTED: probable glycosyltransferase At5g...    383   2e-123   
ref|XP_010454331.1|  PREDICTED: probable glycosyltransferase At5g...    385   3e-123   
gb|KHN33893.1|  Putative glycosyltransferase                            380   4e-123   
ref|XP_008443936.1|  PREDICTED: probable glycosyltransferase At5g...    385   4e-123   
ref|XP_006400593.1|  hypothetical protein EUTSA_v10015371mg             385   5e-123   
gb|KCW58739.1|  hypothetical protein EUGRSUZ_H01381                     382   6e-123   
ref|XP_006381108.1|  hypothetical protein POPTR_0006s06330g             385   7e-123   
ref|XP_011016249.1|  PREDICTED: probable glycosyltransferase At5g...    384   1e-122   
ref|XP_001767347.1|  predicted protein                                  379   1e-122   
ref|XP_006289990.1|  hypothetical protein CARUB_v10003620mg             384   1e-122   
gb|AHL38607.1|  glycosyltransferase                                     379   2e-122   
ref|XP_011017849.1|  PREDICTED: probable glycosyltransferase At5g...    383   2e-122   
ref|XP_002989572.1|  xylosyltransferase-like protein                    378   2e-122   
ref|XP_010026197.1|  PREDICTED: probable glycosyltransferase At5g...    382   3e-122   
ref|XP_010454330.1|  PREDICTED: probable glycosyltransferase At5g...    382   4e-122   
gb|KHN26915.1|  Putative glycosyltransferase                            377   5e-122   
ref|XP_002964241.1|  xylosyltransferase-like protein                    377   7e-122   
ref|XP_010493786.1|  PREDICTED: probable glycosyltransferase At5g...    382   8e-122   
ref|XP_003609425.1|  Xylogalacturonan beta-1,3-xylosyltransferase       387   9e-122   
ref|XP_010454857.1|  PREDICTED: probable glycosyltransferase At5g...    381   1e-121   
gb|EYU20246.1|  hypothetical protein MIMGU_mgv1a006806mg                380   1e-121   
ref|XP_007155062.1|  hypothetical protein PHAVU_003G169900g             380   2e-121   
ref|XP_002872156.1|  exostosin family protein                           376   2e-121   
ref|XP_009346171.1|  PREDICTED: probable glycosyltransferase At5g...    378   3e-121   
ref|XP_002531945.1|  catalytic, putative                                379   7e-121   
ref|XP_008336981.1|  PREDICTED: probable glycosyltransferase At3g...    377   7e-121   
ref|XP_007155061.1|  hypothetical protein PHAVU_003G169800g             378   2e-120   
emb|CBI21065.3|  unnamed protein product                                376   2e-120   
gb|KGN65113.1|  hypothetical protein Csa_1G226410                       379   2e-120   
emb|CDY60376.1|  BnaCnng36170D                                          377   4e-120   
ref|XP_002285239.2|  PREDICTED: probable glycosyltransferase At5g...    378   4e-120   
ref|XP_006474663.1|  PREDICTED: probable glycosyltransferase At3g...    377   5e-120   
ref|XP_010493134.1|  PREDICTED: probable glycosyltransferase At5g...    377   5e-120   
ref|NP_196674.2|  exostosin family protein                              377   7e-120   
gb|KHN15049.1|  Putative glycosyltransferase                            374   8e-120   
ref|XP_006381109.1|  hypothetical protein POPTR_0006s06340g             378   8e-120   
emb|CDY35818.1|  BnaC09g37500D                                          376   9e-120   
ref|XP_006286824.1|  hypothetical protein CARUB_v10003769mg             376   9e-120   
ref|XP_003550812.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    377   1e-119   
emb|CDX92476.1|  BnaA10g15150D                                          376   1e-119   
ref|XP_009340649.1|  PREDICTED: probable glycosyltransferase At5g...    376   1e-119   
ref|XP_009131787.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    376   2e-119   
ref|XP_010687901.1|  PREDICTED: probable glycosyltransferase At5g...    373   2e-119   
ref|XP_009121991.1|  PREDICTED: probable glycosyltransferase At5g...    376   2e-119   
ref|XP_010050740.1|  PREDICTED: probable glycosyltransferase At5g...    373   2e-119   
ref|XP_004288780.1|  PREDICTED: probable glycosyltransferase At5g...    376   2e-119   
gb|KHN15046.1|  Xylogalacturonan beta-1,3-xylosyltransferase            374   2e-119   
ref|XP_009120823.1|  PREDICTED: probable glycosyltransferase At5g...    375   3e-119   
ref|XP_011020203.1|  PREDICTED: probable glycosyltransferase At5g...    376   4e-119   
emb|CDY35820.1|  BnaC09g37520D                                          374   4e-119   
emb|CDY22124.1|  BnaC01g39770D                                          379   5e-119   
ref|XP_010099849.1|  putative glycosyltransferase                       373   1e-118   
ref|XP_010520570.1|  PREDICTED: probable glycosyltransferase At5g...    374   2e-118   
ref|XP_010541615.1|  PREDICTED: probable glycosyltransferase At5g...    374   2e-118   
ref|XP_011015263.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    373   2e-118   
ref|NP_001052025.1|  Os04g0109900                                       372   2e-118   
ref|XP_004508619.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    372   3e-118   
gb|KFK38224.1|  hypothetical protein AALP_AA3G084800                    371   3e-118   
ref|XP_010041414.1|  PREDICTED: probable glycosyltransferase At5g...    373   3e-118   
gb|AFW85605.1|  hypothetical protein ZEAMMB73_586394                    374   3e-118   
ref|XP_009117358.1|  PREDICTED: probable glycosyltransferase At3g...    372   6e-118   
ref|XP_010491808.1|  PREDICTED: probable glycosyltransferase At5g...    372   7e-118   
ref|XP_010419667.1|  PREDICTED: probable glycosyltransferase At5g...    372   7e-118   
gb|KCW44366.1|  hypothetical protein EUGRSUZ_L02165                     369   7e-118   
emb|CAH67778.1|  H0201G08.5                                             370   8e-118   
ref|XP_010453152.1|  PREDICTED: probable glycosyltransferase At5g...    372   9e-118   
ref|XP_002877250.1|  exostosin family protein                           370   9e-118   
ref|XP_002515488.1|  catalytic, putative                                371   1e-117   
ref|XP_004139407.1|  PREDICTED: probable glycosyltransferase At3g...    370   1e-117   
emb|CBI25537.3|  unnamed protein product                                371   1e-117   
ref|XP_011017844.1|  PREDICTED: probable glycosyltransferase At5g...    372   2e-117   
ref|XP_006389446.1|  hypothetical protein POPTR_0025s00770g             372   2e-117   
ref|XP_004304808.1|  PREDICTED: probable glycosyltransferase At5g...    372   3e-117   
ref|XP_010656546.1|  PREDICTED: probable glycosyltransferase At3g...    370   3e-117   
emb|CDX85728.1|  BnaA02g00850D                                          370   4e-117   
sp|Q3E9A4.3|GLYT5_ARATH  RecName: Full=Probable glycosyltransfera...    369   4e-117   
emb|CDY51109.1|  BnaCnng20120D                                          370   5e-117   
ref|XP_006389444.1|  hypothetical protein POPTR_0025s00750g             378   6e-117   
emb|CDX76960.1|  BnaC08g35460D                                          369   6e-117   
ref|XP_010687902.1|  PREDICTED: probable glycosyltransferase At5g...    370   6e-117   
ref|NP_197526.5|  Exostosin family protein                              369   6e-117   
ref|XP_002873987.1|  hypothetical protein ARALYDRAFT_326421             375   7e-117   
ref|XP_008337135.1|  PREDICTED: probable glycosyltransferase At5g...    369   7e-117   
gb|EPS58814.1|  hypothetical protein M569_15998                         364   9e-117   
ref|XP_006396181.1|  hypothetical protein EUTSA_v10002345mg             368   1e-116   
gb|KHN31216.1|  Putative glycosyltransferase                            363   1e-116   
emb|CDY13789.1|  BnaA09g42910D                                          366   1e-116   
ref|XP_009355880.1|  PREDICTED: probable glycosyltransferase At5g...    365   1e-116   
ref|XP_002308053.2|  hypothetical protein POPTR_0006s06350g             370   2e-116   
ref|XP_011036589.1|  PREDICTED: probable glycosyltransferase At5g...    367   2e-116   
ref|XP_003561022.1|  PREDICTED: probable glycosyltransferase At5g...    368   2e-116   
emb|CDX97082.1|  BnaC09g45430D                                          367   9e-116   
ref|XP_011020198.1|  PREDICTED: probable glycosyltransferase At5g...    368   9e-116   
dbj|BAK03842.1|  predicted protein                                      365   9e-116   
gb|KFK38225.1|  hypothetical protein AALP_AA3G084800                    365   9e-116   
ref|XP_010314106.1|  PREDICTED: probable glycosyltransferase At3g...    365   1e-115   
ref|XP_009125787.1|  PREDICTED: probable glycosyltransferase At5g...    366   1e-115   
ref|XP_006399613.1|  hypothetical protein EUTSA_v10013399mg             366   1e-115   
ref|XP_008660691.1|  PREDICTED: probable glycosyltransferase At5g...    375   2e-115   
gb|EPS67003.1|  hypothetical protein M569_07773                         362   2e-115   
ref|XP_007155059.1|  hypothetical protein PHAVU_003G169600g             365   3e-115   
ref|XP_006453094.1|  hypothetical protein CICLE_v10010628mg             374   3e-115   
ref|XP_011020197.1|  PREDICTED: probable glycosyltransferase At5g...    366   4e-115   
ref|XP_007011816.1|  Exostosin family protein                           364   4e-115   
ref|XP_004287275.1|  PREDICTED: probable glycosyltransferase At5g...    364   8e-115   
ref|XP_006345278.1|  PREDICTED: probable glycosyltransferase At5g...    361   8e-115   
ref|XP_010520569.1|  PREDICTED: probable glycosyltransferase At3g...    363   1e-114   
ref|XP_006353139.1|  PREDICTED: probable glycosyltransferase At3g...    365   2e-114   
ref|XP_011020199.1|  PREDICTED: probable glycosyltransferase At5g...    364   2e-114   
ref|XP_002266490.3|  PREDICTED: probable glycosyltransferase At5g...    365   2e-114   
ref|XP_006279358.1|  hypothetical protein CARUB_v10008022mg             362   2e-114   
gb|ABA18105.1|  exostosin family protein                                360   4e-114   
ref|XP_002266646.2|  PREDICTED: probable glycosyltransferase At5g...    362   5e-114   
emb|CDO99716.1|  unnamed protein product                                361   5e-114   
ref|XP_004498960.1|  PREDICTED: probable glycosyltransferase At5g...    361   8e-114   
ref|XP_010514701.1|  PREDICTED: probable glycosyltransferase At3g...    361   9e-114   
ref|XP_006450384.1|  hypothetical protein CICLE_v10010549mg             358   9e-114   
emb|CDP10462.1|  unnamed protein product                                355   1e-113   
ref|XP_009592269.1|  PREDICTED: probable glycosyltransferase At3g...    360   1e-113   
ref|XP_010520568.1|  PREDICTED: probable glycosyltransferase At3g...    361   2e-113   
ref|XP_009337994.1|  PREDICTED: probable glycosyltransferase At3g...    358   2e-113   
ref|XP_009802047.1|  PREDICTED: probable glycosyltransferase At5g...    358   3e-113   
ref|XP_007013569.1|  Exostosin family protein isoform 2                 355   4e-113   
ref|XP_009362346.1|  PREDICTED: probable glycosyltransferase At5g...    361   4e-113   
ref|XP_009337993.1|  PREDICTED: probable glycosyltransferase At5g...    359   5e-113   
gb|EYU23547.1|  hypothetical protein MIMGU_mgv1a009659mg                354   6e-113   
ref|XP_008370810.1|  PREDICTED: probable glycosyltransferase At5g...    359   7e-113   
ref|XP_008370808.1|  PREDICTED: probable glycosyltransferase At5g...    359   7e-113   
gb|EMT14849.1|  Exostosin-1c                                            358   7e-113   
ref|XP_006483713.1|  PREDICTED: probable glycosyltransferase At5g...    358   9e-113   
emb|CBI25530.3|  unnamed protein product                                355   1e-112   
ref|XP_002871458.1|  exostosin family protein                           353   1e-112   
gb|ABG48476.1|  At3g42180                                               357   1e-112   
ref|XP_004508451.1|  PREDICTED: probable glycosyltransferase At5g...    355   1e-112   
ref|XP_007205109.1|  hypothetical protein PRUPE_ppa004757mg             358   2e-112   
gb|AES91621.2|  glycosyltransferase                                     353   2e-112   
ref|NP_189804.4|  Exostosin family protein                              357   2e-112   
gb|AES91613.2|  exostosin family protein                                357   2e-112   
gb|EAY86665.1|  hypothetical protein OsI_08049                          357   3e-112   
ref|XP_008218430.1|  PREDICTED: probable glycosyltransferase At5g...    358   3e-112   
ref|XP_004166098.1|  PREDICTED: probable glycosyltransferase At5g...    353   4e-112   
emb|CAB96648.1|  putative protein                                       352   5e-112   
ref|XP_007049437.1|  Exostosin family protein                           355   5e-112   
ref|XP_002324873.2|  hypothetical protein POPTR_0018s01950g             353   5e-112   
ref|XP_010425790.1|  PREDICTED: probable glycosyltransferase At3g...    357   5e-112   
emb|CDX88845.1|  BnaA03g08040D                                          365   5e-112   
gb|KDP30240.1|  hypothetical protein JCGZ_17022                         351   8e-112   
gb|KDP42268.1|  hypothetical protein JCGZ_01592                         353   1e-111   
gb|KHG16877.1|  Xylogalacturonan beta-1,3-xylosyltransferase -lik...    351   1e-111   
ref|XP_011036586.1|  PREDICTED: probable glycosyltransferase At5g...    355   2e-111   
ref|XP_011070139.1|  PREDICTED: probable glycosyltransferase At5g...    353   3e-111   
ref|XP_004292976.1|  PREDICTED: probable glycosyltransferase At5g...    352   3e-111   
ref|XP_010491807.1|  PREDICTED: probable glycosyltransferase At5g...    356   3e-111   
ref|XP_001781687.1|  predicted protein                                  351   4e-111   
ref|XP_009338023.1|  PREDICTED: probable glycosyltransferase At5g...    355   5e-111   
ref|XP_002437936.1|  hypothetical protein SORBIDRAFT_10g005120          352   6e-111   
ref|XP_011082204.1|  PREDICTED: probable glycosyltransferase At5g...    352   7e-111   
ref|XP_002530666.1|  catalytic, putative                                355   7e-111   
gb|KCW80353.1|  hypothetical protein EUGRSUZ_C01718                     348   9e-111   
ref|XP_009337990.1|  PREDICTED: probable glycosyltransferase At5g...    354   1e-110   
emb|CBI25529.3|  unnamed protein product                                350   1e-110   
ref|XP_007039785.1|  Exostosin family protein isoform 2                 353   2e-110   
ref|XP_009337989.1|  PREDICTED: probable glycosyltransferase At5g...    353   2e-110   
ref|XP_002264922.2|  PREDICTED: probable glycosyltransferase At5g...    352   3e-110   
ref|XP_007223103.1|  hypothetical protein PRUPE_ppa007120mg             348   4e-110   
ref|XP_006837291.1|  hypothetical protein AMTR_s00111p00027680          357   4e-110   
gb|KDO73474.1|  hypothetical protein CISIN_1g048345mg                   347   4e-110   
ref|XP_010667144.1|  PREDICTED: probable glycosyltransferase At5g...    349   4e-110   
ref|XP_002264880.2|  PREDICTED: probable glycosyltransferase At5g...    351   5e-110   
ref|XP_007206344.1|  hypothetical protein PRUPE_ppa017605mg             351   6e-110   
ref|XP_004302151.1|  PREDICTED: probable glycosyltransferase At5g...    352   6e-110   
ref|XP_007039784.1|  Exostosin family protein isoform 1                 353   1e-109   
ref|XP_008218431.1|  PREDICTED: probable glycosyltransferase At5g...    350   2e-109   
ref|XP_010440106.1|  PREDICTED: probable glycosyltransferase At5g...    352   2e-109   
ref|XP_008645924.1|  PREDICTED: probable glycosyltransferase At5g...    350   2e-109   
ref|XP_008393870.1|  PREDICTED: probable glycosyltransferase At5g...    356   2e-109   
ref|XP_010456387.1|  PREDICTED: probable glycosyltransferase At5g...    347   4e-109   
ref|XP_008219690.1|  PREDICTED: probable glycosyltransferase At5g...    348   4e-109   
gb|KDO61791.1|  hypothetical protein CISIN_1g038832mg                   344   5e-109   
ref|XP_009761144.1|  PREDICTED: probable glycosyltransferase At5g...    350   5e-109   
emb|CDM83500.1|  unnamed protein product                                348   1e-108   
emb|CDX69782.1|  BnaA10g21310D                                          354   2e-108   
ref|XP_010111057.1|  putative glycosyltransferase                       348   2e-108   
gb|AHL38617.1|  glycosyltransferase                                     342   2e-108   
emb|CDY12392.1|  BnaC08g08130D                                          348   2e-108   
ref|XP_009783538.1|  PREDICTED: probable glycosyltransferase At5g...    349   3e-108   
ref|XP_009363968.1|  PREDICTED: probable glycosyltransferase At3g...    342   3e-108   
ref|XP_010434775.1|  PREDICTED: probable glycosyltransferase At5g...    348   3e-108   
ref|XP_010096841.1|  putative glycosyltransferase                       342   5e-108   
ref|XP_009108067.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    348   5e-108   
emb|CBI25528.3|  unnamed protein product                                357   6e-108   
emb|CDY54752.1|  BnaAnng13460D                                          343   6e-108   



>ref|XP_009774931.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana sylvestris]
Length=454

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/373 (72%), Positives = 319/373 (86%), Gaps = 0/373 (0%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             Y+ +E++EA LA+ARA+ILR         +D+ +P GPMY NA+ F RSY EMEK  KVY
Sbjct  68    YSKLEKLEAGLAKARATILRENNNWNNQTEDEYIPHGPMYLNATAFHRSYLEMEKNFKVY  127

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             VY++G+PPV H+GPCK TYAIEG FIHAM+ S+FRT+DP+KAH+YFLP S+T+L++ VY 
Sbjct  128   VYKEGEPPVFHFGPCKHTYAIEGYFIHAMEISKFRTSDPNKAHVYFLPMSVTMLTQFVYV  187

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
              +SH+W  MK  ALDYVN ++ KYPFWNRSLGADHFIL+CHDWGPEISFAIP L+ NSIR
Sbjct  188   RDSHEWGLMKNIALDYVNIISNKYPFWNRSLGADHFILACHDWGPEISFAIPYLYKNSIR  247

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
             ALCNANTSE+F+P KDVSIPEI LP GTTKGLLGGP PS+RPVLVF+AGGLHGP+RPILL
Sbjct  248   ALCNANTSEKFNPTKDVSIPEIHLPYGTTKGLLGGPPPSERPVLVFFAGGLHGPIRPILL  307

Query  1388  QHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             QHWENKDEDVQ+H YLPKG+SY  M++KS+YCICPSGYEVASPRMVE LYMGCVPVLIK 
Sbjct  308   QHWENKDEDVQIHKYLPKGISYYDMIKKSKYCICPSGYEVASPRMVEGLYMGCVPVLIKD  367

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
              YV PFSDVL+W  F+V+IPV+DIPNLKKIL  I Q +Y+ MQ+RG+++RRHFEVNSPPK
Sbjct  368   NYVIPFSDVLDWTTFSVLIPVKDIPNLKKILLDIPQEKYLEMQKRGIQMRRHFEVNSPPK  427

Query  1748  RFDVFHMILHSIW  1786
              +DVFHMILHSIW
Sbjct  428   IYDVFHMILHSIW  440



>ref|XP_009774930.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana sylvestris]
Length=455

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/373 (72%), Positives = 319/373 (86%), Gaps = 0/373 (0%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             Y+ +E++EA LA+ARA+ILR         +D+ +P GPMY NA+ F RSY EMEK  KVY
Sbjct  69    YSKLEKLEAGLAKARATILRENNNWNNQTEDEYIPHGPMYLNATAFHRSYLEMEKNFKVY  128

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             VY++G+PPV H+GPCK TYAIEG FIHAM+ S+FRT+DP+KAH+YFLP S+T+L++ VY 
Sbjct  129   VYKEGEPPVFHFGPCKHTYAIEGYFIHAMEISKFRTSDPNKAHVYFLPMSVTMLTQFVYV  188

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
              +SH+W  MK  ALDYVN ++ KYPFWNRSLGADHFIL+CHDWGPEISFAIP L+ NSIR
Sbjct  189   RDSHEWGLMKNIALDYVNIISNKYPFWNRSLGADHFILACHDWGPEISFAIPYLYKNSIR  248

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
             ALCNANTSE+F+P KDVSIPEI LP GTTKGLLGGP PS+RPVLVF+AGGLHGP+RPILL
Sbjct  249   ALCNANTSEKFNPTKDVSIPEIHLPYGTTKGLLGGPPPSERPVLVFFAGGLHGPIRPILL  308

Query  1388  QHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             QHWENKDEDVQ+H YLPKG+SY  M++KS+YCICPSGYEVASPRMVE LYMGCVPVLIK 
Sbjct  309   QHWENKDEDVQIHKYLPKGISYYDMIKKSKYCICPSGYEVASPRMVEGLYMGCVPVLIKD  368

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
              YV PFSDVL+W  F+V+IPV+DIPNLKKIL  I Q +Y+ MQ+RG+++RRHFEVNSPPK
Sbjct  369   NYVIPFSDVLDWTTFSVLIPVKDIPNLKKILLDIPQEKYLEMQKRGIQMRRHFEVNSPPK  428

Query  1748  RFDVFHMILHSIW  1786
              +DVFHMILHSIW
Sbjct  429   IYDVFHMILHSIW  441



>ref|XP_009631064.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
tomentosiformis]
Length=461

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/395 (69%), Positives = 327/395 (83%), Gaps = 7/395 (2%)
 Frame = +2

Query  602   DERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGP  781
             DE  NG  S +T      KRY+   +E++EA LA+ARA+IL+         +D+ +P GP
Sbjct  60    DEAPNGTLSSET-----PKRYS--KLEKLEAGLAKARAAILKENKSWNNQTEDEYIPHGP  112

Query  782   MYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTD  961
             MY NA+ F RSY EME   KVYVY++G+PPV H+GPCK TYAIEG FIH M+ S FRT+D
Sbjct  113   MYLNATAFHRSYLEMENKFKVYVYKEGEPPVFHFGPCKHTYAIEGYFIHTMEISEFRTSD  172

Query  962   PDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFIL  1141
             P+KAH+YFLP S+T+L++ +Y  +SH+W  MK TALDYVN ++ KYP+WNRSLGADHF+L
Sbjct  173   PNKAHVYFLPMSVTMLTQFIYVHDSHEWGLMKNTALDYVNVISNKYPYWNRSLGADHFML  232

Query  1142  SCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSP  1321
             +CHDWGPEISFAIP L+ NSIRALCNANTSE+F+P KDVSIPEI LP GTT+GLLGGP P
Sbjct  233   ACHDWGPEISFAIPYLYKNSIRALCNANTSEKFNPTKDVSIPEIHLPYGTTEGLLGGPPP  292

Query  1322  SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGY  1501
             S+RPVLVF+AGGLHGP+RPILLQHWENKD+DVQ+H YLPKG+SY  M++KS+YCICPSGY
Sbjct  293   SERPVLVFFAGGLHGPIRPILLQHWENKDKDVQIHKYLPKGISYYDMIKKSKYCICPSGY  352

Query  1502  EVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQ  1681
             EVASPRMVE LYMGCVPVLIK  YV PFSDVL+W  F+VIIPV+DIPNLKKIL  I Q +
Sbjct  353   EVASPRMVEGLYMGCVPVLIKDNYVIPFSDVLDWNTFSVIIPVKDIPNLKKILLDIPQEK  412

Query  1682  YIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             Y+ MQ+RG+++R+HFEVNSPPKR+DVFHMILHSIW
Sbjct  413   YLEMQKRGIQMRKHFEVNSPPKRYDVFHMILHSIW  447



>emb|CDP15333.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/373 (72%), Positives = 318/373 (85%), Gaps = 1/373 (0%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             Y+N+E +EA LA ARA+I +G   G +   +D VP GPMY NA+ F RSY EMEK  KV+
Sbjct  59    YSNLEILEASLAEARAAI-KGARIGQEAPHEDFVPKGPMYLNATAFRRSYLEMEKRFKVF  117

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             +YE+G PPV H GPCK TYAIEG FI A++ S  RTTDP KAHLY+LPFS+T +++ +Y 
Sbjct  118   IYEEGGPPVFHVGPCKHTYAIEGYFIQALEVSPIRTTDPSKAHLYYLPFSVTRITEFIYV  177

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
             P S +W  MK    DYVN+++ KYP+WNRSLGADHF+L+CHDWGPE+SFA+P L+ NSIR
Sbjct  178   PESREWGLMKSFVADYVNTISHKYPYWNRSLGADHFMLACHDWGPELSFAVPYLYTNSIR  237

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
             ALCNANTSERF P +DVSIPEI LP GTTKG++GGPSPSKRP+LVFYAGG+HGP+RPILL
Sbjct  238   ALCNANTSERFAPSRDVSIPEIHLPLGTTKGMIGGPSPSKRPILVFYAGGIHGPIRPILL  297

Query  1388  QHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             ++WE+KD DVQ+H YLPKGVSY GMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK 
Sbjct  298   EYWEDKDADVQIHQYLPKGVSYYGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKE  357

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
             GYV PFSD+LNW+AFAV+IPV+DIPNLK+IL  IS RQYIRMQRRG++VRRHFE+N+PPK
Sbjct  358   GYVIPFSDILNWKAFAVVIPVQDIPNLKRILMAISPRQYIRMQRRGIQVRRHFEINTPPK  417

Query  1748  RFDVFHMILHSIW  1786
             R+DVFHMILHSIW
Sbjct  418   RYDVFHMILHSIW  430



>gb|EYU38594.1| hypothetical protein MIMGU_mgv1a021350mg [Erythranthe guttata]
Length=485

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/387 (70%), Positives = 327/387 (84%), Gaps = 3/387 (1%)
 Frame = +2

Query  635   TEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDS--VPVGPMYRNASFFL  808
              ED  ++   TY+++E +EADLA+ R +I +   GG +T+D D   VP GPMY N   F 
Sbjct  84    NEDKYRNFTRTYSSLEMVEADLAQTRDAISQAKKGGNETRDPDPDYVPDGPMYWNPKVFH  143

Query  809   RSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFL  988
             RSY EMEK +KV+VYE+G PPV H+GPCK TYAIEG FI  M+ SRFRT D DKAHL+FL
Sbjct  144   RSYLEMEKKMKVFVYEEGDPPVFHFGPCKHTYAIEGIFISNMEVSRFRTMDQDKAHLFFL  203

Query  989   PFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEI  1168
             PFS+T++++++Y  +SH+W  MK  A DYVN +A+K+P+WNRSLGADHF+L+CHDWGPEI
Sbjct  204   PFSVTMITQVIYVKDSHEWGLMKNAASDYVNVIAQKHPYWNRSLGADHFMLACHDWGPEI  263

Query  1169  SFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFY  1348
             SFA+PNL+ N+IRALCNANTSERFDP +DVSIPEI LP GTT+G++GGP PSKRP+LVFY
Sbjct  264   SFAVPNLYKNAIRALCNANTSERFDPSRDVSIPEIHLPGGTTQGIIGGPPPSKRPILVFY  323

Query  1349  AGGLHGPVRPILLQHWENK-DEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMV  1525
             AGG+HGP+RPILL+HWENK D DVQ++ YLPK +SY GMMRKSRYCICPSGYEVASPRMV
Sbjct  324   AGGVHGPIRPILLEHWENKTDPDVQIYRYLPKNMSYYGMMRKSRYCICPSGYEVASPRMV  383

Query  1526  EALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRG  1705
             E LY+GCVPVLIK  YV PFSDVLNWE FAVI+PV DIPNLKKILTGIS ++Y++MQRRG
Sbjct  384   EGLYLGCVPVLIKDSYVIPFSDVLNWETFAVIVPVRDIPNLKKILTGISSKEYMKMQRRG  443

Query  1706  VKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             V++RRHFE+NSPPKR+DVFHMILHSIW
Sbjct  444   VQMRRHFEINSPPKRYDVFHMILHSIW  470



>ref|XP_011101498.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=486

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/399 (67%), Positives = 331/399 (83%), Gaps = 4/399 (1%)
 Frame = +2

Query  596   GDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRggggg-TQTKDDDSVP  772
             G  ER+     + T + R  KRY+  ++E +EADL +A A+I      G  QT+D D +P
Sbjct  76    GKPERREEGYKNATRNGRPEKRYS--DLEMVEADLVQAPAAIREAIVTGGNQTEDPDYIP  133

Query  773   VGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFR  952
              GPMY N+  F RSY EMEK LK+++YE+G PPV H+GPCK TYAIEG F+  M+ SRFR
Sbjct  134   NGPMYWNSKVFHRSYLEMEKRLKIFIYEEGDPPVFHFGPCKHTYAIEGIFMANMEVSRFR  193

Query  953   TTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADH  1132
             T D +KAHL+FLPFS+T++++++Y P SH+WS MK TA DY+N +A+K+P+WNR+LGADH
Sbjct  194   TFDHNKAHLFFLPFSVTMITQVIYVPESHEWSQMKNTASDYINVIAQKHPYWNRTLGADH  253

Query  1133  FILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGG  1312
             F+L+CHDWGPEISFAIPNL+ NSIRALCNANTSE+F+P +DVSIPEI LP G T+G++GG
Sbjct  254   FMLACHDWGPEISFAIPNLYKNSIRALCNANTSEQFNPSRDVSIPEIHLPGGGTRGMIGG  313

Query  1313  PSPSKRPVLVFYAGGLHGPVRPILLQHWENK-DEDVQVHSYLPKGVSYNGMMRKSRYCIC  1489
             P PSKRP+LVFYAGG+HGP+RPILL+HWENK D DVQ++ YLP+ VSY GMMRKSRYCIC
Sbjct  314   PPPSKRPILVFYAGGVHGPIRPILLEHWENKSDPDVQIYKYLPQNVSYYGMMRKSRYCIC  373

Query  1490  PSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGI  1669
             PSGYEVASPRMVE LYMGCVPVLIK GYV PFSDVLNWE FAVI+PV+DIPNLK ILT I
Sbjct  374   PSGYEVASPRMVEGLYMGCVPVLIKDGYVIPFSDVLNWETFAVIVPVKDIPNLKTILTAI  433

Query  1670  SQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
               ++Y++MQ+RG+++RRHFEVNSPPKR+DVFHMILHSIW
Sbjct  434   PMKKYVQMQQRGIQMRRHFEVNSPPKRYDVFHMILHSIW  472



>ref|XP_002528630.1| catalytic, putative [Ricinus communis]
 gb|EEF33733.1| catalytic, putative [Ricinus communis]
Length=574

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/381 (69%), Positives = 316/381 (83%), Gaps = 2/381 (1%)
 Frame = +2

Query  647   RKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEM  826
             + + +  +TN+ER+EA L  ARA+I +    G QT+D + VP+GPMY N+  F RSY EM
Sbjct  178   KTTHQKAFTNLERLEAGLQNARAAI-KEAKNGNQTEDPEYVPIGPMYWNSKVFHRSYLEM  236

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSIT  1003
             EK  KV+VYE+G+PPV H GPCKS Y++EGNFIH M+   +FRT DP+KAH+YFLPFS+ 
Sbjct  237   EKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHRMEIDDQFRTKDPEKAHVYFLPFSVA  296

Query  1004  VLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIP  1183
             ++ + VY  +SHD+ P+K T  DYVN VA KYP+WNRSLGADHF+L+CHDWGPE SF++P
Sbjct  297   MMVQFVYVRDSHDFGPIKRTVRDYVNLVAGKYPYWNRSLGADHFMLACHDWGPETSFSLP  356

Query  1184  NLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLH  1363
             +L  NSIRALCNANTSERF+P KDVS PEI L +GTTKG +GGPSPSKR +L F+AGGLH
Sbjct  357   DLAKNSIRALCNANTSERFNPIKDVSFPEINLQTGTTKGFIGGPSPSKRSILAFFAGGLH  416

Query  1364  GPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMG  1543
             GP+RPILL+HWENKD D++VH YLPKGVSY  MMRKS++C+CPSGYEVASPR+VEALY G
Sbjct  417   GPIRPILLEHWENKDNDMKVHRYLPKGVSYYEMMRKSKFCLCPSGYEVASPRVVEALYTG  476

Query  1544  CVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRH  1723
             CVPVLI   YV PFSDVLNW++F+V +PV DIPNLK+ILT IS RQYIRMQRR ++VRRH
Sbjct  477   CVPVLISDHYVPPFSDVLNWKSFSVEVPVSDIPNLKRILTSISSRQYIRMQRRVLQVRRH  536

Query  1724  FEVNSPPKRFDVFHMILHSIW  1786
             FEVNSPPKR+DVFHMILHSIW
Sbjct  537   FEVNSPPKRYDVFHMILHSIW  557



>ref|XP_009779883.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=550

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/374 (70%), Positives = 308/374 (82%), Gaps = 1/374 (0%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++N+ER+EA L ++RASI      G QT D D VP GPMY NA+ F RSY EMEK  KV+
Sbjct  163   FSNLERLEAKLWKSRASIKEAAMSGNQTDDSDYVPSGPMYWNANAFHRSYLEMEKQFKVF  222

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             VYE+G  P+ H GPCKS YA+EGNFI+ M+ ++FRT DP+KAH++FLP S+T +   +Y+
Sbjct  223   VYEEGDQPIFHNGPCKSIYAMEGNFIYQMETTKFRTRDPEKAHIFFLPISVTAIVHFIYD  282

Query  1028  PNSHD-WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
              NS + W+PMK T  DY+N VA KYP+WNRSLGADHFIL+CHDWGPEIS A+P L  NSI
Sbjct  283   RNSREHWNPMKQTLRDYINLVAGKYPYWNRSLGADHFILACHDWGPEISKAVPELFKNSI  342

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             RALCNANTSE F P KDVS PEI+LP GT  GL+GGPSPS+R +L F+AGGLHGP+RPIL
Sbjct  343   RALCNANTSEGFKPSKDVSFPEILLPGGTMDGLIGGPSPSRRSILAFFAGGLHGPIRPIL  402

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             L HWENKD+D+QVH YLPKGVSY GM+RKS+YC+CPSGYEVASPRMVEALY GCVPVL+K
Sbjct  403   LDHWENKDDDMQVHRYLPKGVSYYGMLRKSKYCLCPSGYEVASPRMVEALYTGCVPVLLK  462

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSDVLNW++F+V +PVE+IPNLK IL GIS RQYIR+QRRG +VRRHFEVN PP
Sbjct  463   DHYVPPFSDVLNWKSFSVEVPVEEIPNLKNILAGISTRQYIRLQRRGKQVRRHFEVNLPP  522

Query  1745  KRFDVFHMILHSIW  1786
             KR+DVFHMILHSIW
Sbjct  523   KRYDVFHMILHSIW  536



>ref|XP_004249790.2| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=472

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/376 (69%), Positives = 313/376 (83%), Gaps = 3/376 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQ--TKDDDSVPVGPMYRNASFFLRSYAEMEKTLK  841
             ++ ++++EA LAR+RA+IL      T    ++++ +P GPMY NA+ F RSY EMEK  K
Sbjct  83    FSKIDKLEAGLARSRAAILLSRQNKTNHIEEEEEYIPHGPMYLNATSFHRSYLEMEKKFK  142

Query  842   VYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             VYVY++G PP+ H+GPCK TYAIEG FI AM+ S+FRT +P+KAH+YFLP SIT+L + +
Sbjct  143   VYVYKEGDPPLYHFGPCKHTYAIEGYFIQAMEVSKFRTENPNKAHVYFLPLSITMLIEFI  202

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             Y   SH+W  MK T +DY+N +++KYP+WN SLGADHF+L+CHDWGPEISFAIP+L+ NS
Sbjct  203   YVAESHEWGLMKNTTMDYINVISQKYPYWNTSLGADHFMLACHDWGPEISFAIPHLYKNS  262

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IRALCNANTSE+F+P KDVSIPEI LP GTTKGLLGGP PS R VLVF+AGG+HGP+RPI
Sbjct  263   IRALCNANTSEKFNPTKDVSIPEIHLPLGTTKGLLGGPPPSDRRVLVFFAGGVHGPIRPI  322

Query  1382  LLQHWEN-KDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVL  1558
             LLQHWEN KDEDVQ+H YLPKGVSY  M+RKS+YCICPSGYEVASPRMVE LYMGCVPVL
Sbjct  323   LLQHWENSKDEDVQIHKYLPKGVSYYDMIRKSKYCICPSGYEVASPRMVEGLYMGCVPVL  382

Query  1559  IKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNS  1738
             IK  YV PFSDVL+W+ F V I V+DIPNLKKIL  I Q +Y+ MQ+RG+++RRHFEVNS
Sbjct  383   IKDNYVTPFSDVLDWDTFVVTIHVKDIPNLKKILMDIPQHKYLEMQKRGIQMRRHFEVNS  442

Query  1739  PPKRFDVFHMILHSIW  1786
             PPKR+DVFHMILHSIW
Sbjct  443   PPKRYDVFHMILHSIW  458



>ref|XP_006339310.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=427

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/406 (65%), Positives = 325/406 (80%), Gaps = 8/406 (2%)
 Frame = +2

Query  587   TGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASIL-----RgggggTQT  751
             T +  DE+      +  + +   KR++   +E++EA LARARA+IL     +      + 
Sbjct  10    TKMAIDEKDEVPIINVNKSTTTPKRFS--KIEKLEAGLARARAAILLLRQNKSNHIEEEE  67

Query  752   KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHA  931
             +DD+ +P GPMY NA+ F RSY EMEK  KVYVY++G+PP+ H+GPCK TYAIEG FI A
Sbjct  68    EDDEYIPHGPMYLNATSFHRSYLEMEKKFKVYVYKEGEPPLYHFGPCKQTYAIEGYFIQA  127

Query  932   MDFSRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWN  1111
             ++ S+FRT +P+KAH+YFLP S+T+L + +Y   SH+W  MK T +DYVN +++KYP+WN
Sbjct  128   IEVSKFRTENPNKAHVYFLPLSVTMLIEFIYVAESHEWGLMKNTTMDYVNVISQKYPYWN  187

Query  1112  RSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGT  1291
             RSLGADHF+L+CHDW PEISFAIP+L+ NSIRALCNANTSE+F+P KDVSIPEI LP GT
Sbjct  188   RSLGADHFMLACHDWAPEISFAIPHLYKNSIRALCNANTSEKFNPTKDVSIPEIHLPLGT  247

Query  1292  TKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWEN-KDEDVQVHSYLPKGVSYNGMMR  1468
             TKGLLGGP PS RPVLVF+AGG+HGP+RPILLQHWEN KDEDVQ+H YLPKGVSY  M+R
Sbjct  248   TKGLLGGPPPSDRPVLVFFAGGVHGPIRPILLQHWENSKDEDVQIHKYLPKGVSYYDMIR  307

Query  1469  KSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNL  1648
             KS+YCICPSGYEVASPRMVE LYMGCVPVLIK  YV PFSDVL+W+ F V I V+DIP L
Sbjct  308   KSKYCICPSGYEVASPRMVEGLYMGCVPVLIKDNYVTPFSDVLDWDTFVVTIHVKDIPKL  367

Query  1649  KKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             KKIL  I Q +Y+ MQ+RG+++RRHFEVNSPPKR+DVFHMILHSIW
Sbjct  368   KKILMDIPQDKYLEMQKRGIQMRRHFEVNSPPKRYDVFHMILHSIW  413



>ref|XP_009617933.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana tomentosiformis]
Length=550

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/374 (69%), Positives = 307/374 (82%), Gaps = 1/374 (0%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++N+ER+EA L + RA+I      G QT D D +P GPMY NA+ F RSY EMEK  KV+
Sbjct  163   FSNLERLEAKLGKFRAAIKEAATSGNQTDDADYIPSGPMYWNANAFHRSYLEMEKQFKVF  222

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             VYE+G  P+ H GPCKS YA+EGNFI+ M+ ++FRT DP+KAH++FLP S+T +   +Y+
Sbjct  223   VYEEGDQPIFHNGPCKSIYAMEGNFIYQMETTKFRTRDPEKAHIFFLPISVTAIVHFIYD  282

Query  1028  PNSHD-WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
              NS + W+PMK T  DY+N VA KYP+WNRSLGADHF+L+CHDWGPEIS A+P L  NSI
Sbjct  283   RNSKEHWNPMKQTLRDYINLVAGKYPYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  342

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             RALCNANTSE F P KDVS PEI+LP GT  GL+GGPSPS R +L F+AGGLHGP+RPIL
Sbjct  343   RALCNANTSEGFKPSKDVSFPEILLPGGTMDGLIGGPSPSHRSILAFFAGGLHGPIRPIL  402

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             L+HWENKD+D+QVH YLPKGVSY GM+RKS+YC+CPSGYEVASPRMVEALY GCVPVLIK
Sbjct  403   LEHWENKDDDIQVHRYLPKGVSYYGMLRKSKYCLCPSGYEVASPRMVEALYTGCVPVLIK  462

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSDVLNW++F+V + VE+IPNLKKIL GIS RQYIR+QRRG +VRRHFEVN PP
Sbjct  463   DHYVLPFSDVLNWKSFSVEVLVEEIPNLKKILAGISTRQYIRLQRRGKQVRRHFEVNMPP  522

Query  1745  KRFDVFHMILHSIW  1786
             KR+DVFHMILHSIW
Sbjct  523   KRYDVFHMILHSIW  536



>ref|XP_009617934.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana tomentosiformis]
Length=549

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/374 (69%), Positives = 307/374 (82%), Gaps = 1/374 (0%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++N+ER+EA L + RA+I      G QT D D +P GPMY NA+ F RSY EMEK  KV+
Sbjct  162   FSNLERLEAKLGKFRAAIKEAATSGNQTDDADYIPSGPMYWNANAFHRSYLEMEKQFKVF  221

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             VYE+G  P+ H GPCKS YA+EGNFI+ M+ ++FRT DP+KAH++FLP S+T +   +Y+
Sbjct  222   VYEEGDQPIFHNGPCKSIYAMEGNFIYQMETTKFRTRDPEKAHIFFLPISVTAIVHFIYD  281

Query  1028  PNSHD-WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
              NS + W+PMK T  DY+N VA KYP+WNRSLGADHF+L+CHDWGPEIS A+P L  NSI
Sbjct  282   RNSKEHWNPMKQTLRDYINLVAGKYPYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  341

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             RALCNANTSE F P KDVS PEI+LP GT  GL+GGPSPS R +L F+AGGLHGP+RPIL
Sbjct  342   RALCNANTSEGFKPSKDVSFPEILLPGGTMDGLIGGPSPSHRSILAFFAGGLHGPIRPIL  401

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             L+HWENKD+D+QVH YLPKGVSY GM+RKS+YC+CPSGYEVASPRMVEALY GCVPVLIK
Sbjct  402   LEHWENKDDDIQVHRYLPKGVSYYGMLRKSKYCLCPSGYEVASPRMVEALYTGCVPVLIK  461

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSDVLNW++F+V + VE+IPNLKKIL GIS RQYIR+QRRG +VRRHFEVN PP
Sbjct  462   DHYVLPFSDVLNWKSFSVEVLVEEIPNLKKILAGISTRQYIRLQRRGKQVRRHFEVNMPP  521

Query  1745  KRFDVFHMILHSIW  1786
             KR+DVFHMILHSIW
Sbjct  522   KRYDVFHMILHSIW  535



>gb|KDP29231.1| hypothetical protein JCGZ_16620 [Jatropha curcas]
Length=452

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/393 (66%), Positives = 315/393 (80%), Gaps = 1/393 (0%)
 Frame = +2

Query  611   QNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYR  790
             +N  SS D     K ++  Y+++ER+EA L  AR++I     G    +D + VP GPMY 
Sbjct  43    KNASSSIDLSIKSKHQKEYYSSLERLEAGLQNARSAIKDAKNGNQTLEDPEYVPTGPMYW  102

Query  791   NASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPD  967
             N+  F RSY EMEK  +V+VYE+G+PPV H GPCKS Y++EGNFIH M+   +FRT DPD
Sbjct  103   NSKVFHRSYLEMEKQFRVFVYEEGEPPVFHNGPCKSIYSMEGNFIHRMEIDDQFRTKDPD  162

Query  968   KAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSC  1147
             KAH+YFLPFS+T++ + VY  +SHD+ P++ T  DYV+ +A KYPFWNRSLGADHF+L+C
Sbjct  163   KAHVYFLPFSVTMMVRFVYVRDSHDFGPIRRTVGDYVSLIAGKYPFWNRSLGADHFMLAC  222

Query  1148  HDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSK  1327
             HDWGPE SF++P L  NSIRALCNANTSERF+P KDVS PEI L +G+TKGL+GGPSPSK
Sbjct  223   HDWGPETSFSVPYLGKNSIRALCNANTSERFNPIKDVSFPEINLQTGSTKGLIGGPSPSK  282

Query  1328  RPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEV  1507
             R +L FYAGGLHGP+RPILL HWENKD+D++VH YLPKGVSY  MMRKS++C+CPSGYEV
Sbjct  283   RSILAFYAGGLHGPIRPILLAHWENKDDDIKVHRYLPKGVSYYEMMRKSKFCLCPSGYEV  342

Query  1508  ASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYI  1687
             ASPR+VEA Y GCVPVLI   YV PFSDVLNW++F+V +PV  IPNLK+ILT IS RQYI
Sbjct  343   ASPRVVEAFYTGCVPVLISDHYVPPFSDVLNWKSFSVEVPVSKIPNLKRILTSISPRQYI  402

Query  1688  RMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             RMQRR  ++RRHFEVNSPPKR+DVFHMILHSIW
Sbjct  403   RMQRRVQQIRRHFEVNSPPKRYDVFHMILHSIW  435



>ref|XP_010543482.1| PREDICTED: probable glycosyltransferase At5g03795 [Tarenaya hassleriana]
Length=489

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/378 (68%), Positives = 313/378 (83%), Gaps = 2/378 (1%)
 Frame = +2

Query  656   KRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKT  835
             K+   +NME+IEA+L RARA+I +G        D D VP+GPMY NA  F RSY EMEK 
Sbjct  102   KKRILSNMEKIEAELQRARAAI-KGASFEDDMDDPDYVPLGPMYWNAKVFHRSYLEMEKQ  160

Query  836   LKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLS  1012
              K++VY++G+PP+ H GPCKS Y++EGNFI+ M+  +RFRTTDPD+AH ++LP S+  + 
Sbjct  161   FKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYQMETDTRFRTTDPDRAHAFYLPLSVVKMV  220

Query  1013  KLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLH  1192
             + VYE +SHD+SP++ T  DY++ V  KYP+WNRS+GADHFILSCHDWGPE SF+ P L 
Sbjct  221   RYVYERDSHDFSPIRKTVRDYIDLVDGKYPYWNRSIGADHFILSCHDWGPEASFSHPQLG  280

Query  1193  NNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPV  1372
              NSIRALCNANTSERF P+KDVSIPEI L +GT  GL+GGPSPS+RP+L F+AGG+HGPV
Sbjct  281   ENSIRALCNANTSERFKPRKDVSIPEINLRTGTLTGLVGGPSPSRRPILAFFAGGVHGPV  340

Query  1373  RPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVP  1552
             RPILL+HWEN+DEDV+VH YLPKG SY+ MMR S++CICPSGYEVASPR+VEALY GCVP
Sbjct  341   RPILLKHWENRDEDVRVHKYLPKGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVP  400

Query  1553  VLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEV  1732
             VLI  GYV PFSDVLNW +F+V++PVE+IPNLKKIL GIS RQYIRM RR +KV+RHF+V
Sbjct  401   VLINEGYVPPFSDVLNWRSFSVVVPVEEIPNLKKILMGISPRQYIRMYRRVLKVQRHFQV  460

Query  1733  NSPPKRFDVFHMILHSIW  1786
             NSPPKRFDVFHMILHSIW
Sbjct  461   NSPPKRFDVFHMILHSIW  478



>ref|XP_004246587.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Solanum lycopersicum]
Length=534

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/374 (67%), Positives = 306/374 (82%), Gaps = 1/374 (0%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             +TN+E++E  L +ARA+I      G QT D D VP GPMY NA  F RSY EMEK LKV+
Sbjct  147   FTNLEKLEVKLGKARAAIKEAATFGNQTDDSDYVPSGPMYWNAKAFHRSYLEMEKELKVF  206

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             VYE+G+ P+ H GPCKS YA+EGNFI+ M+ S+FRT DP+KAH++FLP S+T +   +Y+
Sbjct  207   VYEEGEQPIFHNGPCKSIYAMEGNFIYQMETSKFRTRDPEKAHVFFLPISVTSIVHFIYD  266

Query  1028  PNSHD-WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
              NS   W PM+ T +DY+N V+ KYP+WNRSLGADHF+L+CHDWGPE+S ++P L  NSI
Sbjct  267   RNSRGHWDPMRQTVMDYINLVSGKYPYWNRSLGADHFMLACHDWGPELSKSVPELFKNSI  326

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             RALCNANTSE F P KDVS PEI+LP GT  GLLGGPSPS+R +L F+AGGLHGP+RPIL
Sbjct  327   RALCNANTSEGFKPSKDVSFPEILLPGGTMNGLLGGPSPSRRSILAFFAGGLHGPIRPIL  386

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             L+HWENKD+D+QVH YLPKGVSY GM+R S++C+CPSGYEVASPRMVEALY GCVPVL+K
Sbjct  387   LEHWENKDDDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRMVEALYTGCVPVLLK  446

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSDVLNW++F+V +PV+ IP+LKKIL+GIS RQYIR+QRRG +VRRHFEVN   
Sbjct  447   DHYVPPFSDVLNWKSFSVEVPVDRIPDLKKILSGISTRQYIRLQRRGKQVRRHFEVNMFA  506

Query  1745  KRFDVFHMILHSIW  1786
             KR+DVFHMILHS+W
Sbjct  507   KRYDVFHMILHSVW  520



>ref|XP_010325948.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Solanum lycopersicum]
Length=535

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/374 (67%), Positives = 306/374 (82%), Gaps = 1/374 (0%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             +TN+E++E  L +ARA+I      G QT D D VP GPMY NA  F RSY EMEK LKV+
Sbjct  148   FTNLEKLEVKLGKARAAIKEAATFGNQTDDSDYVPSGPMYWNAKAFHRSYLEMEKELKVF  207

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             VYE+G+ P+ H GPCKS YA+EGNFI+ M+ S+FRT DP+KAH++FLP S+T +   +Y+
Sbjct  208   VYEEGEQPIFHNGPCKSIYAMEGNFIYQMETSKFRTRDPEKAHVFFLPISVTSIVHFIYD  267

Query  1028  PNSHD-WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
              NS   W PM+ T +DY+N V+ KYP+WNRSLGADHF+L+CHDWGPE+S ++P L  NSI
Sbjct  268   RNSRGHWDPMRQTVMDYINLVSGKYPYWNRSLGADHFMLACHDWGPELSKSVPELFKNSI  327

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             RALCNANTSE F P KDVS PEI+LP GT  GLLGGPSPS+R +L F+AGGLHGP+RPIL
Sbjct  328   RALCNANTSEGFKPSKDVSFPEILLPGGTMNGLLGGPSPSRRSILAFFAGGLHGPIRPIL  387

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             L+HWENKD+D+QVH YLPKGVSY GM+R S++C+CPSGYEVASPRMVEALY GCVPVL+K
Sbjct  388   LEHWENKDDDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRMVEALYTGCVPVLLK  447

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSDVLNW++F+V +PV+ IP+LKKIL+GIS RQYIR+QRRG +VRRHFEVN   
Sbjct  448   DHYVPPFSDVLNWKSFSVEVPVDRIPDLKKILSGISTRQYIRLQRRGKQVRRHFEVNMFA  507

Query  1745  KRFDVFHMILHSIW  1786
             KR+DVFHMILHS+W
Sbjct  508   KRYDVFHMILHSVW  521



>ref|XP_006366795.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=519

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/374 (67%), Positives = 305/374 (82%), Gaps = 1/374 (0%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             +TN+E++E  L +ARA+I      G QT D D VP GPMY N   F RSY EMEK  KV+
Sbjct  132   FTNLEKLEVKLGKARAAIKEAAVSGNQTDDSDYVPSGPMYWNPKAFHRSYLEMEKEFKVF  191

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             VYE+G+ P+ H GPCKS YA+EGNFI+ M+ S+FRT DP+KAH++FLP S+T +   +Y+
Sbjct  192   VYEEGEQPIFHNGPCKSIYAMEGNFIYQMETSKFRTRDPEKAHVFFLPISVTSIVHFIYD  251

Query  1028  PNSHD-WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
              NS + W+PMK T  DY+N V+ KYP+WNRSLGADHF+L+CHDWGPE+S A+P L  NSI
Sbjct  252   RNSREHWNPMKQTLTDYINLVSGKYPYWNRSLGADHFMLACHDWGPELSKAVPELFKNSI  311

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             RALCNANTSE F P KDVS PEI+LP GT  GL+GGPSPS+R +L F+AGGLHGP+RPIL
Sbjct  312   RALCNANTSEGFKPSKDVSFPEILLPGGTMNGLIGGPSPSRRSILAFFAGGLHGPIRPIL  371

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             L+HWENKD+D+QVH YLPKGVSY GM+R S++C+CPSGYEVASPRMVEALY GCVPVL+K
Sbjct  372   LEHWENKDDDIQVHRYLPKGVSYYGMLRNSKFCLCPSGYEVASPRMVEALYTGCVPVLLK  431

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSDVLNW++F+V +PV+ IP+LKKIL GIS RQYIR+QRRG +VRRHFEVN  P
Sbjct  432   DHYVPPFSDVLNWKSFSVEVPVDRIPDLKKILAGISTRQYIRLQRRGKQVRRHFEVNMIP  491

Query  1745  KRFDVFHMILHSIW  1786
             +R+DVFHMILHS+W
Sbjct  492   QRYDVFHMILHSVW  505



>ref|XP_002284018.2| PREDICTED: probable glycosyltransferase At5g03795 [Vitis vinifera]
Length=546

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/374 (69%), Positives = 307/374 (82%), Gaps = 2/374 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             YT +ER+EA L RAR++I R    G +T D D +P GP+Y N + F RSY EMEK LKVY
Sbjct  159   YTTLERVEAGLRRARSAI-REAKIGNRTPDPDYIPNGPIYWNVNAFHRSYLEMEKQLKVY  217

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVY  1024
             VY++G+PP+ H GPCKS Y++EGNFIH M+  S FRT DP+KAHL+FLPFS+ +L + VY
Sbjct  218   VYDEGEPPLFHNGPCKSIYSMEGNFIHKMEMDSHFRTKDPEKAHLFFLPFSVAMLVRFVY  277

Query  1025  EPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
               +SHD  P+K T +DYVN V+ KYP+WNRSLGADHF+L+CHDWGPE SF+IP LH NSI
Sbjct  278   VRDSHDLGPIKQTVIDYVNVVSTKYPYWNRSLGADHFMLACHDWGPETSFSIPYLHKNSI  337

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             R LCNANTSE F+P KDVS PEI L +G+T   +GGPSPS R +L F+AGGLHGP+RPIL
Sbjct  338   RVLCNANTSEGFNPSKDVSFPEINLLTGSTDSFIGGPSPSHRTLLAFFAGGLHGPIRPIL  397

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             L+HWENKDEDV+VH YLPKGVSY  MMRKS+YC+CPSGYEVASPR+VEALY GCVPVLI 
Sbjct  398   LEHWENKDEDVKVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEALYTGCVPVLIS  457

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSDVLNW++F+V +PV +IPNLK+IL  IS RQYIRMQRRG++ RRHFEVNSPP
Sbjct  458   DHYVPPFSDVLNWKSFSVEVPVREIPNLKRILMDISPRQYIRMQRRGIQARRHFEVNSPP  517

Query  1745  KRFDVFHMILHSIW  1786
             KR+DVFHMILHS+W
Sbjct  518   KRYDVFHMILHSLW  531



>ref|XP_004494122.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=526

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/374 (68%), Positives = 309/374 (83%), Gaps = 2/374 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++ ++R EA L +ARA+I R    G QT+D D VP+GPMY N + F RSY EMEK  KV+
Sbjct  142   FSILDRTEAGLLQARAAI-RKARNGNQTQDIDYVPIGPMYYNPNAFHRSYLEMEKQFKVF  200

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSITVLSKLVY  1024
             VYE+G+PPV H GPCKS Y++EGNFIH ++ + +FRT DPDKAH++FLPFS+ ++ + VY
Sbjct  201   VYEEGEPPVFHNGPCKSIYSMEGNFIHTIEMNDQFRTRDPDKAHVFFLPFSVAMMVQFVY  260

Query  1025  EPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
               +SHD+SP+K T  DY+N ++ +YPFWNRSLGADHF+LSCHDWGPE+S ++PNL+ NSI
Sbjct  261   VRDSHDFSPIKKTVADYINVISERYPFWNRSLGADHFMLSCHDWGPEVSNSVPNLYKNSI  320

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             RALCNANTSE F P KDVS PEI L +GT  G +GGPSPSKR VL F+AGGLHGP+RPIL
Sbjct  321   RALCNANTSEGFKPAKDVSFPEINLQTGTIHGFVGGPSPSKRSVLAFFAGGLHGPIRPIL  380

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             L HWENKDED+QVH YLPKGVSY  M+RKS++C+CPSGYEVASPR+VEA+Y GCVPVLI 
Sbjct  381   LDHWENKDEDIQVHKYLPKGVSYYDMLRKSKFCLCPSGYEVASPRVVEAIYTGCVPVLIS  440

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSDVLNW++F+V + V+DIPNLKKIL  IS RQYIRMQRR  +VRRHFEV+SPP
Sbjct  441   DHYVPPFSDVLNWKSFSVEVSVDDIPNLKKILLSISPRQYIRMQRRVGQVRRHFEVHSPP  500

Query  1745  KRFDVFHMILHSIW  1786
             KRFDVFHMILHSIW
Sbjct  501   KRFDVFHMILHSIW  514



>gb|KEH24081.1| glycosyltransferase [Medicago truncatula]
Length=401

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/374 (68%), Positives = 307/374 (82%), Gaps = 2/374 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++ ++R EA L +ARA+I R      +T+D D VP GPMY N + F RSY EMEK  KV+
Sbjct  17    FSILDRTEAGLLQARAAI-RKARNENRTQDIDYVPTGPMYHNPNSFHRSYLEMEKQFKVF  75

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSITVLSKLVY  1024
             VYE+G+PPV H GPCKS Y++EGNFIHA++ + RFRT DP+KAH++FLPFS+  + + VY
Sbjct  76    VYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDRFRTRDPEKAHVFFLPFSVAKMVQFVY  135

Query  1025  EPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
               +SHD+SP++ T  DY+N V+ KYPFWNRSLGADHF+LSCHDWGPE S ++PNL+ NSI
Sbjct  136   VRDSHDFSPIRKTITDYINVVSEKYPFWNRSLGADHFMLSCHDWGPETSKSVPNLYKNSI  195

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             RALCNANTSE F P KDVSIPE  L +GT  G++GGPSPSKR VL F+AGG+HGPVRP+L
Sbjct  196   RALCNANTSEGFKPAKDVSIPETNLQTGTIHGIVGGPSPSKRSVLAFFAGGVHGPVRPVL  255

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             L+HWE+KDED+QVH YLPKGVSY  M+RKS++C+CPSGYEVASPR+VEA+Y GCVPVLI 
Sbjct  256   LEHWEHKDEDLQVHKYLPKGVSYYDMLRKSKFCLCPSGYEVASPRVVEAIYTGCVPVLIS  315

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSDVLNW++F+V + V DIPNLKKILT IS RQYIRMQRR  +VRRHFEV+SPP
Sbjct  316   DHYVPPFSDVLNWKSFSVEVSVNDIPNLKKILTSISPRQYIRMQRRVGQVRRHFEVHSPP  375

Query  1745  KRFDVFHMILHSIW  1786
              RFDVFHMILHSIW
Sbjct  376   TRFDVFHMILHSIW  389



>ref|XP_010098868.1| putative glycosyltransferase [Morus notabilis]
 gb|EXB75956.1| putative glycosyltransferase [Morus notabilis]
Length=465

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/381 (67%), Positives = 311/381 (82%), Gaps = 3/381 (1%)
 Frame = +2

Query  650   KSKRY-TYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEM  826
             K++R+  Y+++ER+EA L +AR++I      G +T+D + VP GPMY N+  F RSY EM
Sbjct  74    KARRHREYSDLERLEARLMKARSAI-SEAKVGNETQDPEYVPTGPMYWNSKAFHRSYIEM  132

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSIT  1003
             EK  KV+VYE+G+PP+ H GPCKS Y++EGNFIH ++  S+FRT DP+KAH++FLPFS+T
Sbjct  133   EKEFKVFVYEEGEPPLFHNGPCKSIYSMEGNFIHEIEMNSQFRTKDPNKAHVFFLPFSVT  192

Query  1004  VLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIP  1183
             +L + VY  +SHD+ P+K T +DYVN V+ K+PFWNRSL ADHF+LSCHDWGPE S +  
Sbjct  193   MLVRYVYVRDSHDFHPIKQTVIDYVNVVSEKHPFWNRSLAADHFMLSCHDWGPEASRSNR  252

Query  1184  NLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLH  1363
              LH NSIR LCNANTSE F+P KDVS PEI L SG T GLLGGPS S+RP L F+AGG+H
Sbjct  253   FLHQNSIRVLCNANTSEGFNPSKDVSFPEINLLSGATDGLLGGPSASRRPNLAFFAGGVH  312

Query  1364  GPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMG  1543
             GP+RPILL+HWENKDED+++  YLPKGVSY  M+RKS+YCICPSGYEVASPR+VEA+Y G
Sbjct  313   GPIRPILLEHWENKDEDMKIQQYLPKGVSYYDMLRKSKYCICPSGYEVASPRIVEAIYTG  372

Query  1544  CVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRH  1723
             CVPVLI   YV PFSDVLNW++F+V +PV+DIPNLK IL  IS RQYIRMQRR +KVRRH
Sbjct  373   CVPVLISDHYVPPFSDVLNWKSFSVEVPVKDIPNLKTILMSISPRQYIRMQRRVLKVRRH  432

Query  1724  FEVNSPPKRFDVFHMILHSIW  1786
             FEVNSPPKRFDVFHMILHS+W
Sbjct  433   FEVNSPPKRFDVFHMILHSVW  453



>ref|XP_007162830.1| hypothetical protein PHAVU_001G184500g [Phaseolus vulgaris]
 gb|ESW34824.1| hypothetical protein PHAVU_001G184500g [Phaseolus vulgaris]
Length=537

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/381 (66%), Positives = 307/381 (81%), Gaps = 2/381 (1%)
 Frame = +2

Query  647   RKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEM  826
             R   +  ++ ++R EA L +ARA+I R    G QT+D D VP+GPMY NA  F RS+ EM
Sbjct  141   RPKLQRKFSILDRTEAGLVKARAAI-REARNGNQTQDADYVPIGPMYMNAKAFHRSFLEM  199

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSIT  1003
             EK LKVYVYE+G+ PV H GPCKS Y++EGNFIH ++ + +FRT DP+KAH++FLPFS+ 
Sbjct  200   EKQLKVYVYEEGEAPVFHNGPCKSIYSMEGNFIHGIEMNEKFRTRDPEKAHVFFLPFSVA  259

Query  1004  VLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIP  1183
             +L + VY  +SHD+ P+K T  DYVN +A +YP+WNRSLGADHF ++CHDWGPE S ++P
Sbjct  260   MLVQFVYVRDSHDFGPIKKTVTDYVNVIAGRYPYWNRSLGADHFYIACHDWGPETSRSVP  319

Query  1184  NLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLH  1363
             NL +NSIR LCNANTSE F P KDVS+PEI L SG+  GL+GGPS SKRP+L F+AGGLH
Sbjct  320   NLQDNSIRVLCNANTSEGFKPSKDVSLPEINLQSGSINGLIGGPSASKRPLLAFFAGGLH  379

Query  1364  GPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMG  1543
             GP+RPILL+HWENK ED+QVH YLPKGVSY  M+RKSR+C+CPSGYEVASPR+VEA+Y G
Sbjct  380   GPIRPILLEHWENKQEDMQVHRYLPKGVSYYEMLRKSRFCLCPSGYEVASPRVVEAIYTG  439

Query  1544  CVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRH  1723
             CVPVLI   YV PFSDVLNW++F+V + VEDIP LK IL  IS  QYIRMQRR V+VRRH
Sbjct  440   CVPVLISDHYVPPFSDVLNWKSFSVEVSVEDIPKLKDILLSISPTQYIRMQRRVVQVRRH  499

Query  1724  FEVNSPPKRFDVFHMILHSIW  1786
             FEV+SPPKRFDVFHMILHS+W
Sbjct  500   FEVHSPPKRFDVFHMILHSVW  520



>ref|XP_009122667.1| PREDICTED: probable glycosyltransferase At5g03795 [Brassica rapa]
 emb|CDX70282.1| BnaA10g26310D [Brassica napus]
Length=501

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/378 (66%), Positives = 305/378 (81%), Gaps = 2/378 (1%)
 Frame = +2

Query  656   KRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKT  835
             K+   +N+E+IE +L +AR +I +         D D  P+GPMY NA  F RSY EMEK 
Sbjct  114   KKRVISNLEKIEFELQKARVAI-KAASMNDPLDDPDYAPLGPMYWNAKAFHRSYLEMEKQ  172

Query  836   LKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLS  1012
              K++VY++G+PP+ H GPCKS Y++EGNFI+ M+  +RFRT +P+KAH ++LP S+  + 
Sbjct  173   FKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYEMETNTRFRTNNPEKAHAFYLPLSVVKMV  232

Query  1013  KLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLH  1192
             + VYE +SHD+SP++ T  DY++ V  KYP+WNRS+GADHFILSCHDWGPE SF+ P+L 
Sbjct  233   RYVYERDSHDFSPIRKTVRDYIDLVGDKYPYWNRSIGADHFILSCHDWGPEASFSHPHLG  292

Query  1193  NNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPV  1372
              NSIRALCNANTSERF P+KDVSIPEI L +G+ KGL+GGPSPS RP+L F+AGG+HGPV
Sbjct  293   QNSIRALCNANTSERFKPRKDVSIPEINLLTGSLKGLVGGPSPSSRPILAFFAGGVHGPV  352

Query  1373  RPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVP  1552
             RP+LLQHWENKD D++VH YLPKG SY+ MMR S++CICPSGYEVASPR+VEALY GCVP
Sbjct  353   RPVLLQHWENKDSDIRVHKYLPKGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVP  412

Query  1553  VLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEV  1732
             VLI  GYV PFSDVLNW +F+VI+ VEDIPNLK ILT IS RQY+RM RR +KVRRHFEV
Sbjct  413   VLINSGYVPPFSDVLNWASFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVRRHFEV  472

Query  1733  NSPPKRFDVFHMILHSIW  1786
             NSP KRFDVFHMILHSIW
Sbjct  473   NSPAKRFDVFHMILHSIW  490



>ref|XP_004156325.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cucumis 
sativus]
Length=516

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/406 (63%), Positives = 321/406 (79%), Gaps = 6/406 (1%)
 Frame = +2

Query  584   ETGIGDDERQNGISSDDTEDS----RKSKRYTYTNMERIEADLARARASILRgggggTQT  751
             ET    +E    +S++ + +S    R  ++  YT +ERIEA L RARA+ +R      QT
Sbjct  103   ETATTINEVIRKVSNESSYESAVKVRARRQREYTKLERIEAGLRRARAA-IREAKFLNQT  161

Query  752   KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHA  931
             +D D VP GPMY N+  F RSY EMEK +K++VYE+G+PP+ H GPCKS Y+ EGNFIHA
Sbjct  162   QDPDFVPSGPMYWNSKAFHRSYLEMEKEMKIFVYEEGEPPLFHNGPCKSIYSTEGNFIHA  221

Query  932   MDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFW  1108
             ++  S+FRT DP+KAH++FLP S+ +L + VY  +SHD++P++ T +DY+N +  KYPFW
Sbjct  222   IEMDSQFRTKDPNKAHVFFLPLSVAMLVRFVYVHDSHDFTPIRHTVVDYINVIGTKYPFW  281

Query  1109  NRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG  1288
             NRSLGADHF+LSCHDWGPE S ++PNL+ NSIR LCNANTSE F+P KDVS PEI L +G
Sbjct  282   NRSLGADHFMLSCHDWGPEASKSVPNLYKNSIRVLCNANTSEGFNPSKDVSFPEINLQTG  341

Query  1289  TTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMR  1468
                G LGGPSPS RP+L F+AGGLHGP+RPIL+Q WEN+D+D+QVH YLPKGVSY  MMR
Sbjct  342   HLTGFLGGPSPSHRPILAFFAGGLHGPIRPILIQQWENQDQDIQVHQYLPKGVSYIDMMR  401

Query  1469  KSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNL  1648
             KS++C+CPSGYEVASPR+VEA+Y GCVPVLI   YV PFSDV+NW++F+V + V+DIPNL
Sbjct  402   KSKFCLCPSGYEVASPRIVEAIYTGCVPVLISDHYVPPFSDVINWKSFSVEVSVDDIPNL  461

Query  1649  KKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             K ILTGIS RQY+RM RR VKVRRHFEVNSPPKR+DV+HMILHS+W
Sbjct  462   KTILTGISTRQYLRMYRRVVKVRRHFEVNSPPKRYDVYHMILHSVW  507



>dbj|BAB08605.1| unnamed protein product [Arabidopsis thaliana]
Length=408

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/393 (65%), Positives = 312/393 (79%), Gaps = 4/393 (1%)
 Frame = +2

Query  611   QNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYR  790
              N +SS  T      KR   +N+E+IE  L +ARASI +         D D VP+GPMY 
Sbjct  8     SNNVSS--TASLEPKKRRVLSNLEKIEFKLQKARASI-KAASMDDPVDDPDYVPLGPMYW  64

Query  791   NASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPD  967
             NA  F RSY EMEK  K+YVY++G+PP+ H GPCKS Y++EG+FI+ ++  +RFRT +PD
Sbjct  65    NAKVFHRSYLEMEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEIETDTRFRTNNPD  124

Query  968   KAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSC  1147
             KAH+++LPFS+  + + VYE NS D+SP++ T  DY+N V  KYP+WNRS+GADHFILSC
Sbjct  125   KAHVFYLPFSVVKMVRYVYERNSRDFSPIRNTVKDYINLVGDKYPYWNRSIGADHFILSC  184

Query  1148  HDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSK  1327
             HDWGPE SF+ P+L +NSIRALCNANTSERF P+KDVSIPEI L +G+  GL+GGPSPS 
Sbjct  185   HDWGPEASFSHPHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSS  244

Query  1328  RPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEV  1507
             RP+L F+AGG+HGPVRP+LLQHWENKD D++VH YLP+G SY+ MMR S++CICPSGYEV
Sbjct  245   RPILAFFAGGVHGPVRPVLLQHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEV  304

Query  1508  ASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYI  1687
             ASPR+VEALY GCVPVLI  GYV PFSDVLNW +F+VI+ VEDIPNLK ILT IS RQY+
Sbjct  305   ASPRIVEALYSGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYL  364

Query  1688  RMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             RM RR +KVRRHFEVNSP KRFDVFHMILHSIW
Sbjct  365   RMYRRVLKVRRHFEVNSPAKRFDVFHMILHSIW  397



>ref|XP_010242926.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=530

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/455 (57%), Positives = 326/455 (72%), Gaps = 7/455 (2%)
 Frame = +2

Query  428   ATEEEIGKGLPHESNVTGVSRLPALVTTEEEIDKGLHENNVTGDSRPILLAPETGIGDDE  607
             A  +E G+       + G    P ++   EE  K    N    D  P+++         E
Sbjct  66    AVMKEAGEDSKSAERLNGSGVAPIIMKVAEEDSKSDRINGSNVD--PVIMKVAEENSKSE  123

Query  608   RQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRggggg-TQTKDDDSVPVGPM  784
             R NG    D   +    +  +T +ER+EA LA+ RA+I         QT D D VP GPM
Sbjct  124   RING---SDVAPTIIKMQKNHTQLERLEAGLAKIRAAIREAAHQKGNQTSDFDYVPEGPM  180

Query  785   YRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTD  961
             Y NA  F RSY  MEK  K+++Y++G+PP+ H GPC+S Y++EGNFIH ++   RFRT +
Sbjct  181   YWNAQAFHRSYLVMEKQFKIFIYDEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRN  240

Query  962   PDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFIL  1141
             P +AH +FLPFS+T + + VY PNSHD  P+K T +DYVN +A KYP+WNRSL ADHF+L
Sbjct  241   PKEAHAFFLPFSVTKMVRFVYVPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFML  300

Query  1142  SCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSP  1321
             SCHDWGP  S  +P+L+ N IR LCNANTSE F+P KD S PEI L +G TKG +GGPSP
Sbjct  301   SCHDWGPLTSSYVPHLYKNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGFIGGPSP  360

Query  1322  SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGY  1501
             S+RP+L F+AGGLHGP+RP+LL+HW+NKDEDV+V+ YLPKG+SY  MM+KS+YCICPSGY
Sbjct  361   SRRPILXFFAGGLHGPIRPVLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGY  420

Query  1502  EVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQ  1681
             EVASPR+VEA+Y GCVPVLI   YV PFSDVLNW++F+V +PV +IPNLK+IL  IS RQ
Sbjct  421   EVASPRIVEAIYAGCVPVLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSISTRQ  480

Query  1682  YIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             YIRMQRRG+KVRRHFEVN PPKRFDV+HMILHS+W
Sbjct  481   YIRMQRRGLKVRRHFEVNFPPKRFDVYHMILHSVW  515



>ref|XP_010039055.1| PREDICTED: probable glycosyltransferase At5g03795 [Eucalyptus 
grandis]
Length=562

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/373 (67%), Positives = 304/373 (82%), Gaps = 2/373 (1%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYV  850
             T++ER+EA L RAR+ I R    G   +D D VPVGPMYRNA+ F RSY EMEK  K++V
Sbjct  179   TDLERLEAGLRRARSGI-REAKTGNPMEDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFV  237

Query  851   YEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             Y++G PPV H GPCKS YA+EGNFIH ++ + RFRT DP +AH++FLPFS+ ++ + VY 
Sbjct  238   YKEGDPPVFHNGPCKSIYAMEGNFIHMVEINKRFRTEDPREAHVFFLPFSVAMMVQFVYV  297

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
              +SHD+ P+K T +DY++ VA KYP+WNRSLGADHF+L+CHDWGPE SFA+P+LH NSIR
Sbjct  298   RDSHDFGPIKRTVIDYIDVVASKYPYWNRSLGADHFMLACHDWGPEASFAVPHLHRNSIR  357

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
              LCNANTSE FDP KDVS PE+ L +G   GL+GGPSPS R +L F+AGGLHGP+RPILL
Sbjct  358   VLCNANTSEGFDPSKDVSFPEVNLHTGAIGGLIGGPSPSHRSILAFFAGGLHGPIRPILL  417

Query  1388  QHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             QHWENKDEDV+VH YLP+GVSY  MM++S++CICPSGYEVASPR+VEA+Y GCVPVLI  
Sbjct  418   QHWENKDEDVKVHRYLPRGVSYYDMMKRSKFCICPSGYEVASPRVVEAIYTGCVPVLISD  477

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
              YV PFSDVLNW +F+V + V +IPNLK IL  IS RQYIRMQRR  +VRRHFEV+SPPK
Sbjct  478   HYVPPFSDVLNWRSFSVEVTVREIPNLKTILASISSRQYIRMQRRVAQVRRHFEVHSPPK  537

Query  1748  RFDVFHMILHSIW  1786
             R+DVFHMILHS+W
Sbjct  538   RYDVFHMILHSVW  550



>ref|XP_004143371.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cucumis 
sativus]
 gb|KGN48221.1| hypothetical protein Csa_6G449280 [Cucumis sativus]
Length=516

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/406 (63%), Positives = 321/406 (79%), Gaps = 6/406 (1%)
 Frame = +2

Query  584   ETGIGDDERQNGISSDDTEDS----RKSKRYTYTNMERIEADLARARASILRgggggTQT  751
             ET    +E    +S++ + +S    R  ++  YT +ERIEA L RARA+ +R      QT
Sbjct  103   ETATTINEVIRKVSNESSYESAVKVRARRQREYTKLERIEAGLRRARAA-IREAKFLNQT  161

Query  752   KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHA  931
             +D D VP GPMY N+  F RSY EMEK +K++VYE+G+PP+ H GPCKS Y+ EGNFIHA
Sbjct  162   QDPDFVPSGPMYWNSKAFHRSYLEMEKEMKIFVYEEGEPPLFHNGPCKSIYSTEGNFIHA  221

Query  932   MDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFW  1108
             ++  S+FRT DP+KAH++FLP S+ +L + VY  +SHD++P++ T +DY+N +  KYPFW
Sbjct  222   IEMDSQFRTKDPNKAHVFFLPLSVAMLVRFVYVHDSHDFTPIRHTVVDYINVIGTKYPFW  281

Query  1109  NRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG  1288
             NRSLGADHF+LSCHDWGPE S ++PNL+ NSIR LCNANTSE F+P KDVS PEI L +G
Sbjct  282   NRSLGADHFMLSCHDWGPEASKSVPNLYKNSIRVLCNANTSEGFNPSKDVSFPEINLQTG  341

Query  1289  TTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMR  1468
                G LGGPSPS RP++ F+AGGLHGP+RPIL+Q WEN+D+D+QVH YLPKGVSY  MMR
Sbjct  342   HLTGFLGGPSPSHRPIMAFFAGGLHGPIRPILIQRWENQDQDIQVHQYLPKGVSYIDMMR  401

Query  1469  KSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNL  1648
             KS++C+CPSGYEVASPR+VEA+Y GCVPVLI   YV PFSDV+NW++F+V + V+DIPNL
Sbjct  402   KSKFCLCPSGYEVASPRIVEAIYTGCVPVLISDHYVPPFSDVINWKSFSVEVSVDDIPNL  461

Query  1649  KKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             K ILTGIS RQY+RM RR VKVRRHFEVNSPPKR+DV+HMILHS+W
Sbjct  462   KTILTGISTRQYLRMYRRVVKVRRHFEVNSPPKRYDVYHMILHSVW  507



>ref|XP_011094446.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=559

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/374 (69%), Positives = 302/374 (81%), Gaps = 2/374 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++N+E +EA L +ARA+I R    G    D D +P GP+Y N S F RSY EMEK  KV+
Sbjct  173   FSNLEILEATLQQARAAI-RDAQRGNPAYDPDYIPTGPIYWNPSGFHRSYLEMEKHFKVF  231

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             VYE+G+ P+ H GPC S Y++EGNFI+ ++ S+FRT DP++AH+YFLPFS+T +   +Y+
Sbjct  232   VYEEGEQPIFHNGPCGSIYSMEGNFIYKLETSKFRTRDPERAHVYFLPFSVTSIVHFIYD  291

Query  1028  PNSHD-WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
                HD W PMK T  DYV+ VA KYP+WNRS+G+DH +LSCHDWGPE+S ++P L  NSI
Sbjct  292   KRVHDHWLPMKQTVKDYVDLVAGKYPYWNRSIGSDHVMLSCHDWGPELSKSLPELFKNSI  351

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             RALCNANTSE F P KDVSIPEI LP G T GL+GGPSPSKRP+LVF+AGGLHGP+RPIL
Sbjct  352   RALCNANTSEGFRPSKDVSIPEINLPGGRTNGLIGGPSPSKRPILVFFAGGLHGPIRPIL  411

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             L+HWENK +DVQVH YLPK VSY+ MMRKSR+CICPSGYEVASPRMVEALY GCVPVLIK
Sbjct  412   LEHWENKGQDVQVHRYLPKDVSYSAMMRKSRFCICPSGYEVASPRMVEALYTGCVPVLIK  471

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSDVLNW++F+V I V DIPNLKKILTGIS RQYIRMQRRGV VRRHFEVN  P
Sbjct  472   DHYVPPFSDVLNWKSFSVEISVADIPNLKKILTGISMRQYIRMQRRGVAVRRHFEVNLSP  531

Query  1745  KRFDVFHMILHSIW  1786
             KR+DVFHM LHSIW
Sbjct  532   KRYDVFHMTLHSIW  545



>ref|XP_010039041.1| PREDICTED: probable glycosyltransferase At5g03795 [Eucalyptus 
grandis]
Length=562

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/373 (67%), Positives = 302/373 (81%), Gaps = 2/373 (1%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYV  850
             T++ER+EA L RAR+ I R    G   +D D VPVGPMYRNA+ F RSY EMEK  K++V
Sbjct  179   TDLERLEAGLRRARSGI-REAKTGNPMEDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFV  237

Query  851   YEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             Y++G PPV H GPCKS YA EGNFIH ++ + RFRT DP KAH++FLPFS+ ++ + VY 
Sbjct  238   YKEGDPPVFHNGPCKSIYAKEGNFIHMVEINKRFRTGDPRKAHVFFLPFSVAMMVQFVYV  297

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
              +SHD+ P+K T +DY++ VA KYP+WNRSLGADHF+L+CHDWGPE SFA+P+L  NSIR
Sbjct  298   RDSHDFGPIKRTVIDYIDVVASKYPYWNRSLGADHFMLACHDWGPEASFAVPHLQRNSIR  357

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
              LCNANTSE FDP KDVS PE+ L +G   GL+GGPSPS R +L F+AGGLHGP+RPILL
Sbjct  358   VLCNANTSEGFDPSKDVSFPEVNLHTGAISGLIGGPSPSHRSILAFFAGGLHGPIRPILL  417

Query  1388  QHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             QHWENKDEDV+VH YLP+GVSY  MMR+S++CICPSGYEVASPR+VEA+Y GCVPVLI  
Sbjct  418   QHWENKDEDVKVHRYLPRGVSYYDMMRRSKFCICPSGYEVASPRVVEAIYTGCVPVLISD  477

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
              YV PFSDVLNW +F+V + V +IPNLK IL  IS RQYIRMQRR  +VRRHFEV+SPPK
Sbjct  478   HYVPPFSDVLNWRSFSVEVTVREIPNLKTILASISSRQYIRMQRRVAQVRRHFEVHSPPK  537

Query  1748  RFDVFHMILHSIW  1786
             R+DVFHMILHS+W
Sbjct  538   RYDVFHMILHSVW  550



>emb|CDY42006.1| BnaC04g00840D [Brassica napus]
Length=506

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/385 (65%), Positives = 307/385 (80%), Gaps = 2/385 (1%)
 Frame = +2

Query  635   TEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRS  814
             T   +  K+   +N+++IE +L +AR +I +         D D VP+GPMY NA  F RS
Sbjct  112   TASLKLMKKRVISNLKKIEFELQKARVAI-KAASINDPLDDPDYVPLGPMYWNAKAFHRS  170

Query  815   YAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLP  991
             Y EMEK  K++VY++G+PP+ H GPCKS Y++EGNFI+ M+  +RFRT +P+KAH ++LP
Sbjct  171   YLEMEKQFKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYEMETDTRFRTNNPEKAHAFYLP  230

Query  992   FSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEIS  1171
              S+  + + VYE +SHD+SP++ T  DY++ V  KYP+WNRS+GADHFILSCHDWGPE S
Sbjct  231   LSVVKMVRYVYERDSHDFSPIRKTVRDYIDLVGDKYPYWNRSIGADHFILSCHDWGPEAS  290

Query  1172  FAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYA  1351
             F+ P+L  NSIRALCNANTSERF P+KDVSIPEI L +G+ KGL+GGPSPS RP+L F+A
Sbjct  291   FSHPHLGQNSIRALCNANTSERFKPRKDVSIPEINLLTGSLKGLVGGPSPSSRPILAFFA  350

Query  1352  GGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEA  1531
             GG+HGPVRP+LLQHWENKD D++VH YLPKG SY+  MR S++CICPSGYEVASPR+VEA
Sbjct  351   GGVHGPVRPVLLQHWENKDSDIRVHKYLPKGTSYSDTMRNSKFCICPSGYEVASPRIVEA  410

Query  1532  LYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVK  1711
             LY GCVPVLI  GYV PFSDVLNW +F+VI+ VEDIPNLK ILT IS RQY+RM RR +K
Sbjct  411   LYSGCVPVLINSGYVPPFSDVLNWPSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLK  470

Query  1712  VRRHFEVNSPPKRFDVFHMILHSIW  1786
             VRRHFEVNSP KRFDVFHMILHSIW
Sbjct  471   VRRHFEVNSPAKRFDVFHMILHSIW  495



>ref|NP_001031828.1| Exostosin family protein [Arabidopsis thaliana]
 sp|Q9FFN2.2|GLYT3_ARATH RecName: Full=Probable glycosyltransferase At5g03795 [Arabidopsis 
thaliana]
 gb|AED90655.1| Exostosin family protein [Arabidopsis thaliana]
Length=518

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/393 (65%), Positives = 312/393 (79%), Gaps = 4/393 (1%)
 Frame = +2

Query  611   QNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYR  790
              N +SS  T      KR   +N+E+IE  L +ARASI +         D D VP+GPMY 
Sbjct  118   SNNVSS--TASLEPKKRRVLSNLEKIEFKLQKARASI-KAASMDDPVDDPDYVPLGPMYW  174

Query  791   NASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPD  967
             NA  F RSY EMEK  K+YVY++G+PP+ H GPCKS Y++EG+FI+ ++  +RFRT +PD
Sbjct  175   NAKVFHRSYLEMEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEIETDTRFRTNNPD  234

Query  968   KAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSC  1147
             KAH+++LPFS+  + + VYE NS D+SP++ T  DY+N V  KYP+WNRS+GADHFILSC
Sbjct  235   KAHVFYLPFSVVKMVRYVYERNSRDFSPIRNTVKDYINLVGDKYPYWNRSIGADHFILSC  294

Query  1148  HDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSK  1327
             HDWGPE SF+ P+L +NSIRALCNANTSERF P+KDVSIPEI L +G+  GL+GGPSPS 
Sbjct  295   HDWGPEASFSHPHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSS  354

Query  1328  RPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEV  1507
             RP+L F+AGG+HGPVRP+LLQHWENKD D++VH YLP+G SY+ MMR S++CICPSGYEV
Sbjct  355   RPILAFFAGGVHGPVRPVLLQHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEV  414

Query  1508  ASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYI  1687
             ASPR+VEALY GCVPVLI  GYV PFSDVLNW +F+VI+ VEDIPNLK ILT IS RQY+
Sbjct  415   ASPRIVEALYSGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYL  474

Query  1688  RMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             RM RR +KVRRHFEVNSP KRFDVFHMILHSIW
Sbjct  475   RMYRRVLKVRRHFEVNSPAKRFDVFHMILHSIW  507



>ref|XP_006398838.1| hypothetical protein EUTSA_v10016080mg [Eutrema salsugineum]
 gb|ESQ40291.1| hypothetical protein EUTSA_v10016080mg [Eutrema salsugineum]
Length=517

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/438 (60%), Positives = 331/438 (76%), Gaps = 14/438 (3%)
 Frame = +2

Query  476   TGVSRLPALVTTEEEIDKGLHENNVTGDSRPILLAPETGIGDDERQNGISSDDTEDSRKS  655
             TG+    + ++T+ E  +G  +NN T    PI +   +        N ++S  T  S + 
Sbjct  82    TGLLSPASSLSTKVEFFQG--DNNRTVGLNPINITSAS--------NNVTS--TASSEQI  129

Query  656   KRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKT  835
             K+   +N+E+IE +L +AR +I +         D D VP+GPMY NA  F RSY EMEK 
Sbjct  130   KKRVMSNLEKIEFELQKARVAI-KAASMDDPVDDPDYVPLGPMYWNAKVFHRSYLEMEKQ  188

Query  836   LKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLS  1012
              K++VY++G+PP+ H GPCKS Y++EGNFI+ M+  +RFRT +PDKAH ++LP S+  + 
Sbjct  189   FKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYEMETDTRFRTNNPDKAHAFYLPLSVVKMV  248

Query  1013  KLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLH  1192
             + VY  NSHD+SP++ T  DY++ V+ KY +WNRS+GADHFILSCHDWGPE SF+ P+L 
Sbjct  249   RYVYVSNSHDFSPIRKTVRDYIDLVSDKYSYWNRSIGADHFILSCHDWGPEASFSHPHLG  308

Query  1193  NNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPV  1372
              NSIRALCNANTSERF P+KDVSIPEI L +G+ KGL+GGPSPS RP+L F+AGG+HGPV
Sbjct  309   QNSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSSRPILAFFAGGVHGPV  368

Query  1373  RPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVP  1552
             RP+LLQHWENKD D++VH YLP+G SY+ MMR S++CICPSGYEVASPR+VEALY GCVP
Sbjct  369   RPVLLQHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVP  428

Query  1553  VLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEV  1732
             VLI  GYV PFSDVLNW +F+VI+ VEDIPNLK ILT IS RQY+RM RR +KVRRHFEV
Sbjct  429   VLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVRRHFEV  488

Query  1733  NSPPKRFDVFHMILHSIW  1786
             NSP KRFDVFHMILHSIW
Sbjct  489   NSPAKRFDVFHMILHSIW  506



>ref|XP_006287392.1| hypothetical protein CARUB_v10000598mg, partial [Capsella rubella]
 gb|EOA20290.1| hypothetical protein CARUB_v10000598mg, partial [Capsella rubella]
Length=562

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/394 (65%), Positives = 314/394 (80%), Gaps = 6/394 (2%)
 Frame = +2

Query  620   ISSDD----TEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMY  787
             ++S+D    T  S   KR   +N+E+IE +L +ARASI +         D D VP+GPMY
Sbjct  159   VASNDNVTTTASSEPKKRRVLSNLEKIELELQKARASI-KAASMDDPVDDPDYVPLGPMY  217

Query  788   RNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDP  964
              NA  F RSY EMEK  K+YVY++G+PP+ H GPCKS Y++EG+FI+ M+  +RFRT +P
Sbjct  218   WNAKVFHRSYLEMEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETDTRFRTNNP  277

Query  965   DKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILS  1144
             DKAH ++LPFS+  + + VYE NS D+ P++ T  DY+N V  KYP+WNRS+GADHFILS
Sbjct  278   DKAHAFYLPFSVVKMVRYVYERNSRDFGPIRNTVRDYINLVGDKYPYWNRSIGADHFILS  337

Query  1145  CHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPS  1324
             CHDWGPE SF+ P+L +NSIRALCNANTSERF P+KDVSIPEI L +G+ KGL+GGPSPS
Sbjct  338   CHDWGPEASFSHPHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPS  397

Query  1325  KRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYE  1504
              RP+L F+AGG+HGPVRP+LL HWE+KD D++VH YLP+G SY+ MMR S++CICPSGYE
Sbjct  398   SRPILAFFAGGVHGPVRPVLLDHWEDKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYE  457

Query  1505  VASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQY  1684
             VASPR+VEALY GCVPVLI  GYV PFSDVLNW++F+VI+ VEDIPNLK ILT IS RQY
Sbjct  458   VASPRIVEALYSGCVPVLINSGYVPPFSDVLNWKSFSVIVSVEDIPNLKTILTSISPRQY  517

Query  1685  IRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             +RM RR +KVRRHFEVNSP KRFDVFHMILHSIW
Sbjct  518   LRMYRRVLKVRRHFEVNSPAKRFDVFHMILHSIW  551



>gb|EYU41561.1| hypothetical protein MIMGU_mgv1a004154mg [Erythranthe guttata]
Length=541

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/375 (67%), Positives = 303/375 (81%), Gaps = 3/375 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++N++ +EA + ++R +I R     +   D D VP GP+Y N S F RSY EMEK  KV+
Sbjct  154   FSNLQILEAKMQQSRTAI-RDARKESVIHDPDYVPSGPIYWNPSAFHRSYLEMEKNFKVF  212

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             VYE+G+ P+ H GPC S Y++EGNFI+ ++ S+FRT DP+KAH++FLPFS+T +   +++
Sbjct  213   VYEEGEHPIFHNGPCGSIYSMEGNFIYKLEISKFRTRDPEKAHVFFLPFSVTSIVHFIFD  272

Query  1028  PNSHD-WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
              NS D W PMK T  DYV  VA KYP+WNRSLG+DHF+LSCHDWGPE+S ++P L NNSI
Sbjct  273   KNSRDHWLPMKQTVSDYVELVAAKYPYWNRSLGSDHFMLSCHDWGPELSKSLPELFNNSI  332

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             RALCNANT+E F P KDVSIPEI LP G T GL+GGPSPS+RPVLVF+AGGLHGP+RP L
Sbjct  333   RALCNANTTEGFKPSKDVSIPEINLPGGRTNGLIGGPSPSRRPVLVFFAGGLHGPIRPAL  392

Query  1385  LQHWEN-KDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             L+HWEN KD+DVQ+H YLPK VSY+ +MRKS+YC+CPSGYEVASPRMVEALY GCVPVL+
Sbjct  393   LEHWENSKDKDVQIHQYLPKNVSYSALMRKSKYCVCPSGYEVASPRMVEALYTGCVPVLV  452

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
             K  YV PFSDVLNW++FAV IPV DIPNL+ IL GIS RQYIRMQRRGV VRRHFEVN  
Sbjct  453   KDHYVPPFSDVLNWKSFAVEIPVGDIPNLRNILLGISTRQYIRMQRRGVTVRRHFEVNLT  512

Query  1742  PKRFDVFHMILHSIW  1786
             PKR+DVFHMILHSIW
Sbjct  513   PKRYDVFHMILHSIW  527



>ref|XP_007027562.1| Exostosin family protein [Theobroma cacao]
 gb|EOY08064.1| Exostosin family protein [Theobroma cacao]
Length=569

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/377 (65%), Positives = 307/377 (81%), Gaps = 2/377 (1%)
 Frame = +2

Query  659   RYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTL  838
             R   T ++++EA L RARA+I +    G+  +D D VP+GPMY +A  F RSY EMEK  
Sbjct  177   RQVRTKLDKLEAGLQRARAAI-KEAKNGSLLQDPDYVPIGPMYWDAKAFHRSYLEMEKQF  235

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSK  1015
             K++VY++G+PPV H GPCKS Y++EGNFIH MD  S F+T DP+KAH+++LPFS+  + +
Sbjct  236   KIFVYKEGEPPVFHDGPCKSIYSMEGNFIHKMDVDSNFQTKDPEKAHVFYLPFSVAKMVR  295

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              VY  +S D+SP++ T +DYVN +A KYP+WNRSLGADHF+L+CHDWGPE SF++P L  
Sbjct  296   FVYLRDSRDFSPIRRTVVDYVNLIAEKYPYWNRSLGADHFMLACHDWGPEASFSLPYLQK  355

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             NSIRALCNANTSE+F+P KDVSIPEI L +G   GL+GGPS S+RP+L F+AGG+HGP+R
Sbjct  356   NSIRALCNANTSEKFNPVKDVSIPEINLLTGKLTGLIGGPSASRRPILAFFAGGVHGPIR  415

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
             PILL+HWE KDED++VH YLPKGV+Y  MM+ S+YCICPSGYEVASPR+VEALY GCVPV
Sbjct  416   PILLEHWEGKDEDIRVHKYLPKGVNYYEMMKNSKYCICPSGYEVASPRIVEALYNGCVPV  475

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI + YV PFSDVL W++F+V++ V+DIP LK+ILT IS RQYIRMQRR ++VRRHF  N
Sbjct  476   LISKSYVPPFSDVLRWKSFSVVVSVDDIPKLKEILTKISSRQYIRMQRRVLQVRRHFAFN  535

Query  1736  SPPKRFDVFHMILHSIW  1786
             SPPKRFDVFHMILHSIW
Sbjct  536   SPPKRFDVFHMILHSIW  552



>ref|XP_002873114.1| hypothetical protein ARALYDRAFT_487158 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49373.1| hypothetical protein ARALYDRAFT_487158 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/378 (67%), Positives = 307/378 (81%), Gaps = 2/378 (1%)
 Frame = +2

Query  656   KRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKT  835
             KR   +N+E+IE +L +ARASI +         D D VP+GPMY NA  F RSY EMEK 
Sbjct  132   KRRVLSNLEKIEFELQKARASI-KAASMDDPVDDPDYVPLGPMYWNAKVFHRSYLEMEKQ  190

Query  836   LKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLS  1012
              K+YVY++G+PP+ H GPCKS Y++EG+FI+ M+  +RFRT +PDKAH ++LPFS+  + 
Sbjct  191   FKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETDTRFRTNNPDKAHAFYLPFSVVKMV  250

Query  1013  KLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLH  1192
             + VYE NS D+SP++ T  DY+N V  KYP+WNRS+GADHFILSCHDWGPE SF+ P+L 
Sbjct  251   RYVYERNSRDFSPIRNTVRDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFSHPHLG  310

Query  1193  NNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPV  1372
             +NSIRALCNANTSE+F P+KDVSIPEI L +G+  GL+GGPSPS RP+L F+AGG+HGPV
Sbjct  311   HNSIRALCNANTSEKFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGGVHGPV  370

Query  1373  RPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVP  1552
             RP+LL+HWENKD D++VH YLP+G SY+ MMR S++CICPSGYEVASPR+VEALY GCVP
Sbjct  371   RPVLLEHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVP  430

Query  1553  VLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEV  1732
             VLI  GYV PFSDVLNW +F+VI+ VEDIPNLK ILT IS RQY+RM RR +KVRRHFEV
Sbjct  431   VLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTAISPRQYLRMYRRVLKVRRHFEV  490

Query  1733  NSPPKRFDVFHMILHSIW  1786
             NSP KRFDVFHMILHSIW
Sbjct  491   NSPAKRFDVFHMILHSIW  508



>ref|XP_008462519.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
Length=518

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/407 (63%), Positives = 320/407 (79%), Gaps = 7/407 (2%)
 Frame = +2

Query  584   ETGIGDDERQNGISSDDTEDS----RKSKRYTYTNMERIEADLARARASILRgggggTQT  751
             ET    +     +S+D + +S    R  ++  YT +ERIEA L RARA+ +R      QT
Sbjct  104   ETATAINGVIRNVSNDSSYESAVKVRARRQREYTKLERIEAGLRRARAA-IREAKFLNQT  162

Query  752   KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHA  931
             +D D VP GPMY N+  F RSY EMEK +K++VYE+G+PP+ H GPCKS Y+ EGNFIHA
Sbjct  163   QDPDFVPSGPMYWNSKAFHRSYLEMEKEMKIFVYEEGEPPLFHNGPCKSIYSTEGNFIHA  222

Query  932   MDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFW  1108
             ++  S+FRT DP+KAH++FLP S+ +L + VY  +SHD++P++ T +DY+N +  KYPFW
Sbjct  223   IEMDSQFRTKDPNKAHVFFLPLSVAMLVRFVYVHDSHDFTPIRHTVIDYINVIGTKYPFW  282

Query  1109  NRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG  1288
             NRSLGADHF+LSCHDWGPE S ++PNL+ NSIR LCNANTSE F+P KDVS PEI L +G
Sbjct  283   NRSLGADHFMLSCHDWGPEASKSVPNLYKNSIRVLCNANTSEGFNPSKDVSFPEINLQTG  342

Query  1289  TTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKG-VSYNGMM  1465
                G LGGPSPS RP+L F+AGGLHGP+RPIL+Q WEN+D+D+QVH YLPKG VSY  MM
Sbjct  343   YLTGFLGGPSPSHRPILAFFAGGLHGPIRPILIQQWENQDQDIQVHQYLPKGVVSYIDMM  402

Query  1466  RKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPN  1645
             RKS++C+CPSGYEVASPR+VEA+Y GCVPVLI   YV PFSDV+NW++F+V + V++IPN
Sbjct  403   RKSKFCLCPSGYEVASPRIVEAIYTGCVPVLISDHYVPPFSDVINWKSFSVEVSVDEIPN  462

Query  1646  LKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             LK ILTGIS RQY+RM RR VKVRRHFEVNSPPKR+DV+HMILHS+W
Sbjct  463   LKTILTGISTRQYLRMYRRVVKVRRHFEVNSPPKRYDVYHMILHSVW  509



>ref|XP_003541440.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
 gb|KHN48210.1| Putative glycosyltransferase [Glycine soja]
Length=491

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/390 (63%), Positives = 307/390 (79%), Gaps = 2/390 (1%)
 Frame = +2

Query  620   ISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNAS  799
             ++  D    R  ++  ++ ++R E  LA+ARA+I R      +T D D VP GPMY NA 
Sbjct  91    VNKPDESHPRLKQKRKFSFLDRTEVVLAQARAAI-REARNRNRTLDSDYVPTGPMYWNAK  149

Query  800   FFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAH  976
              F RSY EMEK  KV+VYE+G+ PV H GPCKS Y++EGNFIHA++ +  FRT DP KAH
Sbjct  150   AFHRSYLEMEKQFKVFVYEEGETPVFHNGPCKSIYSMEGNFIHAIEMNDHFRTKDPKKAH  209

Query  977   LYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDW  1156
             ++FLPFS+ ++ + VYE +S D+ P+K T +DYVN +A +YP+WNRSLGADHF+L+CHDW
Sbjct  210   VFFLPFSVVMMVRFVYERDSRDFGPIKKTVIDYVNLIATRYPYWNRSLGADHFMLACHDW  269

Query  1157  GPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPV  1336
             GPE SF++P LH NSIR LCNANTSE F P KDVS PEI L +G+  G +GGPS SKR +
Sbjct  270   GPEASFSLPYLHKNSIRVLCNANTSEGFKPAKDVSFPEINLQTGSINGFVGGPSASKRSI  329

Query  1337  LVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASP  1516
             L F+AGG+HGP+RPILL+HWENKDED+QVH YLPKGVSY GM+RKS++C+CPSGYEVASP
Sbjct  330   LAFFAGGVHGPIRPILLEHWENKDEDIQVHKYLPKGVSYYGMLRKSKFCLCPSGYEVASP  389

Query  1517  RMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQ  1696
             R+VEA+Y GCVPVLI   YV PFSDVLNW++F+V + V+DIP LK IL  IS RQ+IRMQ
Sbjct  390   RVVEAIYTGCVPVLISEHYVPPFSDVLNWKSFSVELSVKDIPILKDILMSISPRQHIRMQ  449

Query  1697  RRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             RR  ++RRHFEV+SPPKRFDVFHMILHS+W
Sbjct  450   RRVGQIRRHFEVHSPPKRFDVFHMILHSVW  479



>ref|XP_003553575.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=537

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/391 (63%), Positives = 311/391 (80%), Gaps = 2/391 (1%)
 Frame = +2

Query  617   GISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNA  796
             G++       R   +  ++ ++R EA L +ARA+I R    G QT+D D VPVGPMY NA
Sbjct  136   GVNESYLPPERPKLQRKFSILDRTEAGLRQARAAI-REARNGNQTQDIDYVPVGPMYNNA  194

Query  797   SFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKA  973
             + F RSY EMEK  KV+VYE+G+PPV H GPCKS Y++EGNFIHA++ + +FRT DP++A
Sbjct  195   NAFHRSYLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPEEA  254

Query  974   HLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHD  1153
             H++FLPFS+ +L + VY  +SHD+ P+K T  DYVN +  +YP+WNRSLGADHF L+CHD
Sbjct  255   HVFFLPFSVAMLVQFVYVRDSHDFGPIKKTVTDYVNVIGGRYPYWNRSLGADHFYLACHD  314

Query  1154  WGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRP  1333
             WGPE S +IPNL+ NSIR LCNANTSE F P KDVS PEI L +G+  G +GGPS S+RP
Sbjct  315   WGPETSRSIPNLNKNSIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASRRP  374

Query  1334  VLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVAS  1513
             +L F+AGGLHGP+RP+LL+HWENKDED+QVH YLPKGVSY  M+RKS++C+CPSGYEVAS
Sbjct  375   LLAFFAGGLHGPIRPVLLEHWENKDEDIQVHKYLPKGVSYYEMLRKSKFCLCPSGYEVAS  434

Query  1514  PRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRM  1693
             PR+VEA+Y GCVPVLI   YV PF+DVLNW++F+V + V+DIP LK+IL  IS RQYIRM
Sbjct  435   PRVVEAIYTGCVPVLISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRQYIRM  494

Query  1694  QRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             QRR  +VRRHFEV+SPPKR+DVFHMILHS+W
Sbjct  495   QRRVGQVRRHFEVHSPPKRYDVFHMILHSVW  525



>gb|KHN02275.1| Putative glycosyltransferase [Glycine soja]
Length=537

 Score =   535 bits (1379),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 247/391 (63%), Positives = 311/391 (80%), Gaps = 2/391 (1%)
 Frame = +2

Query  617   GISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNA  796
             G++       R   +  ++ ++R EA L +ARA+I R    G QT+D D VPVGPMY NA
Sbjct  136   GVNESYLPPERPKLQRKFSILDRTEAGLRQARAAI-REARNGNQTQDIDYVPVGPMYNNA  194

Query  797   SFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKA  973
             + F RSY EMEK  KV+VYE+G+PPV H GPCKS Y++EGNF+HA++ + +FRT DP++A
Sbjct  195   NAFHRSYLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFVHAIEMNDQFRTRDPEEA  254

Query  974   HLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHD  1153
             H++FLPFS+ +L + VY  +SHD+ P+K T  DYVN +  +YP+WNRSLGADHF L+CHD
Sbjct  255   HVFFLPFSVAMLVQFVYVRDSHDFGPIKKTVTDYVNVIGGRYPYWNRSLGADHFYLACHD  314

Query  1154  WGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRP  1333
             WGPE S +IPNL+ NSIR LCNANTSE F P KDVS PEI L +G+  G +GGPS S+RP
Sbjct  315   WGPETSRSIPNLNKNSIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASRRP  374

Query  1334  VLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVAS  1513
             +L F+AGGLHGP+RP+LL+HWENKDED+QVH YLPKGVSY  M+RKS++C+CPSGYEVAS
Sbjct  375   LLAFFAGGLHGPIRPVLLEHWENKDEDIQVHKYLPKGVSYYEMLRKSKFCLCPSGYEVAS  434

Query  1514  PRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRM  1693
             PR+VEA+Y GCVPVLI   YV PF+DVLNW++F+V + V+DIP LK+IL  IS RQYIRM
Sbjct  435   PRVVEAIYTGCVPVLISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRQYIRM  494

Query  1694  QRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             QRR  +VRRHFEV+SPPKR+DVFHMILHS+W
Sbjct  495   QRRVGQVRRHFEVHSPPKRYDVFHMILHSVW  525



>ref|XP_010248410.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=646

 Score =   539 bits (1388),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 258/441 (59%), Positives = 326/441 (74%), Gaps = 9/441 (2%)
 Frame = +2

Query  470   NVTGVSRLPALVTTEEEIDKGLHENNVTGDSRPILLAPETGIGDDERQNGISSDDTEDSR  649
             N +GV+  P ++   EE  K    N    D  PIL+         ER NG    D   + 
Sbjct  198   NGSGVA--PIIMKVAEEDSKSDRING--SDVAPILVKVAEEDSKSERLNG---SDVSATI  250

Query  650   KSKRYTYTNMERIEADLARARASILRggggg-TQTKDDDSVPVGPMYRNASFFLRSYAEM  826
                +  ++ +ER+E+ LA+ RA+I         +T D D VP GPMY NA  F RSY EM
Sbjct  251   IKMQKNHSQLERMESGLAKIRAAIREAAHQKGNRTSDFDYVPEGPMYWNAQAFHRSYLEM  310

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSIT  1003
             EK  K+++Y++G+PP+ H GPC+S Y++EGNFIH ++   RFRT +P++AH++FLPFS+T
Sbjct  311   EKQFKIFIYDEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPEEAHVFFLPFSVT  370

Query  1004  VLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIP  1183
              + + VY PNSHD  P+K T +DYVN +A KYP+WNRSL ADHF+LSCHDWGP  S  +P
Sbjct  371   KMVRFVYVPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSCHDWGPLTSSYVP  430

Query  1184  NLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLH  1363
             +L+ N IR LCNANTSE F+P KD S PEI L +G TKGL+GGP PS RP+L F+AGGLH
Sbjct  431   HLYKNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGLIGGPPPSCRPILAFFAGGLH  490

Query  1364  GPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMG  1543
             GP+RP+LL+HW+NKDEDV+V+ YLPKG+SY  MM+KS+YCICPSGYEVASPR+VEA+Y G
Sbjct  491   GPIRPLLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEVASPRIVEAIYAG  550

Query  1544  CVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRH  1723
             CVPVLI   YV PFSDVLNW++F+V +PV +IPNLK+IL  IS RQYIRMQRRG+KVRRH
Sbjct  551   CVPVLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSISTRQYIRMQRRGLKVRRH  610

Query  1724  FEVNSPPKRFDVFHMILHSIW  1786
             FEVN PPKRFDV+HMILHS+W
Sbjct  611   FEVNFPPKRFDVYHMILHSVW  631



>ref|XP_010490872.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
Length=521

 Score =   534 bits (1376),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 251/382 (66%), Positives = 308/382 (81%), Gaps = 2/382 (1%)
 Frame = +2

Query  644   SRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAE  823
             S   KR   +N+++IE +L +ARASI +         D D VP+GPMY NA  F RSY E
Sbjct  130   SEPKKRRVLSNLQKIEFELQKARASI-KAASMDDPVDDPDYVPLGPMYWNAKIFHRSYLE  188

Query  824   MEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSI  1000
             MEK  K+YVY++G+PP+ H GPCKS Y++EG+FI+ M+  +RFRT +PDKAH ++LPFS+
Sbjct  189   MEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETNTRFRTNNPDKAHAFYLPFSV  248

Query  1001  TVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAI  1180
               + + VYE NS D+ P++ T  DY+N V  KYP+WNRS+GADHF+LSCHDWGPE SF+ 
Sbjct  249   VKMVRFVYERNSRDFGPIRNTVRDYINLVGDKYPYWNRSIGADHFMLSCHDWGPEASFSH  308

Query  1181  PNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGL  1360
             P+L +NSIRALCNANTSERF P+KDVSIPEI L +G+  GL+GGPSPS RP+L F+AGG+
Sbjct  309   PHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGGV  368

Query  1361  HGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYM  1540
             HGPVRP+LL+HWENKD D++VH YLP+G SY+ MMR S++CICPSGYEVASPR+VEALY 
Sbjct  369   HGPVRPVLLEHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYS  428

Query  1541  GCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRR  1720
             GCVPVLI  GYV PFSDVLNW++F+VI+ VEDIPNLK ILT IS RQY+RM RR +KVRR
Sbjct  429   GCVPVLINSGYVPPFSDVLNWKSFSVIVSVEDIPNLKTILTAISPRQYLRMYRRVLKVRR  488

Query  1721  HFEVNSPPKRFDVFHMILHSIW  1786
             HFEVNSP KRFDVFHMILHSIW
Sbjct  489   HFEVNSPAKRFDVFHMILHSIW  510



>ref|XP_006381337.1| hypothetical protein POPTR_0006s11930g [Populus trichocarpa]
 gb|ERP59134.1| hypothetical protein POPTR_0006s11930g [Populus trichocarpa]
Length=510

 Score =   533 bits (1373),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 248/383 (65%), Positives = 308/383 (80%), Gaps = 3/383 (1%)
 Frame = +2

Query  644   SRKSKRYT-YTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYA  820
             +RK++  T +T++E++EA L +AR + L+    G Q  D D  P GPMY NA  F RSY 
Sbjct  112   ARKTRHKTEHTSLEKLEAGLQKARVA-LKEAKNGKQADDPDYAPAGPMYWNAEVFHRSYL  170

Query  821   EMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFS  997
             EMEK  KV+VY +G+PPV H GPC+S Y++EGNFIH M+    FRT DPDKAH+YFLPFS
Sbjct  171   EMEKQFKVFVYGEGEPPVFHNGPCRSIYSMEGNFIHRMEIDGHFRTKDPDKAHVYFLPFS  230

Query  998   ITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFA  1177
             + ++ + VYE  S D+ P++ T  DY+N ++ KYPFWNRSLGADHF+L+CHDWGPE SF+
Sbjct  231   VAMMVRFVYERESRDFGPIRRTVSDYINLISGKYPFWNRSLGADHFMLACHDWGPEASFS  290

Query  1178  IPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGG  1357
             +P+L   SIRALCNANTSE+F+P KDVS+PEI L +G+ KG +GG SPSKR +L F+AG 
Sbjct  291   VPHLGKISIRALCNANTSEKFNPIKDVSLPEINLRTGSIKGFVGGLSPSKRSILAFFAGR  350

Query  1358  LHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALY  1537
             LHGP+RP++L+HWENKD+D++VH  LPKGVSY  MMR S++C+CPSGYEVASPR+VEALY
Sbjct  351   LHGPIRPVVLEHWENKDDDIKVHQQLPKGVSYYEMMRGSKFCLCPSGYEVASPRIVEALY  410

Query  1538  MGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVR  1717
              GCVPVLI   YV PFSDVLNW++F+V +PV DIP+LKKILT IS RQYIRMQRR ++VR
Sbjct  411   AGCVPVLISDHYVPPFSDVLNWKSFSVEVPVSDIPSLKKILTSISPRQYIRMQRRVLQVR  470

Query  1718  RHFEVNSPPKRFDVFHMILHSIW  1786
             RHFEVNSPPKRFDVFHMILHSIW
Sbjct  471   RHFEVNSPPKRFDVFHMILHSIW  493



>ref|XP_011018855.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
 ref|XP_011018857.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
 ref|XP_011018858.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
Length=513

 Score =   533 bits (1373),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 307/382 (80%), Gaps = 2/382 (1%)
 Frame = +2

Query  644   SRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAE  823
             S+   +  +T++E++EA L +AR + L+    G Q  D D VP GPMY NA  F RSY E
Sbjct  113   SKTRHKTEHTSLEKLEAGLQKARVA-LKEAKNGKQADDPDYVPAGPMYWNAKVFHRSYLE  171

Query  824   MEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSI  1000
             ME+  KV+VYE+G+PP+ H GPC+S Y++EGNFIH M+ +  FRT DPDKAH+YFLPFS+
Sbjct  172   MEEQFKVFVYEEGEPPLFHNGPCRSIYSMEGNFIHMMEINGHFRTKDPDKAHVYFLPFSV  231

Query  1001  TVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAI  1180
              ++ + VYE  S D+ P++ T  DY+N ++RKY FWNRSLGADHF+L+CHDWGPE SF++
Sbjct  232   AMMVRFVYERQSRDFGPIRRTVSDYINLISRKYSFWNRSLGADHFMLACHDWGPEASFSV  291

Query  1181  PNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGL  1360
             P+L   SIRALCNANTSE+F+P KDVS+PEI L +G+ KG +GG SPSKR +L F+AG L
Sbjct  292   PHLGKISIRALCNANTSEKFNPVKDVSLPEINLLTGSIKGFVGGLSPSKRLILAFFAGRL  351

Query  1361  HGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYM  1540
             HGP+RP++L+HWENKD+D++VH  LPKGVSY  MMR S++C+CPSGYEVASPR+VEALY 
Sbjct  352   HGPIRPVVLEHWENKDDDIKVHQQLPKGVSYYEMMRGSKFCLCPSGYEVASPRIVEALYA  411

Query  1541  GCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRR  1720
             GCVPVLI   YV PFSDVLNW++F+V +PV DIP+LKKILT IS RQYIRMQRR ++VRR
Sbjct  412   GCVPVLISDHYVPPFSDVLNWKSFSVEVPVSDIPSLKKILTSISPRQYIRMQRRVLQVRR  471

Query  1721  HFEVNSPPKRFDVFHMILHSIW  1786
             HFEVN PPKRFDVFHMILHSIW
Sbjct  472   HFEVNYPPKRFDVFHMILHSIW  493



>gb|KHG20191.1| hypothetical protein F383_08256 [Gossypium arboreum]
Length=575

 Score =   535 bits (1378),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 240/380 (63%), Positives = 309/380 (81%), Gaps = 2/380 (1%)
 Frame = +2

Query  650   KSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEME  829
             K  R   T ++++EA L RAR++I R    G+Q ++ D VP+GPMY +A  F RSY EME
Sbjct  180   KHSRQVRTKLDKVEAGLQRARSAI-REAKNGSQLQESDYVPIGPMYWDAKAFHRSYLEME  238

Query  830   KTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITV  1006
             K  KV+VY++G+PPV H GPCKS Y++EGNFI+ +D  ++F+T DP KAH+++LPFS+  
Sbjct  239   KQFKVFVYKEGEPPVFHDGPCKSIYSMEGNFIYKLDVDTKFQTKDPQKAHVFYLPFSVAK  298

Query  1007  LSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPN  1186
             + + VY  +S D+SP++ T +DY+N VA+KYP+WNRS GADHF+L+CHDWGPE SF++P+
Sbjct  299   MVRFVYSRDSRDFSPIRRTVVDYINLVAQKYPYWNRSHGADHFMLACHDWGPEASFSLPH  358

Query  1187  LHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHG  1366
             L  NSIRALCNANTSERF+P KDVSIPEI L +    GL+GGPS S+R +L F+AGG+HG
Sbjct  359   LEKNSIRALCNANTSERFNPVKDVSIPEINLITDKLTGLMGGPSASQRQILAFFAGGVHG  418

Query  1367  PVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGC  1546
             P+RP+LL+HWE+KDED++VH YLP+GV+Y  MMR S+YCICPSGYEVASPR+VEALY GC
Sbjct  419   PIRPVLLEHWEDKDEDIKVHKYLPRGVNYYDMMRNSKYCICPSGYEVASPRIVEALYNGC  478

Query  1547  VPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHF  1726
             VPVLI + YVAPFSDVL W++F+V + V+DIP LK+IL  IS RQYIRMQRR ++VRRHF
Sbjct  479   VPVLISKSYVAPFSDVLRWKSFSVTVSVDDIPKLKEILMNISTRQYIRMQRRVLQVRRHF  538

Query  1727  EVNSPPKRFDVFHMILHSIW  1786
             E NSPPKR+DVFHMILHS+W
Sbjct  539   EFNSPPKRYDVFHMILHSVW  558



>ref|XP_010423660.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
Length=514

 Score =   533 bits (1372),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 251/382 (66%), Positives = 306/382 (80%), Gaps = 2/382 (1%)
 Frame = +2

Query  644   SRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAE  823
             S   KR   +N+E+IE +L +ARASI +         D D VP+GPMY NA  F RSY E
Sbjct  123   SEPKKRRVLSNLEKIEFELQKARASI-KAASMDDPVDDPDYVPLGPMYWNAKVFHRSYLE  181

Query  824   MEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSI  1000
             MEK  K+YVY++G+PP+ H GPCKS Y++EG+FI+ M+  +RFRT  PDKAH ++LPFS+
Sbjct  182   MEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETNTRFRTNKPDKAHAFYLPFSV  241

Query  1001  TVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAI  1180
               + + VYE NS D+ P++ T  DY+N V  KYP+WNRS+GADHFILSCHDWGPE SF+ 
Sbjct  242   VKMVRFVYERNSRDFGPIRNTVRDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFSH  301

Query  1181  PNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGL  1360
             P+L +NSIRALCNANTSERF P+KDVSIPEI L +G+  GL+GG SPS RP+L F+AGG+
Sbjct  302   PHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGRSPSSRPILAFFAGGV  361

Query  1361  HGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYM  1540
             HGPVRP+LL+HWENKD D++VH YLP+G SY+ MMR S++CICPSGYEVASPR+VEALY 
Sbjct  362   HGPVRPVLLEHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYS  421

Query  1541  GCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRR  1720
             GCVPVLI  GYV PFSDVLNW++F+V++ VEDIPNLK ILT IS RQY+RM RR +KVRR
Sbjct  422   GCVPVLINSGYVPPFSDVLNWKSFSVVVSVEDIPNLKTILTAISPRQYLRMYRRVLKVRR  481

Query  1721  HFEVNSPPKRFDVFHMILHSIW  1786
             HFEVNSP KRFDVFHMILHSIW
Sbjct  482   HFEVNSPAKRFDVFHMILHSIW  503



>ref|XP_009787886.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=460

 Score =   530 bits (1366),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 240/373 (64%), Positives = 297/373 (80%), Gaps = 1/373 (0%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYV  850
             +++ER+EA L RARA+I +         D + VP GP+Y N   F RSY EMEK  K+YV
Sbjct  75    SSLERLEAGLVRARAAIKQAQSKNQTFDDPEYVPTGPIYWNPIAFHRSYLEMEKHFKIYV  134

Query  851   YEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYEP  1030
             YE+G+PPV HY   +    IEG  IH ++ S+FRT DP+KAH+YFLPFS+  +   VY  
Sbjct  135   YEEGEPPVFHYSASQGILGIEGILIHQLEISKFRTNDPEKAHVYFLPFSVLSIVSYVYVV  194

Query  1031  NSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRA  1210
             +S +W PM+ TA DY+++++RKYP+WNRSLG+DHF+L+CHDWGP IS AIP L+ NSIR 
Sbjct  195   DSREWGPMRNTAADYIDNISRKYPYWNRSLGSDHFMLACHDWGPRISLAIPYLYKNSIRV  254

Query  1211  LCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQ  1390
             LCNANTSERF+P KDVS+PEI LP GTT GL+GGPSPS R VLVFYAGG+HG +R +L++
Sbjct  255   LCNANTSERFNPSKDVSLPEIYLPQGTTDGLIGGPSPSHRSVLVFYAGGIHGYIRQVLME  314

Query  1391  HW-ENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             +W +N D DVQ+H YLPK VSY GM+RKS+YCICPSG+EVASPRMVEALYMGCVP+L+K 
Sbjct  315   YWGKNDDPDVQIHEYLPKNVSYYGMIRKSKYCICPSGWEVASPRMVEALYMGCVPILLKD  374

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
              YVAPFSDVLNW++FAV +   DIPNLKKIL  I QRQYI+MQ+RG++VRRHFEVN PP+
Sbjct  375   HYVAPFSDVLNWKSFAVEMTSNDIPNLKKILNAIPQRQYIKMQKRGLQVRRHFEVNFPPR  434

Query  1748  RFDVFHMILHSIW  1786
             R+DVFHMILHSIW
Sbjct  435   RYDVFHMILHSIW  447



>ref|XP_003537031.2| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=491

 Score =   531 bits (1368),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 243/388 (63%), Positives = 307/388 (79%), Gaps = 3/388 (1%)
 Frame = +2

Query  626   SDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFF  805
             SD++   +K KR   + ++R E  LA+ARA+I R      QT+D D VP+GPMY NA  F
Sbjct  94    SDESHPRQKQKR-KLSFIDRNEVVLAQARAAI-REAKNENQTQDSDYVPIGPMYWNAKTF  151

Query  806   LRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLY  982
              RSY EMEK  KV+VYE+G+ PV H GPCKS Y++EGNFIHA++ +  FRT DP KAH++
Sbjct  152   HRSYLEMEKQFKVFVYEEGETPVFHNGPCKSIYSMEGNFIHAIEMNDHFRTKDPKKAHVF  211

Query  983   FLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGP  1162
             FLPFS+ ++ + VY+ +S D+ P++ T +DY+N +A +Y +WNRSLGADHF+L+CHDWGP
Sbjct  212   FLPFSVVMMVRFVYQRDSRDFGPIRKTVIDYINLIAARYSYWNRSLGADHFMLACHDWGP  271

Query  1163  EISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLV  1342
             E S ++P LH NSIR LCNANTSE F P KDVS PEI L +G+  G +GGPS SKR +L 
Sbjct  272   EASLSLPYLHKNSIRVLCNANTSEGFKPAKDVSFPEINLQTGSINGFIGGPSASKRSILA  331

Query  1343  FYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRM  1522
             F+AGG+HGP+RPILL+HWENKDED+QVH YLPKGVSY   +R S++C+CPSGYEVASPR+
Sbjct  332   FFAGGVHGPIRPILLEHWENKDEDIQVHKYLPKGVSYYDKLRNSKFCLCPSGYEVASPRV  391

Query  1523  VEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRR  1702
             VEA+Y GCVPVLI   YV PFSDVLNW++F+V + V+DIPNLK IL  IS RQYIRMQRR
Sbjct  392   VEAIYTGCVPVLISEHYVPPFSDVLNWKSFSVELSVKDIPNLKDILMSISPRQYIRMQRR  451

Query  1703  GVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
              ++++RHFEV+SPPKRFDVFHMILHS+W
Sbjct  452   VIQIQRHFEVHSPPKRFDVFHMILHSVW  479



>gb|AES60658.2| exostosin family protein [Medicago truncatula]
Length=488

 Score =   531 bits (1367),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 247/382 (65%), Positives = 303/382 (79%), Gaps = 3/382 (1%)
 Frame = +2

Query  647   RKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEM  826
             R  ++  ++ ++R EA L  ARA+I R     TQT+D D VP+GPMY NA  F RSY EM
Sbjct  96    RLKQQRKFSILDRTEAGLLHARAAI-REASYSTQTQDPDYVPIGPMYWNAKAFHRSYLEM  154

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSIT  1003
             EK  KV+VYE+G+PPV H GPCKS Y++EGNFIHA++ + +FRT DP KAH+YFLPFS+ 
Sbjct  155   EKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIELNDQFRTRDPQKAHVYFLPFSVV  214

Query  1004  VLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIP  1183
             +L + VY  +S D+ P++ T  DY+N +A KYP+WNRSLGADHF+L+CHDWGPE SF++P
Sbjct  215   MLVRFVYLRDSRDFGPIRKTVTDYINVIAGKYPYWNRSLGADHFMLACHDWGPETSFSVP  274

Query  1184  NLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLH  1363
              LH NSIR LCNANTSERF+P KDVS PEI L +G+  G LGG S SKRP+L F+AGGLH
Sbjct  275   YLHKNSIRVLCNANTSERFNPAKDVSFPEINLQTGSINGFLGGLSASKRPILAFFAGGLH  334

Query  1364  GPVRPILLQHWE-NKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYM  1540
             G +R ILL+HWE NKD+D+ +  YLPKGVSY  M+RKS++C+CPSGYEVASPR+VEA+Y 
Sbjct  335   GHIRAILLEHWENNKDQDMMIQKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRIVEAIYT  394

Query  1541  GCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRR  1720
             GCVPVLI   YV PFSDVLNW++F+V I VEDIP LK IL  IS  QYIRMQRR V++RR
Sbjct  395   GCVPVLISDHYVPPFSDVLNWKSFSVEISVEDIPKLKDILMRISPTQYIRMQRRVVQIRR  454

Query  1721  HFEVNSPPKRFDVFHMILHSIW  1786
             HFEV+SPPKRFDVFHMILHS+W
Sbjct  455   HFEVHSPPKRFDVFHMILHSVW  476



>ref|XP_003590407.1| hypothetical protein MTR_1g061760 [Medicago truncatula]
Length=508

 Score =   531 bits (1368),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 247/382 (65%), Positives = 303/382 (79%), Gaps = 3/382 (1%)
 Frame = +2

Query  647   RKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEM  826
             R  ++  ++ ++R EA L  ARA+I R     TQT+D D VP+GPMY NA  F RSY EM
Sbjct  116   RLKQQRKFSILDRTEAGLLHARAAI-REASYSTQTQDPDYVPIGPMYWNAKAFHRSYLEM  174

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSIT  1003
             EK  KV+VYE+G+PPV H GPCKS Y++EGNFIHA++ + +FRT DP KAH+YFLPFS+ 
Sbjct  175   EKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIELNDQFRTRDPQKAHVYFLPFSVV  234

Query  1004  VLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIP  1183
             +L + VY  +S D+ P++ T  DY+N +A KYP+WNRSLGADHF+L+CHDWGPE SF++P
Sbjct  235   MLVRFVYLRDSRDFGPIRKTVTDYINVIAGKYPYWNRSLGADHFMLACHDWGPETSFSVP  294

Query  1184  NLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLH  1363
              LH NSIR LCNANTSERF+P KDVS PEI L +G+  G LGG S SKRP+L F+AGGLH
Sbjct  295   YLHKNSIRVLCNANTSERFNPAKDVSFPEINLQTGSINGFLGGLSASKRPILAFFAGGLH  354

Query  1364  GPVRPILLQHWE-NKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYM  1540
             G +R ILL+HWE NKD+D+ +  YLPKGVSY  M+RKS++C+CPSGYEVASPR+VEA+Y 
Sbjct  355   GHIRAILLEHWENNKDQDMMIQKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRIVEAIYT  414

Query  1541  GCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRR  1720
             GCVPVLI   YV PFSDVLNW++F+V I VEDIP LK IL  IS  QYIRMQRR V++RR
Sbjct  415   GCVPVLISDHYVPPFSDVLNWKSFSVEISVEDIPKLKDILMRISPTQYIRMQRRVVQIRR  474

Query  1721  HFEVNSPPKRFDVFHMILHSIW  1786
             HFEV+SPPKRFDVFHMILHS+W
Sbjct  475   HFEVHSPPKRFDVFHMILHSVW  496



>ref|XP_010243080.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nelumbo nucifera]
Length=598

 Score =   534 bits (1376),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 257/455 (56%), Positives = 323/455 (71%), Gaps = 7/455 (2%)
 Frame = +2

Query  428   ATEEEIGKGLPHESNVTGVSRLPALVTTEEEIDKGLHENNVTGDSRPILLAPETGIGDDE  607
             A  +E G+       + G    P +    EE  K    N    D  P+++         E
Sbjct  134   AVMKEAGEDSKSAERLNGSGVAPIITKVAEEDSKSDRINGSNVD--PVIMKVAEENSKSE  191

Query  608   RQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRggggg-TQTKDDDSVPVGPM  784
             R NG    D   +    +  +T +ER+EA LA+ RA+I         QT D D VP GPM
Sbjct  192   RING---SDVAPTIIKMQKNHTQLERLEAGLAKIRAAIREAAHQKGNQTSDFDYVPEGPM  248

Query  785   YRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTD  961
             Y NA  F RSY  MEK  K+++YE+G+PP+ H GPC+S Y++EGNFIH ++   RFRT +
Sbjct  249   YWNAQAFHRSYLVMEKQFKIFIYEEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRN  308

Query  962   PDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFIL  1141
             P++A+ +FLPFS+T + + VY PNSHD  P+K T +DYVN +A KYP+WNRSL ADHF+L
Sbjct  309   PEEAYAFFLPFSVTQMVRFVYVPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFML  368

Query  1142  SCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSP  1321
             SCHDWGP  S  +P+L+ N IR LCNANTSE F+P KD S PEI L +G TKGL+GGP P
Sbjct  369   SCHDWGPLTSSYVPHLYKNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGLIGGPPP  428

Query  1322  SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGY  1501
             S RP+L F+AGGLHGP+RP+LL+HW+NKDEDV+V+ YLPKG+SY  MM+KS+YCICPSGY
Sbjct  429   SCRPILAFFAGGLHGPIRPLLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGY  488

Query  1502  EVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQ  1681
             EVASPR+VEA+Y GCVPVLI   YV PFSDVLNW++F+V +PV +IPNLK+IL  I  RQ
Sbjct  489   EVASPRIVEAIYAGCVPVLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSIPTRQ  548

Query  1682  YIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             Y RMQRRG+KVRRHFEVN PPKRFDV+HMILHS+W
Sbjct  549   YKRMQRRGLKVRRHFEVNFPPKRFDVYHMILHSVW  583



>ref|XP_003521429.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=534

 Score =   532 bits (1370),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 246/371 (66%), Positives = 301/371 (81%), Gaps = 2/371 (1%)
 Frame = +2

Query  677   MERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYE  856
             ++R EA L +ARA+I      G QT+D D VPVGPMY NA+ F RSY EMEK  KV+VYE
Sbjct  153   LDRTEAGLIQARAAI-SEARNGNQTQDKDYVPVGPMYNNANAFHRSYLEMEKQFKVFVYE  211

Query  857   DGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSITVLSKLVYEPN  1033
             +G+PPV H GPCKS Y++EGNFIHA++ + +FRT DP+KAH++FLPFS+ +L + VY  +
Sbjct  212   EGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPEKAHVFFLPFSVAMLVQFVYVRD  271

Query  1034  SHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRAL  1213
             SHD+ P+K T  DYVN +A +YP+WNRSLGADHF L+CHDWGPE S +IPNL+ NSIR L
Sbjct  272   SHDFGPIKKTVTDYVNVIAGRYPYWNRSLGADHFYLACHDWGPETSRSIPNLNENSIRVL  331

Query  1214  CNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQH  1393
             CNANTSE F P KDVS PEI L +G+  G +GGPS S RP+L F+AGGLHGP+RP+LL+H
Sbjct  332   CNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASGRPLLAFFAGGLHGPIRPVLLEH  391

Query  1394  WENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGY  1573
             WEN+DED+QVH YLPKGVSY  M+RKSR+C+CPSGYEVASPR+VEA+Y GCVPVLI   Y
Sbjct  392   WENRDEDIQVHKYLPKGVSYYEMLRKSRFCLCPSGYEVASPRVVEAIYTGCVPVLISDHY  451

Query  1574  VAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRF  1753
             V PF+DVLNW++F+V + V+DIP LK+IL  IS R YIRMQRR   VRRHFEV+SPPKR+
Sbjct  452   VPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRHYIRMQRRVGLVRRHFEVHSPPKRY  511

Query  1754  DVFHMILHSIW  1786
             DVFHMILHS+W
Sbjct  512   DVFHMILHSVW  522



>ref|XP_004303053.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=549

 Score =   532 bits (1371),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 244/401 (61%), Positives = 311/401 (78%), Gaps = 2/401 (0%)
 Frame = +2

Query  587   TGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDS  766
              G  D+   N   ++   D+  ++R  YT++ R+E  L RAR +I R      +T D D 
Sbjct  138   NGTNDEVPMNETDANSAMDNPATRRKEYTHLGRLEGRLRRARVAI-REAKFANKTHDADY  196

Query  767   VPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR  946
             +P GPMY NA+ F RSY EMEK  KV+VYE+G+PP+ H GPCKS Y++EGNFIH ++ ++
Sbjct  197   IPNGPMYWNANAFQRSYLEMEKRFKVFVYEEGEPPLFHNGPCKSIYSMEGNFIHEIEVNK  256

Query  947   -FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLG  1123
              FRT +P++AH+YFLP+S+T+L + VY  +SHD+SP++ T  DYVN ++ KYP+WNRSL 
Sbjct  257   QFRTRNPEEAHVYFLPYSVTMLVRFVYVRDSHDFSPIRQTVRDYVNIISTKYPYWNRSLA  316

Query  1124  ADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGL  1303
             ADHF ++CHDWGPE S + P L  NSIR LCNANTSE F+P KDVS PE+ L +G T G 
Sbjct  317   ADHFTVACHDWGPETSNSDPYLRKNSIRGLCNANTSEGFNPSKDVSFPEVNLQTGDTHGF  376

Query  1304  LGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYC  1483
             LGGPSP  R +L F+AGG+HGP+RPILL+HWENKD+D++VH YLPKGVSY  MM+KS++C
Sbjct  377   LGGPSPRLRSILAFFAGGVHGPIRPILLEHWENKDKDMRVHQYLPKGVSYYDMMKKSKFC  436

Query  1484  ICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILT  1663
             +CPSGYEVASPR+VEA+Y GCVPVLI   YV PFSDVLNW++F+V + V DIPNLK ILT
Sbjct  437   LCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVSVSDIPNLKNILT  496

Query  1664  GISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
              IS RQY+RMQ+R ++VR+HFEVNSPPKRFDVFHMILHSIW
Sbjct  497   SISTRQYLRMQKRVIQVRKHFEVNSPPKRFDVFHMILHSIW  537



>gb|KCW48746.1| hypothetical protein EUGRSUZ_K02385, partial [Eucalyptus grandis]
Length=352

 Score =   525 bits (1351),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 239/346 (69%), Positives = 286/346 (83%), Gaps = 1/346 (0%)
 Frame = +2

Query  752   KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHA  931
             +D D VPVGPMYRNA+ F RSY EMEK  K++VY++G PPV H GPCKS YA EGNFIH 
Sbjct  2     EDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPVFHNGPCKSIYAKEGNFIHM  61

Query  932   MDFS-RFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFW  1108
             ++ + RFRT DP KAH++FLPFS+ ++ + VY  +SHD+ P+K T +DY++ VA KYP+W
Sbjct  62    VEINKRFRTGDPRKAHVFFLPFSVAMMVQFVYVRDSHDFGPIKRTVIDYIDVVASKYPYW  121

Query  1109  NRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG  1288
             NRSLGADHF+L+CHDWGPE SFA+P+L  NSIR LCNANTSE FDP KDVS PE+ L +G
Sbjct  122   NRSLGADHFMLACHDWGPEASFAVPHLQRNSIRVLCNANTSEGFDPSKDVSFPEVNLHTG  181

Query  1289  TTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMR  1468
                GL+GGPSPS R +L F+AGGLHGP+RPILLQHWENKDEDV+VH YLP+GVSY  MMR
Sbjct  182   AISGLIGGPSPSHRSILAFFAGGLHGPIRPILLQHWENKDEDVKVHRYLPRGVSYYDMMR  241

Query  1469  KSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNL  1648
             +S++CICPSGYEVASPR+VEA+Y GCVPVLI   YV PFSDVLNW +F+V + V +IPNL
Sbjct  242   RSKFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWRSFSVEVTVREIPNL  301

Query  1649  KKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             K IL  IS RQYIRMQRR  +VRRHFEV+SPPKR+DVFHMILHS+W
Sbjct  302   KTILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMILHSVW  347



>gb|KHN18714.1| Putative glycosyltransferase [Glycine soja]
Length=546

 Score =   532 bits (1370),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 246/371 (66%), Positives = 301/371 (81%), Gaps = 2/371 (1%)
 Frame = +2

Query  677   MERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYE  856
             ++R EA L +ARA+I      G QT+D D VPVGPMY NA+ F RSY EMEK  KV+VYE
Sbjct  165   LDRTEAGLIQARAAI-SEARNGNQTQDKDYVPVGPMYNNANAFHRSYLEMEKQFKVFVYE  223

Query  857   DGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSITVLSKLVYEPN  1033
             +G+PPV H GPCKS Y++EGNFIHA++ + +FRT DP+KAH++FLPFS+ +L + VY  +
Sbjct  224   EGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPEKAHVFFLPFSVAMLVQFVYVRD  283

Query  1034  SHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRAL  1213
             SHD+ P+K T  DYVN +A +YP+WNRSLGADHF L+CHDWGPE S +IPNL+ NSIR L
Sbjct  284   SHDFGPIKKTVTDYVNVIAGRYPYWNRSLGADHFYLACHDWGPETSRSIPNLNENSIRVL  343

Query  1214  CNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQH  1393
             CNANTSE F P KDVS PEI L +G+  G +GGPS S RP+L F+AGGLHGP+RP+LL+H
Sbjct  344   CNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASGRPLLAFFAGGLHGPIRPVLLEH  403

Query  1394  WENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGY  1573
             WEN+DED+QVH YLPKGVSY  M+RKSR+C+CPSGYEVASPR+VEA+Y GCVPVLI   Y
Sbjct  404   WENRDEDIQVHKYLPKGVSYYEMLRKSRFCLCPSGYEVASPRVVEAIYTGCVPVLISDHY  463

Query  1574  VAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRF  1753
             V PF+DVLNW++F+V + V+DIP LK+IL  IS R YIRMQRR   VRRHFEV+SPPKR+
Sbjct  464   VPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRHYIRMQRRVGLVRRHFEVHSPPKRY  523

Query  1754  DVFHMILHSIW  1786
             DVFHMILHS+W
Sbjct  524   DVFHMILHSVW  534



>ref|XP_010243073.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nelumbo nucifera]
Length=620

 Score =   533 bits (1374),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 257/455 (56%), Positives = 323/455 (71%), Gaps = 7/455 (2%)
 Frame = +2

Query  428   ATEEEIGKGLPHESNVTGVSRLPALVTTEEEIDKGLHENNVTGDSRPILLAPETGIGDDE  607
             A  +E G+       + G    P +    EE  K    N    D  P+++         E
Sbjct  156   AVMKEAGEDSKSAERLNGSGVAPIITKVAEEDSKSDRINGSNVD--PVIMKVAEENSKSE  213

Query  608   RQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRggggg-TQTKDDDSVPVGPM  784
             R NG    D   +    +  +T +ER+EA LA+ RA+I         QT D D VP GPM
Sbjct  214   RING---SDVAPTIIKMQKNHTQLERLEAGLAKIRAAIREAAHQKGNQTSDFDYVPEGPM  270

Query  785   YRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTD  961
             Y NA  F RSY  MEK  K+++YE+G+PP+ H GPC+S Y++EGNFIH ++   RFRT +
Sbjct  271   YWNAQAFHRSYLVMEKQFKIFIYEEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRN  330

Query  962   PDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFIL  1141
             P++A+ +FLPFS+T + + VY PNSHD  P+K T +DYVN +A KYP+WNRSL ADHF+L
Sbjct  331   PEEAYAFFLPFSVTQMVRFVYVPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFML  390

Query  1142  SCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSP  1321
             SCHDWGP  S  +P+L+ N IR LCNANTSE F+P KD S PEI L +G TKGL+GGP P
Sbjct  391   SCHDWGPLTSSYVPHLYKNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGLIGGPPP  450

Query  1322  SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGY  1501
             S RP+L F+AGGLHGP+RP+LL+HW+NKDEDV+V+ YLPKG+SY  MM+KS+YCICPSGY
Sbjct  451   SCRPILAFFAGGLHGPIRPLLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGY  510

Query  1502  EVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQ  1681
             EVASPR+VEA+Y GCVPVLI   YV PFSDVLNW++F+V +PV +IPNLK+IL  I  RQ
Sbjct  511   EVASPRIVEAIYAGCVPVLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSIPTRQ  570

Query  1682  YIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             Y RMQRRG+KVRRHFEVN PPKRFDV+HMILHS+W
Sbjct  571   YKRMQRRGLKVRRHFEVNFPPKRFDVYHMILHSVW  605



>gb|KHG04052.1| hypothetical protein F383_28592 [Gossypium arboreum]
Length=541

 Score =   530 bits (1366),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 240/380 (63%), Positives = 305/380 (80%), Gaps = 2/380 (1%)
 Frame = +2

Query  650   KSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEME  829
             K  R   T ++++EA L RARA+I +     +Q  D + VP+GPMY +A  F RSY EME
Sbjct  146   KRNRRVRTKLDKLEARLQRARAAI-KDAKNSSQLLDPEYVPIGPMYWDAKAFHRSYMEME  204

Query  830   KTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITV  1006
             K  KV+VY++G+PPV H GPCKS Y++EGNFI+ MD  ++FRT DP+KAH ++LPFS+  
Sbjct  205   KQFKVFVYKEGEPPVFHDGPCKSIYSMEGNFIYQMDVNTKFRTNDPEKAHAFYLPFSVAK  264

Query  1007  LSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPN  1186
             + + VY  +S D+ P++ T +DYVN V+ KYP+WNRSLGADHF+L+CHDWGPE SF+ P 
Sbjct  265   MVQFVYLRDSRDFGPIRRTVIDYVNVVSEKYPYWNRSLGADHFMLACHDWGPEASFSNPY  324

Query  1187  LHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHG  1366
             L  NSIRALCNANTSE+F+P KDVSIPE+ L +G   GL+GGPS S+RP+L F+AGG+HG
Sbjct  325   LGKNSIRALCNANTSEKFNPVKDVSIPEMNLRTGKLTGLIGGPSASRRPILAFFAGGVHG  384

Query  1367  PVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGC  1546
             P+RPILL+HWE KD++++VH YLPKG++Y  MMR S+YC+CPSGYEVASPR+VEALY GC
Sbjct  385   PIRPILLEHWEGKDDEIKVHKYLPKGINYYEMMRSSKYCLCPSGYEVASPRIVEALYNGC  444

Query  1547  VPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHF  1726
             VPVLI + YV PFSDVL W++F+V++ VEDIP LK+IL  IS RQYIRMQRR ++VRRHF
Sbjct  445   VPVLISKSYVPPFSDVLRWKSFSVVVSVEDIPRLKEILMKISSRQYIRMQRRVLQVRRHF  504

Query  1727  EVNSPPKRFDVFHMILHSIW  1786
             E +SPPKRFDVFHMILHSIW
Sbjct  505   EFHSPPKRFDVFHMILHSIW  524



>ref|XP_004249828.2| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=431

 Score =   525 bits (1353),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 241/374 (64%), Positives = 296/374 (79%), Gaps = 3/374 (1%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQTKDD-DSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             +N+E++EA L R R +I +      QT DD + VP GP+Y N + F RSY EMEK  K++
Sbjct  45    SNLEKVEAGLVRVRVAI-KEAQSKNQTLDDPEYVPTGPIYWNPTAFHRSYMEMEKHFKIF  103

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             VYE+G+PPV HY   +    IEG  IH ++ S+FRT DP+KAH+YFLPFS+  +   VY 
Sbjct  104   VYEEGEPPVFHYSASEGILGIEGILIHQIEISKFRTNDPEKAHVYFLPFSVLSIVSYVYV  163

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
              +S  W PM+ TA DY++S++RKYP+WNRSLG+DHF+L+CHDW P ISFA+P L+ NSIR
Sbjct  164   VDSRSWGPMQNTAADYIDSISRKYPYWNRSLGSDHFMLACHDWAPTISFAVPYLYKNSIR  223

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
              LCNANTSERFDP KDVS+PEI LP G   GL+GGPSPS R VLVFYAGG+HG +R +L+
Sbjct  224   VLCNANTSERFDPTKDVSLPEIYLPQGKMDGLIGGPSPSHRSVLVFYAGGIHGYIRQVLM  283

Query  1388  QHW-ENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             +HW +N D DVQ+H YLPK +SY GM+RKS++CICPSGYEVASPRMVEALYMGCVPVL+K
Sbjct  284   EHWGKNDDLDVQIHEYLPKNMSYYGMIRKSKFCICPSGYEVASPRMVEALYMGCVPVLLK  343

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YVAPFSDVLNW++F+V +   DIPNLKKIL  ISQ QYIRMQ+RG++VRRHFEVN PP
Sbjct  344   DHYVAPFSDVLNWKSFSVQMNSRDIPNLKKILMSISQTQYIRMQKRGLQVRRHFEVNFPP  403

Query  1745  KRFDVFHMILHSIW  1786
             KR+DVFHMILHSIW
Sbjct  404   KRYDVFHMILHSIW  417



>ref|XP_004497579.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=518

 Score =   528 bits (1360),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 241/382 (63%), Positives = 300/382 (79%), Gaps = 3/382 (1%)
 Frame = +2

Query  644   SRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAE  823
              +  ++  ++ ++R EA L +ARA+I        Q  D D VP+GPMY NA  F RSY E
Sbjct  127   QKMKQQRKFSILDRTEAGLLQARAAIREATNQTLQ--DPDYVPIGPMYWNAKAFHRSYLE  184

Query  824   MEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSI  1000
             MEK  KV+VYE+G+PPV H GPCKS Y++EGNFIHA++ + +FRT DPDKA ++FLPFS+
Sbjct  185   MEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPDKAQVFFLPFSV  244

Query  1001  TVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAI  1180
              +L + VY  +S D+ P++ T  DY+N +A KYP+WNRSLGADHF+L+CHDWGPE SF++
Sbjct  245   VMLVRFVYLRDSRDFGPIRKTVNDYINVIAGKYPYWNRSLGADHFMLACHDWGPETSFSV  304

Query  1181  PNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGL  1360
             P LH NSIR LCNANTSE+F+P KDVS PEI L +G+  G +GGPS SKRP+L F+AGGL
Sbjct  305   PYLHKNSIRVLCNANTSEKFNPSKDVSFPEINLQTGSINGFIGGPSASKRPILAFFAGGL  364

Query  1361  HGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYM  1540
             HG +R ILL HWENKD+D+ V  YLPKGVSY  M+RKS++C+CPSGYEVASPR+VEA+Y 
Sbjct  365   HGYIRSILLDHWENKDQDIMVQKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRVVEAIYT  424

Query  1541  GCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRR  1720
             GCVPVLI   YV PFSDVLNW++F+V + VEDIPNLK IL  IS  QYIRMQRR  ++RR
Sbjct  425   GCVPVLISEHYVLPFSDVLNWKSFSVEVKVEDIPNLKDILMRISTTQYIRMQRRVGQIRR  484

Query  1721  HFEVNSPPKRFDVFHMILHSIW  1786
             HFEV+SPPKRFDVFHMILHS+W
Sbjct  485   HFEVHSPPKRFDVFHMILHSVW  506



>gb|KCW48767.1| hypothetical protein EUGRSUZ_K02411, partial [Eucalyptus grandis]
Length=345

 Score =   521 bits (1342),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 237/344 (69%), Positives = 286/344 (83%), Gaps = 1/344 (0%)
 Frame = +2

Query  752   KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHA  931
             +D D VPVGPMYRNA+ F RSY EMEK  K++VY++G PPV H GPCKS YA+EGNFIH 
Sbjct  2     EDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPVFHNGPCKSIYAMEGNFIHM  61

Query  932   MDFS-RFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFW  1108
             ++ + RFRT DP +AH++FLPFS+ ++ + VY  +SHD+ P+K T +DY++ VA KYP+W
Sbjct  62    VEINKRFRTEDPREAHVFFLPFSVAMMVQFVYVRDSHDFGPIKRTVIDYIDVVASKYPYW  121

Query  1109  NRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG  1288
             NRSLGADHF+L+CHDWGPE SFA+P+LH NSIR LCNANTSE FDP KDVS PE+ L +G
Sbjct  122   NRSLGADHFMLACHDWGPEASFAVPHLHRNSIRVLCNANTSEGFDPSKDVSFPEVNLHTG  181

Query  1289  TTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMR  1468
                GL+GGPSPS R +L F+AGGLHGP+RPILLQHWENKDEDV+VH YLP+GVSY  MM+
Sbjct  182   AIGGLIGGPSPSHRSILAFFAGGLHGPIRPILLQHWENKDEDVKVHRYLPRGVSYYDMMK  241

Query  1469  KSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNL  1648
             +S++CICPSGYEVASPR+VEA+Y GCVPVLI   YV PFSDVLNW +F+V + V +IPNL
Sbjct  242   RSKFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWRSFSVEVTVREIPNL  301

Query  1649  KKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHS  1780
             K IL  IS RQYIRMQRR  +VRRHFEV+SPPKR+DVFHMILHS
Sbjct  302   KTILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMILHS  345



>ref|XP_010247793.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=592

 Score =   529 bits (1362),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 254/434 (59%), Positives = 316/434 (73%), Gaps = 12/434 (3%)
 Frame = +2

Query  494   PALVTTEEEIDKGLHENNVTG-DSRPILLAPETGIGDDERQNGISSDDTEDSRKSKRYTY  670
             PA +  EE+   G  E ++ G D  P+++         ER N  +  + +  R+SK    
Sbjct  155   PATMEVEED---GKLERSLNGYDVSPVIMKVPEEENKQERLNASAVAEVQKKRRSK----  207

Query  671   TNMERIEADLARARASILRgg-gggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
               +ER+EA L+RAR +I         QT D D VP GPMY NA  F RSY EMEK  KV+
Sbjct  208   --LERLEAGLSRARVTIREAAHQKRNQTPDLDYVPQGPMYWNAQAFHRSYLEMEKQFKVF  265

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVY  1024
             VYE+G+PP+ H GPC S Y+ EGNFIH M+   RFRT  P++AH++FLPFS+ ++ + VY
Sbjct  266   VYEEGEPPLFHNGPCGSIYSSEGNFIHQMEMDKRFRTQHPEEAHVFFLPFSVAMMVRFVY  325

Query  1025  EPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
               +SHD  P+K T  DYVN +A KYP+WNRSL ADHF+LSCHDWGP  S  +P+L+NN I
Sbjct  326   VRDSHDIGPIKHTVTDYVNIIAGKYPYWNRSLAADHFMLSCHDWGPATSTYVPHLYNNGI  385

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             R LCNANTSE F+P KD S PEI + +   KGL+GGPSPS RP L F+AG LHGPVRP+L
Sbjct  386   RVLCNANTSEGFNPAKDASFPEINMVTREIKGLIGGPSPSHRPTLAFFAGKLHGPVRPVL  445

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
              +HW+NKDEDVQV+  LP+G+SY  MMRKS+YCICPSGYEVASPR+VEALY+GCVPVLI 
Sbjct  446   FEHWKNKDEDVQVYESLPRGLSYYDMMRKSKYCICPSGYEVASPRVVEALYVGCVPVLIS  505

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSD+LNW +F+V +PV +IPNLK+IL  IS +QYIRMQRRG+ VR+HFEVN PP
Sbjct  506   DHYVPPFSDILNWRSFSVEVPVNEIPNLKRILLNISSKQYIRMQRRGLLVRKHFEVNFPP  565

Query  1745  KRFDVFHMILHSIW  1786
             KRFDV+HMILHS+W
Sbjct  566   KRFDVYHMILHSVW  579



>ref|XP_006339262.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=456

 Score =   523 bits (1347),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 241/374 (64%), Positives = 294/374 (79%), Gaps = 3/374 (1%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQTKDD-DSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             +N+E++EA L R R +I +      QT DD + VP GP+Y N + F RSY EMEK  K+Y
Sbjct  70    SNLEKVEAGLVRVRVAI-KEAQSKNQTFDDPEYVPTGPIYWNPTAFHRSYMEMEKHFKIY  128

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             VYE+G+PPV HY   +    IEG  IH ++ S+FRT DP+KAH+YFLPFS+  +   VY 
Sbjct  129   VYEEGEPPVFHYSASEGILGIEGILIHHIEISKFRTNDPEKAHVYFLPFSVLSIVSYVYV  188

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
              NS  W PM+ TA DY++ ++RKYP+WNRSLGADHF+L+CHDW P ISFA+P L+ NSIR
Sbjct  189   VNSRSWGPMQNTAADYIDGISRKYPYWNRSLGADHFMLACHDWAPTISFAVPYLYKNSIR  248

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
              LCNANTSERFDP KDVS+PEI LP G   GL+GGPSPS R VLVFYAGG+HG +R +L+
Sbjct  249   VLCNANTSERFDPTKDVSLPEIYLPQGKMDGLIGGPSPSHRSVLVFYAGGIHGYIRQVLM  308

Query  1388  QHW-ENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             + W +N D DVQ+H YLPK +SY GM+RKS++CICPSGYEVASPRMVEALYMGCVPVL+K
Sbjct  309   ELWGKNDDSDVQIHEYLPKNMSYYGMIRKSKFCICPSGYEVASPRMVEALYMGCVPVLLK  368

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YVAPF+DVLNW++FAV +   DIPNLKKIL  ISQ QYIRMQ+RG++VRRHFEVN PP
Sbjct  369   DHYVAPFNDVLNWKSFAVQMNSTDIPNLKKILMSISQTQYIRMQKRGLQVRRHFEVNFPP  428

Query  1745  KRFDVFHMILHSIW  1786
             +R+DVFHMILHSIW
Sbjct  429   RRYDVFHMILHSIW  442



>ref|XP_006430348.1| hypothetical protein CICLE_v10011407mg [Citrus clementina]
 gb|ESR43588.1| hypothetical protein CICLE_v10011407mg [Citrus clementina]
Length=552

 Score =   526 bits (1355),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 246/381 (65%), Positives = 305/381 (80%), Gaps = 2/381 (1%)
 Frame = +2

Query  647   RKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEM  826
             +  ++   T +E++EA L RAR +I +    G QT+D D VP+GPMY ++  F RSY EM
Sbjct  156   KAERKRAVTKLEKLEAGLQRARVAI-KEASIGNQTQDPDFVPLGPMYWDSKAFHRSYLEM  214

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSIT  1003
             E+  KV+VYE+G+PPV H GPCKS Y++EGNFI+ M+ ++ FRT + DKAH++FLPFS+ 
Sbjct  215   EQKFKVFVYEEGEPPVFHDGPCKSIYSMEGNFIYTMEVNKQFRTKEADKAHVFFLPFSVV  274

Query  1004  VLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIP  1183
              L + VY  +SHD+ P++ T +DYVN +A KYP+WNRSLGADHF+L+CHDWGPE SF++P
Sbjct  275   KLVRFVYVRDSHDFGPIRRTVIDYVNLIAGKYPYWNRSLGADHFMLACHDWGPETSFSVP  334

Query  1184  NLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLH  1363
              L  NSIR LCNANTSE+F P KDVS PEI L +G   GL+GGPSPS+R +L F+AGG+H
Sbjct  335   YLGKNSIRVLCNANTSEKFSPVKDVSFPEINLQTGGLTGLIGGPSPSRRSILAFFAGGVH  394

Query  1364  GPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMG  1543
             GP+RP+LL+HWENKDED++VH YLPKGVSY  MMRKS+YC+CPSGYEVASPR+VEA+Y G
Sbjct  395   GPIRPVLLEHWENKDEDIRVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEAIYTG  454

Query  1544  CVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRH  1723
             CVPVLI   YV PFSDVLNW++F+V +   DIPNLK ILT IS RQYIRM RR V+VRRH
Sbjct  455   CVPVLISEHYVPPFSDVLNWKSFSVALSTRDIPNLKSILTSISPRQYIRMHRRVVQVRRH  514

Query  1724  FEVNSPPKRFDVFHMILHSIW  1786
             FE NSPPKRFDVFHMILHSIW
Sbjct  515   FEFNSPPKRFDVFHMILHSIW  535



>gb|KDO60990.1| hypothetical protein CISIN_1g048582mg [Citrus sinensis]
Length=555

 Score =   526 bits (1355),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 246/381 (65%), Positives = 305/381 (80%), Gaps = 2/381 (1%)
 Frame = +2

Query  647   RKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEM  826
             +  ++   T +E++EA L RAR +I +    G QT+D D VP+GPMY ++  F RSY EM
Sbjct  159   KAERKRAVTKLEKLEAGLQRARVAI-KEASIGNQTQDPDFVPLGPMYWDSKAFHRSYLEM  217

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSIT  1003
             E+  KV+VYE+G+PPV H GPCKS Y++EGNFI+ M+ ++ FRT + DKAH++FLPFS+ 
Sbjct  218   EQKFKVFVYEEGEPPVFHDGPCKSIYSMEGNFIYTMEVNKQFRTKEADKAHVFFLPFSVV  277

Query  1004  VLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIP  1183
              L + VY  +SHD+ P++ T +DYVN +A KYP+WNRSLGADHF+L+CHDWGPE SF++P
Sbjct  278   KLVRFVYVRDSHDFGPIRRTVIDYVNLIAGKYPYWNRSLGADHFMLACHDWGPETSFSVP  337

Query  1184  NLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLH  1363
              L  NSIR LCNANTSE+F P KDVS PEI L +G   GL+GGPSPS+R +L F+AGG+H
Sbjct  338   YLGKNSIRVLCNANTSEKFSPVKDVSFPEINLQTGGLTGLIGGPSPSRRSILAFFAGGVH  397

Query  1364  GPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMG  1543
             GP+RP+LL+HWENKDED++VH YLPKGVSY  MMRKS+YC+CPSGYEVASPR+VEA+Y G
Sbjct  398   GPIRPVLLEHWENKDEDIRVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEAIYTG  457

Query  1544  CVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRH  1723
             CVPVLI   YV PFSDVLNW++F+V +   DIPNLK ILT IS RQYIRM RR V+VRRH
Sbjct  458   CVPVLISEHYVPPFSDVLNWKSFSVALSTRDIPNLKSILTSISPRQYIRMHRRVVQVRRH  517

Query  1724  FEVNSPPKRFDVFHMILHSIW  1786
             FE NSPPKRFDVFHMILHSIW
Sbjct  518   FEFNSPPKRFDVFHMILHSIW  538



>ref|XP_006481931.1| PREDICTED: probable glycosyltransferase At5g03795-like [Citrus 
sinensis]
Length=555

 Score =   526 bits (1354),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 246/381 (65%), Positives = 305/381 (80%), Gaps = 2/381 (1%)
 Frame = +2

Query  647   RKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEM  826
             +  ++   T +E++EA L RAR +I +    G QT+D D VP+GPMY ++  F RSY EM
Sbjct  159   KAERKRAVTKLEKLEAGLQRARVAI-KEASIGNQTQDPDFVPLGPMYWDSKAFHRSYLEM  217

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSIT  1003
             E+  KV+VYE+G+PPV H GPCKS Y++EGNFI+ M+ ++ FRT + DKAH++FLPFS+ 
Sbjct  218   EQKFKVFVYEEGEPPVFHDGPCKSIYSMEGNFIYTMEVNKQFRTKEADKAHVFFLPFSVV  277

Query  1004  VLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIP  1183
              L + VY  +SHD+ P++ T +DYVN +A KYP+WNRSLGADHF+L+CHDWGPE SF++P
Sbjct  278   KLVRFVYVRDSHDFGPIRRTVVDYVNLIAGKYPYWNRSLGADHFMLACHDWGPETSFSVP  337

Query  1184  NLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLH  1363
              L  NSIR LCNANTSE+F P KDVS PEI L +G   GL+GGPSPS+R +L F+AGG+H
Sbjct  338   YLGKNSIRVLCNANTSEKFSPVKDVSFPEINLQTGGLTGLIGGPSPSRRSILAFFAGGVH  397

Query  1364  GPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMG  1543
             GP+RP+LL+HWENKDED++VH YLPKGVSY  MMRKS+YC+CPSGYEVASPR+VEA+Y G
Sbjct  398   GPIRPVLLEHWENKDEDIRVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEAIYTG  457

Query  1544  CVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRH  1723
             CVPVLI   YV PFSDVLNW++F+V +   DIPNLK ILT IS RQYIRM RR V+VRRH
Sbjct  458   CVPVLISEHYVPPFSDVLNWKSFSVALSTRDIPNLKSILTSISPRQYIRMHRRVVQVRRH  517

Query  1724  FEVNSPPKRFDVFHMILHSIW  1786
             FE NSPPKRFDVFHMILHSIW
Sbjct  518   FEFNSPPKRFDVFHMILHSIW  538



>ref|XP_009340969.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=542

 Score =   524 bits (1349),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 250/412 (61%), Positives = 308/412 (75%), Gaps = 7/412 (2%)
 Frame = +2

Query  554   GDSRPILLAPETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgg  733
              ++ P L  P    GDD R    +S   +  RK+    +       A  A   A      
Sbjct  125   AEALPTLQQPNVTKGDDSRNETHASIMEKRQRKNTNLGWLEARLRRARAAIREAKF----  180

Query  734   gggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIE  913
               G QT+D D +P GPMY NA+ F RSY EME+  KV+VY +G+PP+ H GPCKS Y++E
Sbjct  181   --GNQTRDVDYIPNGPMYWNANAFHRSYLEMEEKFKVFVYAEGEPPLFHNGPCKSIYSME  238

Query  914   GNFIHAMDFSR-FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVA  1090
             GNFIH ++ ++ FRT DP+KAH+YFLPFS+T+L + VY  +SHD+SP++ T  DYVN V+
Sbjct  239   GNFIHEIEVNKQFRTQDPEKAHVYFLPFSVTMLVRFVYVRDSHDFSPIRQTVRDYVNIVS  298

Query  1091  RKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPE  1270
              KYP+WNRSLGADHF+L+CHDWGPE S + P+L  NSIRALCNANTSE F+P +DVS PE
Sbjct  299   EKYPYWNRSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFNPSRDVSFPE  358

Query  1271  IVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVS  1450
             I L +G T G LGGPSP  R  L F+AGG+HGP+RPILL+HWENKD D++VH YLPKG S
Sbjct  359   INLQTGDTHGFLGGPSPRLRSNLAFFAGGVHGPIRPILLEHWENKDPDMRVHQYLPKGAS  418

Query  1451  YNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPV  1630
             Y  MMR+SR+C+CPSGYEVASPR+VEA+Y GCVPVLI   YV PFSD+LNW++F+V + V
Sbjct  419   YYDMMRQSRFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDILNWKSFSVEVSV  478

Query  1631  EDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
              DIPNLKKILT IS RQY+RMQRR ++VR+HFEVNSPPKRFDVFHMILHSIW
Sbjct  479   SDIPNLKKILTRISSRQYVRMQRRVLQVRKHFEVNSPPKRFDVFHMILHSIW  530



>gb|KFK24839.1| hypothetical protein AALP_AA8G031400 [Arabis alpina]
Length=498

 Score =   521 bits (1343),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 243/378 (64%), Positives = 304/378 (80%), Gaps = 2/378 (1%)
 Frame = +2

Query  656   KRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKT  835
             ++   +N+E++E +L +ARA+I +         D D VP+GPMY NA  F RSY EMEK 
Sbjct  111   QKRILSNLEKVEFELQKARAAI-KASSIDDPVDDPDYVPLGPMYWNAKVFHRSYLEMEKQ  169

Query  836   LKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLS  1012
              K++VY++G+PP+ H GPCKS Y++EG+FI+ M+  + FRT +PDKAH ++LP S+  + 
Sbjct  170   FKIFVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETNTHFRTNNPDKAHAFYLPLSVVKMV  229

Query  1013  KLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLH  1192
             + VY+ NS D+ P++ T  DY+  V+ +YP+WNRS+GADHFILSCHDWGPE SF+ P+L 
Sbjct  230   RFVYDRNSRDFGPIRNTVRDYIELVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPHLG  289

Query  1193  NNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPV  1372
              NSIRALCNANTSERF P+KDVSIPEI L +G+  GL+GGPSPS RP+L F+AGG+HGPV
Sbjct  290   QNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGGVHGPV  349

Query  1373  RPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVP  1552
             RPILL+HWENKD D++VH YLPKG SY+ MMR S++CICPSGYEVASPR+VEALY GCVP
Sbjct  350   RPILLEHWENKDNDIRVHKYLPKGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVP  409

Query  1553  VLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEV  1732
             VLI  GYV PFSDVLNW++F+VI+ VE+IPNLK ILT IS RQY+RM RR +KVRRHFEV
Sbjct  410   VLINSGYVPPFSDVLNWKSFSVIVSVEEIPNLKTILTSISPRQYLRMYRRVLKVRRHFEV  469

Query  1733  NSPPKRFDVFHMILHSIW  1786
             NSP KRFDVFHMILHSIW
Sbjct  470   NSPAKRFDVFHMILHSIW  487



>emb|CDX80888.1| BnaC03g01420D [Brassica napus]
Length=515

 Score =   521 bits (1343),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 254/416 (61%), Positives = 315/416 (76%), Gaps = 8/416 (2%)
 Frame = +2

Query  545   NVTGD-SRPILLAPETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASI  721
             +V GD +R I L P   I      N ++S  T  S   K+     +++IE +L +AR +I
Sbjct  95    SVQGDKNRTIQLNP---INITLVSNNVTS--TASSELMKKRVTKKIDKIEFELQKARVAI  149

Query  722   LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKST  901
              +         D D VP+GPMY NA  F RSY EMEK  K++VY +G PP+ H GPCKS 
Sbjct  150   -KAASMDDPVDDPDYVPIGPMYWNAKVFHRSYLEMEKQFKIFVYREGDPPLFHDGPCKSI  208

Query  902   YAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYV  1078
             Y++EGNFI+ M+  + FRT +PDKAH ++LP S+  + + VY+ +SHD+ P++ T  DY+
Sbjct  209   YSMEGNFIYEMERDTHFRTNNPDKAHAFYLPLSVVKMVRYVYQRDSHDFGPIRRTVRDYI  268

Query  1079  NSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDV  1258
             + V+ +YP+WNRS+GADHFILSCHDWGPE SF+ P+L  NSIRALCNANTSERF P+KDV
Sbjct  269   DLVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPHLGQNSIRALCNANTSERFKPRKDV  328

Query  1259  SIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLP  1438
             SIPEI L +G+ KGL+GGPSPS RP+L F+AGG+HGPVRP+LLQHWENKD D++VH YLP
Sbjct  329   SIPEINLRTGSLKGLVGGPSPSVRPILAFFAGGVHGPVRPVLLQHWENKDNDIRVHKYLP  388

Query  1439  KGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAV  1618
             KG SY  MMR S++C+CPSGYEVASPR+VEALY GCVPVLI  GYV PFSDVLNW +F+V
Sbjct  389   KGTSYPDMMRSSKFCLCPSGYEVASPRIVEALYSGCVPVLINSGYVPPFSDVLNWRSFSV  448

Query  1619  IIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             I+ VEDIP LK ILT IS RQY++M RR +KVRRHFEVNSP KRFDVFHMILHSIW
Sbjct  449   IVSVEDIPKLKTILTSISPRQYLKMYRRVLKVRRHFEVNSPAKRFDVFHMILHSIW  504



>ref|XP_008359607.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=539

 Score =   522 bits (1344),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 237/349 (68%), Positives = 287/349 (82%), Gaps = 1/349 (0%)
 Frame = +2

Query  743   TQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNF  922
              QT D D +P GPMY NA+ F  SY EME+  KV+VY +G+PP+ H GPCKS Y++EGNF
Sbjct  179   NQTHDVDYIPNGPMYWNANAFHSSYLEMEEKFKVFVYAEGEPPLFHNGPCKSIYSMEGNF  238

Query  923   IHAMDFSR-FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKY  1099
             IH ++ ++ FRT DP+KAH+YFLPFS+T+L + VY  +SHD+SP++ T  DYVN V+ KY
Sbjct  239   IHQIEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHDFSPIRQTVRDYVNIVSEKY  298

Query  1100  PFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVL  1279
             P+WNRSLGADHF+L+CHDWGPE S + P+L  NSIRALCNANTSE F+P KDVS PEI L
Sbjct  299   PYWNRSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFNPSKDVSFPEINL  358

Query  1280  PSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNG  1459
              +G T G LGGPSP  R  L F+AGG+HGP+RPILL+HWENKD D++VH YLPKGVSY  
Sbjct  359   QTGDTHGFLGGPSPRLRSNLAFFAGGVHGPIRPILLEHWENKDPDMRVHQYLPKGVSYYN  418

Query  1460  MMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDI  1639
             MMR+SR+C+CPSGYEVASPR+VEA+Y GCVPVLI   YV PFSD+LNW++F+V + V DI
Sbjct  419   MMRQSRFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDILNWKSFSVEVSVSDI  478

Query  1640  PNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             PNLKKILT IS RQY+RMQRR ++VR+HFEVNSPPKRFDVFHMILHSIW
Sbjct  479   PNLKKILTSISSRQYVRMQRRVLQVRKHFEVNSPPKRFDVFHMILHSIW  527



>ref|XP_003542567.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
 gb|KHN48212.1| Putative glycosyltransferase [Glycine soja]
Length=505

 Score =   521 bits (1341),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 244/388 (63%), Positives = 304/388 (78%), Gaps = 3/388 (1%)
 Frame = +2

Query  626   SDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFF  805
             SD++   +K KR  ++ +++ EA LA+ARA+I R      QT+D D VPVGPMY N   F
Sbjct  108   SDESHPRQKRKR-KFSFLDKTEAVLAQARAAI-REAENWNQTQDSDYVPVGPMYWNPKEF  165

Query  806   LRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLY  982
              RSY EMEK  KV+VYE+G+ PV H GPC S Y+ EG+FIHA++ +  FRT DP KAH++
Sbjct  166   HRSYLEMEKQFKVFVYEEGELPVFHEGPCASIYSTEGSFIHAIEMNEHFRTRDPKKAHVF  225

Query  983   FLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGP  1162
             FLPFS+ ++ + VY  +SHD+ P+K T  DY+N +A +YP+WNRSLGADHF+LSCHDWGP
Sbjct  226   FLPFSVVMMVRYVYIRDSHDFGPIKRTVRDYINVIAARYPYWNRSLGADHFMLSCHDWGP  285

Query  1163  EISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLV  1342
             E S   P L  NSIR LCNANTSE FDP+KDVS PEI L  G   GLLGGPS S+R +L 
Sbjct  286   EASKFSPYLRKNSIRVLCNANTSEGFDPRKDVSFPEINLQRGPIDGLLGGPSASQRSILA  345

Query  1343  FYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRM  1522
             F+AGG+HGP+RPILL+HWE KDED+QVH YLPKGVSY GM+RKS++C+CPSGYEVASPR+
Sbjct  346   FFAGGIHGPIRPILLEHWEKKDEDIQVHQYLPKGVSYYGMLRKSKFCLCPSGYEVASPRV  405

Query  1523  VEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRR  1702
             VEA+Y GCVPVLI   YV PFSDVLNW+ F+V + +++IPNLK IL  IS R+YIRMQ+R
Sbjct  406   VEAIYTGCVPVLISDHYVPPFSDVLNWKMFSVEVSMKEIPNLKDILMNISPRKYIRMQKR  465

Query  1703  GVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
               ++RRHFEV+SPPKR+DVFHMILHS+W
Sbjct  466   VRQIRRHFEVHSPPKRYDVFHMILHSVW  493



>emb|CDY11270.1| BnaA03g01060D [Brassica napus]
Length=389

 Score =   516 bits (1328),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 242/378 (64%), Positives = 300/378 (79%), Gaps = 2/378 (1%)
 Frame = +2

Query  656   KRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKT  835
             K+     +++IE +L +AR +I +         D D VP+GPMY NA  F RSY EMEK 
Sbjct  2     KKRVTKKIDKIEFELQKARVAI-KAASMDDPVDDPDYVPIGPMYWNAKVFHRSYLEMEKQ  60

Query  836   LKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLS  1012
              K++VY++G PP+ H GPCKS Y++EGNFI+ M+  + FRT +PDKAH ++LP S+  + 
Sbjct  61    FKIFVYKEGDPPLFHDGPCKSIYSMEGNFIYEMERDTHFRTNNPDKAHAFYLPLSVVKMV  120

Query  1013  KLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLH  1192
             + VY+ +SHD+ P++ T  DY++ V+ +YP+WNRS+GADHFILSCHDWGPE SF+ P+L 
Sbjct  121   RYVYQRDSHDFGPIRRTVRDYIDLVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPHLG  180

Query  1193  NNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPV  1372
              NSIRALCNANTSERF P+KDVSIPEI L +G+ KGL+GGPSPS RP+L F+AGG+HGPV
Sbjct  181   QNSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSIRPILAFFAGGVHGPV  240

Query  1373  RPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVP  1552
             RP+LLQHWENKD+D+ VH YLPKG SY  MMR S++C+CPSGYEVASPR+VEALY GCVP
Sbjct  241   RPVLLQHWENKDKDISVHKYLPKGTSYPDMMRSSKFCLCPSGYEVASPRIVEALYSGCVP  300

Query  1553  VLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEV  1732
             VLI  GYV PFSDVLNW +F+VI+ VEDIP LK ILT IS RQY++M RR +KVRRHFEV
Sbjct  301   VLINSGYVPPFSDVLNWRSFSVIVSVEDIPKLKTILTSISPRQYLKMYRRVLKVRRHFEV  360

Query  1733  NSPPKRFDVFHMILHSIW  1786
             NSP KRFDVFHMILHSIW
Sbjct  361   NSPAKRFDVFHMILHSIW  378



>ref|XP_009130782.1| PREDICTED: probable glycosyltransferase At5g03795 [Brassica rapa]
Length=518

 Score =   520 bits (1340),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 253/416 (61%), Positives = 315/416 (76%), Gaps = 8/416 (2%)
 Frame = +2

Query  545   NVTGD-SRPILLAPETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASI  721
             +V GD +R I L P   I      N ++S  T  S   K+     +++IE +L +AR +I
Sbjct  98    SVQGDKNRTIQLNP---INITLVSNNVTS--TASSELMKKRVTKKIDKIEFELQKARVAI  152

Query  722   LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKST  901
              +         D D VP+GPMY NA  F RSY EMEK  K++VY++G PP+ H GPCKS 
Sbjct  153   -KAASMDDPVDDPDYVPIGPMYWNAKVFHRSYLEMEKQFKIFVYKEGDPPLFHDGPCKSI  211

Query  902   YAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYV  1078
             Y++EGNFI+ M+  + FRT +PDKAH ++LP S+  + + VY+ +SHD+ P++ T  DY+
Sbjct  212   YSMEGNFIYEMERDTHFRTNNPDKAHAFYLPLSVVKMVRYVYQRDSHDFGPIRRTVRDYI  271

Query  1079  NSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDV  1258
             + V+ +YP+WNRS+GADHFILSCHDWGPE SF+ P+L  NSIRALCNANTSERF P+KDV
Sbjct  272   DLVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPHLGQNSIRALCNANTSERFKPRKDV  331

Query  1259  SIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLP  1438
             SIPEI L +G+ KGL+GGPSPS RP+L F+AGG+HGPVRP+LLQHWENKD D++VH YLP
Sbjct  332   SIPEINLRTGSLKGLVGGPSPSIRPILAFFAGGVHGPVRPVLLQHWENKDNDIRVHKYLP  391

Query  1439  KGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAV  1618
             KG SY  MMR S++C+CPSGYEVA PR+VEALY GCVPVLI  GYV PFSDVLNW +F+V
Sbjct  392   KGTSYPDMMRSSKFCLCPSGYEVAGPRIVEALYSGCVPVLINSGYVPPFSDVLNWRSFSV  451

Query  1619  IIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             I+ VEDIP LK ILT IS RQY++M RR +KVRRHFEVNSP KRFDVFHMILHSIW
Sbjct  452   IVSVEDIPKLKTILTSISPRQYLKMYRRVLKVRRHFEVNSPAKRFDVFHMILHSIW  507



>ref|XP_008392545.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=542

 Score =   520 bits (1339),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 235/349 (67%), Positives = 287/349 (82%), Gaps = 1/349 (0%)
 Frame = +2

Query  743   TQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNF  922
              QT+D D +P GPMY NA+ F RSY EME+  KV+VY +G+PP+ H GPCKS Y++EGNF
Sbjct  182   NQTRDVDYIPNGPMYWNANAFHRSYLEMEEXFKVFVYGEGEPPLFHNGPCKSIYSMEGNF  241

Query  923   IHAMDFSR-FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKY  1099
             IH ++ ++ FRT DP+KAH+YFLPFS+T+L + VY  +SHD+ P++ T  DYVN V+ KY
Sbjct  242   IHEIEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHDFGPIRRTVRDYVNIVSEKY  301

Query  1100  PFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVL  1279
             P+WNRSLGADHF+L+CHDWGPE S + P+L  NSIRALCNANTSE F+P KDVS PEI L
Sbjct  302   PYWNRSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFNPSKDVSFPEINL  361

Query  1280  PSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNG  1459
              +G T G +GGPSP  R +L F+AGG+HGP+RPILL+HWENKD D++VH YLPKGVSY  
Sbjct  362   QTGDTHGFIGGPSPRLRSILGFFAGGVHGPIRPILLEHWENKDPDLRVHQYLPKGVSYYD  421

Query  1460  MMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDI  1639
             MMR+SR+C+CPSGYEVASPR+VEA+Y GC+PVLI   YV PFSDVLNW +F++ +   DI
Sbjct  422   MMRQSRFCLCPSGYEVASPRVVEAIYTGCIPVLISDHYVPPFSDVLNWRSFSIEVSASDI  481

Query  1640  PNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             PNLKKILT IS RQY+RMQRR ++VRRHFEVNSPPKRFDVFHMILHSIW
Sbjct  482   PNLKKILTSISSRQYLRMQRRVLQVRRHFEVNSPPKRFDVFHMILHSIW  530



>ref|XP_009776098.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=484

 Score =   518 bits (1333),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 237/375 (63%), Positives = 292/375 (78%), Gaps = 3/375 (1%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQTKDDDS--VPVGPMYRNASFFLRSYAEMEKTLKV  844
             +N+ R+EA L + R +I            DDS  VP GP Y N S F RSY EMEK  K+
Sbjct  99    SNLGRVEAGLGKVRGAIREAQSNSNNQTFDDSEYVPRGPCYWNPSAFHRSYIEMEKHFKI  158

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVY  1024
             YVYE G+PPV HY   +    IEG  IH ++ S+FRT DP+KAH+YFLPFS+  +   VY
Sbjct  159   YVYEKGEPPVFHYSSSEGILGIEGIMIHQIEISKFRTNDPEKAHVYFLPFSVFSIVSYVY  218

Query  1025  EPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
               +SH W PMK T  DY++ ++ KYP+WNRSLG+DHF+L+CHDW PEIS A+P L+ NSI
Sbjct  219   VVDSHQWGPMKNTVADYIDGISTKYPYWNRSLGSDHFMLACHDWAPEISTAVPYLYKNSI  278

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             R LCNANTSERF+P KDV++PEI LP GT KGL+GGPSPS+R VLVF+AGG+HG +R +L
Sbjct  279   RVLCNANTSERFNPSKDVTLPEIYLPQGTMKGLIGGPSPSQRSVLVFHAGGIHGYIRQVL  338

Query  1385  LQHW-ENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             ++ W +N D++VQ+H YLPK VSY GM+RKS++CICPSG+EVASPRMVEALYMGCVPVL+
Sbjct  339   MEKWGKNDDQEVQIHEYLPKNVSYYGMIRKSKFCICPSGWEVASPRMVEALYMGCVPVLL  398

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
             K  YVAPFSDVLNW++FAV +   DIPNLKKIL  ISQ+QYI+MQ+RG++VRRHFEVN P
Sbjct  399   KDHYVAPFSDVLNWKSFAVEMTSNDIPNLKKILMAISQKQYIKMQKRGLQVRRHFEVNFP  458

Query  1742  PKRFDVFHMILHSIW  1786
             PKR+DVFHMILHSIW
Sbjct  459   PKRYDVFHMILHSIW  473



>ref|XP_007202112.1| hypothetical protein PRUPE_ppa006842mg [Prunus persica]
 gb|EMJ03311.1| hypothetical protein PRUPE_ppa006842mg [Prunus persica]
Length=393

 Score =   513 bits (1322),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 235/349 (67%), Positives = 286/349 (82%), Gaps = 1/349 (0%)
 Frame = +2

Query  743   TQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNF  922
              QT+D D +P GPMY NA+ F RSY EMEK  KV+VY +G+PP+ H GPCKS Y++EGNF
Sbjct  33    NQTQDVDYIPNGPMYWNANAFQRSYLEMEKRFKVFVYGEGEPPLFHNGPCKSIYSMEGNF  92

Query  923   IHAMDFSR-FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKY  1099
             IH ++ ++ FRT DP+KAH+YFLPFS+T+L + VY  +SHD+ P++ T  DYVN V+ KY
Sbjct  93    IHEIEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHDFGPIRQTVRDYVNIVSGKY  152

Query  1100  PFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVL  1279
             P+WNRSLGADHF+L+CHDWGPE S + P+L  NSIR LCNANTSE F+P KDVS PEI L
Sbjct  153   PYWNRSLGADHFMLACHDWGPETSNSDPHLRKNSIRVLCNANTSEGFNPSKDVSFPEINL  212

Query  1280  PSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNG  1459
              +G T G LGGPSP  R +L F+AGG+HGP+RP+LL+HWENKDED++VH YLPKG+SY  
Sbjct  213   QTGDTHGFLGGPSPRLRSILAFFAGGVHGPIRPVLLEHWENKDEDLRVHQYLPKGISYYD  272

Query  1460  MMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDI  1639
             MMR S++C+CPSGYEVASPR+VEA+Y GCVPVLI   YV PFSDVLNW++F+V + V +I
Sbjct  273   MMRHSKFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVKVSEI  332

Query  1640  PNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             PNLK IL  IS +QYIRMQRR V+VRRHFEVNSPPKRFDVFHMILHSIW
Sbjct  333   PNLKNILMSISTKQYIRMQRRVVQVRRHFEVNSPPKRFDVFHMILHSIW  381



>gb|KEH24082.1| glycosyltransferase [Medicago truncatula]
Length=402

 Score =   512 bits (1319),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 238/373 (64%), Positives = 298/373 (80%), Gaps = 2/373 (1%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYV  850
             +N++R+EADL +ARA+I R    G QT+D D VP GPMY   + F RSY EMEK  KV+V
Sbjct  19    SNLDRVEADLLQARAAI-RKAVNGKQTQDIDYVPTGPMYHKPNLFHRSYLEMEKRFKVFV  77

Query  851   YEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             YE+G+PPV H GPC+  Y++EG FI+ M+ + +F T DP+KAH++FL +S+ ++   VY 
Sbjct  78    YEEGEPPVFHDGPCRDIYSMEGIFINQMEMNDKFITKDPEKAHVFFLSYSVAMMVHYVYV  137

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
              +S  +  ++IT  DY+N ++ KYP+WNRS GADHFIL+CHDWGPE+S A+PNL+ NSIR
Sbjct  138   RDSRAYDLLRITVKDYINVLSEKYPYWNRSHGADHFILACHDWGPEVSNAVPNLYKNSIR  197

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
             A CNANTSE F P KDVSIPEI + +G    LLGGPSPSKR +L F+AGGLHG +R +LL
Sbjct  198   AFCNANTSEGFKPVKDVSIPEINVRTGIIDDLLGGPSPSKRSILAFFAGGLHGDIRNVLL  257

Query  1388  QHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             +HWE+KDED+QVH YLPKGVSY  M+RKS++C+CPSG+EVASPR+VEA+Y GCVPVLI  
Sbjct  258   EHWEHKDEDIQVHKYLPKGVSYYAMLRKSKFCLCPSGWEVASPRVVEAIYTGCVPVLISD  317

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
              YV PFSDVLNW++F+V + V DIPNLKKIL+ IS RQYIRMQRR  +VR+HFEVNSPPK
Sbjct  318   HYVPPFSDVLNWKSFSVEVSVNDIPNLKKILSNISPRQYIRMQRRVGQVRKHFEVNSPPK  377

Query  1748  RFDVFHMILHSIW  1786
             RFDVFHMILHSIW
Sbjct  378   RFDVFHMILHSIW  390



>ref|XP_009413449.1| PREDICTED: probable glycosyltransferase At5g03795 [Musa acuminata 
subsp. malaccensis]
Length=514

 Score =   515 bits (1326),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 242/377 (64%), Positives = 295/377 (78%), Gaps = 4/377 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTL  838
             YT ++R+E  L RARA+I    R  G  T   D D VP GP+YRNA  F RSY EMEK  
Sbjct  123   YTKLQRLELGLGRARAAIKKAFRNAGNRTALPDKDYVPQGPLYRNAYAFHRSYLEMEKLF  182

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSK  1015
             KVYVYE+G+PP+ H GPC+S Y+ EG FI++M+  SR+RT +PD AH++FLPFS+  + K
Sbjct  183   KVYVYEEGEPPLFHDGPCRSIYSSEGRFINSMEMDSRYRTRNPDLAHVFFLPFSVAKMVK  242

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              +Y+P S D SP+K T  DY++ VA +YP+WNRSLGADHF+LSCHDWGP  S A+PNL+ 
Sbjct  243   FIYKPESFDISPIKKTIADYIDVVAERYPYWNRSLGADHFMLSCHDWGPHSSKAVPNLYG  302

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             NS+R LCNANTSE FDP KDVS+PEI + +     ++GGPS S RP+L F+AGG HGPVR
Sbjct  303   NSVRVLCNANTSEGFDPSKDVSLPEINIKTDVMADMMGGPSASHRPILAFFAGGDHGPVR  362

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
             P+LL+ W++KD DVQVH YLPKGVSY   MRKS+YC+CPSGYEVASPR+VEA+Y+GCVPV
Sbjct  363   PLLLEAWKDKDPDVQVHEYLPKGVSYYDTMRKSKYCLCPSGYEVASPRIVEAIYLGCVPV  422

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
              I   YV PFSDVL+W+AF+V I VEDIPN+KKIL GIS  QYIR+QRRG  V+RHF VN
Sbjct  423   TINDHYVLPFSDVLDWKAFSVQISVEDIPNIKKILMGISPTQYIRLQRRGAMVQRHFVVN  482

Query  1736  SPPKRFDVFHMILHSIW  1786
             SPP+RFDVFHMILHSIW
Sbjct  483   SPPRRFDVFHMILHSIW  499



>ref|XP_009375632.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=543

 Score =   516 bits (1329),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 235/349 (67%), Positives = 286/349 (82%), Gaps = 1/349 (0%)
 Frame = +2

Query  743   TQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNF  922
              QT+  D +P GPMY NA+ F RSY EME+  KV+VY +G+PP+ H GPCKS Y++EGNF
Sbjct  183   NQTRGVDYIPNGPMYWNANAFHRSYLEMEEKFKVFVYGEGEPPLFHNGPCKSIYSMEGNF  242

Query  923   IHAMDFSR-FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKY  1099
             IH ++ ++ FRT DP+KAH+YFLPFS+T+L + VY  +SHD+ P++ T  DYVN V+ KY
Sbjct  243   IHEIEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHDFGPIRRTVRDYVNIVSEKY  302

Query  1100  PFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVL  1279
             P+WNRSLGADHF+L+CHDWGPE S + P+L  NSIRALCNANTSE F P KDVS PEI L
Sbjct  303   PYWNRSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFKPSKDVSFPEINL  362

Query  1280  PSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNG  1459
              +G T G +GGPSP  R +L F+AGG+HGP+RPILL+HWENKD D++VH YLPKGVSY  
Sbjct  363   QTGDTHGFIGGPSPRLRSILGFFAGGVHGPIRPILLEHWENKDPDLRVHQYLPKGVSYYD  422

Query  1460  MMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDI  1639
             MMR+SR+C+CPSGYEVASPR+VEA+Y GCVPVLI   YV PFSDVLNW +F++ + V DI
Sbjct  423   MMRQSRFCLCPSGYEVASPRVVEAIYAGCVPVLISDHYVPPFSDVLNWNSFSIEVSVSDI  482

Query  1640  PNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             PNLKKILT IS R+Y+RMQRR ++VRRHFEVNSPPKRFDVFHMILHSIW
Sbjct  483   PNLKKILTSISSRRYLRMQRRMLQVRRHFEVNSPPKRFDVFHMILHSIW  531



>emb|CBI30213.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   507 bits (1306),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 231/322 (72%), Positives = 273/322 (85%), Gaps = 1/322 (0%)
 Frame = +2

Query  824   MEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSI  1000
             MEK LKVYVY++G+PP+ H GPCKS Y++EGNFIH M+  S FRT DP+KAHL+FLPFS+
Sbjct  1     MEKQLKVYVYDEGEPPLFHNGPCKSIYSMEGNFIHKMEMDSHFRTKDPEKAHLFFLPFSV  60

Query  1001  TVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAI  1180
              +L + VY  +SHD  P+K T +DYVN V+ KYP+WNRSLGADHF+L+CHDWGPE SF+I
Sbjct  61    AMLVRFVYVRDSHDLGPIKQTVIDYVNVVSTKYPYWNRSLGADHFMLACHDWGPETSFSI  120

Query  1181  PNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGL  1360
             P LH NSIR LCNANTSE F+P KDVS PEI L +G+T   +GGPSPS R +L F+AGGL
Sbjct  121   PYLHKNSIRVLCNANTSEGFNPSKDVSFPEINLLTGSTDSFIGGPSPSHRTLLAFFAGGL  180

Query  1361  HGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYM  1540
             HGP+RPILL+HWENKDEDV+VH YLPKGVSY  MMRKS+YC+CPSGYEVASPR+VEALY 
Sbjct  181   HGPIRPILLEHWENKDEDVKVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEALYT  240

Query  1541  GCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRR  1720
             GCVPVLI   YV PFSDVLNW++F+V +PV +IPNLK+IL  IS RQYIRMQRRG++ RR
Sbjct  241   GCVPVLISDHYVPPFSDVLNWKSFSVEVPVREIPNLKRILMDISPRQYIRMQRRGIQARR  300

Query  1721  HFEVNSPPKRFDVFHMILHSIW  1786
             HFEVNSPPKR+DVFHMILHS+W
Sbjct  301   HFEVNSPPKRYDVFHMILHSLW  322



>gb|KHN24379.1| Putative glycosyltransferase [Glycine soja]
Length=502

 Score =   512 bits (1319),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 244/388 (63%), Positives = 297/388 (77%), Gaps = 3/388 (1%)
 Frame = +2

Query  626   SDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFF  805
             SD++    K KR   + ++R E  LA+ARA+I R       T+D D VP+GPMY NA  F
Sbjct  97    SDESHPREKQKRKP-SFLDRTEVVLAQARATI-REAKNWNLTQDSDYVPIGPMYWNAKEF  154

Query  806   LRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLY  982
              RSY EMEK  KV+VYE+G+ PV H GPC S Y+ EG+FIHA++ +  FRT DP KA+++
Sbjct  155   HRSYLEMEKQFKVFVYEEGELPVFHDGPCSSIYSTEGSFIHAIEMNEHFRTRDPKKANVF  214

Query  983   FLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGP  1162
             FLPFSI  + + VY  NS+D+ P+K T  DYVN +A +YP+WNRSLGADHF+LSCHDWGP
Sbjct  215   FLPFSIAWMVRYVYIRNSYDFGPIKRTVRDYVNVIATRYPYWNRSLGADHFMLSCHDWGP  274

Query  1163  EISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLV  1342
             E S +IP L  NSIR LCNANTSE FDP KD S PEI L  G     +GGP  SKR +L 
Sbjct  275   ETSKSIPYLRKNSIRVLCNANTSEGFDPIKDASFPEINLQPGLKDSFIGGPPASKRSILA  334

Query  1343  FYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRM  1522
             F+AGG HGP+RPILL+HWENKDED+QVH YLPKGVSY GM+R S++C+CPSGYEVASPR+
Sbjct  335   FFAGGNHGPIRPILLEHWENKDEDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRV  394

Query  1523  VEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRR  1702
             VEA+Y GCVPVLI   YV PFSDVLNW+ F+V + V++IPNLK ILT IS RQYIRMQ+R
Sbjct  395   VEAIYTGCVPVLISEHYVPPFSDVLNWKMFSVNVSVKEIPNLKDILTSISPRQYIRMQKR  454

Query  1703  GVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
               ++RRHFEV+SPPKR+DVFHMILHS+W
Sbjct  455   VGQIRRHFEVHSPPKRYDVFHMILHSVW  482



>ref|XP_008241335.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=541

 Score =   513 bits (1322),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 234/349 (67%), Positives = 285/349 (82%), Gaps = 1/349 (0%)
 Frame = +2

Query  743   TQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNF  922
              QT+D D +P GPMY  A+ F RSY EMEK  KV+VY +G+PP+ H GPCKS Y++EGNF
Sbjct  181   NQTQDVDYIPNGPMYWKANAFQRSYLEMEKRFKVFVYGEGEPPLFHNGPCKSIYSMEGNF  240

Query  923   IHAMDFSR-FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKY  1099
             IH ++ ++ FRT DP+KAH+YFLPFS+T+L + VY  +SHD+ P++ T  DYVN V+ KY
Sbjct  241   IHEIEVNKQFRTHDPEKAHVYFLPFSVTMLVRFVYVRDSHDFGPIRQTVRDYVNIVSGKY  300

Query  1100  PFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVL  1279
             P+WNRSLGADHF+L+CHDWGPE S + P+L  NSIR LCNANTSE F+P KDVS PEI L
Sbjct  301   PYWNRSLGADHFMLACHDWGPETSNSDPHLRKNSIRVLCNANTSEGFNPSKDVSFPEINL  360

Query  1280  PSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNG  1459
              +G T G LGGPSP  R +L F+AGG+HGP+RP+LL+HWENKDED++VH YLPKG+SY  
Sbjct  361   QTGDTHGFLGGPSPRLRSILAFFAGGVHGPIRPVLLEHWENKDEDLRVHQYLPKGISYYD  420

Query  1460  MMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDI  1639
             MMR S++C+CPSGYEVASPR+VEA+Y GCVPVLI   YV PFSDVLNW++F+V + V +I
Sbjct  421   MMRHSKFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVKVSEI  480

Query  1640  PNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             PNLK IL  IS +QYIRMQRR V+VRRHFEVNSPPKRFDVFHMILHSIW
Sbjct  481   PNLKNILMSISTKQYIRMQRRVVQVRRHFEVNSPPKRFDVFHMILHSIW  529



>ref|XP_003535253.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=523

 Score =   511 bits (1317),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 244/388 (63%), Positives = 297/388 (77%), Gaps = 3/388 (1%)
 Frame = +2

Query  626   SDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFF  805
             SD++    K KR   + ++R E  LA+ARA+I R       T+D D VP+GPMY NA  F
Sbjct  118   SDESHPREKQKRKP-SFLDRTEVVLAQARATI-REAKNWNLTQDSDYVPIGPMYWNAKEF  175

Query  806   LRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLY  982
              RSY EMEK  KV+VYE+G+ PV H GPC S Y+ EG+FIHA++ +  FRT DP KA+++
Sbjct  176   HRSYLEMEKQFKVFVYEEGELPVFHDGPCSSIYSTEGSFIHAIEMNEHFRTRDPKKANVF  235

Query  983   FLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGP  1162
             FLPFSI  + + VY  NS+D+ P+K T  DYVN +A +YP+WNRSLGADHF+LSCHDWGP
Sbjct  236   FLPFSIAWMVRYVYIRNSYDFGPIKRTVRDYVNVIATRYPYWNRSLGADHFMLSCHDWGP  295

Query  1163  EISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLV  1342
             E S +IP L  NSIR LCNANTSE FDP KD S PEI L  G     +GGP  SKR +L 
Sbjct  296   ETSKSIPYLRKNSIRVLCNANTSEGFDPIKDASFPEINLQPGLKDSFVGGPPASKRSILA  355

Query  1343  FYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRM  1522
             F+AGG HGP+RPILL+HWENKDED+QVH YLPKGVSY GM+R S++C+CPSGYEVASPR+
Sbjct  356   FFAGGNHGPIRPILLEHWENKDEDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRV  415

Query  1523  VEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRR  1702
             VEA+Y GCVPVLI   YV PFSDVLNW+ F+V + V++IPNLK ILT IS RQYIRMQ+R
Sbjct  416   VEAIYTGCVPVLISEHYVPPFSDVLNWKMFSVNVSVKEIPNLKDILTSISPRQYIRMQKR  475

Query  1703  GVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
               ++RRHFEV+SPPKR+DVFHMILHS+W
Sbjct  476   VGQIRRHFEVHSPPKRYDVFHMILHSVW  503



>ref|XP_010039048.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At5g03795 [Eucalyptus grandis]
Length=382

 Score =   506 bits (1303),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 238/365 (65%), Positives = 287/365 (79%), Gaps = 7/365 (2%)
 Frame = +2

Query  695   DLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPV  874
             +L  AR+ I R    G   +D D VPVGPMYRNA+ F RSY EMEK  K++VY++G PPV
Sbjct  12    ELVPARSGI-REAKTGNPMEDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPV  70

Query  875   AHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSP  1051
              H GPCKS YA E NFIH ++ + RFRT DP KAH++FLPFS+ ++ + VY  +SHD+ P
Sbjct  71    FHNGPCKSIYATERNFIHMVEINKRFRTGDPRKAHVFFLPFSVAMMVQFVYVRDSHDFGP  130

Query  1052  MKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTS  1231
             +K T +DY++ VA KYP+WNRSLGADHF+L+CHDWGP     +P LH NSIR LCNANTS
Sbjct  131   IKRTVIDYIDVVAGKYPYWNRSLGADHFMLACHDWGP-----VPRLHRNSIRVLCNANTS  185

Query  1232  ERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDE  1411
             E FDP KDVS PE+ L +G   GL+G  SPS R +L F+AGGLHGP+RPILLQHWENKDE
Sbjct  186   EGFDPSKDVSFPEVNLHTGAISGLIGEASPSHRSILAFFAGGLHGPIRPILLQHWENKDE  245

Query  1412  DVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSD  1591
             DV+VH YLP+GVSY  MM++S++CICPSGYEVASPR+VEA+Y GCVPVLI   YV PFSD
Sbjct  246   DVKVHRYLPRGVSYYDMMKRSKFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSD  305

Query  1592  VLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMI  1771
             VLNW +F+V + V +IPNLK IL  IS RQYIRMQRR  +VRRHFEV+SPPKR+DVFHMI
Sbjct  306   VLNWRSFSVEVTVREIPNLKTILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMI  365

Query  1772  LHSIW  1786
             LHS+W
Sbjct  366   LHSVW  370



>gb|EPS64188.1| hypothetical protein M569_10593, partial [Genlisea aurea]
Length=383

 Score =   501 bits (1289),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 243/373 (65%), Positives = 289/373 (77%), Gaps = 3/373 (1%)
 Frame = +2

Query  674   NMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVY  853
             N+  +EA L RAR SI R    GT   D D VP GP+Y + S F RSY EMEK  +V+VY
Sbjct  1     NLHILEAKLKRARNSI-RESRNGTAIDDPDYVPYGPVYHSPSAFHRSYKEMEKHFRVFVY  59

Query  854   EDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYEPN  1033
              +G+ P+ H GPC S Y+ EGNFI+ ++ S FRT DP+KA ++FLP S+  + + VY+ N
Sbjct  60    GEGEHPIFHNGPCGSIYSTEGNFIYTVEGSSFRTRDPEKASVFFLPLSVAAIVRFVYDRN  119

Query  1034  SHD-WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRA  1210
             S D W PMK T  DYV+ VA +YP+WNRSLG+DH +LSCHDWGPE+S ++P L  NSIRA
Sbjct  120   SGDQWGPMKRTVKDYVDLVAMRYPYWNRSLGSDHVMLSCHDWGPELSKSVPELFKNSIRA  179

Query  1211  LCNANTSERFDPKKDVSIPEIVLPSG-TTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
             LCNANT+E F P KDV+IPEI LP G  TKGL+GG S SKR +L F+AGG+HGPVRPILL
Sbjct  180   LCNANTTEGFKPAKDVAIPEINLPGGGRTKGLIGGLSASKRTILAFFAGGVHGPVRPILL  239

Query  1388  QHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             +HWENKD DVQV+ YLPK +SY+  MRKSR+CICPSGYEVASPR+VEALY GCVPVLI  
Sbjct  240   EHWENKDPDVQVYQYLPKRLSYSDQMRKSRFCICPSGYEVASPRIVEALYNGCVPVLIND  299

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
              YV PF DVLNW+AFAV +PV +IPNLKKILT IS RQYIR++RRG  VRRHFEVN PPK
Sbjct  300   HYVPPFGDVLNWKAFAVEVPVGEIPNLKKILTAISTRQYIRLKRRGETVRRHFEVNFPPK  359

Query  1748  RFDVFHMILHSIW  1786
             R+DVFHM LHSIW
Sbjct  360   RYDVFHMTLHSIW  372



>gb|KHN45704.1| Putative glycosyltransferase [Glycine soja]
Length=348

 Score =   496 bits (1276),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 221/336 (66%), Positives = 275/336 (82%), Gaps = 1/336 (0%)
 Frame = +2

Query  782   MYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTT  958
             MY NA  F RSY EMEK  KV+VYE+G+ PV H GPCKS Y++EGNFIHA++ +  FRT 
Sbjct  1     MYWNAKTFHRSYLEMEKQFKVFVYEEGETPVFHNGPCKSIYSMEGNFIHAIEMNDHFRTK  60

Query  959   DPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFI  1138
             DP KAH++FLPFS+ ++ + VY+ +S D+ P++ T +DY+N +A +Y +WNRSLGADHF+
Sbjct  61    DPKKAHVFFLPFSVVMMVRFVYQRDSRDFGPIRKTVIDYINLIAARYSYWNRSLGADHFM  120

Query  1139  LSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPS  1318
             L+CHDWGPE S ++P LH NSIR LCNANTSE F P KDVS PEI L +G+  G +GGPS
Sbjct  121   LACHDWGPEASLSLPYLHKNSIRVLCNANTSEGFKPAKDVSFPEINLQTGSINGFIGGPS  180

Query  1319  PSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSG  1498
              SKR +L F+AGG+HGP+RPILL+HWENKDED+QVH YLPKGVSY   +R S++C+CPSG
Sbjct  181   ASKRSILAFFAGGVHGPIRPILLEHWENKDEDIQVHKYLPKGVSYYDKLRNSKFCLCPSG  240

Query  1499  YEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQR  1678
             YEVASPR+VEA+Y GCVPVLI   YV PFSDVLNW++F+V + V+DIPNLK IL  IS R
Sbjct  241   YEVASPRVVEAIYTGCVPVLISEHYVPPFSDVLNWKSFSVELSVKDIPNLKDILMSISPR  300

Query  1679  QYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             QYIRMQRR ++++RHFEV+SPPKRFDVFHMILHS+W
Sbjct  301   QYIRMQRRVIQIQRHFEVHSPPKRFDVFHMILHSVW  336



>ref|XP_010683939.1| PREDICTED: probable glycosyltransferase At5g03795 [Beta vulgaris 
subsp. vulgaris]
Length=538

 Score =   503 bits (1294),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 228/374 (61%), Positives = 294/374 (79%), Gaps = 2/374 (1%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYV  850
             T+++R+E  L ++RA+I           D D  P+GPMY NA+ F RSY EME+  KVYV
Sbjct  151   TDLDRLEIGLQQSRAAIKEAKYTNRTYDDPDFKPLGPMYWNANAFHRSYLEMERRFKVYV  210

Query  851   YEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             YE+G+PP+ H GPCKS Y+ EGNFIH M+ + +FRT   D+AH++FLPFS+ ++   VY 
Sbjct  211   YEEGEPPLFHNGPCKSIYSTEGNFIHLMEINDQFRTKKLDEAHVFFLPFSVVMMVHFVYL  270

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
              +SHD+ P++ T  DY+N V+ KYP+WNRSLGADHF+LSCHDWGPE SF++P L  NSIR
Sbjct  271   RDSHDFGPIRQTVRDYINVVSTKYPYWNRSLGADHFMLSCHDWGPETSFSVPYLAKNSIR  330

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
              LCNANTSE F P KDVS+PEI L +G   G +GGPSPS+R +L F+AGGLHGP+RPILL
Sbjct  331   VLCNANTSEGFKPHKDVSLPEINLRTGAINGFVGGPSPSRRSILAFFAGGLHGPIRPILL  390

Query  1388  QHWENKDE-DVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             +HW NKD+ D+++ +YLPKGVSY  M+R S++CICPSGYEVASPR+VEA+Y GCVPVLI 
Sbjct  391   EHWGNKDDKDLKIFTYLPKGVSYYDMLRNSKFCICPSGYEVASPRVVEAIYTGCVPVLIS  450

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSDVLNW++F+V + V+DIPNLK ILT IS ++Y++M RR ++VRRHFEV++PP
Sbjct  451   DHYVPPFSDVLNWKSFSVEVSVKDIPNLKTILTNISTKKYLKMYRRVLQVRRHFEVHAPP  510

Query  1745  KRFDVFHMILHSIW  1786
             KR+D FHMILHS+W
Sbjct  511   KRYDFFHMILHSVW  524



>ref|XP_009593673.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana tomentosiformis]
Length=486

 Score =   498 bits (1281),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 225/378 (60%), Positives = 288/378 (76%), Gaps = 1/378 (0%)
 Frame = +2

Query  608   RQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMY  787
             +Q+G+     E    S +   +N+E++EA L + RA+I         + D +  P GP Y
Sbjct  72    KQDGLDVTRKEPQMISSKKNLSNLEKVEAGLGKVRAAIREAQTKNLTSDDSEYAPKGPCY  131

Query  788   RNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPD  967
              N+S F RSY EMEK  K+YVYE+G+PPV HY   +    IEG  IH ++ S+FRT  P+
Sbjct  132   WNSSAFHRSYLEMEKHFKIYVYEEGEPPVFHYSSSEGILGIEGILIHQIEISKFRTNYPE  191

Query  968   KAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSC  1147
             KAH+YFLPFS+  +   VY  +SH W PMK TA DY++S++RKYPFWNRSLG+DHF+L+C
Sbjct  192   KAHVYFLPFSVFSIVSYVYVVDSHQWGPMKNTAADYIDSISRKYPFWNRSLGSDHFMLAC  251

Query  1148  HDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSK  1327
             HDW PEIS A+P L+ NSIR LCNANTSERF+P KDV++PEI LP GT +GL+GGPSPS+
Sbjct  252   HDWAPEISTAVPYLYKNSIRVLCNANTSERFNPSKDVTLPEIYLPQGTMEGLIGGPSPSQ  311

Query  1328  RPVLVFYAGGLHGPVRPILLQHW-ENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYE  1504
             R +LVFYAGG+HG +R +L++ W EN D +VQ+H YLPK VSY GM+RKS++CICPSG+E
Sbjct  312   RSILVFYAGGIHGYIRQVLMEQWGENDDPEVQIHEYLPKNVSYYGMIRKSKFCICPSGWE  371

Query  1505  VASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQY  1684
             VASPRMVEA Y+GCVPVL+K  YVAPFSDVLNW++FAV +   DIPNLKKIL  ISQ+QY
Sbjct  372   VASPRMVEAFYIGCVPVLLKDNYVAPFSDVLNWKSFAVEMTSNDIPNLKKILMSISQKQY  431

Query  1685  IRMQRRGVKVRRHFEVNS  1738
             I+MQ+RG++VRRHFEVN+
Sbjct  432   IKMQKRGLQVRRHFEVNN  449



>ref|XP_009593674.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana tomentosiformis]
Length=402

 Score =   492 bits (1267),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 222/363 (61%), Positives = 282/363 (78%), Gaps = 1/363 (0%)
 Frame = +2

Query  653   SKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEK  832
             S +   +N+E++EA L + RA+I         + D +  P GP Y N+S F RSY EMEK
Sbjct  3     SSKKNLSNLEKVEAGLGKVRAAIREAQTKNLTSDDSEYAPKGPCYWNSSAFHRSYLEMEK  62

Query  833   TLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLS  1012
               K+YVYE+G+PPV HY   +    IEG  IH ++ S+FRT  P+KAH+YFLPFS+  + 
Sbjct  63    HFKIYVYEEGEPPVFHYSSSEGILGIEGILIHQIEISKFRTNYPEKAHVYFLPFSVFSIV  122

Query  1013  KLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLH  1192
               VY  +SH W PMK TA DY++S++RKYPFWNRSLG+DHF+L+CHDW PEIS A+P L+
Sbjct  123   SYVYVVDSHQWGPMKNTAADYIDSISRKYPFWNRSLGSDHFMLACHDWAPEISTAVPYLY  182

Query  1193  NNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPV  1372
              NSIR LCNANTSERF+P KDV++PEI LP GT +GL+GGPSPS+R +LVFYAGG+HG +
Sbjct  183   KNSIRVLCNANTSERFNPSKDVTLPEIYLPQGTMEGLIGGPSPSQRSILVFYAGGIHGYI  242

Query  1373  RPILLQHW-ENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCV  1549
             R +L++ W EN D +VQ+H YLPK VSY GM+RKS++CICPSG+EVASPRMVEA Y+GCV
Sbjct  243   RQVLMEQWGENDDPEVQIHEYLPKNVSYYGMIRKSKFCICPSGWEVASPRMVEAFYIGCV  302

Query  1550  PVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFE  1729
             PVL+K  YVAPFSDVLNW++FAV +   DIPNLKKIL  ISQ+QYI+MQ+RG++VRRHFE
Sbjct  303   PVLLKDNYVAPFSDVLNWKSFAVEMTSNDIPNLKKILMSISQKQYIKMQKRGLQVRRHFE  362

Query  1730  VNS  1738
             VN+
Sbjct  363   VNN  365



>gb|EMT30821.1| Exostosin-2 [Aegilops tauschii]
Length=537

 Score =   496 bits (1277),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 242/410 (59%), Positives = 299/410 (73%), Gaps = 11/410 (3%)
 Frame = +2

Query  575   LAPETGIGDDERQNGISSDDTEDSRKS--KRYTYTNMERIEADLARARASI---LRgggg  739
             LAPE+G  D +     S D T + R    +      +ER+E  LA+AR  I   +R    
Sbjct  121   LAPESGFDDAD-----SPDGTVEVRVPLMQGRVDVKLERVELGLAKARLVIREAIRNKDK  175

Query  740   gTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGN  919
                  D D VPVGP+YRNA  F RSY EMEK  KVYVYE+G+PPV H GPC+S Y+ EG 
Sbjct  176   RPPLTDRDYVPVGPVYRNAYAFHRSYLEMEKLFKVYVYEEGEPPVFHDGPCRSIYSSEGR  235

Query  920   FIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARK  1096
             FI AM+  +R RT DP+ AH++FLPFS+  + K++YEPNSHD  P++ T  DY++ ++ K
Sbjct  236   FIFAMEMENRMRTRDPELAHVFFLPFSVVKMVKMIYEPNSHDMEPLRRTLSDYIDVLSTK  295

Query  1097  YPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIV  1276
             YP+WNRSLGADHF+LSCHDWGP +S A  +L +NSIR LCNANTSE F+P KDVS+PEI 
Sbjct  296   YPYWNRSLGADHFMLSCHDWGPYVSSADGHLFSNSIRVLCNANTSEGFNPSKDVSLPEIT  355

Query  1277  LPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYN  1456
             L +      +GGPS S+RP+L F+AGG HGPVRP+LL+HW+ KD DVQV  YLP+GVSY 
Sbjct  356   LRTDIVDNQVGGPSASRRPILAFFAGGDHGPVRPLLLRHWKGKDADVQVSEYLPRGVSYI  415

Query  1457  GMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVED  1636
              +MR+S++C+CPSGYEVASPR+VEA+Y+ CVPV+I   YV PFSDVLNW AF+V + V D
Sbjct  416   NVMRRSKFCLCPSGYEVASPRVVEAIYLECVPVVIGDDYVLPFSDVLNWPAFSVRVAVAD  475

Query  1637  IPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             IPNLK IL  +S RQYIRMQR    VRRHF VN PP+RFDVFHMILHSIW
Sbjct  476   IPNLKTILAAVSPRQYIRMQRGVRPVRRHFMVNGPPRRFDVFHMILHSIW  525



>ref|XP_007027565.1| Exostosin family protein, putative [Theobroma cacao]
 gb|EOY08067.1| Exostosin family protein, putative [Theobroma cacao]
Length=546

 Score =   493 bits (1270),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 232/384 (60%), Positives = 298/384 (78%), Gaps = 15/384 (4%)
 Frame = +2

Query  656   KRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKT  835
             +R  YT ++R+E  L +ARA+I +    G+Q +D D +P GP+YRNA FF RSY EMEK 
Sbjct  154   RRRVYTKLDRLEDGLRKARAAI-KKAMNGSQLQDPDYIPDGPIYRNAKFFHRSYLEMEKK  212

Query  836   LKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSITVLS  1012
              K+YVY++G+ P+ H GPC+  Y +EG FI+ M+ ++ FRT +P+KAH+++LP+S+T + 
Sbjct  213   FKIYVYKEGELPLFHDGPCRLLYTMEGQFINKMEVNKKFRTYNPEKAHVFYLPYSVTRMV  272

Query  1013  KLVYEPNSHDW---SPMKI---TALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISF  1174
             +       ++W   +PMK      LDYVN +A KYPFWNRSLGADHF+LSCHDWGP  SF
Sbjct  273   Q-------YNWVRGTPMKRLGGIVLDYVNVIAGKYPFWNRSLGADHFMLSCHDWGPATSF  325

Query  1175  AIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAG  1354
              +P+L  NSIRALCNANTSERF+P KDVSIPEI L S   +GL+GGPSPS+R +L F+AG
Sbjct  326   YVPDLVKNSIRALCNANTSERFNPMKDVSIPEISLKSSRLEGLIGGPSPSQRTILAFFAG  385

Query  1355  GLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEAL  1534
             G HG VRPIL +HWE KD  ++VH+YLP+ V Y  +MR+S+YC+CPSGYEVASPR+VEAL
Sbjct  386   GNHGFVRPILFRHWEKKDPAIRVHNYLPRRVPYYDLMRQSKYCLCPSGYEVASPRVVEAL  445

Query  1535  YMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKV  1714
             Y GCVPVLI + YV PFSDVLNW+ F+V++ +EDIPNLKKIL  I +RQYI+MQ+R V+V
Sbjct  446   YNGCVPVLISKSYVPPFSDVLNWKMFSVMVSLEDIPNLKKILMSIPERQYIKMQKRVVQV  505

Query  1715  RRHFEVNSPPKRFDVFHMILHSIW  1786
             RRHFE++  PKRFDVFHMILHSIW
Sbjct  506   RRHFELHVTPKRFDVFHMILHSIW  529



>ref|XP_008381668.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=526

 Score =   492 bits (1267),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 235/402 (58%), Positives = 298/402 (74%), Gaps = 8/402 (2%)
 Frame = +2

Query  593   IGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASI---LRgggggTQTKDDD  763
             I + +  NG S+  T  S K     Y+ +E++EA+LA  RASI    R     +  +D D
Sbjct  115   ITESDEINGTSAIITSTSIKR----YSRLEKLEANLAGVRASIREAARVRNLTSTHEDPD  170

Query  764   SVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS  943
              VP GP+YRNA+ F RSY +MEK  K+YVYE+G+PP+ H GPCKS Y+ EG FIH M+  
Sbjct  171   YVPRGPIYRNANAFHRSYLKMEKHFKIYVYEEGEPPIFHNGPCKSIYSTEGRFIHEMEME  230

Query  944   R-FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSL  1120
               +RT DPD+A +YFLPFS+ +L + +Y  +SHD  P+    +DYVN ++ K+PFWNRSL
Sbjct  231   NIYRTRDPDQALVYFLPFSVVMLVQYLYVADSHDTQPIGRAVVDYVNVISDKHPFWNRSL  290

Query  1121  GADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKG  1300
             GADHF+LSCHDWGP  S  +P+L+ NSIR LCNANTSE F+P KDVS PEI L +G TKG
Sbjct  291   GADHFMLSCHDWGPSTSAYVPHLYQNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGETKG  350

Query  1301  LLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRY  1480
             LLGG SPS+R +L F+AG LHG +R +LL  W+ KD+DVQV+  LP GVSY  M++KSR+
Sbjct  351   LLGGLSPSRRSILAFFAGRLHGHIRYLLLNEWKEKDQDVQVYDQLPNGVSYESMLKKSRF  410

Query  1481  CICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKIL  1660
             C+CPSGYEVASPR+VEA+Y  CVPVLI   YV PFSDVL W++F+V + V+DIPN+K+IL
Sbjct  411   CLCPSGYEVASPRVVEAIYAECVPVLISDSYVPPFSDVLEWKSFSVQVQVKDIPNIKRIL  470

Query  1661  TGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
              GISQ QY+RMQRR  +V+RHF VN P KRFDVFHMI+HSIW
Sbjct  471   MGISQSQYLRMQRRVKQVQRHFVVNGPSKRFDVFHMIVHSIW  512



>emb|CBI28483.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   488 bits (1255),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 230/392 (59%), Positives = 301/392 (77%), Gaps = 6/392 (2%)
 Frame = +2

Query  623   SSDDTEDSRKSKRYTYTNMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRN  793
             S +  +++ K KRY+   +ER+EA LARAR+SI    R G   +  +D D VP GP+YRN
Sbjct  17    SYEKKQETWKDKRYS--KLERLEAGLARARSSIREAARNGSLKSTHEDPDYVPQGPIYRN  74

Query  794   ASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDK  970
             A+ F RSY EMEK  K+YVYE+G+PP+ H GPCKS Y+ EG FIH M+  S +RTTDPD+
Sbjct  75    ANAFHRSYLEMEKLFKIYVYEEGEPPMFHNGPCKSIYSTEGRFIHEMEKGSVYRTTDPDQ  134

Query  971   AHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCH  1150
             A LYFLPFS+ ++ + +Y P+SH+   ++ T +DY+N ++  +PFWNRSLGADHF+LSCH
Sbjct  135   ALLYFLPFSVVMMVQYLYVPDSHEIHAIEKTVIDYINLISHNHPFWNRSLGADHFMLSCH  194

Query  1151  DWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKR  1330
             DWGP  S ++P L+NNSIR LCNANTSE F+P KDVS PEI L +G   G LGG SPS+R
Sbjct  195   DWGPRASTSVPYLYNNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGEMSGPLGGLSPSRR  254

Query  1331  PVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVA  1510
             P+L F+AG LHG +R +LL+ W++KD+D+QV+  LP G+SY+ M++KSR+C+CPSGYEVA
Sbjct  255   PILGFFAGRLHGHIRYLLLEQWKDKDKDLQVYDQLPNGLSYDSMLKKSRFCLCPSGYEVA  314

Query  1511  SPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIR  1690
             SPR+VEA+Y  CVPVLI   YV PF+DVLNW++FAV + V DI N+K+IL GISQ QY+R
Sbjct  315   SPRVVEAIYAECVPVLISDNYVPPFNDVLNWKSFAVQVQVRDIANIKRILMGISQTQYLR  374

Query  1691  MQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             M RR  +V+RHF VN+ P+RFDVFHM +HSIW
Sbjct  375   MYRRVKQVQRHFMVNAAPQRFDVFHMTIHSIW  406



>ref|XP_011094445.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=497

 Score =   489 bits (1259),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 230/410 (56%), Positives = 285/410 (70%), Gaps = 1/410 (0%)
 Frame = +2

Query  560   SRPILLAPETGIGDDERQNGISSDDTEDSRKSKRYT-YTNMERIEADLARARASILRggg  736
             SR  L  P      D+     +    + ++  K YT   N++ +EA LA+ARA+I     
Sbjct  74    SRAALQPPAAQPTQDQSLVMENVQSAKTAKFGKTYTNLDNLDMVEASLAQARATIQEAQR  133

Query  737   ggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEG  916
                 + D D VP GPMYRN + FLRSY EMEK  K+YVYEDG+PP+ HY        IEG
Sbjct  134   NNETSYDPDYVPTGPMYRNPNAFLRSYLEMEKLFKIYVYEDGEPPLYHYSKSLGILGIEG  193

Query  917   NFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARK  1096
               IH ++ S+FRT DP KAH+YF+P S+  +    Y  ++  WSP++  A DYV  ++ K
Sbjct  194   ILIHQIEISKFRTRDPGKAHVYFIPLSVQSIVAYAYVRHNRAWSPLQNIARDYVKLISTK  253

Query  1097  YPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIV  1276
             YP+WNR+LG DHFIL CHDW P IS A+P+L  NSIR LCNANTSE F P  DVS+PEI 
Sbjct  254   YPYWNRTLGCDHFILGCHDWTPMISNAVPDLFKNSIRVLCNANTSEGFKPSTDVSLPEIY  313

Query  1277  LPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYN  1456
             LP GT  GL+GG  PS+R VLVFYAGG+HG +R +L+  W++KD D+Q+H YLPK +SY 
Sbjct  314   LPHGTMDGLIGGMPPSERSVLVFYAGGIHGYIRQVLMDQWKDKDPDIQIHEYLPKNMSYY  373

Query  1457  GMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVED  1636
              M RKS+YCICPSG+EVASPRMVE LYMGCVPVL+K  Y  PF+DVL+W  F+V +PV  
Sbjct  374   SMFRKSKYCICPSGWEVASPRMVEGLYMGCVPVLLKDHYAKPFNDVLDWSTFSVDVPVNQ  433

Query  1637  IPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             IP+LKKILT I Q QY  MQ+ G+ VRRHFEVN PPKR+DVFHMILHSIW
Sbjct  434   IPDLKKILTAIPQEQYQEMQKTGILVRRHFEVNFPPKRYDVFHMILHSIW  483



>ref|XP_002320538.2| hypothetical protein POPTR_0014s16920g [Populus trichocarpa]
 gb|EEE98853.2| hypothetical protein POPTR_0014s16920g [Populus trichocarpa]
Length=452

 Score =   487 bits (1253),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 225/377 (60%), Positives = 289/377 (77%), Gaps = 4/377 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTL  838
             ++ +E++EA+LA+ R+SI    R     +  +D D VP GP+YRNA+ F RSY EMEK  
Sbjct  66    HSKLEKMEANLAKIRSSIREAARVRNLTSIYEDPDYVPKGPIYRNANAFHRSYLEMEKLF  125

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSITVLSK  1015
             K+Y+Y++G PP+ H GPCKS Y+ EG FIH ++  + F TTDPD+A +YFLPFS+ +L +
Sbjct  126   KIYIYKEGDPPMFHDGPCKSIYSSEGRFIHELEKGKSFTTTDPDEALVYFLPFSVVMLVQ  185

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              +Y P SH+   +  T +DY+N +A KYPFWNRSLGADHFILSCHDWGP  S  +P+L N
Sbjct  186   YLYVPGSHEIDAIGNTVVDYINVIADKYPFWNRSLGADHFILSCHDWGPRTSSYVPHLFN  245

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             NSIR LCNANTSE F+PKKD S PEI L +G   GL+GGPSPS+R +L F+AG LHG +R
Sbjct  246   NSIRVLCNANTSEGFNPKKDASFPEIHLRTGEITGLVGGPSPSRRSILAFFAGRLHGHIR  305

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
              +LL+ W++KD+DVQVH  L  G+SY+ M++ SR+C+CPSGYEVASPR+VEA+Y  CVPV
Sbjct  306   RLLLEQWKDKDQDVQVHDQLRNGMSYDSMLKNSRFCLCPSGYEVASPRIVEAIYAECVPV  365

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI  GYV PFSDVLNW+AF++ + V+DIP +K IL GISQRQY+RMQRR  +V+RHF VN
Sbjct  366   LISDGYVPPFSDVLNWKAFSIQVQVKDIPKIKDILMGISQRQYLRMQRRVKQVQRHFVVN  425

Query  1736  SPPKRFDVFHMILHSIW  1786
               PKRFDVFHM +HSIW
Sbjct  426   GIPKRFDVFHMTIHSIW  442



>ref|XP_002264076.2| PREDICTED: probable glycosyltransferase At5g03795 [Vitis vinifera]
Length=484

 Score =   487 bits (1254),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 229/390 (59%), Positives = 300/390 (77%), Gaps = 6/390 (2%)
 Frame = +2

Query  629   DDTEDSRKSKRYTYTNMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNAS  799
             +  +++ K KRY+   +ER+EA LARAR+SI    R G   +  +D D VP GP+YRNA+
Sbjct  87    EKKQETWKDKRYS--KLERLEAGLARARSSIREAARNGSLKSTHEDPDYVPQGPIYRNAN  144

Query  800   FFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAH  976
              F RSY EMEK  K+YVYE+G+PP+ H GPCKS Y+ EG FIH M+  S +RTTDPD+A 
Sbjct  145   AFHRSYLEMEKLFKIYVYEEGEPPMFHNGPCKSIYSTEGRFIHEMEKGSVYRTTDPDQAL  204

Query  977   LYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDW  1156
             LYFLPFS+ ++ + +Y P+SH+   ++ T +DY+N ++  +PFWNRSLGADHF+LSCHDW
Sbjct  205   LYFLPFSVVMMVQYLYVPDSHEIHAIEKTVIDYINLISHNHPFWNRSLGADHFMLSCHDW  264

Query  1157  GPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPV  1336
             GP  S ++P L+NNSIR LCNANTSE F+P KDVS PEI L +G   G LGG SPS+RP+
Sbjct  265   GPRASTSVPYLYNNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGEMSGPLGGLSPSRRPI  324

Query  1337  LVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASP  1516
             L F+AG LHG +R +LL+ W++KD+D+QV+  LP G+SY+ M++KSR+C+CPSGYEVASP
Sbjct  325   LGFFAGRLHGHIRYLLLEQWKDKDKDLQVYDQLPNGLSYDSMLKKSRFCLCPSGYEVASP  384

Query  1517  RMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQ  1696
             R+VEA+Y  CVPVLI   YV PF+DVLNW++FAV + V DI N+K+IL GISQ QY+RM 
Sbjct  385   RVVEAIYAECVPVLISDNYVPPFNDVLNWKSFAVQVQVRDIANIKRILMGISQTQYLRMY  444

Query  1697  RRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             RR  +V+RHF VN+ P+RFDVFHM +HSIW
Sbjct  445   RRVKQVQRHFMVNAAPQRFDVFHMTIHSIW  474



>ref|XP_010252860.1| PREDICTED: probable glycosyltransferase At3g07620 [Nelumbo nucifera]
Length=517

 Score =   485 bits (1249),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 229/381 (60%), Positives = 287/381 (75%), Gaps = 8/381 (2%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggg---gTQTKDDDS---VPVGPMYRNASFFLRSYAEME  829
             Y+ + R+EA LARARASI          T T DDD    VP GP+YRNA  F RSY EME
Sbjct  127   YSKLMRLEAGLARARASIRMASAQSRNQTSTHDDDDPDYVPRGPIYRNAFVFHRSYLEME  186

Query  830   KTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS--RFRTTDPDKAHLYFLPFSIT  1003
             K  K++VYE+G PP+ H GPC+S Y+ EG FI+ M+ +   +RT DPD+AH+YFLPFS+ 
Sbjct  187   KIFKIFVYEEGDPPLFHNGPCRSIYSTEGRFINEMEKAGNHYRTRDPDEAHVYFLPFSVV  246

Query  1004  VLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIP  1183
             ++ + +Y P+SH+   +  T +DY+N ++ KYP+WNRSLGADHF+LSCHDWGP  S  + 
Sbjct  247   MMVQFLYVPDSHEIDSIGRTVVDYINILSAKYPYWNRSLGADHFMLSCHDWGPRTSAYVR  306

Query  1184  NLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLH  1363
              L +NSIR LCNANTSE F+P KD S PEI L +G   GLLGG SPS+RP+L F+AG LH
Sbjct  307   ELFDNSIRVLCNANTSEGFNPLKDASFPEIHLRTGEITGLLGGLSPSRRPLLAFFAGRLH  366

Query  1364  GPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMG  1543
             G +R +LLQ W+++D+DVQV+  LP G+SYN M++KS+YC+CPSGYEVASPR+VEA+Y  
Sbjct  367   GNIRLLLLQEWKDRDKDVQVYDELPDGMSYNEMLKKSKYCLCPSGYEVASPRIVEAIYAE  426

Query  1544  CVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRH  1723
             CVPVLI   YV PFSDVLNW +F+V I V DIPN+K IL+ ISQ QYIRMQRR  +V+RH
Sbjct  427   CVPVLISDHYVPPFSDVLNWNSFSVQIAVSDIPNIKTILSSISQTQYIRMQRRVKQVQRH  486

Query  1724  FEVNSPPKRFDVFHMILHSIW  1786
             F VN PP+RFDVFHMILHSIW
Sbjct  487   FVVNGPPQRFDVFHMILHSIW  507



>ref|XP_011009812.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Populus euphratica]
Length=510

 Score =   484 bits (1245),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 224/377 (59%), Positives = 287/377 (76%), Gaps = 4/377 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTL  838
             ++ +E++EA+LA+ R+SI    R     +  +D D VP GP+YRNA+ F RSY EMEK  
Sbjct  124   HSKLEKMEANLAKIRSSIREAARVRNLTSIYEDPDYVPKGPIYRNANAFHRSYLEMEKLF  183

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSITVLSK  1015
             K+Y+Y++G PP+ H GPCKS Y+ EG FIH ++  + F TTDPDKA +YFLPFS+ +L +
Sbjct  184   KIYIYKEGDPPMFHDGPCKSIYSSEGRFIHELEKGKSFTTTDPDKALVYFLPFSVVMLVQ  243

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              +Y P SH+   +  T +DY+  +A KYPFWNRSLGADHFILSCHDWGP  S  +P+L N
Sbjct  244   YLYVPGSHEIDAIGNTVVDYIKVIADKYPFWNRSLGADHFILSCHDWGPRTSSYVPHLFN  303

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             NSIR LCNANTSE F+PKKD S PEI L +G   GL+GGPSPS+R +L F+AG LHG +R
Sbjct  304   NSIRVLCNANTSEGFNPKKDASFPEIHLRTGEITGLVGGPSPSRRSILAFFAGRLHGHIR  363

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
              +LL+ W++KD+D+QVH  L  G+SY+ M++ SR+C+CPSGYEVASPR+VEA+Y  CVPV
Sbjct  364   RLLLEQWKDKDQDMQVHDQLRNGMSYDSMLKNSRFCLCPSGYEVASPRIVEAIYAECVPV  423

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI  GYV PFSDVLNW+AF++ + V+DIP LK IL GISQRQY+RMQRR  +V+RHF VN
Sbjct  424   LISDGYVPPFSDVLNWKAFSIQVQVKDIPKLKDILMGISQRQYLRMQRRVKQVQRHFVVN  483

Query  1736  SPPKRFDVFHMILHSIW  1786
               PKRFD FHM +HSIW
Sbjct  484   GLPKRFDEFHMTIHSIW  500



>ref|XP_011009813.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Populus euphratica]
Length=381

 Score =   477 bits (1227),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 223/371 (60%), Positives = 282/371 (76%), Gaps = 4/371 (1%)
 Frame = +2

Query  686   IEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYE  856
             +EA+LA+ R+SI    R     +  +D D VP GP+YRNA+ F RSY EMEK  K+Y+Y+
Sbjct  1     MEANLAKIRSSIREAARVRNLTSIYEDPDYVPKGPIYRNANAFHRSYLEMEKLFKIYIYK  60

Query  857   DGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSITVLSKLVYEPN  1033
             +G PP+ H GPCKS Y+ EG FIH ++  + F TTDPDKA +YFLPFS+ +L + +Y P 
Sbjct  61    EGDPPMFHDGPCKSIYSSEGRFIHELEKGKSFTTTDPDKALVYFLPFSVVMLVQYLYVPG  120

Query  1034  SHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRAL  1213
             SH+   +  T +DY+  +A KYPFWNRSLGADHFILSCHDWGP  S  +P+L NNSIR L
Sbjct  121   SHEIDAIGNTVVDYIKVIADKYPFWNRSLGADHFILSCHDWGPRTSSYVPHLFNNSIRVL  180

Query  1214  CNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQH  1393
             CNANTSE F+PKKD S PEI L +G   GL+GGPSPS+R +L F+AG LHG +R +LL+ 
Sbjct  181   CNANTSEGFNPKKDASFPEIHLRTGEITGLVGGPSPSRRSILAFFAGRLHGHIRRLLLEQ  240

Query  1394  WENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGY  1573
             W++KD+D+QVH  L  G+SY+ M++ SR+C+CPSGYEVASPR+VEA+Y  CVPVLI  GY
Sbjct  241   WKDKDQDMQVHDQLRNGMSYDSMLKNSRFCLCPSGYEVASPRIVEAIYAECVPVLISDGY  300

Query  1574  VAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRF  1753
             V PFSDVLNW+AF++ + V+DIP LK IL GISQRQY+RMQRR  +V+RHF VN  PKRF
Sbjct  301   VPPFSDVLNWKAFSIQVQVKDIPKLKDILMGISQRQYLRMQRRVKQVQRHFVVNGLPKRF  360

Query  1754  DVFHMILHSIW  1786
             D FHM +HSIW
Sbjct  361   DEFHMTIHSIW  371



>ref|XP_002524591.1| catalytic, putative [Ricinus communis]
 gb|EEF37799.1| catalytic, putative [Ricinus communis]
Length=507

 Score =   481 bits (1238),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 223/377 (59%), Positives = 285/377 (76%), Gaps = 4/377 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTK---DDDSVPVGPMYRNASFFLRSYAEMEKTL  838
             Y+ +E++EA LAR R+SI         +    D D VP GP+YRNA+ F RSY EMEK  
Sbjct  118   YSRLEKLEASLARVRSSIREAAQVRNLSSVHDDPDYVPQGPVYRNANAFHRSYLEMEKQF  177

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSITVLSK  1015
             K+YVYE+G PP+ H GPCKS Y+ EG FIH ++  + +RT DPD+A +YFLPFS+ ++ +
Sbjct  178   KIYVYEEGGPPMYHDGPCKSIYSSEGRFIHELEKGKLYRTLDPDEALVYFLPFSVVMMVE  237

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              +Y P+SH+ + +    +DY++ ++ K+PFWNRSLGADHF+LSCHDWGP  S  +P+L N
Sbjct  238   YLYVPDSHETNAIGRAIVDYIHVISNKHPFWNRSLGADHFMLSCHDWGPRASSYVPHLFN  297

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             +SIR LCNANTSE F+P KD S PEI L +G   GLLGG SPS+R +L F+AG LHG +R
Sbjct  298   SSIRVLCNANTSEGFNPSKDASFPEIHLKTGEISGLLGGVSPSRRSILAFFAGRLHGHIR  357

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
              ILL+ W+NKDEDVQV+  +P GVSY  M++ SR+C+CPSGYEVASPR+VEA+Y  CVPV
Sbjct  358   QILLEQWKNKDEDVQVYDQMPNGVSYESMLKTSRFCLCPSGYEVASPRIVEAIYTECVPV  417

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI   YV PFSDVLNW+AF+V I V DIP +K+IL GISQRQY+RMQRR  +V+RHF VN
Sbjct  418   LISDNYVPPFSDVLNWKAFSVQIQVRDIPKIKEILMGISQRQYLRMQRRLKQVQRHFVVN  477

Query  1736  SPPKRFDVFHMILHSIW  1786
              PPKRFD+FHM +HSIW
Sbjct  478   GPPKRFDMFHMTIHSIW  494



>ref|XP_008459522.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
Length=514

 Score =   481 bits (1239),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 231/411 (56%), Positives = 293/411 (71%), Gaps = 8/411 (2%)
 Frame = +2

Query  566   PILLAPETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggT  745
             P +   +  +  D+  NG S+     S  SK   Y+ ++++E  L RARA+I +      
Sbjct  98    PSIEESQKTVAKDKEANGKSAT----SGISKTKGYSKLKKLEEKLGRARAAIRKASQLHN  153

Query  746   QTK---DDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEG  916
              T    D D VP GP+YRN + F RSY EME+ LK+YVY++G+PP+ H GPCKS Y+ EG
Sbjct  154   LTSIHHDPDYVPTGPIYRNPNAFHRSYLEMERLLKIYVYKEGEPPMFHGGPCKSIYSTEG  213

Query  917   NFIHAMDFSRFRTT-DPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVAR  1093
              FIH M+     TT DPD+A LYFLPFS+  L + +Y PNSH+ + +     DY+N +++
Sbjct  214   RFIHEMEKGNLYTTNDPDQALLYFLPFSVVNLVQYLYVPNSHEVNAIGRAITDYINVISK  273

Query  1094  KYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEI  1273
             K+PFW+RSLGADHF+LSCHDWGP  +  +P L NNSIR LCNAN SE F P KD S PEI
Sbjct  274   KHPFWDRSLGADHFMLSCHDWGPRTTSYVPLLFNNSIRVLCNANVSEGFLPSKDASFPEI  333

Query  1274  VLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSY  1453
              L +G   GL+GG SPS+R VL F+AG LHG +R +LLQ W+ KDEDV V+  LP G+SY
Sbjct  334   HLRTGEIDGLIGGLSPSRRSVLAFFAGRLHGHIRYLLLQEWKEKDEDVLVYEELPSGISY  393

Query  1454  NGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVE  1633
             N M++KSR+C+CPSGYEVASPR+VEA+Y  CVPVLI   YV PFSDVLNW++F+V I V+
Sbjct  394   NSMLKKSRFCLCPSGYEVASPRVVEAIYAECVPVLISESYVPPFSDVLNWKSFSVQIQVK  453

Query  1634  DIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             DIPN+KKIL GISQ QY+RMQRR  +V+RHF +N  PKRFD FHMILHSIW
Sbjct  454   DIPNIKKILKGISQTQYLRMQRRVKQVQRHFALNGTPKRFDAFHMILHSIW  504



>ref|XP_006447859.1| hypothetical protein CICLE_v10017948mg [Citrus clementina]
 gb|ESR61099.1| hypothetical protein CICLE_v10017948mg [Citrus clementina]
Length=524

 Score =   482 bits (1240),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 230/420 (55%), Positives = 302/420 (72%), Gaps = 5/420 (1%)
 Frame = +2

Query  542   NNVTGDSRPILLAPET-GIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARAS  718
             N V G S    +A E+  +  ++ +   S++  E+ R      Y  +ER+EA L RAR+S
Sbjct  90    NIVNGSSSGFFVANESIQLVQEQEKLKHSNESDEEVRTDAVKKYNKLERVEASLVRARSS  149

Query  719   ILRgggggTQT---KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGP  889
             I         T   +D D VP GP+YRNA+ F RSY  MEK  K+YVYE+G+PP+ H GP
Sbjct  150   IREAALVRNLTSVHQDPDYVPRGPIYRNANAFHRSYLLMEKLFKIYVYEEGEPPMFHDGP  209

Query  890   CKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITA  1066
             CKS Y+ EG FIH M+ S  ++T DP+KA +YFLPFS+ ++ + +Y P +H+ + +  + 
Sbjct  210   CKSIYSTEGRFIHEMERSNMYKTKDPEKALVYFLPFSVVMMVEHLYVPGAHEINAIGRSI  269

Query  1067  LDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDP  1246
             +DY++ ++ KYPFWNRSLGADHF+LSCHDWGP  S  +P+L  NSIR LCNANTSE F+P
Sbjct  270   VDYISIISHKYPFWNRSLGADHFMLSCHDWGPRSSSFVPHLFRNSIRVLCNANTSEGFNP  329

Query  1247  KKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVH  1426
              KD S+PEI L +G   GL+GGPSPS+R +L F+AG LHG +R +LL +W+NKD+DVQV+
Sbjct  330   VKDASLPEINLLTGEVTGLIGGPSPSRRSILAFFAGRLHGHIRHLLLDNWKNKDQDVQVY  389

Query  1427  SYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWE  1606
               LP  VSYN M+RKS++C+CPSGYEVASPR+VEA+Y  CVPVLI   +V PFSDVLNW 
Sbjct  390   DKLPNNVSYNSMLRKSKFCLCPSGYEVASPRVVEAIYSECVPVLISDSFVPPFSDVLNWN  449

Query  1607  AFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             AF+V I V+DIP +K+IL GISQRQY+RMQRR  +V+RHF  N   KRFDVFHM +HS+W
Sbjct  450   AFSVQIDVKDIPKIKEILKGISQRQYLRMQRRVKQVQRHFVANQSLKRFDVFHMTVHSVW  509



>ref|XP_009782025.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana sylvestris]
Length=549

 Score =   483 bits (1242),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 230/424 (54%), Positives = 298/424 (70%), Gaps = 18/424 (4%)
 Frame = +2

Query  536   HENNVTGDSRPILLAPETGIGDDERQNGISSDDTEDSRKSKR---YTYTNMERIEADLAR  706
             H NN T            G G+ E +    S++ E    +       Y+ +ER+EA LA+
Sbjct  127   HSNNATA-----------GEGESETEKDEISNEEEHGNNATAGVLKMYSRLERVEAILAK  175

Query  707   ARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVA  877
             +R+SI    R G   +  +D D VP GPMY NA+ F RSY EMEK+ K YVYE+G+PP+ 
Sbjct  176   SRSSIREAARNGSMISNHQDPDYVPQGPMYHNANSFHRSYLEMEKSFKAYVYEEGEPPIF  235

Query  878   HYGPCKSTYAIEGNFIHAMDFSRF-RTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPM  1054
             H GPC+S Y+ EG FIH M+   F RT DPD+A +YFLPFS+ V+   +Y P +HD   +
Sbjct  236   HNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAMVYFLPFSVVVMVHYLYVPGAHDMHTI  295

Query  1055  KITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSE  1234
               T  DYV  ++ ++ FWNRSLGADHF+LSCHDWGP  +  +P+L NNSIR LCNANTSE
Sbjct  296   GTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPHSTSYVPHLFNNSIRVLCNANTSE  355

Query  1235  RFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDED  1414
              F+P KDVS+PEI L +G  KGL+GGPSPS R +L F+AGGLHG +R  LL+ W+ KDE+
Sbjct  356   GFNPIKDVSLPEIHLKTGDIKGLVGGPSPSTRSILAFFAGGLHGNIRHHLLEQWKGKDEE  415

Query  1415  VQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDV  1594
             V V+  LP+G SY  M++ S++C+CPSGYEVASPR+VEA+Y  C+PVLI   YV PFSDV
Sbjct  416   VLVYEKLPRGKSYESMLKNSKFCLCPSGYEVASPRIVEAIYAECIPVLISDSYVPPFSDV  475

Query  1595  LNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMIL  1774
             LNW++F+V + V+DIPN+KKIL  ISQ QY+RM RR  +V+RHF +N PPKRFD+FHMI+
Sbjct  476   LNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHFMINGPPKRFDLFHMIV  535

Query  1775  HSIW  1786
             HSIW
Sbjct  536   HSIW  539



>ref|XP_009782027.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X4 
[Nicotiana sylvestris]
Length=523

 Score =   481 bits (1238),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 221/377 (59%), Positives = 284/377 (75%), Gaps = 4/377 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTL  838
             Y+ +ER+EA LA++R+SI    R G   +  +D D VP GPMY NA+ F RSY EMEK+ 
Sbjct  137   YSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNANSFHRSYLEMEKSF  196

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRF-RTTDPDKAHLYFLPFSITVLSK  1015
             K YVYE+G+PP+ H GPC+S Y+ EG FIH M+   F RT DPD+A +YFLPFS+ V+  
Sbjct  197   KAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAMVYFLPFSVVVMVH  256

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              +Y P +HD   +  T  DYV  ++ ++ FWNRSLGADHF+LSCHDWGP  +  +P+L N
Sbjct  257   YLYVPGAHDMHTIGTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPHSTSYVPHLFN  316

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             NSIR LCNANTSE F+P KDVS+PEI L +G  KGL+GGPSPS R +L F+AGGLHG +R
Sbjct  317   NSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPSTRSILAFFAGGLHGNIR  376

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
               LL+ W+ KDE+V V+  LP+G SY  M++ S++C+CPSGYEVASPR+VEA+Y  C+PV
Sbjct  377   HHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEVASPRIVEAIYAECIPV  436

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI   YV PFSDVLNW++F+V + V+DIPN+KKIL  ISQ QY+RM RR  +V+RHF +N
Sbjct  437   LISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHFMIN  496

Query  1736  SPPKRFDVFHMILHSIW  1786
              PPKRFD+FHMI+HSIW
Sbjct  497   GPPKRFDLFHMIVHSIW  513



>ref|XP_006469477.1| PREDICTED: probable glycosyltransferase At5g03795-like [Citrus 
sinensis]
Length=524

 Score =   481 bits (1238),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 230/420 (55%), Positives = 301/420 (72%), Gaps = 5/420 (1%)
 Frame = +2

Query  542   NNVTGDSRPILLAPET-GIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARAS  718
             N V G S    +A E+  +  ++ +   S++  E+ R      Y  +ER+EA L RAR+S
Sbjct  90    NIVNGSSSGFFVANESIQLVQEQEKLKHSNESDEEVRTDAVKKYNKLERVEASLVRARSS  149

Query  719   ILRgggggTQT---KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGP  889
             I         T   +D D VP GP+YRNA+ F RSY  MEK  K+YVYE+G+PP+ H GP
Sbjct  150   IREAALVRNLTSVHQDPDYVPRGPIYRNANAFHRSYLLMEKLFKIYVYEEGEPPMFHDGP  209

Query  890   CKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITA  1066
             CKS Y+ EG FIH M+ S  ++T DP+KA +YFLPFS+ ++   +Y P +H+ + +  + 
Sbjct  210   CKSIYSTEGRFIHEMERSNMYKTKDPEKALVYFLPFSVVMMVAHLYVPGAHEINAIGRSI  269

Query  1067  LDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDP  1246
             +DY++ ++ KYPFWNRSLGADHF+LSCHDWGP  S  +P+L  NSIR LCNANTSE F+P
Sbjct  270   VDYISIISHKYPFWNRSLGADHFMLSCHDWGPRSSSFVPHLFRNSIRVLCNANTSEGFNP  329

Query  1247  KKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVH  1426
              KD S+PEI L +G   GL+GGPSPS+R +L F+AG LHG +R +LL +W+NKD+DVQV+
Sbjct  330   VKDASLPEINLLTGEVTGLIGGPSPSRRSILAFFAGRLHGHIRHLLLDNWKNKDQDVQVY  389

Query  1427  SYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWE  1606
               LP  VSYN M+RKS++C+CPSGYEVASPR+VEA+Y  CVPVLI   +V PFSDVLNW 
Sbjct  390   DKLPNNVSYNSMLRKSKFCLCPSGYEVASPRVVEAIYSECVPVLISDSFVPPFSDVLNWN  449

Query  1607  AFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             AF+V I V+DIP +K+IL GISQRQY+RMQRR  +V+RHF  N   KRFDVFHM +HS+W
Sbjct  450   AFSVQIDVKDIPKIKEILKGISQRQYLRMQRRVKQVQRHFVANQSLKRFDVFHMTVHSVW  509



>ref|XP_009782024.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana sylvestris]
Length=553

 Score =   481 bits (1238),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 221/377 (59%), Positives = 284/377 (75%), Gaps = 4/377 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTL  838
             Y+ +ER+EA LA++R+SI    R G   +  +D D VP GPMY NA+ F RSY EMEK+ 
Sbjct  167   YSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNANSFHRSYLEMEKSF  226

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRF-RTTDPDKAHLYFLPFSITVLSK  1015
             K YVYE+G+PP+ H GPC+S Y+ EG FIH M+   F RT DPD+A +YFLPFS+ V+  
Sbjct  227   KAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAMVYFLPFSVVVMVH  286

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              +Y P +HD   +  T  DYV  ++ ++ FWNRSLGADHF+LSCHDWGP  +  +P+L N
Sbjct  287   YLYVPGAHDMHTIGTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPHSTSYVPHLFN  346

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             NSIR LCNANTSE F+P KDVS+PEI L +G  KGL+GGPSPS R +L F+AGGLHG +R
Sbjct  347   NSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPSTRSILAFFAGGLHGNIR  406

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
               LL+ W+ KDE+V V+  LP+G SY  M++ S++C+CPSGYEVASPR+VEA+Y  C+PV
Sbjct  407   HHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEVASPRIVEAIYAECIPV  466

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI   YV PFSDVLNW++F+V + V+DIPN+KKIL  ISQ QY+RM RR  +V+RHF +N
Sbjct  467   LISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHFMIN  526

Query  1736  SPPKRFDVFHMILHSIW  1786
              PPKRFD+FHMI+HSIW
Sbjct  527   GPPKRFDLFHMIVHSIW  543



>ref|XP_009622709.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
tomentosiformis]
Length=524

 Score =   480 bits (1235),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 233/420 (55%), Positives = 299/420 (71%), Gaps = 9/420 (2%)
 Frame = +2

Query  548   VTGDSRPILLAPETGIGDDERQNGISSDDTEDSRKSKR---YTYTNMERIEADLARARAS  718
             VT DS P    P+ G   +E+ + IS +  E    +       Y+ +ER+EA LA+AR+S
Sbjct  97    VTEDSIP-HQPPQEGESQNEK-DEISIEREEHGNNATAGVVKMYSRLERVEAILAKARSS  154

Query  719   I---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGP  889
             I    R G   +  +D D VP GPMY NA+ F RSY EMEK  K YVYE+G+PP+ H GP
Sbjct  155   IREAARNGSMISSHQDPDYVPQGPMYHNANSFHRSYLEMEKNFKAYVYEEGEPPIFHNGP  214

Query  890   CKSTYAIEGNFIHAMDFSRF-RTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITA  1066
             C+S Y+ EG FIH M+   F RT DPD+A +YFLPFS+ V+   +Y P +HD   +  T 
Sbjct  215   CRSIYSTEGRFIHEMEKGNFYRTKDPDEAMVYFLPFSVVVMVHYLYVPGAHDMHTIGTTV  274

Query  1067  LDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDP  1246
              DYV  ++ ++ FWNRSLGADHF+LSCHDWGP  +  +P+L NNSIR LCNANTSE F+P
Sbjct  275   ADYVKVISSRHTFWNRSLGADHFMLSCHDWGPRSTSYVPHLFNNSIRVLCNANTSEGFNP  334

Query  1247  KKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVH  1426
              KDVS+PEI L +G  KGL+GGPSPS R +L F+AGGLHG +R  LL+ W+ KDEDV V+
Sbjct  335   IKDVSLPEIHLKTGDIKGLIGGPSPSTRSILAFFAGGLHGNIRHHLLKQWKGKDEDVLVY  394

Query  1427  SYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWE  1606
               LP+  SY  M++KS++C+CPSGYEVASPR+VEA+Y  C+PVLI   YV PFSDVLNW+
Sbjct  395   EKLPRSKSYESMLKKSKFCLCPSGYEVASPRVVEAIYAECIPVLISDSYVPPFSDVLNWK  454

Query  1607  AFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             +F+V + V+DIPN+KKIL  ISQ QY+RM RR  +V+RHF +N PPKRFD+FHM +HSIW
Sbjct  455   SFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHFVINGPPKRFDLFHMTVHSIW  514



>ref|XP_008794078.1| PREDICTED: probable glycosyltransferase At5g03795 [Phoenix dactylifera]
Length=552

 Score =   481 bits (1237),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 229/393 (58%), Positives = 292/393 (74%), Gaps = 9/393 (2%)
 Frame = +2

Query  617   GISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTK--DDDSVPVGPMYR  790
             G S ++T  +R+      T +ER+E  LARARA+I        +T   D D VP GP+YR
Sbjct  154   GSSPNNTRRARRKD----TKLERLELGLARARAAIKEAVRNPNRTALVDKDYVPKGPVYR  209

Query  791   NASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPD  967
             NA  F +SY EMEK  KVYVY++G+PP+ H GPCKS Y+ EG FI++MD  SR RT DPD
Sbjct  210   NAYAFHKSYLEMEKLFKVYVYQEGEPPIFHDGPCKSIYSTEGFFINSMDMESRLRTRDPD  269

Query  968   KAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSC  1147
             +AH++FLPFS+  + + +Y  + HD  P++ T LDY+N ++ KYP+WNRSLGADHF+LSC
Sbjct  270   RAHVFFLPFSVVRMVQYIYPRDHHDMKPLRRTVLDYINVISGKYPYWNRSLGADHFMLSC  329

Query  1148  HDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSK  1327
             HDWGP  S   P L  NSIR LCNANTSE F+  +DV++PE+ + S   K  +GGPS S 
Sbjct  330   HDWGPYASGGHPQLFFNSIRVLCNANTSEWFNASRDVTLPEMNVRSHVVK--VGGPSASG  387

Query  1328  RPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEV  1507
             RP+L F+AGG HGP+RP+LL+HW++ D DVQVH YLPKGVSY  +M+KS++C+CPSGYEV
Sbjct  388   RPILAFFAGGNHGPIRPLLLKHWKDIDGDVQVHEYLPKGVSYVDLMKKSKFCLCPSGYEV  447

Query  1508  ASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYI  1687
             ASPR++EA+Y  CVPV I   YV PFSDVLNW+AF+V + VEDIPNLK IL  IS RQYI
Sbjct  448   ASPRIMEAIYYECVPVTINAHYVLPFSDVLNWKAFSVQVSVEDIPNLKNILMSISPRQYI  507

Query  1688  RMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             RMQRR   V+RHF +N PP+RFD++HM+LHSIW
Sbjct  508   RMQRRVRTVQRHFMINGPPRRFDLYHMLLHSIW  540



>ref|XP_009782026.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X3 
[Nicotiana sylvestris]
Length=524

 Score =   479 bits (1234),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 226/408 (55%), Positives = 298/408 (73%), Gaps = 7/408 (2%)
 Frame = +2

Query  581   PETGIGDDERQNGISSDDTEDSRKSKRY--TYTNMERIEADLARARASI---LRgggggT  745
             P+ G  + E+ + IS+++   +  +      Y+ +ER+EA LA++R+SI    R G   +
Sbjct  108   PQEGESETEK-DEISNEEEHGNNATAGVLKMYSRLERVEAILAKSRSSIREAARNGSMIS  166

Query  746   QTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFI  925
               +D D VP GPMY NA+ F RSY EMEK+ K YVYE+G+PP+ H GPC+S Y+ EG FI
Sbjct  167   NHQDPDYVPQGPMYHNANSFHRSYLEMEKSFKAYVYEEGEPPIFHNGPCRSIYSTEGRFI  226

Query  926   HAMDFSRF-RTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYP  1102
             H M+   F RT DPD+A +YFLPFS+ V+   +Y P +HD   +  T  DYV  ++ ++ 
Sbjct  227   HEMEKGNFYRTEDPDEAMVYFLPFSVVVMVHYLYVPGAHDMHTIGTTVADYVKVISSRHT  286

Query  1103  FWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLP  1282
             FWNRSLGADHF+LSCHDWGP  +  +P+L NNSIR LCNANTSE F+P KDVS+PEI L 
Sbjct  287   FWNRSLGADHFMLSCHDWGPHSTSYVPHLFNNSIRVLCNANTSEGFNPIKDVSLPEIHLK  346

Query  1283  SGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGM  1462
             +G  KGL+GGPSPS R +L F+AGGLHG +R  LL+ W+ KDE+V V+  LP+G SY  M
Sbjct  347   TGDIKGLVGGPSPSTRSILAFFAGGLHGNIRHHLLEQWKGKDEEVLVYEKLPRGKSYESM  406

Query  1463  MRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIP  1642
             ++ S++C+CPSGYEVASPR+VEA+Y  C+PVLI   YV PFSDVLNW++F+V + V+DIP
Sbjct  407   LKNSKFCLCPSGYEVASPRIVEAIYAECIPVLISDSYVPPFSDVLNWKSFSVTVAVKDIP  466

Query  1643  NLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             N+KKIL  ISQ QY+RM RR  +V+RHF +N PPKRFD+FHMI+HSIW
Sbjct  467   NIKKILMSISQSQYLRMHRRVKQVQRHFMINGPPKRFDLFHMIVHSIW  514



>gb|KGN52623.1| hypothetical protein Csa_5G647450 [Cucumis sativus]
Length=510

 Score =   479 bits (1232),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 230/404 (57%), Positives = 287/404 (71%), Gaps = 9/404 (2%)
 Frame = +2

Query  602   DERQNGISSDDTEDSRK-----SKRYTYTNMERIEADLARARASILRgggggTQTK---D  757
             +E Q  ++ D   + +      SK   Y+ ++++E  L RARA+I         T    D
Sbjct  97    EESQKTVAKDKEANGKSATPGISKTERYSKLKKLEEKLGRARAAIREASQIHNLTSIHHD  156

Query  758   DDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD  937
              D VP GP+YRN + F RSY EMEK LK+YVY++G+PP+ H GPCKS Y+ EG FIH M+
Sbjct  157   PDYVPTGPIYRNPNAFHRSYIEMEKLLKIYVYKEGEPPMFHGGPCKSIYSTEGRFIHEME  216

Query  938   FSRFRTT-DPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNR  1114
                  TT DPD+A LYFLPFS+  L + +Y PNSH+ + +     DY+N ++ K+PFW+R
Sbjct  217   KGNLYTTNDPDQALLYFLPFSVVNLVQYLYVPNSHEVNAIGTAITDYINVISNKHPFWDR  276

Query  1115  SLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTT  1294
             SLGADHF+LSCHDWGP  +  +P L NNSIR LCNAN SE F P KD S PEI L +G  
Sbjct  277   SLGADHFMLSCHDWGPRTTSFVPLLFNNSIRVLCNANVSEGFRPSKDASFPEIHLRTGEI  336

Query  1295  KGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKS  1474
              GLLGG SPS+R VL F+AG LHG +R +LLQ W+ KDEDV V+  LP G+SY+ M++KS
Sbjct  337   DGLLGGLSPSRRSVLAFFAGRLHGHIRYLLLQEWKEKDEDVLVYDELPSGISYDSMLKKS  396

Query  1475  RYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKK  1654
             R+C+CPSGYEVASPR+VEA+Y  CVPVLI   YV PFSDVLNW +FAV I V+DIPN+KK
Sbjct  397   RFCLCPSGYEVASPRVVEAIYAECVPVLISESYVPPFSDVLNWNSFAVQIQVKDIPNIKK  456

Query  1655  ILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             IL GISQ QY+RMQRR  +V+RHF +N  PKRFD FHMILHSIW
Sbjct  457   ILNGISQTQYLRMQRRVKQVQRHFVLNGTPKRFDAFHMILHSIW  500



>ref|XP_010048370.1| PREDICTED: probable glycosyltransferase At3g07620 [Eucalyptus 
grandis]
Length=521

 Score =   479 bits (1233),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 228/389 (59%), Positives = 290/389 (75%), Gaps = 8/389 (2%)
 Frame = +2

Query  638   EDSRKSKRYTYTNMERIEADLARARASILRgggggTQTK---DDDSVPVGPMYRNASFFL  808
             E +R  KRY+    ER+EA L++AR++I         T    D D VP GP+YRNA+ F 
Sbjct  123   EPARAVKRYS--RFERLEASLSQARSAIREAALVRNLTSVHADADYVPRGPIYRNANAFH  180

Query  809   RSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD--FSRFRTTDPDKAHLY  982
             RSY EMEK  K+YVY++G+PP+ H GPCKS Y+ EG FIH M+   + +RTTDPD+A +Y
Sbjct  181   RSYLEMEKLFKIYVYQEGEPPMFHDGPCKSIYSTEGRFIHEMERGHNMYRTTDPDEALVY  240

Query  983   FLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGP  1162
             FLPFS+ +L + +YEP SH+   +    +DY++ +A K+PFWNRSLGADHF+LSCHDWGP
Sbjct  241   FLPFSVVMLVQYLYEPGSHETHAIGHAVVDYIDVIAAKHPFWNRSLGADHFMLSCHDWGP  300

Query  1163  EISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLV  1342
               S  +PNL + SIR LCNANTSE FDP KD S+PEI L +G   GLLGGPSPS+R  L 
Sbjct  301   RTSSYVPNLFSKSIRVLCNANTSEGFDPFKDASLPEINLKTGEIFGLLGGPSPSRRGTLA  360

Query  1343  FYAGGLHGPVRPILLQHWENK-DEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPR  1519
             F+AG LHG +R +LLQ W++K D DV+V+  LP+GVSY  M+R+SRYC+CPSGYEVASPR
Sbjct  361   FFAGRLHGHIRHLLLQEWKDKEDPDVRVYDELPRGVSYESMLRQSRYCLCPSGYEVASPR  420

Query  1520  MVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQR  1699
             +VEA+Y  CVPVLI   YV PFSDVLNW+AF+V + V+DIPN+KK+L  IS  QY+RMQR
Sbjct  421   IVEAIYAECVPVLISDSYVPPFSDVLNWKAFSVQVQVKDIPNIKKLLMAISPSQYLRMQR  480

Query  1700  RGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             R  +V+RHF  N PP+R+DVFHM +HSIW
Sbjct  481   RVKQVQRHFVANGPPRRYDVFHMTVHSIW  509



>ref|XP_010068733.1| PREDICTED: probable glycosyltransferase At5g03795 [Eucalyptus 
grandis]
 gb|KCW89056.1| hypothetical protein EUGRSUZ_A01382 [Eucalyptus grandis]
Length=496

 Score =   478 bits (1230),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 229/389 (59%), Positives = 288/389 (74%), Gaps = 8/389 (2%)
 Frame = +2

Query  638   EDSRKSKRYTYTNMERIEADLARARASILRgggggTQTK---DDDSVPVGPMYRNASFFL  808
             E  R  KRY+    ER+EA L+RAR++I         T    D D +P GP+YRNA+ F 
Sbjct  98    EPVRAVKRYS--RFERLEASLSRARSAIREAALVRNLTSVHADADYIPQGPIYRNANAFH  155

Query  809   RSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD--FSRFRTTDPDKAHLY  982
             RSY EMEK  K+YVY++G+PP+ H GPCKS Y+ EG FIH M+   + +RTT PD+A +Y
Sbjct  156   RSYLEMEKLFKIYVYQEGEPPMFHDGPCKSIYSTEGRFIHEMERGHNMYRTTGPDEALVY  215

Query  983   FLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGP  1162
             FLPFS+ +L   +YEP SH+   +    +DY++ +A K+PFWNRSLGADHF+LSCHDWGP
Sbjct  216   FLPFSVVMLVHYLYEPGSHETHAIGRAVVDYIDVIAAKHPFWNRSLGADHFMLSCHDWGP  275

Query  1163  EISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLV  1342
               S  +PNL + SIR LCNANTSE FDP KD S+PEI L +G   GLLGGPSPS+R  L 
Sbjct  276   RTSSYVPNLFSKSIRVLCNANTSEGFDPFKDASLPEINLKTGEIFGLLGGPSPSRRGTLA  335

Query  1343  FYAGGLHGPVRPILLQHWENK-DEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPR  1519
             F+AG LHG +R +LLQ W++K D DV+V+  LP+GVSY  M+R+SRYC+CPSGYEVASPR
Sbjct  336   FFAGHLHGHIRYLLLQEWKDKEDPDVRVYDKLPRGVSYESMLRQSRYCLCPSGYEVASPR  395

Query  1520  MVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQR  1699
             +VEA+Y  CVPVLI  GYV PFSDVLNW+AF+V + V+DIPN+KKIL  IS  QY+RMQR
Sbjct  396   IVEAIYAECVPVLISDGYVPPFSDVLNWKAFSVQVQVKDIPNIKKILMAISPSQYLRMQR  455

Query  1700  RGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             R  +V+RHF  N PP+R+DVFHM +HSIW
Sbjct  456   RVKQVQRHFVANGPPRRYDVFHMTVHSIW  484



>ref|NP_001059081.1| Os07g0188700 [Oryza sativa Japonica Group]
 dbj|BAC83913.1| putative pectin-glucuronyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAD31848.1| putative pectin-glucuronyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF20995.1| Os07g0188700 [Oryza sativa Japonica Group]
 gb|EAZ38963.1| hypothetical protein OsJ_23384 [Oryza sativa Japonica Group]
 dbj|BAG93622.1| unnamed protein product [Oryza sativa Japonica Group]
Length=606

 Score =   482 bits (1240),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 237/408 (58%), Positives = 297/408 (73%), Gaps = 14/408 (3%)
 Frame = +2

Query  590   GIGDDERQNGISSDDT-EDSRKSKRYTYTNMERIEADLARARASI---LRgggggTQTKD  757
             G+GD       S DD  +   +++R     +E +E  LA+ARA+I   ++         D
Sbjct  191   GVGD-----AASGDDIIQVMPQAQRRRDVKLELLELGLAKARATIREAIQNKDNKPPLTD  245

Query  758   DDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD  937
              D VPVGP+YRNA  F RSY EMEK  KV+VYE+G+PPV H GPC+S Y+ EG FI+AM+
Sbjct  246   KDYVPVGPVYRNAYAFHRSYLEMEKVFKVFVYEEGEPPVFHDGPCRSIYSTEGRFIYAME  305

Query  938   F-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNR  1114
               +R RT DPD+AH++FLPFS+  + K++YEPNSHD  P++ T  DY+N V+ KYP WNR
Sbjct  306   MENRMRTRDPDQAHVFFLPFSVVKMVKMIYEPNSHDMDPLRRTISDYINVVSTKYPHWNR  365

Query  1115  SLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTT  1294
             SLGADHF+LSCHDWGP +S A  +L +NSIR LCNANTSE FDP +DVS+PEI L S   
Sbjct  366   SLGADHFMLSCHDWGPYVSSANGHLFSNSIRVLCNANTSEGFDPSRDVSLPEINLRSDVV  425

Query  1295  KGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHW-ENKDEDVQVHSYLPK--GVSYNGMM  1465
                +GGPS S RP+L F+AGG HGPVRP+LLQHW + +D D+QV  YLP+  G+SY  MM
Sbjct  426   DRQVGGPSASHRPILAFFAGGDHGPVRPLLLQHWGKGQDADIQVSEYLPRRHGMSYTDMM  485

Query  1466  RKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPN  1645
             R+SR+C+CPSGYEVASPR+VEA+Y+ CVPV+I   Y  PF+DVLNW AF+V + V DIP 
Sbjct  486   RRSRFCLCPSGYEVASPRVVEAIYLECVPVVIGDDYTLPFADVLNWAAFSVRVAVGDIPR  545

Query  1646  LKKILTGISQRQYIRMQRRGVKVRRHFEV-NSPPKRFDVFHMILHSIW  1786
             LK+IL  +S RQYIRMQRR   VRRHF V +  P+RFDVFHMILHSIW
Sbjct  546   LKEILAAVSPRQYIRMQRRVRAVRRHFMVSDGAPRRFDVFHMILHSIW  593



>gb|KCW89058.1| hypothetical protein EUGRSUZ_A01384 [Eucalyptus grandis]
Length=559

 Score =   479 bits (1234),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 232/413 (56%), Positives = 298/413 (72%), Gaps = 8/413 (2%)
 Frame = +2

Query  566   PILLAPETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggT  745
             P   APE     ++ +   +    E +R  KRY+    ER+EA L++AR++I        
Sbjct  137   PFYQAPENEPPTEQPEPDETVTVEEPARAVKRYS--RFERLEASLSQARSAIREAALVRN  194

Query  746   QTK---DDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEG  916
              T    D D VP GP+YRNA+ F RSY EMEK  K+YVY++G+PP+ H GPCKS Y+ EG
Sbjct  195   LTSVHADADYVPRGPIYRNANAFHRSYLEMEKLFKIYVYQEGEPPMFHDGPCKSIYSTEG  254

Query  917   NFIHAMD--FSRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVA  1090
              FIH M+   + +RTTDPD+A +YFLPFS+ +L + +YEP SH+   +    +DY++ +A
Sbjct  255   RFIHEMERGHNMYRTTDPDEALVYFLPFSVVMLVQYLYEPGSHETHAIGHAVVDYIDVIA  314

Query  1091  RKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPE  1270
              K+PFWNRSLGADHF+LSCHDWGP  S  +PNL + SIR LCNANTSE FDP KD S+PE
Sbjct  315   AKHPFWNRSLGADHFMLSCHDWGPRTSSYVPNLFSKSIRVLCNANTSEGFDPFKDASLPE  374

Query  1271  IVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENK-DEDVQVHSYLPKGV  1447
             I L +G   GLLGGPSPS+R  L F+AG LHG +R +LLQ W++K D DV+V+  LP+GV
Sbjct  375   INLKTGEIFGLLGGPSPSRRGTLAFFAGRLHGHIRHLLLQEWKDKEDPDVRVYDELPRGV  434

Query  1448  SYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIP  1627
             SY  M+R+SRYC+CPSGYEVASPR+VEA+Y  CVPVLI   YV PFSDVLNW+AF+V + 
Sbjct  435   SYESMLRQSRYCLCPSGYEVASPRIVEAIYAECVPVLISDSYVPPFSDVLNWKAFSVQVQ  494

Query  1628  VEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             V+DIPN+KK+L  IS  QY+RMQRR  +V+RHF  N PP+R+DVFHM +HSIW
Sbjct  495   VKDIPNIKKLLMAISPSQYLRMQRRVKQVQRHFVANGPPRRYDVFHMTVHSIW  547



>ref|XP_008237734.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=415

 Score =   474 bits (1221),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 227/406 (56%), Positives = 294/406 (72%), Gaps = 13/406 (3%)
 Frame = +2

Query  584   ETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASI---LRgggggTQTK  754
             + G+G DE    ++S  T   R      Y+ +E++EA+LA  RASI    R     +  +
Sbjct  5     DQGLGADEV--NVTSASTTIKR------YSRLEKLEANLAGVRASIREAARVRNLTSTHE  56

Query  755   DDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAM  934
             D D VP GP+YRNA+ F RSY EME+  K+YVYE+G PP+ H GPCKS Y+ EG FIH M
Sbjct  57    DPDYVPKGPIYRNANAFHRSYLEMERLFKIYVYEEGDPPIFHNGPCKSIYSTEGRFIHEM  116

Query  935   DFSR--FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFW  1108
             +     +RT DPD+A +YFLPFS+ +L + +Y  +SH+   +    +DYVN ++ K+PFW
Sbjct  117   EMDNNIYRTRDPDEALVYFLPFSVVMLVQYLYAADSHNTDSIGRAVIDYVNVISDKHPFW  176

Query  1109  NRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG  1288
             NRSLGADHF+LSCHDWGP  S  +P+L++ SIR LCNANTSE F+P KD S PEI L +G
Sbjct  177   NRSLGADHFMLSCHDWGPRTSSYVPHLYHKSIRVLCNANTSEGFNPSKDASFPEIHLRTG  236

Query  1289  TTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMR  1468
               KGLLGG SPS+R +L F+AG LHG +R +LL  W+ KD+DVQV+  LP GVSY  M++
Sbjct  237   EIKGLLGGLSPSRRSILAFFAGRLHGHIRYLLLNEWKEKDQDVQVYDQLPHGVSYESMLK  296

Query  1469  KSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNL  1648
             KSR+C+CPSGYEVA+PR+VEA+Y  C+PVLI   YV PFSDVL+W++F+V I V+DIPN+
Sbjct  297   KSRFCLCPSGYEVANPRVVEAIYAECIPVLISDSYVPPFSDVLDWKSFSVQIQVKDIPNI  356

Query  1649  KKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             K IL GISQ QY+RM RR  +V+RHF VN P KRFDVF+MI+HSIW
Sbjct  357   KTILMGISQSQYLRMHRRVKQVQRHFVVNGPSKRFDVFNMIVHSIW  402



>ref|XP_009417384.1| PREDICTED: probable glycosyltransferase At5g03795 [Musa acuminata 
subsp. malaccensis]
Length=378

 Score =   472 bits (1215),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 232/365 (64%), Positives = 282/365 (77%), Gaps = 4/365 (1%)
 Frame = +2

Query  704   RARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPV  874
             RARA+I    R     +   D D VP GP YR+A  F RSY EMEK  KVYVYE+G+PP+
Sbjct  2     RARAAIKEAFRNHSNVSPLFDKDYVPQGPSYRDAYAFHRSYLEMEKLFKVYVYEEGEPPL  61

Query  875   AHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSP  1051
              H GPC+S Y+ EG FIH +D  + FRT DPD AH++FLPFS+  + KL+Y+P S D SP
Sbjct  62    FHDGPCRSIYSSEGRFIHGIDMDTWFRTRDPDLAHVFFLPFSVVKMVKLIYKPKSFDISP  121

Query  1052  MKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTS  1231
             +  T  DY++ +A +YP+WNRSLGADHF+LSCHDWGP  S A  +L+ +SIR LCNANTS
Sbjct  122   ITRTIADYISVIAERYPYWNRSLGADHFMLSCHDWGPHASEAHSHLYGDSIRVLCNANTS  181

Query  1232  ERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDE  1411
             E FDP+KDVS+PEI L +     ++GGPS S+RPVL F+AGG HGPVRP+LLQ W+ +D 
Sbjct  182   EGFDPRKDVSLPEINLKTDVMADMMGGPSASRRPVLAFFAGGDHGPVRPLLLQAWKGRDP  241

Query  1412  DVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSD  1591
              VQVH YLP+GVSY  MMR+SR+C+CPSGYEVASPR+VEA+Y+GCVPV I   YV PFSD
Sbjct  242   SVQVHEYLPRGVSYYAMMRRSRFCLCPSGYEVASPRVVEAIYLGCVPVTISHRYVLPFSD  301

Query  1592  VLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMI  1771
             VLNW+AF+V +  EDIP+LK+ILT IS RQYIRMQRR   VRRHFEVNSPP+RFDVFHMI
Sbjct  302   VLNWKAFSVQVSPEDIPDLKRILTAISPRQYIRMQRRVRMVRRHFEVNSPPRRFDVFHMI  361

Query  1772  LHSIW  1786
             LHS+W
Sbjct  362   LHSVW  366



>ref|XP_010923285.1| PREDICTED: probable glycosyltransferase At5g03795 [Elaeis guineensis]
Length=522

 Score =   478 bits (1229),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 230/428 (54%), Positives = 304/428 (71%), Gaps = 6/428 (1%)
 Frame = +2

Query  512   EEEIDKGLHENNVTGDSRPILLAPETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIE  691
             +EE+ +   E N +       L P   +        +   +  ++R+ +R     +ER+E
Sbjct  86    DEELVEFQEEVNTSEHGFYSSLPPMGALSPAPEPAAVVLHNISNTRRERRKD-IKLERLE  144

Query  692   ADLARARASILRgggggTQ--TKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQ  865
               LARARA+I        +    D D VP+GP YRNA  F RSY EMEK LKVYVY +G+
Sbjct  145   LGLARARAAIREDVQNSNRPALADKDYVPIGPAYRNAYAFHRSYLEMEKLLKVYVYGEGE  204

Query  866   PPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHD  1042
             PP+ H GPC S Y+ EG FI++MD  +R RT DPD+AH++FLPFS+  + + +Y+ +  D
Sbjct  205   PPIFHDGPCLSIYSTEGLFINSMDMENRLRTRDPDRAHVFFLPFSVVRMVQHIYQRDRRD  264

Query  1043  WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNA  1222
              SP++ T  DY++ ++RKYP+WNRSLGADHF+LSCHDWGP  S    +L  NSIR LCNA
Sbjct  265   MSPLRRTVRDYIDVISRKYPYWNRSLGADHFMLSCHDWGPYASGGHSHLFFNSIRVLCNA  324

Query  1223  NTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWEN  1402
             NTSE F+P KDVS+PE+ + S      +GGPS S RP+L F+AGG HGPVRP+L++HW++
Sbjct  325   NTSEGFNPLKDVSLPEMNMRSAVVN--VGGPSASGRPILAFFAGGNHGPVRPVLIKHWKD  382

Query  1403  KDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAP  1582
             KD+D+QVH YLP+GVSY  +M+KS++C+CPSGYEVASPR++EA+Y+ CVPV I   YV P
Sbjct  383   KDKDIQVHEYLPQGVSYIDLMKKSKFCLCPSGYEVASPRIMEAIYLECVPVTINDHYVLP  442

Query  1583  FSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVF  1762
              SDVLNW+AF+V + VEDIPNLK IL  IS RQYIRMQRR   V+RHF +NSPPKRFD++
Sbjct  443   LSDVLNWKAFSVQVSVEDIPNLKNILMSISPRQYIRMQRRVKIVQRHFMLNSPPKRFDLY  502

Query  1763  HMILHSIW  1786
             HM+LHS+W
Sbjct  503   HMLLHSVW  510



>ref|XP_004955715.1| PREDICTED: probable glycosyltransferase At5g03795-like [Setaria 
italica]
Length=567

 Score =   478 bits (1231),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 226/379 (60%), Positives = 282/379 (74%), Gaps = 7/379 (2%)
 Frame = +2

Query  671   TNMERIEADLARARASIL---RgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLK  841
               +ER+E  LA+AR++I+   R         D D VP+GP+YRNA  F +SY EMEK  K
Sbjct  177   VKLERLELGLAKARSAIMEGIRNKDNRPPLADKDYVPMGPIYRNAYAFHKSYLEMEKLFK  236

Query  842   VYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKL  1018
             VYVYE+G+PPV H GPC+S Y+ EG FI++M+  SR RT DPD AH +FLPFS+  + K+
Sbjct  237   VYVYEEGEPPVFHDGPCRSIYSTEGRFIYSMEMESRLRTRDPDLAHAFFLPFSVVKMVKM  296

Query  1019  VYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNN  1198
             +YEPNSHD  P+K T  DY+  ++ KYP+WNRSLGADHF+LSCHDWGP +S A  +L  N
Sbjct  297   IYEPNSHDMGPLKRTVSDYIGVLSTKYPYWNRSLGADHFMLSCHDWGPYVSSANGHLFGN  356

Query  1199  SIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRP  1378
             SIR LCNANTSE F+P KDVS+PEI L S      +GGPS S+RP+L F+AGG HGPVRP
Sbjct  357   SIRVLCNANTSEGFNPSKDVSLPEINLRSDVVDRQVGGPSASRRPILAFFAGGNHGPVRP  416

Query  1379  ILLQHWENK-DEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
              LL HW+ K D DVQV  YLP+GVSY  MMR+SR+C+CP GYEVASPR+ EA+Y+ CVPV
Sbjct  417   ALLAHWKGKGDPDVQVSEYLPRGVSYTDMMRRSRFCLCPGGYEVASPRLAEAIYLECVPV  476

Query  1556  LIKRG-YVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEV  1732
             +I  G Y  PF+DVLNW+AFAV +P  DIP L+++L+ +S RQYIRMQRR   VRRHF V
Sbjct  477   VIDDGEYALPFADVLNWDAFAVRLPTADIPRLREVLSAVSPRQYIRMQRRVRAVRRHFMV  536

Query  1733  N-SPPKRFDVFHMILHSIW  1786
             +   P+R+D FHMILHS+W
Sbjct  537   HGGAPRRYDAFHMILHSVW  555



>ref|XP_006354423.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=511

 Score =   474 bits (1221),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 230/428 (54%), Positives = 300/428 (70%), Gaps = 9/428 (2%)
 Frame = +2

Query  524   DKGLHENNVTGDSRPILLAPETGIGDDERQNGISSDDTE---DSRKSKRYTYTNMERIEA  694
             +   HEN   G     +   E+  G++E    I ++  E   ++ K     Y+ +ER+EA
Sbjct  76    NNSFHENLKEGGEE--IERDESNEGEEEIDKDIPNEGEEHGNNATKGVLKMYSKLERLEA  133

Query  695   DLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQ  865
              LA++R+SI    R G   +   D D VP GPMY NA+ F RSY EMEK  KVYVYE+G+
Sbjct  134   ILAKSRSSIREAARNGSMISNHHDPDYVPQGPMYHNANAFHRSYLEMEKNFKVYVYEEGE  193

Query  866   PPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHD  1042
             PP+ H GPC+S Y+ EG FIH M+  S +RT +PD+A +YFLPFS+ V+ + ++ P +HD
Sbjct  194   PPIFHNGPCRSIYSTEGRFIHEMERGSLYRTKNPDEALVYFLPFSVVVMVQYLFVPGAHD  253

Query  1043  WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNA  1222
                +  T  DYV  ++ ++ FWNRS GADHF+LSCHDWGP ++  +P+L N SIR LCNA
Sbjct  254   MHVIGRTVADYVKVISERHSFWNRSRGADHFMLSCHDWGPHLTSYVPHLFNTSIRVLCNA  313

Query  1223  NTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWEN  1402
             NTSE F+P KDVS+PEI L +G  KGL+GGPSPS+R +L F+AGGLHG +R  LL+ W+ 
Sbjct  314   NTSEGFNPLKDVSLPEINLKTGDIKGLIGGPSPSRRSILAFFAGGLHGNIRHHLLEQWKG  373

Query  1403  KDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAP  1582
             KDEDV V+  LP   SY  M++ SR+C+CPSGYEVASPR+VEA+Y  C+PVLI   YV P
Sbjct  374   KDEDVLVYDKLPNDKSYETMLKNSRFCLCPSGYEVASPRIVEAIYAECIPVLISDSYVPP  433

Query  1583  FSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVF  1762
             FSDVLNW AF+V I V+DIPN+KKIL  ISQ QY+RM RR  +V+RHF +N  PKRFD+F
Sbjct  434   FSDVLNWNAFSVTIGVKDIPNIKKILISISQSQYLRMHRRVKQVQRHFVINGSPKRFDLF  493

Query  1763  HMILHSIW  1786
             HMI+HSIW
Sbjct  494   HMIVHSIW  501



>gb|EAZ03045.1| hypothetical protein OsI_25187 [Oryza sativa Indica Group]
Length=601

 Score =   478 bits (1229),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 236/408 (58%), Positives = 295/408 (72%), Gaps = 14/408 (3%)
 Frame = +2

Query  590   GIGDDERQNGISSDDT-EDSRKSKRYTYTNMERIEADLARARASI---LRgggggTQTKD  757
             G+GD       S DD  +   +++R     +ER+E  LA+ARA+I   ++         D
Sbjct  186   GVGD-----AASGDDIIQVMPQAQRRRDVKLERLELGLAKARATIREAIQNKDNKPPLTD  240

Query  758   DDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD  937
              D VPVGP+YRNA  F RSY EMEK  KV+VYE+G+PPV H GPC S Y+ EG FI+AM+
Sbjct  241   KDYVPVGPVYRNAYAFHRSYLEMEKVFKVFVYEEGEPPVFHDGPCHSIYSTEGRFIYAME  300

Query  938   F-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNR  1114
               +R RT DP++AH++FLPFS+  + K++YEPNSHD  P++ T  DY+N V+ KYP WNR
Sbjct  301   MENRMRTRDPNQAHVFFLPFSVVKMVKMIYEPNSHDMDPLRRTISDYINVVSTKYPHWNR  360

Query  1115  SLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTT  1294
             SLGADHF+LSCHDWGP +S A  +L +NSIR LCNANTSE FDP +DVS+PEI L S   
Sbjct  361   SLGADHFMLSCHDWGPYVSSANGHLFSNSIRVLCNANTSEGFDPSRDVSLPEINLRSDVV  420

Query  1295  KGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHW-ENKDEDVQVHSYLPK--GVSYNGMM  1465
                +GGPS S RP+L F+AGG HGPVRP+LLQHW + +D D+QV  YLP+   +SY  MM
Sbjct  421   ARQVGGPSASHRPILAFFAGGDHGPVRPLLLQHWGKGQDADIQVSEYLPRRHSMSYTDMM  480

Query  1466  RKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPN  1645
             R+SR+C+CPSGYEVASPR+VEA+Y+ CVPV+I   Y  PF+DVLNW AF+V + V DIP 
Sbjct  481   RRSRFCLCPSGYEVASPRVVEAIYLECVPVVIGDDYALPFADVLNWAAFSVRVAVGDIPR  540

Query  1646  LKKILTGISQRQYIRMQRRGVKVRRHFEV-NSPPKRFDVFHMILHSIW  1786
             LK+IL  +S RQYIRMQRR   VRRHF V +  P RFDVFHMILHSIW
Sbjct  541   LKEILAAVSPRQYIRMQRRVRAVRRHFMVSDGAPWRFDVFHMILHSIW  588



>ref|XP_004292405.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=526

 Score =   475 bits (1222),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 226/410 (55%), Positives = 293/410 (71%), Gaps = 6/410 (1%)
 Frame = +2

Query  569   ILLAPETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASI---LRgggg  739
             I+   E  + +D+    I++    ++   KRY+   +E++EA LA  RASI    R    
Sbjct  106   IVEKQEVAVLNDKESGEINATTASETITIKRYS--RLEKLEASLAGVRASIREAARVRNL  163

Query  740   gTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGN  919
              +  +D D VP GP+YRNA+ F RSY EME+  K+YVY++G PP+ H GPCKS Y+ EG 
Sbjct  164   TSTHEDPDYVPQGPIYRNANAFHRSYLEMERLFKIYVYQEGDPPIFHNGPCKSIYSTEGM  223

Query  920   FIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARK  1096
             FIH M+  + +RT +PD A +YFLPFS+ +L + +YE  SH    +    +DYVN ++ K
Sbjct  224   FIHEMEMDNTYRTKNPDDALVYFLPFSVVMLVQYLYEAESHSTESIGRAVVDYVNVISDK  283

Query  1097  YPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIV  1276
             +PFWNRSLGADHF+LSCHDWGP  S  +P L++ SIR LCNANTSE F+P KDVS PEI 
Sbjct  284   HPFWNRSLGADHFMLSCHDWGPRTSSYVPQLYHKSIRVLCNANTSEGFNPSKDVSFPEIH  343

Query  1277  LPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYN  1456
             L +G TKGLLGG SPS+R VL F+AG LHG +R +LL  W+ KD+DVQV+  LP GVSY 
Sbjct  344   LRTGETKGLLGGLSPSRRSVLAFFAGRLHGHIRCLLLNEWKEKDQDVQVYDQLPNGVSYE  403

Query  1457  GMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVED  1636
              M+++S++C+CPSGYEVASPR+VEA+Y  CVPVLI   YV PFSDVL W+ F+V + V+D
Sbjct  404   SMLKQSKFCLCPSGYEVASPRIVEAIYAECVPVLISDNYVPPFSDVLEWKTFSVQVQVKD  463

Query  1637  IPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             IPN+K IL GISQ QY+RM RR   V+RHF VN P KR+DVF+MI+HSIW
Sbjct  464   IPNIKTILMGISQSQYLRMHRRVKLVQRHFVVNGPSKRYDVFNMIVHSIW  513



>gb|EYU41560.1| hypothetical protein MIMGU_mgv1a005355mg [Erythranthe guttata]
Length=487

 Score =   473 bits (1216),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 217/376 (58%), Positives = 273/376 (73%), Gaps = 1/376 (0%)
 Frame = +2

Query  662   YTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLK  841
             Y   N++ +EA LA+AR ++ +       + D D VP G +YRNA+ F RSY EMEK  K
Sbjct  98    YNLDNLDMVEASLAKARETMHQARLNNETSFDPDYVPEGSIYRNANAFHRSYLEMEKLFK  157

Query  842   VYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             +YVYEDG PP+ HY   K    IEG  IH ++ S+FRT DP KAH+YF+P S+  ++   
Sbjct  158   IYVYEDGDPPLFHYSKSKGILGIEGILIHQIEISKFRTRDPGKAHVYFIPLSVQSIATYA  217

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             Y  ++  WSP++  A DYV  ++ KYP WN++LG DHFIL CHDW P IS  +P L  NS
Sbjct  218   YVIHNRAWSPLQNIARDYVKLISTKYPHWNQTLGRDHFILGCHDWTPTISHGVPLLFKNS  277

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNANTSE F P  DVS+PEI LP GT  GL+GGP PS R +LVFYAGG+HGP+R +
Sbjct  278   IRVLCNANTSEGFKPSIDVSMPEIYLPEGTMDGLIGGPPPSDRSILVFYAGGVHGPIRQM  337

Query  1382  LLQHW-ENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVL  1558
             L+  W +NKD +VQ+H YLPK +SY  + R+S+YCICPSG+EVASPRMVEALYMGCVPVL
Sbjct  338   LMDQWKDNKDPEVQIHEYLPKNMSYYDVFRRSKYCICPSGWEVASPRMVEALYMGCVPVL  397

Query  1559  IKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNS  1738
             +K  Y  PF DVL+W  FAV + V++I +LKKIL GIS  +Y+ MQR G++VRRHFEVN 
Sbjct  398   LKESYAKPFDDVLDWSTFAVDVRVDEIRDLKKILMGISTEKYVEMQREGIRVRRHFEVNF  457

Query  1739  PPKRFDVFHMILHSIW  1786
             PPKR+DVFHM+LHSIW
Sbjct  458   PPKRYDVFHMVLHSIW  473



>ref|XP_011101497.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=465

 Score =   469 bits (1208),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 218/374 (58%), Positives = 267/374 (71%), Gaps = 0/374 (0%)
 Frame = +2

Query  665   TYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
              Y+++ER EA LARARA I         + D D VP GPMYRN + F RSY EMEK  ++
Sbjct  78    NYSDLERAEASLARARARIQEAQRSNQTSYDPDYVPSGPMYRNPNAFHRSYLEMEKLFRI  137

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTTDPDKAHLYFLPFSITVLSKLVY  1024
             YVYEDG PP+ HY        IEG  IH ++ S FRT DP KAH++F+P S   ++   Y
Sbjct  138   YVYEDGDPPLFHYSKSLGILGIEGILIHHIEISNFRTRDPGKAHVFFVPISAQSIANYAY  197

Query  1025  EPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
               ++  WSP++  A DYVN ++ KYP+WNR+LG DHF+L+CHDW P+IS  +P L  NSI
Sbjct  198   VIHNRAWSPLQNIARDYVNLISTKYPYWNRTLGHDHFMLACHDWAPKISKGVPLLFKNSI  257

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPIL  1384
             R LCNANTSE F P  DVS+PEI LP G   GL+GGP PS R VLVFY+GG+HG +R IL
Sbjct  258   RVLCNANTSEGFKPSVDVSMPEIYLPGGKMDGLIGGPPPSTRSVLVFYSGGVHGYIRQIL  317

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             +  W++KD +VQ+H YLP+ +SY GM RKS+YCICPSG+EVASPR VEALY GCVPVL+K
Sbjct  318   MDQWKDKDPEVQIHEYLPRNMSYYGMFRKSKYCICPSGWEVASPRTVEALYTGCVPVLLK  377

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               Y  PF DVL+W  F+V I V  IP LK +L  I + +YI MQR GV+VRRHFEVN PP
Sbjct  378   DHYAKPFDDVLDWSKFSVDIRVSQIPELKNVLKAIPEERYIEMQRIGVEVRRHFEVNFPP  437

Query  1745  KRFDVFHMILHSIW  1786
             KR+DVFHMILHSIW
Sbjct  438   KRYDVFHMILHSIW  451



>ref|XP_007049438.1| Catalytic, putative [Theobroma cacao]
 gb|EOX93595.1| Catalytic, putative [Theobroma cacao]
Length=545

 Score =   468 bits (1203),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 222/391 (57%), Positives = 289/391 (74%), Gaps = 7/391 (2%)
 Frame = +2

Query  629   DDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQT---KDDDSVPVGPMYRNAS  799
             D T  +R  KRY+   +ER+EA+LARAR+SI         T   ++ D VP GP+YRN++
Sbjct  143   DVTSTTRVVKRYS--KLERLEANLARARSSIKEAALVRNLTSIHQNHDYVPHGPIYRNSN  200

Query  800   FFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRF-RTTDPDKAH  976
              F RSY EMEK  K+YVY++G+PP+ H GPC+S Y+ EG FIH ++  +F RT DPD+A 
Sbjct  201   AFHRSYLEMEKLFKIYVYQEGEPPIFHNGPCRSIYSSEGRFIHELEKGKFYRTQDPDEAL  260

Query  977   LYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDW  1156
             +YFLPFS+ +L   +Y+P + D   +    +DY++ +A K+P+WNRSLGADH +LSCHDW
Sbjct  261   VYFLPFSVVMLVHYLYDPETFDTDAIGRAVVDYIDVIASKHPYWNRSLGADHVMLSCHDW  320

Query  1157  GPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPV  1336
             GP  S  +P+L++ SIR LCNANTSE F+P KD S PEI L +G  +GLLGGPSPS+R +
Sbjct  321   GPRASSYVPHLYHKSIRVLCNANTSEGFNPAKDASFPEINLLTGDVEGLLGGPSPSRRSI  380

Query  1337  LVFYAGGLHGPVRPILLQHWENK-DEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVAS  1513
             L F+AG LHG +R +LL  W++K D DVQV   LPKGVSY   ++ SR+C+CPSGYEVAS
Sbjct  381   LAFFAGRLHGYIRYLLLNEWKDKRDPDVQVFDQLPKGVSYMSKLKNSRFCLCPSGYEVAS  440

Query  1514  PRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRM  1693
             PR+VEA+Y  CVPVLI   YV PFSDVLNW +F+V +  +DIPN+KKIL  ISQR+Y+RM
Sbjct  441   PRIVEAIYAECVPVLISDSYVPPFSDVLNWNSFSVQVAAKDIPNIKKILMSISQRRYLRM  500

Query  1694  QRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             QRR  +V+RHF VN+ PKR+DVFHMI HSIW
Sbjct  501   QRRVKQVQRHFVVNATPKRYDVFHMITHSIW  531



>ref|XP_004239536.1| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=535

 Score =   467 bits (1202),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 224/405 (55%), Positives = 293/405 (72%), Gaps = 8/405 (2%)
 Frame = +2

Query  596   GDDERQNGISSDDTE---DSRKSKRYTYTNMERIEADLARARASI---LRgggggTQTKD  757
             G++E +  IS++  E   ++ K     Y  +ER+EA LA++R+SI    R G   +   D
Sbjct  121   GEEEIEKDISNEGGEHGDNATKEVLKMYRRLERLEAILAKSRSSIREAARNGSMISNHHD  180

Query  758   DDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD  937
              D VP GPMY NA+ F RSY EMEK  KVYVYE+G+PP+ H GPC+S Y+ EG FIH M+
Sbjct  181   PDYVPQGPMYHNANSFHRSYLEMEKNFKVYVYEEGEPPIFHNGPCRSIYSTEGRFIHEME  240

Query  938   F-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNR  1114
               S +RT +PD+A +YFLPFS+ V+ + ++ P +HD   +  T  DYV  ++ ++ FWNR
Sbjct  241   RGSLYRTKNPDEALVYFLPFSVVVMVQYLFVPGAHDMHALGRTVADYVKVISERHSFWNR  300

Query  1115  SLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTT  1294
             SLGADHF+LSCHDWGP ++  +P+L N SIR LCNANTSE F+P KDVS+PEI L +G  
Sbjct  301   SLGADHFMLSCHDWGPHLTSYVPHLFNTSIRVLCNANTSEGFNPLKDVSLPEINLKTGDI  360

Query  1295  KGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKS  1474
             KGL+GGPSPS+R +L F+AGGLHG +R  LL+ W+ KDED+ V+  LP   SY  M++ S
Sbjct  361   KGLIGGPSPSRRSILAFFAGGLHGNIRHHLLEQWKGKDEDMLVYEKLPNDKSYETMLKNS  420

Query  1475  RYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKK  1654
             R+C+CPSGYEVASPR+VEA+Y  C+PVLI   YV PFSDVLNW AF+V I V+DIPN+KK
Sbjct  421   RFCLCPSGYEVASPRVVEAIYAECIPVLISDNYVPPFSDVLNWNAFSVTIGVKDIPNIKK  480

Query  1655  ILTGISQRQYIRMQRRGVKVRRHFEVN-SPPKRFDVFHMILHSIW  1786
             IL  ISQ QY+RM RR  +V+RHF +N   PKRFD+ +MI+HSIW
Sbjct  481   ILMSISQSQYLRMHRRVKQVQRHFVINDGSPKRFDLLNMIVHSIW  525



>ref|XP_008796633.1| PREDICTED: probable glycosyltransferase At5g03795 [Phoenix dactylifera]
Length=499

 Score =   465 bits (1196),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 228/388 (59%), Positives = 289/388 (74%), Gaps = 6/388 (2%)
 Frame = +2

Query  632   DTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQ--TKDDDSVPVGPMYRNASFF  805
             +  ++R+ +R   T +ER+E  LARARA+I        +    D D VP GP YRN+  F
Sbjct  103   NISNTRRERRKD-TKLERLELGLARARAAIREAVQNSNRPALADKDYVPKGPAYRNSYAF  161

Query  806   LRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLY  982
              RSY EMEK LKVYVYE+G+PP+ H GPC S Y+ EG FI+ MD  SR RT DPD+AH++
Sbjct  162   HRSYLEMEKLLKVYVYEEGEPPIFHDGPCLSIYSTEGLFINDMDMESRLRTRDPDRAHVF  221

Query  983   FLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGP  1162
             FLPFS+  + + +Y+ +  D SP++ T L Y+N ++ KYP+WNRSLGADHF+LSCHDWGP
Sbjct  222   FLPFSVVRMVQHIYQRDRRDMSPLRRTVLAYINDISGKYPYWNRSLGADHFMLSCHDWGP  281

Query  1163  EISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLV  1342
               S    +L  NSIR LCNAN SE F+P KDVS+PE+ + S      +GGPS S RP+L 
Sbjct  282   YASGGHSHLFLNSIRVLCNANMSEGFNPLKDVSLPEMNMRSAVVD--VGGPSASGRPILA  339

Query  1343  FYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRM  1522
             F+AGG HGPVRP+LL+HW++KD+D+QVH YLPKGVSY  +MRKS++C+CPSGYEVASPR+
Sbjct  340   FFAGGNHGPVRPVLLKHWKDKDKDMQVHEYLPKGVSYVDLMRKSKFCLCPSGYEVASPRI  399

Query  1523  VEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRR  1702
             +EA+Y+ CVPV I   YV P SDVLNW+AF+V + VEDIPNLK IL  IS RQYIRMQRR
Sbjct  400   MEAIYLECVPVTINDHYVLPLSDVLNWKAFSVQVSVEDIPNLKNILMSISPRQYIRMQRR  459

Query  1703  GVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
                V+RHF +N PPKRFD++HM+LHSIW
Sbjct  460   VKIVQRHFMLNGPPKRFDLYHMLLHSIW  487



>ref|XP_009379539.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=521

 Score =   465 bits (1197),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 221/401 (55%), Positives = 289/401 (72%), Gaps = 7/401 (2%)
 Frame = +2

Query  596   GDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQT---KDDDS  766
             GD        +DD  +  K+   + + ++++EA L RAR+SI        +T   +D D 
Sbjct  111   GDVTNYTAKKNDDVAN--KTVFISSSKLDKVEASLGRARSSIREAALVRNKTSTHQDPDY  168

Query  767   VPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR  946
             VP GP+YRN + F RSY EMEK  K+YVYE+G+ P+ H GPC+S Y+ EG FIH M+  +
Sbjct  169   VPRGPIYRNPNAFHRSYLEMEKVFKIYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGQ  228

Query  947   -FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLG  1123
              +RT  P KA +YFLPFS+  + + +Y P ++D S MK+  +DY+N ++ K+PFWNRSLG
Sbjct  229   LYRTKAPHKALVYFLPFSVVNMVQYIYMPETYDRSGMKLAVVDYINLISHKHPFWNRSLG  288

Query  1124  ADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGL  1303
             ADHF+LSCHDWGP  +  +P+L +NSIR LCNANTSE FDP KD S PEI L +    GL
Sbjct  289   ADHFMLSCHDWGPTTTSFVPDLFHNSIRVLCNANTSEGFDPSKDASFPEINLKTSEMPGL  348

Query  1304  LGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYC  1483
              GG  PSKR  L F+AG LHG +R +LL  W+ KD+DVQV+  LP+GVSY  M++ S++C
Sbjct  349   -GGQPPSKRYTLAFFAGRLHGHIRYLLLNEWKGKDQDVQVYDQLPQGVSYENMLKSSKFC  407

Query  1484  ICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILT  1663
             +CPSGYEVASPR+VEA+Y  CVPVLI  GYV PFSDVLNW++F+V +PV++I ++K ILT
Sbjct  408   LCPSGYEVASPRVVEAIYAECVPVLISDGYVPPFSDVLNWKSFSVQVPVKNISDIKTILT  467

Query  1664  GISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
              IS RQY+RMQRR  +V+RHF VN PPKRFDVFHMI+HSIW
Sbjct  468   AISSRQYLRMQRRVKQVQRHFLVNGPPKRFDVFHMIVHSIW  508



>ref|XP_010933454.1| PREDICTED: probable glycosyltransferase At5g03795 [Elaeis guineensis]
Length=524

 Score =   464 bits (1194),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 227/387 (59%), Positives = 287/387 (74%), Gaps = 5/387 (1%)
 Frame = +2

Query  635   TEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTK--DDDSVPVGPMYRNASFFL  808
             T ++ +  R   T +ER+E  LARARA+I        +T   D D VP+GP+YRNA  F 
Sbjct  128   TPNNTRRARIKDTKLERLEFGLARARAAIREAARNPNRTALVDKDYVPIGPVYRNAYAFH  187

Query  809   RSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYF  985
             +SY EMEK  KV+VYE+G+PP+ H GPC+S Y+ EG FI+ MD  SR RT DPD+AH++F
Sbjct  188   KSYLEMEKLFKVFVYEEGEPPIFHDGPCRSIYSTEGFFINNMDMESRLRTRDPDRAHVFF  247

Query  986   LPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPE  1165
             LPFS+  + + +Y  + HD  P++ T LDY+N ++ KYPFWNRSLGADHF+LSCHDWGP 
Sbjct  248   LPFSVVRMVQYIYPRDHHDMRPLRKTVLDYINLISGKYPFWNRSLGADHFMLSCHDWGPY  307

Query  1166  ISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVF  1345
              S    +L  NSIR LCNANTSE F+  +DVS+PE+ + S   K  +GGPS S RP+L F
Sbjct  308   ASGGHHHLFVNSIRVLCNANTSEWFNASRDVSLPEMNVRSDVIK--VGGPSASGRPILAF  365

Query  1346  YAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMV  1525
             +AGG HGPVRP+LL+HW+ KD DVQVH YLPKGVSY  +M+KS++C+CPSGYEVASPR++
Sbjct  366   FAGGNHGPVRPVLLKHWKGKDNDVQVHEYLPKGVSYVDLMKKSKFCLCPSGYEVASPRIM  425

Query  1526  EALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRG  1705
             EA+Y  CVPV I   YV P SDVLNW+AF+V + VEDIP LK IL  IS RQYIRMQRR 
Sbjct  426   EAIYYECVPVTINANYVLPLSDVLNWKAFSVQVSVEDIPKLKNILMSISPRQYIRMQRRV  485

Query  1706  VKVRRHFEVNSPPKRFDVFHMILHSIW  1786
               V+RHF +N PP+RFD++HM+LHSIW
Sbjct  486   KTVQRHFMMNGPPQRFDLYHMLLHSIW  512



>ref|XP_010228257.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Brachypodium distachyon]
Length=547

 Score =   464 bits (1193),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 222/407 (55%), Positives = 290/407 (71%), Gaps = 9/407 (2%)
 Frame = +2

Query  578   APETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQ---  748
             A E+G+GD    +G+     +  R+        + R+E  LA+AR++I+           
Sbjct  130   ATESGLGDAANSDGVIQVIPQIHRERD----AKLHRLELGLAKARSTIMEASHNKDNRPP  185

Query  749   TKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIH  928
               D D VPVGP+YRNA+ F RSY EMEK  K+YVY++G+PP+ H GPC + Y+ EG FIH
Sbjct  186   LTDKDYVPVGPVYRNANAFHRSYLEMEKLFKIYVYDEGEPPIYHDGPCHNIYSTEGRFIH  245

Query  929   AMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPF  1105
             AM+  +R RTTDP  AH++FLPFSI  + K +Y P SH   P++ T  DY++ ++ K+P+
Sbjct  246   AMEMENRMRTTDPGLAHVFFLPFSIAKMEKTIYVPGSHTMEPLRRTVFDYIDVLSTKHPY  305

Query  1106  WNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPS  1285
             WNRS GADHF+LSCHDWGP +S    NL +NSIR LCNANTSE F P KDVS+PEI   +
Sbjct  306   WNRSQGADHFMLSCHDWGPYVSSVDGNLFSNSIRVLCNANTSEGFIPSKDVSLPEINHLN  365

Query  1286  GTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMM  1465
                K + GGPS S RP+L F+AGG HGPVRP+LL+HW+ KD DVQV  YLP GVSY   M
Sbjct  366   DFKKDI-GGPSASGRPILAFFAGGNHGPVRPLLLKHWKGKDPDVQVSEYLPAGVSYVETM  424

Query  1466  RKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPN  1645
             R+S++C+CPSG+EVASPR+ EA+Y+ CVPV+I   YV PFSDVL+W AF++ + V DIP+
Sbjct  425   RRSKFCLCPSGFEVASPRVAEAIYVECVPVVIADDYVLPFSDVLSWPAFSLRVAVRDIPD  484

Query  1646  LKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             +K+IL+ +S R+YIRMQRR   VRRHF +N  P+R+DVFHMILHSIW
Sbjct  485   IKRILSAVSPRRYIRMQRRVRAVRRHFMLNGVPQRYDVFHMILHSIW  531



>emb|CDP08577.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   462 bits (1188),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 216/377 (57%), Positives = 278/377 (74%), Gaps = 4/377 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTL  838
             Y  +ER+E  L++AR SI    + G   +  +D D VP GPMY NA+ F RSY EMEK+ 
Sbjct  123   YNKLERLETMLSKARYSIREAAKNGSMISTHEDADYVPHGPMYINANGFHRSYLEMEKSF  182

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRF-RTTDPDKAHLYFLPFSITVLSK  1015
             KVYVY++G+PP+ H G CKS Y+ EG FIH M+   F RT +PD A +YFLPFS+  + +
Sbjct  183   KVYVYQEGEPPMFHDGLCKSIYSTEGRFIHEMEKGNFYRTKNPDDALVYFLPFSVVAMVQ  242

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              +YEP  HD   +  T  DY+  ++ K+PFWNRSLGADHF+LSCHDWGP  +  +P L N
Sbjct  243   YLYEPGGHDRQAIGHTLADYIGLISGKHPFWNRSLGADHFMLSCHDWGPYSTSYVPQLFN  302

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             NSIR LCNANTSE F+P KDVS+PEI L +G   GL+G PSPS+RP+L F+AG LHG +R
Sbjct  303   NSIRVLCNANTSEGFNPLKDVSLPEIHLRTGEITGLIGCPSPSRRPILAFFAGRLHGHIR  362

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
              +LL+ W+ KD+ +QV+  LP GVSY  M+RKS++C+CPSGYEVASPR+VEA+Y  C+P+
Sbjct  363   YLLLEQWKEKDQGIQVYDSLPAGVSYESMLRKSKFCLCPSGYEVASPRVVEAIYAECIPI  422

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI   Y  PFSDVLNW++F+V + V+DI N+KKILT ISQ QY RM RR  +V+RHF +N
Sbjct  423   LISDSYAPPFSDVLNWKSFSVEVAVKDILNIKKILTSISQTQYRRMHRRLKQVQRHFVIN  482

Query  1736  SPPKRFDVFHMILHSIW  1786
              PPKRFD+FH I+HSIW
Sbjct  483   GPPKRFDLFHTIMHSIW  499



>ref|XP_007216463.1| hypothetical protein PRUPE_ppa024503mg [Prunus persica]
 gb|EMJ17662.1| hypothetical protein PRUPE_ppa024503mg [Prunus persica]
Length=482

 Score =   461 bits (1185),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 217/384 (57%), Positives = 283/384 (74%), Gaps = 3/384 (1%)
 Frame = +2

Query  644   SRKSKRYTYTNMERIEADLARARASILRgggggTQT--KDDDSVPVGPMYRNASFFLRSY  817
             S+  KR    N+ER+EA LA ARA I        QT  +D D VP G +YRNA  F RS+
Sbjct  89    SKTDKRKGDVNLERLEAGLATARALIREATSKFNQTALEDADYVPQGDIYRNAYAFHRSH  148

Query  818   AEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPF  994
               ME   K+YVYE+G+PP+ H GPCK+ Y++EG F+  M+  ++FRT DPDKAH+YFLPF
Sbjct  149   LLMESLFKIYVYEEGEPPIFHNGPCKNIYSMEGLFLSFMETDTKFRTLDPDKAHVYFLPF  208

Query  995   SITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISF  1174
             S+ ++ + ++ P   D + ++ T +DYV  V+ KYPFWNRSLGADH +LSCHDWGP  ++
Sbjct  209   SVVMIIEYLFHPIIRDKAVLERTVVDYVRVVSNKYPFWNRSLGADHVMLSCHDWGPRATW  268

Query  1175  AIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAG  1354
              +  L+  +IR LCNANTSE F+PKKD S PEI L +G   GL+GG  PS+R  L F+AG
Sbjct  269   YVKQLYFVAIRVLCNANTSEHFNPKKDASFPEINLETGDITGLVGGLPPSERTTLAFFAG  328

Query  1355  GLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEAL  1534
              +HG +RP+L QHW+ KD+D+ V+  LP+GVSY+ M++KS+YCICPSG+EVASPR+ EA+
Sbjct  329   RMHGRIRPLLFQHWKEKDKDLLVYETLPEGVSYHDMLKKSKYCICPSGHEVASPRIAEAI  388

Query  1535  YMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKV  1714
             Y  CVPVLI + YV PFSDVLNWE F+V + V +IP+LK+IL GI + QY RMQ+R  +V
Sbjct  389   YAECVPVLISQHYVLPFSDVLNWEFFSVQVSVSEIPHLKEILMGIPEEQYRRMQKRVKQV  448

Query  1715  RRHFEVNSPPKRFDVFHMILHSIW  1786
             +RHF VNSPPKRFDVFHMI+HSIW
Sbjct  449   QRHFVVNSPPKRFDVFHMIIHSIW  472



>ref|XP_010228256.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Brachypodium distachyon]
Length=548

 Score =   463 bits (1191),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 221/405 (55%), Positives = 289/405 (71%), Gaps = 9/405 (2%)
 Frame = +2

Query  584   ETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQ---TK  754
             E+G+GD    +G+     +  R+        + R+E  LA+AR++I+             
Sbjct  133   ESGLGDAANSDGVIQVIPQIHRERD----AKLHRLELGLAKARSTIMEASHNKDNRPPLT  188

Query  755   DDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAM  934
             D D VPVGP+YRNA+ F RSY EMEK  K+YVY++G+PP+ H GPC + Y+ EG FIHAM
Sbjct  189   DKDYVPVGPVYRNANAFHRSYLEMEKLFKIYVYDEGEPPIYHDGPCHNIYSTEGRFIHAM  248

Query  935   DF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWN  1111
             +  +R RTTDP  AH++FLPFSI  + K +Y P SH   P++ T  DY++ ++ K+P+WN
Sbjct  249   EMENRMRTTDPGLAHVFFLPFSIAKMEKTIYVPGSHTMEPLRRTVFDYIDVLSTKHPYWN  308

Query  1112  RSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGT  1291
             RS GADHF+LSCHDWGP +S    NL +NSIR LCNANTSE F P KDVS+PEI   +  
Sbjct  309   RSQGADHFMLSCHDWGPYVSSVDGNLFSNSIRVLCNANTSEGFIPSKDVSLPEINHLNDF  368

Query  1292  TKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRK  1471
              K + GGPS S RP+L F+AGG HGPVRP+LL+HW+ KD DVQV  YLP GVSY   MR+
Sbjct  369   KKDI-GGPSASGRPILAFFAGGNHGPVRPLLLKHWKGKDPDVQVSEYLPAGVSYVETMRR  427

Query  1472  SRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLK  1651
             S++C+CPSG+EVASPR+ EA+Y+ CVPV+I   YV PFSDVL+W AF++ + V DIP++K
Sbjct  428   SKFCLCPSGFEVASPRVAEAIYVECVPVVIADDYVLPFSDVLSWPAFSLRVAVRDIPDIK  487

Query  1652  KILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             +IL+ +S R+YIRMQRR   VRRHF +N  P+R+DVFHMILHSIW
Sbjct  488   RILSAVSPRRYIRMQRRVRAVRRHFMLNGVPQRYDVFHMILHSIW  532



>ref|XP_010657501.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Vitis vinifera]
Length=410

 Score =   457 bits (1177),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 223/395 (56%), Positives = 286/395 (72%), Gaps = 7/395 (2%)
 Frame = +2

Query  614   NGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTK---DDDSVPVGPM  784
             NG++       R+  R     +ER+EA LARARA I  G    +        D VP G +
Sbjct  11    NGLNEKSV---RERLRPRDAELERVEAGLARARALIREGTTNWSSISAPVGADYVPQGDI  67

Query  785   YRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTD  961
             YRNA+ F RSY  MEK  K+++Y++G+PP+ H GPCKS Y+IEG F   M+  + FRT D
Sbjct  68    YRNATAFHRSYLLMEKLFKIFIYKEGEPPLFHNGPCKSIYSIEGVFFSLMEGDTHFRTQD  127

Query  962   PDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFIL  1141
             PD+AH+YFLPFS+ ++   +++P   D   MK    DYV  +++KY +WNRSLGADHF+L
Sbjct  128   PDEAHVYFLPFSVVMIIHHLFDPIVRDKYVMKHVVSDYVKVISQKYRYWNRSLGADHFML  187

Query  1142  SCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSP  1321
             SCHDWGP  ++ +P L+ NSIR LCNANTSE F+P+KD SIPEI L  G T GL GG  P
Sbjct  188   SCHDWGPRATWYVPQLYYNSIRLLCNANTSECFNPRKDASIPEINLIDGETIGLTGGLPP  247

Query  1322  SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGY  1501
             SKR +L F+AGGLHG +RP LLQHW+ KDE VQV+  LP+G+SY  +M+KS+YCICPSG+
Sbjct  248   SKRTILAFFAGGLHGRIRPALLQHWKEKDEQVQVYETLPEGLSYPDLMKKSKYCICPSGH  307

Query  1502  EVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQ  1681
             EVASPR+VEA+Y  CVPVLI + YV PFSDVL+W +F++ + V +IPNLKKIL GI Q +
Sbjct  308   EVASPRIVEAIYAECVPVLISQHYVLPFSDVLDWGSFSIQVSVNEIPNLKKILLGIPQDR  367

Query  1682  YIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             YIRMQ R  +V++HF VN+PPKRFDVFHMI+HSIW
Sbjct  368   YIRMQERVKQVQQHFVVNNPPKRFDVFHMIIHSIW  402



>ref|XP_007145275.1| hypothetical protein PHAVU_007G225300g [Phaseolus vulgaris]
 gb|ESW17269.1| hypothetical protein PHAVU_007G225300g [Phaseolus vulgaris]
Length=490

 Score =   460 bits (1184),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 223/373 (60%), Positives = 277/373 (74%), Gaps = 8/373 (2%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYV  850
             T ++ IE  LA+ARA+I R    GT T D D VP GPMY NA  F RSY EMEK  KV+ 
Sbjct  108   TILDNIEIGLAQARAAI-REARNGTGTPDSDYVPKGPMYWNAKAFHRSYLEMEKQFKVFS  166

Query  851   YEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             Y +G+PPV H  PCKS Y++EGNF+HA++ +  FRT DP++AH++FLP          YE
Sbjct  167   YGEGEPPVFHNAPCKSKYSMEGNFMHAIEMNNHFRTKDPEEAHVFFLP-----RVGYGYE  221

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
               S D SP+K TA DYV+ +A +YP+WNRSLGADHF L+CHD     S ++P  H NSIR
Sbjct  222   GVSQDLSPVKKTATDYVSVIAARYPYWNRSLGADHFTLACHDMCRGTSLSLPTPHKNSIR  281

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
              LCNANTSE F P KDVS PEI L   + +  +GG S SKR +L F+AGG+HGP+ P+LL
Sbjct  282   VLCNANTSEGFKPAKDVSFPEINLKISSIR-FIGGQSASKRSILTFFAGGVHGPIAPVLL  340

Query  1388  QHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             +HWENKDED+Q+  YLPKG+SY+ MMRKS++C+CPSGYE ASPR+VEA+Y GCVPV I  
Sbjct  341   KHWENKDEDIQILKYLPKGISYHEMMRKSKFCLCPSGYEGASPRVVEAIYTGCVPVFISE  400

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
               V PFSDVLNW++F+V + V+DIPNLK+IL  I  +QYIRMQRR  ++ RHFEV+SPPK
Sbjct  401   HSVPPFSDVLNWKSFSVEVSVKDIPNLKEILMSIPPKQYIRMQRRVEQIGRHFEVHSPPK  460

Query  1748  RFDVFHMILHSIW  1786
             RFDVFHMILHS+W
Sbjct  461   RFDVFHMILHSVW  473



>ref|XP_002264111.3| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Vitis vinifera]
Length=454

 Score =   459 bits (1180),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 223/395 (56%), Positives = 286/395 (72%), Gaps = 7/395 (2%)
 Frame = +2

Query  614   NGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTK---DDDSVPVGPM  784
             NG++       R+  R     +ER+EA LARARA I  G    +        D VP G +
Sbjct  55    NGLNEKSV---RERLRPRDAELERVEAGLARARALIREGTTNWSSISAPVGADYVPQGDI  111

Query  785   YRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTD  961
             YRNA+ F RSY  MEK  K+++Y++G+PP+ H GPCKS Y+IEG F   M+  + FRT D
Sbjct  112   YRNATAFHRSYLLMEKLFKIFIYKEGEPPLFHNGPCKSIYSIEGVFFSLMEGDTHFRTQD  171

Query  962   PDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFIL  1141
             PD+AH+YFLPFS+ ++   +++P   D   MK    DYV  +++KY +WNRSLGADHF+L
Sbjct  172   PDEAHVYFLPFSVVMIIHHLFDPIVRDKYVMKHVVSDYVKVISQKYRYWNRSLGADHFML  231

Query  1142  SCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSP  1321
             SCHDWGP  ++ +P L+ NSIR LCNANTSE F+P+KD SIPEI L  G T GL GG  P
Sbjct  232   SCHDWGPRATWYVPQLYYNSIRLLCNANTSECFNPRKDASIPEINLIDGETIGLTGGLPP  291

Query  1322  SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGY  1501
             SKR +L F+AGGLHG +RP LLQHW+ KDE VQV+  LP+G+SY  +M+KS+YCICPSG+
Sbjct  292   SKRTILAFFAGGLHGRIRPALLQHWKEKDEQVQVYETLPEGLSYPDLMKKSKYCICPSGH  351

Query  1502  EVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQ  1681
             EVASPR+VEA+Y  CVPVLI + YV PFSDVL+W +F++ + V +IPNLKKIL GI Q +
Sbjct  352   EVASPRIVEAIYAECVPVLISQHYVLPFSDVLDWGSFSIQVSVNEIPNLKKILLGIPQDR  411

Query  1682  YIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             YIRMQ R  +V++HF VN+PPKRFDVFHMI+HSIW
Sbjct  412   YIRMQERVKQVQQHFVVNNPPKRFDVFHMIIHSIW  446



>emb|CBI28482.3| unnamed protein product [Vitis vinifera]
Length=634

 Score =   462 bits (1189),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 225/417 (54%), Positives = 293/417 (70%), Gaps = 4/417 (1%)
 Frame = +2

Query  548   VTGDSRPILLAPETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILR  727
             +T +S+         +   E  N  +  + +  R+  R     +ER+EA LARARA I  
Sbjct  210   ITWESKDDDDEDNDAMRQKEFMNPGNGLNEKSVRERLRPRDAELERVEAGLARARALIRE  269

Query  728   gggggTQTK---DDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKS  898
             G    +        D VP G +YRNA+ F RSY  MEK  K+++Y++G+PP+ H GPCKS
Sbjct  270   GTTNWSSISAPVGADYVPQGDIYRNATAFHRSYLLMEKLFKIFIYKEGEPPLFHNGPCKS  329

Query  899   TYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDY  1075
              Y+IEG F   M+  + FRT DPD+AH+YFLPFS+ ++   +++P   D   MK    DY
Sbjct  330   IYSIEGVFFSLMEGDTHFRTQDPDEAHVYFLPFSVVMIIHHLFDPIVRDKYVMKHVVSDY  389

Query  1076  VNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKD  1255
             V  +++KY +WNRSLGADHF+LSCHDWGP  ++ +P L+ NSIR LCNANTSE F+P+KD
Sbjct  390   VKVISQKYRYWNRSLGADHFMLSCHDWGPRATWYVPQLYYNSIRLLCNANTSECFNPRKD  449

Query  1256  VSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYL  1435
              SIPEI L  G T GL GG  PSKR +L F+AGGLHG +RP LLQHW+ KDE VQV+  L
Sbjct  450   ASIPEINLIDGETIGLTGGLPPSKRTILAFFAGGLHGRIRPALLQHWKEKDEQVQVYETL  509

Query  1436  PKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFA  1615
             P+G+SY  +M+KS+YCICPSG+EVASPR+VEA+Y  CVPVLI + YV PFSDVL+W +F+
Sbjct  510   PEGLSYPDLMKKSKYCICPSGHEVASPRIVEAIYAECVPVLISQHYVLPFSDVLDWGSFS  569

Query  1616  VIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             + + V +IPNLKKIL GI Q +YIRMQ R  +V++HF VN+PPKRFDVFHMI+HSIW
Sbjct  570   IQVSVNEIPNLKKILLGIPQDRYIRMQERVKQVQQHFVVNNPPKRFDVFHMIIHSIW  626



>ref|XP_008394205.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=519

 Score =   458 bits (1179),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 218/401 (54%), Positives = 287/401 (72%), Gaps = 7/401 (2%)
 Frame = +2

Query  596   GDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQT---KDDDS  766
             GD        +DD  +  ++   + + ++++EA L RAR+SI        +T   +D D 
Sbjct  109   GDATNYTAKKNDDVAN--RTVFISGSQLDKVEASLGRARSSIREAALVRNKTSTHQDPDY  166

Query  767   VPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR  946
             VP GP+YRN + F RSY EMEK  K+YVYE+G+ P+ H GPC+S Y+ EG FIH M+  +
Sbjct  167   VPRGPIYRNPNAFHRSYLEMEKVFKIYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGK  226

Query  947   -FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLG  1123
              +RT DP KA +YFLPFS+  + + +Y P + D S MK   +DY+N ++ K+PFWNRSLG
Sbjct  227   MYRTKDPHKALVYFLPFSVVNMVQYIYMPETFDRSGMKRAVVDYINLISHKHPFWNRSLG  286

Query  1124  ADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGL  1303
             ADHF+LSCHDWGP  +  +P+L +NSIR LCNANTSE F+P KD S PEI L +    G+
Sbjct  287   ADHFMLSCHDWGPTTTSFVPDLFHNSIRVLCNANTSEGFNPLKDASFPEINLKTSEMPGI  346

Query  1304  LGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYC  1483
              GG  PSKR  L F+AG LHG +R +LL  W+ KD+DVQV+  LP+ VSY  M++ S++C
Sbjct  347   -GGRPPSKRSTLAFFAGRLHGHIRYLLLNEWKGKDQDVQVYDQLPRRVSYENMLKSSKFC  405

Query  1484  ICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILT  1663
             +CPSGYEVASPR+VEA+Y  CVPVLI  GYV PFSDVLNW++F+V IPV++I ++K ILT
Sbjct  406   LCPSGYEVASPRVVEAIYAECVPVLISDGYVPPFSDVLNWKSFSVQIPVKNISDIKTILT  465

Query  1664  GISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
              IS RQY+RMQRR  +V+RHF VN PPKR+DVFHMI+HSIW
Sbjct  466   AISSRQYLRMQRRVKQVQRHFLVNGPPKRYDVFHMIVHSIW  506



>ref|XP_008229804.1| PREDICTED: probable glycosyltransferase At3g07620 [Prunus mume]
Length=482

 Score =   457 bits (1175),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 214/384 (56%), Positives = 282/384 (73%), Gaps = 3/384 (1%)
 Frame = +2

Query  644   SRKSKRYTYTNMERIEADLARARASILRgggggTQT--KDDDSVPVGPMYRNASFFLRSY  817
             S+  K+    N+E++EA LA ARA I         T  +D D VP G +YRNA  F RS+
Sbjct  89    SKTDKQKGDVNLEKLEAGLATARALIREATSKFNHTALEDADYVPQGDIYRNAYAFHRSH  148

Query  818   AEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPF  994
               ME   K+YVYE+G+PP+ H GPCK+ Y++EG F+  M+  ++FRT DPDKAH+YFLPF
Sbjct  149   LLMESLFKIYVYEEGEPPIFHNGPCKNIYSMEGLFLSFMETDTKFRTLDPDKAHVYFLPF  208

Query  995   SITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISF  1174
             S+ ++ + ++ P   D + ++ T +DYV  V+ KYPFWNRSLGADH +LSCHDWGP  ++
Sbjct  209   SVVMIIEYLFHPIIRDKAVLERTVVDYVRVVSNKYPFWNRSLGADHVMLSCHDWGPRATW  268

Query  1175  AIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAG  1354
              +  L+  +IR LCNANTSE F+PKKD S PEI L +G   GL+GG SPS+R  L F+AG
Sbjct  269   YVKQLYFVAIRVLCNANTSEHFNPKKDASFPEINLETGDITGLVGGLSPSERTTLAFFAG  328

Query  1355  GLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEAL  1534
              +HG +RP+L QHW+ KD+D+ V+  LP+GVSY+ M++KS+YCICPSG+EVASPR+ EA+
Sbjct  329   RMHGRIRPLLFQHWKEKDKDLLVYETLPEGVSYHDMLKKSKYCICPSGHEVASPRIAEAI  388

Query  1535  YMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKV  1714
             Y  CVPVLI + YV PFSDVLNWE+F+V + V +IP LK+IL GI + QY RMQ+R  +V
Sbjct  389   YAECVPVLISQHYVLPFSDVLNWESFSVQVSVTEIPQLKEILMGIPEEQYRRMQKRVKQV  448

Query  1715  RRHFEVNSPPKRFDVFHMILHSIW  1786
             +RHF VNS PKRFDVFHMI+HSIW
Sbjct  449   QRHFVVNSSPKRFDVFHMIIHSIW  472



>ref|XP_011085648.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=438

 Score =   454 bits (1168),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 213/388 (55%), Positives = 278/388 (72%), Gaps = 11/388 (3%)
 Frame = +2

Query  656   KRYTYTNMERIEADLARARASI--LRgggggTQTKDDDS--------VPVGPMYRNASFF  805
             K+     +++ EA LA+AR SI  +        T D +         +P GP+YRN + F
Sbjct  40    KKLEQDRLKKAEAVLAKARFSIRDVAQSKLVNSTSDQEHDDDDDDDYIPQGPVYRNPTAF  99

Query  806   LRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRF-RTTDPDKAHLY  982
             LRSY EMEK  K+YVYE+G+ P+ H+GPC+S Y+ EGNFI+ ++   F RT DP +AH++
Sbjct  100   LRSYQEMEKVFKIYVYEEGERPIFHHGPCRSIYSTEGNFIYELERGSFYRTNDPREAHVF  159

Query  983   FLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGP  1162
             FLPFS+  L + +YE  S D   +     DYV +++ +YPFWN SLGADHF+LSCHDWGP
Sbjct  160   FLPFSVVGLVQYLYEAGSRDRKAIAGVVADYVQTISFRYPFWNSSLGADHFMLSCHDWGP  219

Query  1163  EISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLV  1342
               + ++P L +NSIR LCNANTSE F+P KDVS+PEI L +G   GLLGG  PS+RP+L 
Sbjct  220   YSTKSVPKLFSNSIRVLCNANTSEGFNPLKDVSLPEINLNTGDMSGLLGGSPPSQRPILA  279

Query  1343  FYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRM  1522
             F+AG LHG +R ILL+ W+ KD DVQV+  LP+ +SY  M+R S++C+CPSGYEVASPR+
Sbjct  280   FFAGRLHGHIRRILLKQWKGKDHDVQVYDELPRNISYESMLRNSKFCLCPSGYEVASPRV  339

Query  1523  VEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRR  1702
             VEA+Y  CVPVLI +GYV P SDVL WE FAV +  EDIPN+KKIL GI + +Y+RM +R
Sbjct  340   VEAIYAECVPVLISKGYVPPLSDVLKWEEFAVAVAEEDIPNVKKILMGIPKEKYLRMHKR  399

Query  1703  GVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
               +V+RHF +N PPKRFD+FHMILHSIW
Sbjct  400   LREVQRHFVMNGPPKRFDLFHMILHSIW  427



>ref|XP_004243882.1| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=508

 Score =   456 bits (1173),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 230/445 (52%), Positives = 304/445 (68%), Gaps = 25/445 (6%)
 Frame = +2

Query  503   VTTEEEIDKGLHE------NNVTGDSRPILLAPETGIGDDERQNGISSDDTEDSRKSKRY  664
             +T+ EE D+ L        NN   DS      P  G+ D      I  D+  +  K +  
Sbjct  64    LTSYEEKDQHLQVVGLVTFNNSAKDS--FSNRPGEGVED------IWKDEMNEGEKHRNE  115

Query  665   T------YTNMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSY  817
             T      Y  +ER+EA LA+AR+SI    R G   +  +D D VP GP+YRN + F RSY
Sbjct  116   TTGIVKRYNRLERVEAILAKARSSIREAARNGSMISNHEDPDYVPQGPIYRNTNAFHRSY  175

Query  818   AEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD-FSRFRTTDPDKAHLYFLPF  994
              EMEK  K+YVYE+G+ P+ H GPC+S Y+ EG FI+ M+  + +RT +PD+A +YFLPF
Sbjct  176   LEMEKKFKIYVYEEGELPIFHNGPCRSIYSTEGRFIYEMEKGNMYRTKNPDEALVYFLPF  235

Query  995   SITVLSKLVYEPNSHDWS-PMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEIS  1171
             S+ V+ + +Y     D    +  T  DY++ ++ ++ FWN SLGADHF+LSCHDWGP  +
Sbjct  236   SVVVMVRYLYVSGGPDSRHVIGRTVADYIHVISSRHSFWNTSLGADHFMLSCHDWGPHTT  295

Query  1172  FAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYA  1351
               +P+L NNSIR LCNANT+E F+P+KDVS+PEI L +  T G++GGPSPS+R +L F+A
Sbjct  296   SYVPHLFNNSIRVLCNANTTEGFNPQKDVSLPEINLKTDDTIGIIGGPSPSRRSILAFFA  355

Query  1352  GGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEA  1531
             GGLHG +R  L+Q W+ KD+DV V+  LP G SY  M++ S++C+CPSGYEVASPR+VEA
Sbjct  356   GGLHGAIRNNLMQQWKGKDQDVLVYEELPSGESYESMLKNSKFCLCPSGYEVASPRVVEA  415

Query  1532  LYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVK  1711
             +Y  CVPVLI  GYV PFSDVLNW AF+V + VEDIPN+KKIL  ISQ QY+RMQRR  +
Sbjct  416   IYAECVPVLISDGYVPPFSDVLNWNAFSVKVAVEDIPNIKKILMSISQTQYLRMQRRVKQ  475

Query  1712  VRRHFEVNSPPKRFDVFHMILHSIW  1786
             V+RHF +N P KRFD+FHMI+HSIW
Sbjct  476   VQRHFVMNGPSKRFDLFHMIVHSIW  500



>ref|XP_006357695.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=492

 Score =   455 bits (1171),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 222/403 (55%), Positives = 290/403 (72%), Gaps = 8/403 (2%)
 Frame = +2

Query  593   IGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASI---LRgggggTQTKDDD  763
             I  DE   G    D E +   KRY    +ER+EA LA+AR+SI    R G   +  +D D
Sbjct  85    IWKDEMNEGEEHSD-ETAGIVKRYN--RLERLEAILAKARSSIREAARNGSMISNHQDPD  141

Query  764   SVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD-F  940
              VP GP+YRN + F RSY EMEK  K+YVYE+G+ P+ H GPC+S Y+ EG FI+ M+  
Sbjct  142   YVPQGPIYRNTNAFHRSYLEMEKKFKIYVYEEGELPIFHNGPCRSIYSTEGRFIYEMEKG  201

Query  941   SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHD-WSPMKITALDYVNSVARKYPFWNRS  1117
             + +RT DP++A +YFLPFS+ V+ + +Y     D    +  T  DY++ ++ ++ FWN S
Sbjct  202   NMYRTKDPEEALVYFLPFSVVVMVRYLYVSGGPDSRHVIGRTVADYIHVISSRHSFWNTS  261

Query  1118  LGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTK  1297
             LGADHF+LSCHDWGP  +  +P+L NNSIR LCNANT+E F+P+KDVS+PEI L +  T 
Sbjct  262   LGADHFMLSCHDWGPHTTSYVPHLFNNSIRVLCNANTTEGFNPQKDVSLPEINLKTDDTI  321

Query  1298  GLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSR  1477
             G++GGPSPS+R  L F+AGGLHG +R  L+Q W+ KD+DV V+  LP G SY  M++ S+
Sbjct  322   GIIGGPSPSRRSTLAFFAGGLHGAIRNNLMQQWKGKDQDVLVYEELPPGKSYETMLKNSK  381

Query  1478  YCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKI  1657
             +C+CPSGYEVASPR+VEA+Y  CVPVLI  GYV PFSDVLNW AF+V + VEDIPN+KKI
Sbjct  382   FCLCPSGYEVASPRVVEAIYAECVPVLISDGYVPPFSDVLNWNAFSVKVAVEDIPNIKKI  441

Query  1658  LTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             L  ISQ QY+RMQ+R  +V+RHF +N PPKRFD+FHMI+HSIW
Sbjct  442   LMSISQTQYLRMQKRVKQVQRHFVMNGPPKRFDLFHMIVHSIW  484



>ref|XP_006856555.1| hypothetical protein AMTR_s00046p00174470 [Amborella trichopoda]
 gb|ERN18022.1| hypothetical protein AMTR_s00046p00174470 [Amborella trichopoda]
Length=543

 Score =   456 bits (1172),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 215/391 (55%), Positives = 283/391 (72%), Gaps = 3/391 (1%)
 Frame = +2

Query  623   SSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQT--KDDDSVPVGPMYRNA  796
             +S D   S  +KR    +++R++A LARAR+SI R       +    D  VP G  YRN 
Sbjct  143   NSTDEVLSPSTKREKQRSLQRLDAQLARARSSIKRAARFCNDSCYGGDSFVPKGAAYRNP  202

Query  797   SFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKA  973
               F +SY EMEKTLKV++Y++G+PP+ H GPCKS Y++EG FIH  D  +RF  + P+ A
Sbjct  203   YAFYQSYLEMEKTLKVWIYKEGEPPLVHDGPCKSIYSMEGQFIHEFDSGNRFVASSPEHA  262

Query  974   HLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHD  1153
             HL+F+P SIT L   +Y P ++   P+     DY++ ++RKYPFWNR+ G+DHF LSCHD
Sbjct  263   HLHFIPLSITKLVHHLYPPKTYGRGPLHRVVSDYISIISRKYPFWNRTQGSDHFYLSCHD  322

Query  1154  WGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRP  1333
             W P+ S A P L+ NSIR LCNANTSE FDP+KDVS+PEI L +G   GL+GGPSPS+R 
Sbjct  323   WAPDASEANPELNRNSIRVLCNANTSEGFDPRKDVSMPEIHLKTGRLDGLIGGPSPSRRS  382

Query  1334  VLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVAS  1513
             +L F+AG  HG +R +LL+ W++KD  VQVH YLPKG SY+  M+++++C+CPSGYEVAS
Sbjct  383   ILAFFAGAQHGYIRSLLLRQWKDKDSQVQVHEYLPKGQSYSKQMQRAKFCLCPSGYEVAS  442

Query  1514  PRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRM  1693
             PR+VEA+Y GCVPV+I   YV PFSDVL+W  F+V IPV  IP++K IL  ISQR+Y+++
Sbjct  443   PRVVEAIYSGCVPVIISSSYVLPFSDVLDWRKFSVHIPVSKIPDIKTILERISQRRYLQL  502

Query  1694  QRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
              RR ++V+RHF VN P KRFDV HMILHSIW
Sbjct  503   YRRVLQVQRHFVVNRPAKRFDVIHMILHSIW  533



>ref|XP_009379540.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=540

 Score =   454 bits (1169),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 208/376 (55%), Positives = 276/376 (73%), Gaps = 5/376 (1%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQT---KDDDSVPVGPMYRNASFFLRSYAEMEKTLK  841
             + ++++EA L RAR++I        +T   +D D VP GP+Y N + F RSY EMEK  K
Sbjct  153   SQLDKVEASLGRARSAIREAAKVRNKTSTHQDPDYVPRGPIYHNPNAFHRSYLEMEKVFK  212

Query  842   VYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRF-RTTDPDKAHLYFLPFSITVLSKL  1018
             +YVYE+G+ P+ H GPC+  Y+ EG FIH M+  +F RT DP KA +YFLPFS+  + + 
Sbjct  213   IYVYEEGEVPIFHEGPCRGIYSSEGRFIHEMEKGKFYRTKDPHKALVYFLPFSVVTMVQY  272

Query  1019  VYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNN  1198
             +Y P + D + MK+  +DY+N ++ K+PFWNRS GADHF+LSCHDWGP  +  +P+L +N
Sbjct  273   IYMPETFDRNGMKLAVVDYINLISYKHPFWNRSHGADHFMLSCHDWGPFTTSFVPDLFHN  332

Query  1199  SIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRP  1378
             SIR +CNANTSE F+P KD S+PEI L +    G+ GG  PSKR  L FYAGGLHG +R 
Sbjct  333   SIRVVCNANTSEGFNPSKDASLPEINLKTSEMSGI-GGQPPSKRSTLAFYAGGLHGHIRY  391

Query  1379  ILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVL  1558
             +LL  W+ KD+DV V+  LP+G+SY  M + S++C+CPSGYEVASPR+VEA+Y  CVPVL
Sbjct  392   LLLNEWKGKDQDVLVYDKLPQGMSYENMFKSSKFCLCPSGYEVASPRVVEAIYAECVPVL  451

Query  1559  IKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNS  1738
             I  GYV PFSDVLNW +F+V +PV++I ++K ILT IS RQY+RMQRR  +V+RHF VN 
Sbjct  452   ISDGYVPPFSDVLNWNSFSVQVPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLVNG  511

Query  1739  PPKRFDVFHMILHSIW  1786
             PPKR+DVFHMI+HS+W
Sbjct  512   PPKRYDVFHMIVHSVW  527



>ref|XP_008227724.1| PREDICTED: probable glycosyltransferase At3g07620 [Prunus mume]
Length=520

 Score =   454 bits (1167),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 216/407 (53%), Positives = 291/407 (71%), Gaps = 5/407 (1%)
 Frame = +2

Query  578   APETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQT--  751
             AP+    DDE Q  I+      ++     + +++E++EA L RAR+SI        +T  
Sbjct  101   APQIFGVDDEVQETITQQVEGPNKTLFISSSSHLEKLEASLGRARSSIREAAKVRNKTST  160

Query  752   -KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIH  928
              +D D VP GP+YRN + F RSY EMEK  K+YVYE+GQ P+ H GPC   Y  EG FIH
Sbjct  161   HQDPDYVPRGPIYRNPNAFHRSYLEMEKLFKIYVYEEGQVPIFHDGPCFHMYLTEGRFIH  220

Query  929   AMDFSR-FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPF  1105
              M+  + +RTTDP++A +YFLPFS+  + + +Y P+++D + +K+  +DY+N +A K+PF
Sbjct  221   EMENGKLYRTTDPNQALVYFLPFSVVRMVQFLYLPDTYDRNGLKLAVIDYINLIAHKHPF  280

Query  1106  WNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPS  1285
             WNRSLGADHF+LSCHDWGP  +  +P+L + SIR LCNANTSE F+P KD S+PEI L +
Sbjct  281   WNRSLGADHFMLSCHDWGPFTTAFVPHLFHKSIRVLCNANTSEGFNPSKDASLPEIKLLT  340

Query  1286  GTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMM  1465
                  L GG  PSKR  L F+AGGLHG +R +LL  W+ KD+DV V+  +P GVSY  MM
Sbjct  341   PEIPRL-GGQPPSKRSTLAFFAGGLHGHIRYLLLNEWKGKDQDVLVYEKVPHGVSYEEMM  399

Query  1466  RKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPN  1645
             + S++C+CPSGYEVASPR+VEA+Y  CVPVLI  GY+ PFSDVL+W++F+V +PV++I +
Sbjct  400   KSSKFCLCPSGYEVASPRVVEAIYAECVPVLISDGYIPPFSDVLDWKSFSVQVPVKNISD  459

Query  1646  LKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             +K IL  IS RQY+RMQRR  +V+RHF +N PPKR+DVFHMI+HSIW
Sbjct  460   MKNILMSISNRQYLRMQRRLKQVQRHFLMNGPPKRYDVFHMIVHSIW  506



>ref|XP_011009816.1| PREDICTED: probable glycosyltransferase At3g07620 [Populus euphratica]
Length=480

 Score =   452 bits (1164),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 210/375 (56%), Positives = 275/375 (73%), Gaps = 5/375 (1%)
 Frame = +2

Query  677   MERIEADLARARASILRgggggTQTK----DDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             +ER+EA LA ARA I         T     D D +P G +YRNA  F RSY  MEK  K+
Sbjct  96    LERVEAGLAMARALIREAAEDSNCTSSLHDDLDYIPRGYIYRNACAFHRSYLLMEKLFKI  155

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             +VYE+G+PP+ HYG CK  Y++EG F+  M+  ++FRT++PD+AH+YFLPFS+ ++ + +
Sbjct  156   FVYEEGEPPLFHYGTCKDIYSMEGVFLSLMETNTKFRTSNPDEAHVYFLPFSVVMIIEHL  215

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             + P   D + ++ T  DYV  ++ KY +WNRSLGADHF+LSCHDWGP  ++ +  L+ NS
Sbjct  216   FHPIIRDKAVLERTVSDYVRIISHKYLYWNRSLGADHFMLSCHDWGPRATWYVRQLYYNS  275

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNANTSE F+PKKD S PEI L +G   GL GG  PS R VL F+AG +HG +RP 
Sbjct  276   IRVLCNANTSEYFNPKKDASFPEINLKTGEITGLTGGLPPSNRTVLAFFAGKMHGKLRPA  335

Query  1382  LLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             LLQHW  KD+DVQV+  LP+G+SY+ MM KS+YCICPSG+EVASPR+ EA+Y  CVPVLI
Sbjct  336   LLQHWMGKDKDVQVYETLPQGISYHEMMTKSKYCICPSGHEVASPRIAEAIYAECVPVLI  395

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
              + Y+ PFSDVLNW++F + +PV +IPNLK IL GI + QY+RMQ R  +V+RHF VN+P
Sbjct  396   SQHYIFPFSDVLNWDSFTIQVPVTEIPNLKNILEGIPEDQYLRMQERVKQVQRHFVVNNP  455

Query  1742  PKRFDVFHMILHSIW  1786
             P+R+DVFHMI+HSIW
Sbjct  456   PRRYDVFHMIIHSIW  470



>ref|XP_006845223.1| hypothetical protein AMTR_s00005p00255230 [Amborella trichopoda]
 gb|ERN06898.1| hypothetical protein AMTR_s00005p00255230 [Amborella trichopoda]
Length=384

 Score =   448 bits (1153),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 209/373 (56%), Positives = 277/373 (74%), Gaps = 5/373 (1%)
 Frame = +2

Query  683   RIEADLARARASILRgggg---gTQTKD-DDSVPVGPMYRNASFFLRSYAEMEKTLKVYV  850
             ++EA L++ARA+I          T  +D DD  P G +YRN+  F RSY EMEK  K++V
Sbjct  2     KLEAGLSKARAAIREATLSHRNRTPIEDPDDYAPKGGIYRNSYAFHRSYLEMEKRFKIFV  61

Query  851   YEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             YE+G+PP+ H GPCKS Y+ EG FIH M   +RFRT   ++AH++FLPFS+  + + VY 
Sbjct  62    YEEGEPPLVHNGPCKSIYSSEGIFIHEMVLGNRFRTRSQERAHVHFLPFSVVAMIQFVYT  121

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
             P+S D  P+K    DY++ +++KY +WN+SLGADHF+LSCHDWGP  S A P L+ NSIR
Sbjct  122   PSSFDLYPVKNLVADYIDVISKKYHYWNQSLGADHFMLSCHDWGPHTSAANPLLNKNSIR  181

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
              LCNAN+SE F P++DV +PEI +PSG+ +G+LGG  PS R +L F+AGG+HG +R ILL
Sbjct  182   VLCNANSSEDFYPQRDVPLPEINIPSGSIEGMLGGLRPSARTILAFFAGGVHGWIRSILL  241

Query  1388  QHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             QHW+NKD D+Q   YLP  +SY  M+RKS++C+CPSGYEVASPR+VEA+Y  CVPV+I  
Sbjct  242   QHWKNKDPDIQAFEYLPHDLSYWDMLRKSKFCLCPSGYEVASPRLVEAIYAECVPVIISD  301

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
              YV PFSDVLNW +F+V + V +I  LK+IL GIS  +Y+RMQRR  +V+RHF VN PPK
Sbjct  302   HYVLPFSDVLNWASFSVEVKVGEIERLKEILEGISMEKYVRMQRRVKQVQRHFVVNEPPK  361

Query  1748  RFDVFHMILHSIW  1786
             R+DVFHM++HS+W
Sbjct  362   RYDVFHMVIHSVW  374



>gb|KDP22997.1| hypothetical protein JCGZ_01719 [Jatropha curcas]
Length=742

 Score =   461 bits (1185),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 213/365 (58%), Positives = 274/365 (75%), Gaps = 4/365 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTL  838
             Y+ +E++EA+LAR R SI    R     +  +D+D VP GP+YRNA+ F RSY EMEK  
Sbjct  337   YSKLEKMEANLARVRVSIREAARIRNLTSLHQDEDYVPQGPIYRNANAFHRSYLEMEKLF  396

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSITVLSK  1015
             K+YVYE+G+ P+ H GPCKS Y+ EG FIH ++  + +RT DP++A +YFLPFS+ ++ +
Sbjct  397   KIYVYEEGETPLFHDGPCKSIYSSEGTFIHELEKGKSYRTRDPEEALVYFLPFSVVMMVE  456

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              +Y PNSH+   +    +DY+N ++ KYPFWNRSLGADHF+LSCHDWGP  S  +  L  
Sbjct  457   YLYVPNSHEIEAIGRVVVDYINVISNKYPFWNRSLGADHFMLSCHDWGPRTSSYVSQLFK  516

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             NSIR LCNANTSE F+P KD S PEI L +G   GL+GG SPS+R +L F+AG LHG +R
Sbjct  517   NSIRVLCNANTSEGFNPSKDASFPEIHLKTGEITGLIGGSSPSRRSILAFFAGRLHGDIR  576

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
              +LL+ W+NKD+DVQV   LPK VSY  M++KSR+C+CPSGYEVASPR+VEA+Y  CVPV
Sbjct  577   RLLLEKWKNKDKDVQVFEQLPKNVSYESMLKKSRFCLCPSGYEVASPRVVEAIYSECVPV  636

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI   YV PFSDVLNW+AF+V + V+DIP +K+IL GISQRQY+RMQRR  +V+RHF VN
Sbjct  637   LISDSYVPPFSDVLNWKAFSVQVEVKDIPKIKEILMGISQRQYLRMQRRVKQVQRHFVVN  696

Query  1736  SPPKR  1750
              PPKR
Sbjct  697   GPPKR  701


 Score =   219 bits (559),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 156/241 (65%), Gaps = 8/241 (3%)
 Frame = +2

Query  677   MERIEADLARARASI----LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             +E++EA L+ ARA I    L      ++  D D    G +YRN   F RSY  MEK  K+
Sbjct  12    VEKLEATLSIARALIREAALDHNCKSSRDGDGDD---GNIYRNFCAFHRSYMLMEKLFKI  68

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             +VYE+G+PP+ HYGPCK+ Y+ EG F+  M+  ++FRT +P +A  YFLPFS+ ++ + +
Sbjct  69    FVYEEGEPPLFHYGPCKNIYSTEGLFLSLMETNTKFRTFNPHEAVAYFLPFSVVMIIEHL  128

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             + P   D + ++ T +DYV  ++  +PFWN S GADHF+LSCHDWGP  ++    L+ NS
Sbjct  129   FHPVIRDKAVLERTIVDYVRIISHNHPFWNTSHGADHFMLSCHDWGPRATWYERQLYFNS  188

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNANTSE F+PKKD S+P I L +G T GL+GG SPS R +L F+A     P   +
Sbjct  189   IRVLCNANTSEYFNPKKDASLPAINLITGETTGLVGGLSPSNRTILAFFAENYVLPFSDV  248

Query  1382  L  1384
             L
Sbjct  249   L  249



>ref|XP_008227680.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=505

 Score =   452 bits (1164),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 215/391 (55%), Positives = 284/391 (73%), Gaps = 6/391 (2%)
 Frame = +2

Query  629   DDTEDSRKSK-RYTYTNMERIEADLARARASILRgggggTQT---KDDDSVPVGPMYRNA  796
             DD E + K+  + + + ++++EA L RAR+SI        +T   +D D VP GP+YRN 
Sbjct  103   DDDEGANKTVFKSSSSQLDKLEASLGRARSSIREAAKVRNKTSTHQDPDYVPRGPIYRNP  162

Query  797   SFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKA  973
             + F RSY EMEK  K+YVYE+G+ P+ H GPC+S Y+ EG FIH M+  + +RT DPDKA
Sbjct  163   NAFHRSYLEMEKLFKIYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGNMYRTRDPDKA  222

Query  974   HLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHD  1153
              +YFLPFS+  + + +Y P+S+D   MK+  +DYVN +A+K+ FWNRSLGADHF+LSCHD
Sbjct  223   LVYFLPFSVVRMVQYMYMPDSNDRHGMKLAIIDYVNLIAQKHSFWNRSLGADHFMLSCHD  282

Query  1154  WGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRP  1333
             W P  +  +P L + SIR LCNANTSE F+P KD S PEI L +    GL GG SPS R 
Sbjct  283   WAPLTTSFVPLLFHKSIRILCNANTSEGFNPSKDASFPEINLKTSEMSGL-GGQSPSTRS  341

Query  1334  VLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVAS  1513
              L F+AG LHG +R +LL  W+ KD+DVQV+  LP GVSY  M++ S++C+CPSGYEVAS
Sbjct  342   TLAFFAGRLHGHIRSLLLNEWKGKDQDVQVYDKLPPGVSYEKMLKGSKFCLCPSGYEVAS  401

Query  1514  PRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRM  1693
             PR+VEA+Y  C+PVLI  GY+ PFSDVL+W++F+V +PV++I N+K IL  IS  QY+RM
Sbjct  402   PRVVEAIYAECIPVLISDGYIPPFSDVLDWKSFSVQVPVKNISNIKNILMSISSGQYLRM  461

Query  1694  QRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             QRR  +V+RHF VN PPKR+DVFHMI+HSIW
Sbjct  462   QRRVKQVQRHFLVNGPPKRYDVFHMIVHSIW  492



>ref|XP_008227726.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=542

 Score =   453 bits (1166),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/419 (53%), Positives = 291/419 (69%), Gaps = 9/419 (2%)
 Frame = +2

Query  542   NNVTGDSRPILLAPETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASI  721
             NN  G   P   AP+    DDE Q  I+     +  +    + + +E++EA L RAR+SI
Sbjct  116   NNQRGAPAP---APQIFGVDDEVQETITQQVGPNKTRFMSGS-SQLEKLEASLGRARSSI  171

Query  722   LRgggggTQT---KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPC  892
                     +    +D D VP GP+YRN + F RSY EME   K+YVYE+G+ P+ H GPC
Sbjct  172   REAANVRNKISTHQDPDYVPRGPIYRNPNAFHRSYLEMENLFKIYVYEEGEVPIFHDGPC  231

Query  893   KSTYAIEGNFIHAMD-FSRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITAL  1069
             +S Y+ EG FIH M+  + +RT DPDKA +YFLPFS+  + + +Y P+S D   MK+  +
Sbjct  232   RSIYSSEGRFIHEMEKGNMYRTRDPDKALVYFLPFSVARMVRYMYVPDSKDRHGMKLAII  291

Query  1070  DYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPK  1249
             DYVN +A+K+PFWNRSLGADHF+LSCHDWGP  +  +P L +NSIR LCNANTSE F+P 
Sbjct  292   DYVNLIAQKHPFWNRSLGADHFMLSCHDWGPFTTSFVPLLFHNSIRVLCNANTSEGFNPS  351

Query  1250  KDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHS  1429
             KD S PEI L +    GL GG  PS R  L F+AGGLHG +R +LL  W+ KD DV+V+ 
Sbjct  352   KDSSFPEINLKTSEMSGL-GGQPPSSRSTLAFFAGGLHGHIRSLLLNEWKGKDRDVRVYE  410

Query  1430  YLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEA  1609
              LP+GVSY  M++ S++C+CPSGYEVASPR+VEA+Y  C+PVLI  GY+ PFSDVL+W+ 
Sbjct  411   KLPRGVSYEKMLKGSKFCLCPSGYEVASPRVVEAIYAECIPVLISDGYIPPFSDVLDWKT  470

Query  1610  FAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             F+V +PV++I ++K IL  IS RQY+R QRR  +V+RHF VN PPKR+DVFHMI+HSIW
Sbjct  471   FSVQVPVKNISDIKNILMSISSRQYLRTQRRVKEVQRHFLVNGPPKRYDVFHMIVHSIW  529



>ref|XP_002320537.2| hypothetical protein POPTR_0014s16900g [Populus trichocarpa]
 gb|EEE98852.2| hypothetical protein POPTR_0014s16900g [Populus trichocarpa]
Length=461

 Score =   450 bits (1158),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 210/375 (56%), Positives = 276/375 (74%), Gaps = 5/375 (1%)
 Frame = +2

Query  677   MERIEADLARARASILRgggggTQTK----DDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             +ER+EA LA ARA I         T     D D +P G +YRNA  F RSY  MEK  K+
Sbjct  77    LERVEAGLAMARALIREAAEDNNCTSSLHDDLDYIPRGYIYRNACAFHRSYLLMEKLFKI  136

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             +VYE+G+PP+ HYG CK  Y++EG F+  M+  ++FRT++PD+AH+YFLPFS+ ++ + +
Sbjct  137   FVYEEGEPPLFHYGTCKDIYSMEGVFLSLMETNTKFRTSNPDEAHVYFLPFSVVMIIEHL  196

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             + P   D + ++ T  DYV  ++ KY +WNRSLGADHF+LSCHDWGP  ++ +  L+ NS
Sbjct  197   FHPIIRDKAVLERTVSDYVRIISHKYLYWNRSLGADHFMLSCHDWGPRATWYVRQLYYNS  256

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNANTSE F+PKKD S PEI L +G   GL GG  PS R VL F+AG +HG +RP 
Sbjct  257   IRVLCNANTSEYFNPKKDASFPEINLKTGEITGLTGGLPPSNRTVLAFFAGKMHGKLRPA  316

Query  1382  LLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             LLQHW  KD+DVQV+  LP+G+SY+ MM+KS+YCICPSG+EVASPR+ EA+Y  CVPVLI
Sbjct  317   LLQHWMGKDKDVQVYETLPQGISYHEMMKKSKYCICPSGHEVASPRIAEAIYAECVPVLI  376

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
              + Y+ PFSDVLNW++F + +PV +IPNLK IL GI + QY+RMQ R  +V+RHF VN+P
Sbjct  377   SQHYIFPFSDVLNWDSFTIQVPVTEIPNLKNILEGIPEDQYLRMQERVRQVQRHFVVNNP  436

Query  1742  PKRFDVFHMILHSIW  1786
             P+R+DVFHMI+HSIW
Sbjct  437   PRRYDVFHMIIHSIW  451



>ref|XP_010246563.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At5g03795 [Nelumbo nucifera]
Length=494

 Score =   451 bits (1161),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 213/377 (56%), Positives = 268/377 (71%), Gaps = 5/377 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQ--TKDDDSVPVGPMYRNASFFLRSYAEMEKTLK  841
             ++ ++R+EA+LARARA I +     T      +D +P G +Y NA  F RSY EMEK  K
Sbjct  109   HSKLQRLEANLARARALIRKASQNQTSPLQSGEDYIPQGTIYHNAHEFHRSYLEMEKLFK  168

Query  842   VYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR--FRTTDPDKAHLYFLPFSITVLSK  1015
             ++VYEDG PP+ H GPCK  Y+ EG FIH ++ ++   RT DP +A +YFLP SI    +
Sbjct  169   IFVYEDGDPPLFHNGPCKGIYSTEGRFIHQIEINKQFLRTRDPARALVYFLPISIARSVQ  228

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
             L+Y P+S D  P+K     YVN++A KYP+WNRSLGADHF+ SCHDWGP IS  IP LH 
Sbjct  229   LLYVPDSRDIGPIK-RXCHYVNAIAAKYPYWNRSLGADHFLFSCHDWGPLISAYIPYLHQ  287

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             NSIR LCNANTSE F+P +DVS PEI L  G     LGG  P  R +L F+AG  HG VR
Sbjct  288   NSIRVLCNANTSEGFNPSRDVSFPEINLRRGDISAFLGGLPPQARQILAFFAGKQHGHVR  347

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
              +L +HW++KDE++QV+ +LP+G+SY  MMR+S YC+CPSGYEVASPR+ EA+Y  CVPV
Sbjct  348   LLLFEHWKDKDEELQVYEHLPRGISYREMMRRSNYCLCPSGYEVASPRVAEAIYAECVPV  407

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI   YV PFSDVLNW++F+V + V DIPNLK IL G S+ QYIRMQ R  +V++HF VN
Sbjct  408   LISDHYVPPFSDVLNWKSFSVQVQVRDIPNLKSILMGTSEAQYIRMQARVKQVQKHFIVN  467

Query  1736  SPPKRFDVFHMILHSIW  1786
              PP RFD FHM +HSIW
Sbjct  468   DPPTRFDAFHMTIHSIW  484



>gb|KEH35655.1| exostosin family protein [Medicago truncatula]
Length=495

 Score =   451 bits (1161),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 213/386 (55%), Positives = 278/386 (72%), Gaps = 4/386 (1%)
 Frame = +2

Query  641   DSRKSKRYTYTNMERIEADLARARASILRgggggTQT---KDDDSVPVGPMYRNASFFLR  811
             D    + + Y+ +E+IE+ LA+AR SI         T   +D D VP GP+YRN + F R
Sbjct  98    DKVNVRDHKYSKLEKIESKLAKARYSIKEASKVQNLTSTHQDQDYVPQGPIYRNPNAFHR  157

Query  812   SYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRF-RTTDPDKAHLYFL  988
             SY EMEK  K++VYE+G+PP+ H G  K  Y+ EG FI+ M+  R+ RT DP++A +YFL
Sbjct  158   SYLEMEKVFKIFVYEEGEPPLFHNGLSKDIYSTEGIFINEMEKGRYYRTNDPNEAFVYFL  217

Query  989   PFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEI  1168
             PFS+ ++ + +Y   S+D +P+ +T  DY++ ++ KYPFWN+SLG DHF+LSCHDWGP+ 
Sbjct  218   PFSVVMMVEYLYVGGSNDKTPIGVTVKDYIHVISHKYPFWNQSLGHDHFMLSCHDWGPDA  277

Query  1169  SFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFY  1348
             S    NL NNSIR LCNANTSE F P KD S PE+ L  G    L+GG SPS+R +L F+
Sbjct  278   SAYEDNLFNNSIRVLCNANTSEGFKPAKDASFPEMFLKKGEITNLVGGYSPSRRTILAFF  337

Query  1349  AGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVE  1528
             AG LHG +R +LL  W+NKD+DVQV+  LP   SY+  +R S++C+CPSGYEVASPR+VE
Sbjct  338   AGHLHGYIRYLLLDTWKNKDQDVQVYEELPDEDSYHTKLRSSKFCLCPSGYEVASPRIVE  397

Query  1529  ALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGV  1708
             A++  CVPVLI   YV PFSDVLNW+AF+V I V+DIPN+K IL GISQRQY++MQRR  
Sbjct  398   AIFAECVPVLISDSYVPPFSDVLNWKAFSVQIDVKDIPNIKNILMGISQRQYLKMQRRVK  457

Query  1709  KVRRHFEVNSPPKRFDVFHMILHSIW  1786
             +V+RHF  N PPKRFDVFHM +HSIW
Sbjct  458   QVQRHFVPNEPPKRFDVFHMTIHSIW  483



>ref|XP_007137813.1| hypothetical protein PHAVU_009G157700g [Phaseolus vulgaris]
 gb|ESW09807.1| hypothetical protein PHAVU_009G157700g [Phaseolus vulgaris]
Length=501

 Score =   450 bits (1158),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 215/408 (53%), Positives = 289/408 (71%), Gaps = 6/408 (1%)
 Frame = +2

Query  578   APETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQT--  751
             +PE   GD++         T D    K + ++ + RIE +LA+AR SI         T  
Sbjct  84    SPEFNEGDEKLDTNFVQKGT-DKENLKGHKHSKLRRIEKNLAKARYSIREASKIRNLTST  142

Query  752   -KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIH  928
              +D D VP GP+YRNA+ F RSY EMEK  KV+VYE+G+PP+ H G  K  YA EG FI+
Sbjct  143   LQDPDYVPQGPIYRNANAFHRSYLEMEKVFKVFVYEEGEPPLFHNGLSKDIYATEGRFIN  202

Query  929   AMDFSR-FRTTDPDKAHLYFLPFSITVLSKLVYEPNS-HDWSPMKITALDYVNSVARKYP  1102
              M+  R +RT DPD+A +++LPFS+ +L + VY+  S ++  P+ +   DY+ +++ K+P
Sbjct  203   EMEKGRHYRTYDPDEAFVFYLPFSVVMLVEYVYDRGSNYNLDPLGLVVKDYIQTISYKHP  262

Query  1103  FWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLP  1282
             FWNRSLG DHF+LSCHDWGP +S  +  L+NN+IR LCNANTSE F P KDVS PEI L 
Sbjct  263   FWNRSLGHDHFMLSCHDWGPIVSSYVDLLYNNAIRVLCNANTSEGFKPAKDVSFPEIKLM  322

Query  1283  SGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGM  1462
              G   GL+GG  PS+R +L F+AG LHG +R +LL  W+NKD+DVQV+  +P+G+SY   
Sbjct  323   RGEVTGLVGGYPPSQRTILAFFAGHLHGYIRYLLLHTWKNKDQDVQVYEEIPEGISYYTK  382

Query  1463  MRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIP  1642
             +R S++C+CPSGYEVASPR+VEA++  CVPVLI   YV PFSDVLNW +F+V + V++IP
Sbjct  383   LRSSKFCLCPSGYEVASPRIVEAIFAECVPVLISDSYVPPFSDVLNWNSFSVQVAVKEIP  442

Query  1643  NLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             N+KKIL GIS+RQY+RMQRR  +V+RHF  N PP+R+D+FHM +HSIW
Sbjct  443   NIKKILMGISERQYLRMQRRVKQVQRHFMPNEPPERYDMFHMTVHSIW  490



>ref|XP_011100587.1| PREDICTED: probable glycosyltransferase At3g07620 [Sesamum indicum]
Length=548

 Score =   452 bits (1162),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 211/382 (55%), Positives = 274/382 (72%), Gaps = 6/382 (2%)
 Frame = +2

Query  659   RYTYTNMERIEADLARARASILRgggggTQTKDD-----DSVPVGPMYRNASFFLRSYAE  823
             R  Y   E++EA LA+AR SI        ++        D VP GP+Y NA+ F RSY E
Sbjct  155   RIRYGRSEKVEAILAKARYSIREAARNNNRSFISSSSGSDYVPQGPIYFNANAFYRSYTE  214

Query  824   MEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSI  1000
             MEK  K+YVYE+G+ P+ H GPC+S Y  EG FIH M+    +RT D ++AH+YF+PFS+
Sbjct  215   MEKVFKIYVYEEGEAPIFHGGPCRSIYTTEGRFIHEMERGELYRTRDAEEAHVYFMPFSV  274

Query  1001  TVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAI  1180
               + + +YEP + D   M  T  DYV+++A  +PFWNRSLGADHF+LSCHDWGP  S  +
Sbjct  275   VAMVQYLYEPGAVDMDAMGNTLADYVHTIAHNHPFWNRSLGADHFMLSCHDWGPYTSSYV  334

Query  1181  PNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGL  1360
             P L NNSIR LCNANTSE F+P KD ++PEI L  G   GLLGGP PS+R +L F+AGGL
Sbjct  335   PLLFNNSIRVLCNANTSEGFNPIKDATLPEINLKFGEITGLLGGPPPSERSILAFFAGGL  394

Query  1361  HGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYM  1540
             HG +R ILL HW+ KD D++V+  LP  VSY  M++ S++C+CPSGYEVASPR+VEA+Y 
Sbjct  395   HGDIRHILLDHWKEKDPDIRVYEKLPPNVSYEAMLKNSKFCLCPSGYEVASPRIVEAIYS  454

Query  1541  GCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRR  1720
              CVPVLI   YV PFSDVLNW+ F++++ VEDIPN+K IL GIS+ +Y++MQ R  +V+R
Sbjct  455   ECVPVLISDHYVPPFSDVLNWKKFSIVVGVEDIPNIKTILMGISRAKYLKMQMRVKQVQR  514

Query  1721  HFEVNSPPKRFDVFHMILHSIW  1786
             HF +N  PKRFD+FHMI+HS+W
Sbjct  515   HFVLNGTPKRFDLFHMIVHSVW  536



>emb|CDP15733.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   449 bits (1156),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 212/377 (56%), Positives = 272/377 (72%), Gaps = 21/377 (6%)
 Frame = +2

Query  668   YTNMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTL  838
             Y  +ER+E  L++AR SI    + G   +  +D D  P GPMY NA+ F RS+ EMEK+ 
Sbjct  123   YNKLERLETILSKARYSIREAAKNGSMISTHEDADYAPHGPMYINANGFHRSHLEMEKSF  182

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRF-RTTDPDKAHLYFLPFSITVLSK  1015
             KVYVYE+G+PP+ H GPCKS Y+ EG FIH M+   F RT +PD A +YFLPFS+  + +
Sbjct  183   KVYVYEEGEPPMFHDGPCKSIYSTEGRFIHEMEKGNFYRTKNPDDALVYFLPFSVVAMVQ  242

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              +YEP  HD   +  T  DY+  ++ K+PFWN+S GADHF+LSCHDW             
Sbjct  243   YLYEPGGHDRQAIGHTLADYIGLISGKHPFWNQSFGADHFMLSCHDW-------------  289

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
                  LCNANTSE F+P KDVS+PEI L +G   GL+GGPSPS+RP+L F+AG LHG +R
Sbjct  290   ----ILCNANTSEGFNPLKDVSLPEIHLRTGEITGLIGGPSPSRRPILAFFAGRLHGHIR  345

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
              +LL+ W+ KD+D+QV+  LP GVSY  M+RKS++C+CPSGYEVASPR+VEA+Y  C+P+
Sbjct  346   YLLLEQWKEKDQDIQVYDNLPAGVSYESMLRKSKFCLCPSGYEVASPRVVEAIYAECIPI  405

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI   YV PFSDVLNW++F+V + V+DIPN+KKILT ISQ QYIRM RR  +V+RHF +N
Sbjct  406   LISDSYVPPFSDVLNWKSFSVEVAVKDIPNIKKILTSISQTQYIRMHRRLKQVQRHFVIN  465

Query  1736  SPPKRFDVFHMILHSIW  1786
              PPKRFD+FHMILHSIW
Sbjct  466   GPPKRFDLFHMILHSIW  482



>ref|XP_003555678.1| PREDICTED: probable glycosyltransferase At3g07620-like [Glycine 
max]
Length=493

 Score =   449 bits (1154),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 209/391 (53%), Positives = 283/391 (72%), Gaps = 14/391 (4%)
 Frame = +2

Query  632   DTEDSRKSKRYTYTNMERIEADLARARASI-----LRgggggTQTKDDDSVPVGPMYRNA  796
               ED RK        +E++EA LA+ARA I     LR      Q    D +P G +YRNA
Sbjct  102   QIEDDRK--------LEKVEASLAKARALIKEALLLRTNATVLQDDTSDYIPEGDIYRNA  153

Query  797   SFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKA  973
               F RSY  MEK  K++VYE+G+PP+ HYGPCK+ Y++EG FI++++  S+FRT +PD+A
Sbjct  154   VAFHRSYQLMEKVFKIFVYEEGEPPLFHYGPCKNIYSMEGIFINSLEINSQFRTQNPDEA  213

Query  974   HLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHD  1153
             H+YFLPFS+ ++ + ++ P   D + ++ T  DYV+ ++ KY +WNRS GADHF+LSCHD
Sbjct  214   HVYFLPFSVVMILEHLFHPVIRDKAVLERTIGDYVHIISHKYKYWNRSYGADHFMLSCHD  273

Query  1154  WGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRP  1333
             WGP  ++ +  L+  +IR LCNAN SE F+PKKD S PEI L +G T+GL+GG  P  R 
Sbjct  274   WGPRATWYVKELYFIAIRVLCNANISEHFNPKKDASFPEINLVNGETRGLIGGYPPCNRT  333

Query  1334  VLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVAS  1513
             +L F+AG +HG +RP+L QHWE KD+DV V+  LP GV Y+  M+KS+YCICPSG+EVAS
Sbjct  334   ILAFFAGQMHGRIRPVLFQHWEGKDKDVLVYEKLPDGVPYHETMKKSKYCICPSGFEVAS  393

Query  1514  PRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRM  1693
             PR+VEA+Y  CVPV+I + YV PFSDVLNW++F+V I V D+P LK+IL GIS+ +Y+R+
Sbjct  394   PRIVEAIYAQCVPVIISQQYVLPFSDVLNWDSFSVQILVSDVPKLKEILLGISEDKYMRL  453

Query  1694  QRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             Q    +V+RHF VN+PPKR+DVFHMI+HSIW
Sbjct  454   QEGVKQVQRHFVVNNPPKRYDVFHMIIHSIW  484



>gb|AGV54221.1| glycosyltransferase [Phaseolus vulgaris]
Length=490

 Score =   449 bits (1154),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 219/373 (59%), Positives = 274/373 (73%), Gaps = 8/373 (2%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYV  850
             T ++ IE  LA+ARA+I R    GT T D D VP GPMY NA  F RSY EMEK  KV+ 
Sbjct  108   TILDNIEIGLAQARAAI-REARNGTGTPDSDYVPKGPMYWNAKAFHRSYLEMEKQFKVFS  166

Query  851   YEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             Y +G+PP  H  PCKS Y++EGNF+HA++ +  FRT DP++AH++FLP         VYE
Sbjct  167   YGEGEPPNFHNAPCKSKYSMEGNFMHAIEMNNHFRTKDPEEAHVFFLP-----KGGYVYE  221

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
               S D+ P+K TA DYV+++A +YP+ NR+L A HF L+CHD     S ++P  H NSIR
Sbjct  222   GISQDFGPVKKTATDYVSAIAARYPYGNRNLEAKHFTLACHDMCRGTSLSLPTPHKNSIR  281

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
              LCNANTSE F P KDVS PEI L   + +  +GG S SKR +L F+AGG+HGP+ P+LL
Sbjct  282   VLCNANTSEGFKPAKDVSFPEINLKISSIR-FIGGQSASKRSILTFFAGGVHGPIAPVLL  340

Query  1388  QHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             +HWENKDED+Q+  YLPKG+SY  MMRKS++C+CPSGYE ASPR+VEA+Y GCVPV I  
Sbjct  341   KHWENKDEDIQILKYLPKGISYYEMMRKSKFCLCPSGYEGASPRVVEAIYTGCVPVFISE  400

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
               V PFSDVLNW++F+V I V+DIPNLK+IL  I  +QYIRMQRR  ++ RHFEV+SPPK
Sbjct  401   HSVPPFSDVLNWKSFSVEISVKDIPNLKEILMSIPPKQYIRMQRRVEQIGRHFEVHSPPK  460

Query  1748  RFDVFHMILHSIW  1786
             RFDVFHMILHS+W
Sbjct  461   RFDVFHMILHSVW  473



>gb|KHN15414.1| Putative glycosyltransferase [Glycine soja]
Length=493

 Score =   449 bits (1154),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 209/391 (53%), Positives = 283/391 (72%), Gaps = 14/391 (4%)
 Frame = +2

Query  632   DTEDSRKSKRYTYTNMERIEADLARARASI-----LRgggggTQTKDDDSVPVGPMYRNA  796
               ED RK        +E++EA LA+ARA I     LR      Q    D +P G +YRNA
Sbjct  102   QIEDDRK--------LEKVEASLAKARALIKEALLLRTNATVLQDDTSDYIPEGDIYRNA  153

Query  797   SFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKA  973
               F RSY  MEK  K++VYE+G+PP+ HYGPCK+ Y++EG FI++++  S+FRT +PD+A
Sbjct  154   VAFHRSYQLMEKVFKIFVYEEGEPPLFHYGPCKNIYSMEGIFINSLEINSQFRTQNPDEA  213

Query  974   HLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHD  1153
             H+YFLPFS+ ++ + ++ P   D + ++ T  DYV+ ++ KY +WNRS GADHF+LSCHD
Sbjct  214   HVYFLPFSVVMILEHLFHPVIRDKAVLERTIGDYVHIISHKYKYWNRSYGADHFMLSCHD  273

Query  1154  WGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRP  1333
             WGP  ++ +  L+  +IR LCNAN SE F+PKKD S PEI L +G T+GL+GG  P  R 
Sbjct  274   WGPRATWYVKELYFIAIRVLCNANISEHFNPKKDASFPEINLVNGETRGLIGGYPPCNRT  333

Query  1334  VLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVAS  1513
             +L F+AG +HG +RP+L QHWE KD+DV V+  LP GV Y+  M+KS+YCICPSG+EVAS
Sbjct  334   ILAFFAGQMHGRIRPVLFQHWEGKDKDVLVYEKLPDGVPYHETMKKSKYCICPSGFEVAS  393

Query  1514  PRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRM  1693
             PR+VEA+Y  CVPV+I + YV PFSDVLNW++F+V I V D+P LK+IL GIS+ +Y+R+
Sbjct  394   PRIVEAIYAQCVPVIISQQYVLPFSDVLNWDSFSVQILVSDVPKLKEILLGISEDKYMRL  453

Query  1694  QRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             Q    +V+RHF VN+PPKR+DVFHMI+HSIW
Sbjct  454   QEGVKQVQRHFVVNNPPKRYDVFHMIIHSIW  484



>gb|AAU04753.1| EXO [Cucumis melo]
Length=343

 Score =   442 bits (1138),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 205/331 (62%), Positives = 253/331 (76%), Gaps = 1/331 (0%)
 Frame = +2

Query  797   SFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRFRTT-DPDKA  973
             S   RSY EME+ LK+YVY++G+PP+ H GPCKS Y+ EG FIH M+     TT DPD+A
Sbjct  3     SVMCRSYLEMERLLKIYVYKEGEPPMFHGGPCKSIYSTEGRFIHEMEKGNLYTTNDPDQA  62

Query  974   HLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHD  1153
              LYFLPFS+  L + +Y PNSH+ + +     DY+N +++K+PFW+RSLGADHF+LSCHD
Sbjct  63    LLYFLPFSVVNLVQYLYVPNSHEVNAIGRAITDYINVISKKHPFWDRSLGADHFMLSCHD  122

Query  1154  WGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRP  1333
             WGP  +  +P L NNSIR LCNAN SE F P KD S PEI L +G   GL+GG SPS+R 
Sbjct  123   WGPRTTSYVPLLFNNSIRVLCNANVSEGFLPSKDASFPEIHLRTGEIDGLIGGLSPSRRS  182

Query  1334  VLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVAS  1513
             VL F+AG LHG +R +LLQ W+ KDEDV V+  LP G+SYN M++KSR+C+CPSGYEVAS
Sbjct  183   VLAFFAGRLHGHIRYLLLQEWKEKDEDVLVYEELPSGISYNSMLKKSRFCLCPSGYEVAS  242

Query  1514  PRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRM  1693
             PR+VEA+Y  CVPVLI   YV PFSDVLNW++F+V I V+DIPN+KKIL GISQ QY+RM
Sbjct  243   PRVVEAIYAECVPVLISESYVPPFSDVLNWKSFSVQIQVKDIPNIKKILKGISQTQYLRM  302

Query  1694  QRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             QRR  +V+RHF +N  PKRFD FHMILHSIW
Sbjct  303   QRRVKQVQRHFALNGTPKRFDAFHMILHSIW  333



>ref|XP_004503012.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=488

 Score =   446 bits (1147),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 212/377 (56%), Positives = 274/377 (73%), Gaps = 4/377 (1%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQT---KDDDSVPVGPMYRNASFFLRSYAEMEKTL  838
             YT +ERIE+ L +AR SI         T   +D D VP GP+YRNA  F RSY EMEK  
Sbjct  100   YTQLERIESKLVKARYSIKEASKVRNLTSTHQDQDYVPHGPIYRNAKAFHRSYLEMEKIF  159

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRF-RTTDPDKAHLYFLPFSITVLSK  1015
             K++VYE+G+PP+ H G  K+ Y+ EG FI+ M+  R+ RT DPD+A +YFLPFS+ ++ +
Sbjct  160   KIFVYEEGEPPMFHNGLSKNIYSTEGRFINEMEKWRYYRTNDPDEAFVYFLPFSVVMMVE  219

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              +Y   S+D S + ++  DY++ ++ KYPFWN+SLG DHF+LSCHDWGP  S  + NL N
Sbjct  220   YLYVHGSNDRSSIGLSVQDYIHIISHKYPFWNQSLGHDHFMLSCHDWGPIASAYVDNLFN  279

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             NSIR LCNAN SE F P KDVS PE+ L +G   GL+GG  PS+R  L F+AG LHG +R
Sbjct  280   NSIRVLCNANISEGFKPSKDVSFPEMNLKTGEVTGLVGGYPPSQRTTLAFFAGHLHGHIR  339

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
              +LL  W+NKD+DVQV+  LP   SYN  +R S++C+CPSGYEVASPR+VEA++  CVPV
Sbjct  340   YLLLNTWKNKDQDVQVYDELPHEDSYNTKLRSSKFCLCPSGYEVASPRIVEAIFAECVPV  399

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI   YV PFSDVLNW++F+V I V++IPN+KKIL GISQRQY++MQ R  +V+RHF  N
Sbjct  400   LISDNYVPPFSDVLNWKSFSVQIDVKEIPNIKKILMGISQRQYLKMQGRVKQVQRHFVPN  459

Query  1736  SPPKRFDVFHMILHSIW  1786
              PP+RFDVFHM +HSIW
Sbjct  460   EPPERFDVFHMTIHSIW  476



>gb|AGZ15405.1| limonene cyclase-like protein [Phaseolus vulgaris]
Length=491

 Score =   446 bits (1147),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 229/422 (54%), Positives = 286/422 (68%), Gaps = 29/422 (7%)
 Frame = +2

Query  542   NNVTGDSRPILLAPETGIGDD------ERQNGISSDDTEDSRKSKRYTYTNMERIEADLA  703
              ++  D   +L A ET + +       + QNG S               T ++ IE  LA
Sbjct  75    QSINLDETKVLNAFETSVNESSEPHLPQEQNGES---------------TILDNIEIGLA  119

Query  704   RARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHY  883
             +ARA+I R    GT T D D VP GPMY NA  F RSY EMEK  KV+ Y +G+PP  H 
Sbjct  120   QARAAI-REARNGTGTPDSDYVPKGPMYWNAKAFHRSYLEMEKQFKVFSYGEGEPPNFHN  178

Query  884   GPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKI  1060
              PCKS Y++EGNF+HA++ +  FRT DP++AH++FLP          YE  S D SP+K 
Sbjct  179   APCKSKYSMEGNFMHAIEMNNHFRTKDPEEAHVFFLP-----KGGYGYERVSQDLSPVKK  233

Query  1061  TALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERF  1240
             TA DYVN +A +Y +WNRSLGAD F L+CHD     SF++P  H NS R LCNANTSE F
Sbjct  234   TATDYVNVIAARYLYWNRSLGADPFTLACHDMCRGKSFSLPYPHKNSFRVLCNANTSEGF  293

Query  1241  DPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQ  1420
              P KDVS PEI L   + +  +GG S  KR +L F+AGG+HGP+ P+L +HWENKDED+Q
Sbjct  294   KPAKDVSFPEINLKISSIR-FIGGQSAFKRSILTFFAGGVHGPIAPVLFKHWENKDEDIQ  352

Query  1421  VHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLN  1600
             +  YLPKG+SY  MMRKS++C+CPSGYE ASPR+VEA+Y GCVPV I    V PFSDVLN
Sbjct  353   ILKYLPKGISYYEMMRKSKFCLCPSGYEGASPRVVEAIYTGCVPVFIFEHSVPPFSDVLN  412

Query  1601  WEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHS  1780
             W++F+V I V+DIPNLK+IL  I  +QYIRMQRR  ++ RHFEV+SPPKRFDVFHMILHS
Sbjct  413   WKSFSVEISVKDIPNLKEILMSIPPKQYIRMQRRVEQIGRHFEVHSPPKRFDVFHMILHS  472

Query  1781  IW  1786
             +W
Sbjct  473   VW  474



>ref|XP_009379541.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=536

 Score =   446 bits (1147),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 204/376 (54%), Positives = 275/376 (73%), Gaps = 5/376 (1%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQT---KDDDSVPVGPMYRNASFFLRSYAEMEKTLK  841
             + ++++EA L+RAR++I        +T   +D D VP GP+Y N + F RSY EME   K
Sbjct  149   SQLDKVEASLSRARSAIREAAKVRNKTSTHQDPDYVPRGPIYHNPNAFHRSYLEMENVFK  208

Query  842   VYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYFLPFSITVLSKL  1018
             +YVYE+G+ P+ H GPC+S Y+ EG FIH M+  + +RT DP KA +YFLPFS+  + + 
Sbjct  209   IYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGKLYRTKDPHKALVYFLPFSVVNMVQY  268

Query  1019  VYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNN  1198
             +Y P + D S MK+  +DY+N ++ K+PFWNRS GADHF+LSCHDWGP  +  +P+L +N
Sbjct  269   IYMPETFDLSGMKLAVVDYINLISHKHPFWNRSHGADHFMLSCHDWGPLTTSFVPDLFHN  328

Query  1199  SIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRP  1378
             SIR +CNANTSE F+P KD S+PEI L +    G+ GG  PSKR  L FYAGG HG +R 
Sbjct  329   SIRVMCNANTSEGFNPSKDASLPEINLKTSEMSGI-GGQPPSKRSTLAFYAGGQHGHIRY  387

Query  1379  ILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVL  1558
             +LL  W+ K++DV V+  LP+G+SY  M +  ++C+CPSGYEVASPR+VEA+Y  CVPVL
Sbjct  388   LLLNEWKGKEQDVLVYDKLPQGMSYENMFKSGKFCLCPSGYEVASPRVVEAIYAECVPVL  447

Query  1559  IKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNS  1738
             I  GYV PFSDVLNW +F+V +PV++I ++K ILT IS RQY+RMQRR  +V+RHF VN 
Sbjct  448   ISDGYVPPFSDVLNWNSFSVQVPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLVNG  507

Query  1739  PPKRFDVFHMILHSIW  1786
             PPKR+DVFHM+++SIW
Sbjct  508   PPKRYDVFHMLVYSIW  523



>ref|XP_002524592.1| catalytic, putative [Ricinus communis]
 gb|EEF37800.1| catalytic, putative [Ricinus communis]
Length=388

 Score =   441 bits (1133),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 204/375 (54%), Positives = 274/375 (73%), Gaps = 5/375 (1%)
 Frame = +2

Query  677   MERIEADLARARASILRgggg----gTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             +ER+EA LA ARA I           +  KD D VP G +YRN+  F RSY  MEK  K+
Sbjct  4     LERLEAGLAMARALIKEASSLDQNYTSLHKDIDYVPHGDIYRNSCAFHRSYLLMEKLFKI  63

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             +VYE+G+PP+ HYGPCK+ Y++EG F+  M+  ++FRT +PD+A ++FLPFS+ ++ + +
Sbjct  64    FVYEEGEPPLLHYGPCKNIYSMEGLFLSLMETDTKFRTLNPDEAQVFFLPFSVVMIIEHL  123

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             + P   D + ++ T +DYV  ++ KY +WNRSLGADHF+LSCHDWGP  ++    L+ NS
Sbjct  124   FHPIIRDKAVLERTVVDYVRIISHKYTYWNRSLGADHFMLSCHDWGPRATWYERQLYFNS  183

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNANTSE F+PKKD S PEI L +G    L GG  PS R +L F++G +HG +RP+
Sbjct  184   IRVLCNANTSEYFNPKKDASFPEINLITGEIADLTGGLPPSNRTILAFFSGKMHGKLRPL  243

Query  1382  LLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             L QHW+ KD+DV V+   P+G+SY  MM+KSRYCICPSG+EVASPR+VEA+Y  CVPVLI
Sbjct  244   LFQHWKEKDKDVLVYETFPEGLSYQEMMKKSRYCICPSGHEVASPRIVEAIYAECVPVLI  303

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
              + YV PFSDVLNWE+F++ + V DI NLK IL GI + QY+RM+ R  +V++HF +N+P
Sbjct  304   SQNYVFPFSDVLNWESFSIQVSVSDISNLKNILLGIPEDQYLRMRERVKQVQQHFLINNP  363

Query  1742  PKRFDVFHMILHSIW  1786
             PKR+DVFHMI+HSIW
Sbjct  364   PKRYDVFHMIIHSIW  378



>ref|XP_004305861.1| PREDICTED: probable glycosyltransferase At3g07620-like [Fragaria 
vesca subsp. vesca]
Length=465

 Score =   442 bits (1136),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 204/376 (54%), Positives = 276/376 (73%), Gaps = 5/376 (1%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQT---KDDDSVPVGPMYRNASFFLRSYAEMEKTLK  841
              N+ERIEA LA AR  ++R      QT   +D D VP G +YRNA  F RSY  ME   +
Sbjct  81    VNLERIEAGLATAR-ELIREATTLNQTSPLEDADYVPNGDIYRNAYAFHRSYLLMESLFR  139

Query  842   VYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKL  1018
              +VYE+G+PP+ H GPCK+ Y++EG F+  M+  ++FRT+DP++AH+YFLPFS+ ++ + 
Sbjct  140   TFVYEEGEPPIFHNGPCKNIYSMEGLFLSFMETDTKFRTSDPEEAHVYFLPFSVVMIIEY  199

Query  1019  VYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNN  1198
             ++ P   D + ++ T +DYV  ++ KYPFWNRSLGADH +LSCHDWGP  ++ +  L+  
Sbjct  200   LFHPVIRDKAVLQRTVVDYVRVISNKYPFWNRSLGADHVMLSCHDWGPRATWYVRQLYFV  259

Query  1199  SIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRP  1378
             +IR LCNANTSE F+PKKD S PEI L +G   GL+GG  PSKR VL F+AG +HG +RP
Sbjct  260   AIRVLCNANTSEHFNPKKDASFPEINLVTGEITGLIGGLPPSKRSVLAFFAGRMHGRIRP  319

Query  1379  ILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVL  1558
             +L QHW+ KDE++ V+  LPK  SY  M+++S+YCICPSG+EVASPR+VEA+Y  CVPVL
Sbjct  320   LLFQHWKEKDENLLVYEKLPKNASYQDMLKQSKYCICPSGHEVASPRIVEAIYAECVPVL  379

Query  1559  IKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNS  1738
             I + YV PFSDVL+WE+F++ + V +IP LK+IL  I + +Y RMQ R  +V+ HF VN+
Sbjct  380   ISQHYVLPFSDVLDWESFSIQVSVSEIPQLKEILMRIPEEKYRRMQERVKQVQMHFVVNN  439

Query  1739  PPKRFDVFHMILHSIW  1786
             PPKR+DVFHMI+HSIW
Sbjct  440   PPKRYDVFHMIIHSIW  455



>ref|XP_008342266.1| PREDICTED: probable glycosyltransferase At3g07620 [Malus domestica]
Length=476

 Score =   442 bits (1136),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 218/446 (49%), Positives = 300/446 (67%), Gaps = 22/446 (5%)
 Frame = +2

Query  479   GVSRLPALVTTEEEI-DKGLHENNVTG--DSRPILLAPETG---IGDDERQNGISSDDTE  640
             G S+ P L T  + I D     N ++   D+  +   P+ G   IGD   Q      D  
Sbjct  35    GTSQFPWLGTGVDMISDSTFRINYISSYKDATRMKALPDLGRGYIGDSVPQRDWQKGDE-  93

Query  641   DSRKSKRYTYTNMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLR  811
                        N++++EA LA ARA I   ++     T  KD D +P G +YRNA  F R
Sbjct  94    -----------NLKKLEAGLAAARALIGEAIKNLNHTTPLKDADYIPKGDIYRNAYAFHR  142

Query  812   SYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFL  988
             SY  MEK  K+YVYE+G+ P+ H GPCK+ Y++EG F+  M+  ++FRT +P+ AH+YFL
Sbjct  143   SYLLMEKMFKIYVYEEGELPIFHNGPCKNIYSMEGLFLSFMETDTKFRTREPENAHVYFL  202

Query  989   PFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEI  1168
             PFS+ ++ + ++ P   D + ++ T +DYV  ++ +YP+WNRSLGADH +LSCHDWGP  
Sbjct  203   PFSVVMIVEYLFHPIIRDKAVLERTVVDYVRIISNRYPYWNRSLGADHVMLSCHDWGPRA  262

Query  1169  SFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFY  1348
             ++ +  L+  +IR LCNANTSE F+PKKD S PEI L +G   GL+GG  PSKR +L F+
Sbjct  263   TWYVKQLYFVAIRVLCNANTSEHFNPKKDASFPEINLETGEITGLIGGLHPSKRTILAFF  322

Query  1349  AGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVE  1528
             AG +HG +RP L +HW+ KD D+ V+  LP+ +SY+ M++KS+YCICPSG+EVASPR+VE
Sbjct  323   AGRMHGRIRPFLFEHWKGKDRDLLVYEKLPEELSYHDMLKKSKYCICPSGHEVASPRIVE  382

Query  1529  ALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGV  1708
             A+Y  CVPVLI + YV PFSDVLNW++F+V + V +IP LK+IL GI + QY RMQ R  
Sbjct  383   AIYADCVPVLISQHYVLPFSDVLNWDSFSVQVSVSEIPKLKEILMGIPEEQYRRMQERVK  442

Query  1709  KVRRHFEVNSPPKRFDVFHMILHSIW  1786
             +V+RHF VN+PPKR+DVFHMI+HSIW
Sbjct  443   QVQRHFVVNNPPKRYDVFHMIIHSIW  468



>ref|XP_006856554.1| hypothetical protein AMTR_s00046p00173940 [Amborella trichopoda]
 gb|ERN18021.1| hypothetical protein AMTR_s00046p00173940 [Amborella trichopoda]
Length=505

 Score =   442 bits (1138),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 206/373 (55%), Positives = 274/373 (73%), Gaps = 3/373 (1%)
 Frame = +2

Query  677   MERIEADLARARASILRgggggTQT--KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYV  850
              ER+EA L RARASI R       +   DD  VP G +YRN   F +SY +MEKTLK+++
Sbjct  123   FERVEAQLVRARASIKRAAKFCNDSCYGDDPLVPKGAVYRNPHAFYQSYIDMEKTLKIWI  182

Query  851   YEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             Y++G+PP+AHYGP K  Y+IEG FIH  +  ++F T+DP+ AHL+F+P S+T + + +Y 
Sbjct  183   YKEGEPPLAHYGPLKYIYSIEGQFIHEFESRNQFITSDPEIAHLHFIPLSVTKMVQTLYP  242

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
             PN +   P+  T  DYV  ++ KYPFWNR+ GADHFILSCHDW P+      +L +NSIR
Sbjct  243   PNGYGSGPLHRTVSDYVKVISCKYPFWNRTRGADHFILSCHDWAPDALKGNRDLQHNSIR  302

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILL  1387
               CNANTSE FD ++DVS+PEI L       L+GGPSPS+R VL F+AGG HG +R +LL
Sbjct  303   VFCNANTSEGFDRRRDVSMPEIHLKGWEIDDLIGGPSPSRRTVLAFFAGGEHGYIRSVLL  362

Query  1388  QHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             +HW++KD +V+VH YLPKG SY+ +M+++++C+CPSG+EVASPR+VEA+Y GCVPV I  
Sbjct  363   EHWKDKDSEVRVHEYLPKGKSYSKLMKQAKFCLCPSGWEVASPRIVEAIYSGCVPVTISA  422

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
              Y+ PFSDVL+W  F+V IPV  IP +K IL GISQR+Y+++QRR ++V+ HF +N P K
Sbjct  423   SYILPFSDVLDWSKFSVNIPVSRIPEIKTILKGISQRRYLQLQRRVLQVQHHFVLNRPAK  482

Query  1748  RFDVFHMILHSIW  1786
             RFDV HMILHSIW
Sbjct  483   RFDVIHMILHSIW  495



>ref|XP_008337560.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=390

 Score =   438 bits (1126),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 210/382 (55%), Positives = 272/382 (71%), Gaps = 8/382 (2%)
 Frame = +2

Query  614   NGISSDDTEDSRKSKRYT----YTNMERIEADLARARASI---LRgggggTQTKDDDSVP  772
             NG   D+T  +      T    Y+ +E++EA+LA  R SI    R     +  +D D VP
Sbjct  5     NGTEFDETNGTSAIITSTPIKRYSRLEKLEANLAGVRXSIREAARVRNLTSTHEDPDYVP  64

Query  773   VGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-F  949
              GP+YRNA+ F RSY EMEK  K++VY +G+PP+ H GPCKS Y+ EG  IH M+    +
Sbjct  65    HGPIYRNANAFHRSYLEMEKHFKIFVYGEGEPPIFHNGPCKSIYSTEGRSIHEMEMENVY  124

Query  950   RTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGAD  1129
             RT DPD+A +YFLPFS+ +L + +Y  +SHD  P+    +DYVN ++ K+PFWNRSLGAD
Sbjct  125   RTRDPDEALVYFLPFSVVMLVQYLYVADSHDTZPIGRAVIDYVNVISDKHPFWNRSLGAD  184

Query  1130  HFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLG  1309
             HF+ SCH WGP  S  +PNL++NSIR LCNANTSE F+P KDVS PEI L +G T+GLLG
Sbjct  185   HFMJSCHHWGPSTSAYVPNLYHNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGETEGLLG  244

Query  1310  GPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCIC  1489
             G SPS R +L F+AG L G +R +LL  W+ KD+DVQV+   P GVSY  M++K+R+C+C
Sbjct  245   GLSPSXRSILAFFAGRLSGHIRYLLLNEWKEKDQDVQVYDQFPNGVSYESMLKKNRFCLC  304

Query  1490  PSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGI  1669
             PSGYEVASPR+VEA+Y  CVPVLI   YV PFSDVL W++F+V + V+DIPN+K+IL GI
Sbjct  305   PSGYEVASPRVVEAIYAECVPVLISDSYVPPFSDVLEWKSFSVQVKVKDIPNIKRILKGI  364

Query  1670  SQRQYIRMQRRGVKVRRHFEVN  1735
             SQ QY+RMQR   +V+RHF VN
Sbjct  365   SQSQYLRMQRXVKQVQRHFVVN  386



>emb|CDP15735.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   436 bits (1120),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 204/396 (52%), Positives = 284/396 (72%), Gaps = 5/396 (1%)
 Frame = +2

Query  614   NGISSD-DTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQT---KDDDSVPVGP  781
             +G+  D D E  ++  +     ME+IEA LARARA I      G+Q     + D +P G 
Sbjct  6     DGLIKDLDAESLKRRGKPRDEKMEKIEASLARARALIREAIVNGSQQLPLHEADYIPQGE  65

Query  782   MYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTT  958
             +YR+ S F RSY  ME   +++VYEDG+PP+ HYGPC+  Y++EG F+  ++  +RFRT 
Sbjct  66    IYRSPSVFHRSYQLMESLFRIFVYEDGEPPLFHYGPCRDIYSLEGIFLGLIEKNTRFRTY  125

Query  959   DPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFI  1138
             +PD+AH+YFLPFS+  + + +++P S D + ++    DYV  V+ KYP+WNRSLGADH +
Sbjct  126   NPDEAHVYFLPFSVVKILEHLFDPISRDKAVLERVIGDYVRIVSTKYPYWNRSLGADHLM  185

Query  1139  LSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPS  1318
             LSCHDWGP  ++ +  L+  SIRALCNANTSE F+P+KDVS PEI L +G    + GG S
Sbjct  186   LSCHDWGPRATWYVHQLYFTSIRALCNANTSEFFNPRKDVSFPEINLQTGDIAIVTGGLS  245

Query  1319  PSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSG  1498
             PS R +L F+AGG HG +RP L QHW+NKD D+QV+  LP  +SY+ MM+KS+YC+CPSG
Sbjct  246   PSNRTILAFFAGGYHGRIRPALFQHWKNKDSDIQVYEKLPGNLSYHEMMKKSKYCLCPSG  305

Query  1499  YEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQR  1678
             +EVASPR+VEA+Y  CVPVLI + Y+ PFSDVL+W +F++ + V ++PNLKKIL GIS+ 
Sbjct  306   HEVASPRIVEAIYAECVPVLISQDYILPFSDVLDWNSFSIQVSVSELPNLKKILMGISEG  365

Query  1679  QYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             ++ ++     +V+RHF +N PPK++DVFHMI+HSIW
Sbjct  366   KHRKLHEAVKQVQRHFMINDPPKKYDVFHMIIHSIW  401



>ref|XP_010107365.1| putative glycosyltransferase [Morus notabilis]
 gb|EXC15616.1| putative glycosyltransferase [Morus notabilis]
Length=468

 Score =   438 bits (1126),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 211/397 (53%), Positives = 272/397 (69%), Gaps = 14/397 (4%)
 Frame = +2

Query  638   EDSRKSKRYTYTNM--------ERIEADLARARASILRgggggTQTK-----DDDSVPVG  778
             E  RK    + +NM         ++EADLA ARA I        QTK     D D VP G
Sbjct  62    EQRRKRDHESISNMPKHRDEKLAKLEADLATARALIREATKKVNQTKKSFLEDADYVPQG  121

Query  779   PMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRT  955
              +Y+NA  F  SY  ME+  +++VYE+G+PP+ H GPCKS Y+ EG F+  M+    FRT
Sbjct  122   EVYKNAYAFHWSYLLMERVFRIFVYEEGEPPIFHNGPCKSIYSTEGMFLSFMETDIHFRT  181

Query  956   TDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHF  1135
              DPD+AH+YFLPFS+ ++ K +++P   D + ++ T +DYV +++ KYP WNRSLGADHF
Sbjct  182   WDPDEAHVYFLPFSVVMMVKYLFDPIIRDKAVLQRTVVDYVQTISHKYPHWNRSLGADHF  241

Query  1136  ILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGP  1315
             +LSCHDWGP  ++ +P L+ NSIR LCNANTSE F+PKKD S PEI L +G    L GG 
Sbjct  242   MLSCHDWGPRATWYVPQLYYNSIRVLCNANTSEHFNPKKDASFPEINLKTGQISSLTGGS  301

Query  1316  SPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPS  1495
               S R  L F+AG  HG +R +L  HW+ KD DV+V+  LPK +SY  M+R SR+C+CPS
Sbjct  302   PLSDRKTLAFFAGQRHGRIRQVLFHHWKEKDRDVKVYETLPKEISYEKMLRTSRFCLCPS  361

Query  1496  GYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQ  1675
             G+EVASPR+VEA+Y  CVPVLI + YV PFSDVLNWE+FAV + VE+IP LK+IL GIS 
Sbjct  362   GHEVASPRVVEAIYAECVPVLISQQYVPPFSDVLNWESFAVSVSVEEIPKLKEILLGISL  421

Query  1676  RQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
              QY  ++R    V+RHF +N PPK +DVFHMILHSIW
Sbjct  422   VQYENLRRNVKLVQRHFVLNDPPKGYDVFHMILHSIW  458



>ref|XP_004289488.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=399

 Score =   434 bits (1117),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 210/387 (54%), Positives = 269/387 (70%), Gaps = 18/387 (5%)
 Frame = +2

Query  677   MERIEADLARARASILRgggggTQTK----------------DDDSVPVGPMYRNASFFL  808
             ++++E  L++AR+SI          K                D D VP G +YRNA  F 
Sbjct  3     LDKLEESLSKARSSIREAAATSLALKNKINSTSKSVQLVHDQDPDYVPHGRIYRNAQAFH  62

Query  809   RSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-FRTTDPDKAHLYF  985
             RSY  MEK  K+YVYE+G+ P+ H GPCKS Y+ EG FIH M+  + +RT DPD+A +YF
Sbjct  63    RSYLLMEKLFKIYVYEEGEVPLFHAGPCKSIYSSEGRFIHEMEKGKLYRTKDPDEADVYF  122

Query  986   LPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPE  1165
             +P S+T L + +Y   + D  P+K   +DY+  +A ++PFWNRSLGADHF+LSCHDWGP 
Sbjct  123   IPVSVTNLVEYLYVHGTPDRDPIKRAFIDYIKVIADRHPFWNRSLGADHFMLSCHDWGPV  182

Query  1166  ISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVF  1345
              S ++P+  +NSIR LCNANTSE F+P KD S PEI L +G    L GGP PS R VL F
Sbjct  183   TSSSVPDFFHNSIRVLCNANTSEGFNPSKDASFPEINLLTGEISSL-GGPPPSTRTVLAF  241

Query  1346  YAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMV  1525
             +AG LHG +R +LL  W+ KDEDVQV+  LPK VSY   ++ S++C+CPSGYEVASPR+V
Sbjct  242   FAGRLHGHIRYLLLNEWKGKDEDVQVYEVLPKKVSYENKLKSSKFCLCPSGYEVASPRVV  301

Query  1526  EALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRG  1705
             EA+Y  CVPVLI   YV PFSDVLNW +F+V IPV++I ++K IL GIS RQY+RMQR  
Sbjct  302   EAIYAECVPVLISDAYVPPFSDVLNWRSFSVQIPVQNISDIKNILMGISHRQYLRMQRNV  361

Query  1706  VKVRRHFEVNSPPKRFDVFHMILHSIW  1786
              +V+RHF VN PPKR+DVFHMI+HSIW
Sbjct  362   KQVQRHFVVNGPPKRYDVFHMIVHSIW  388



>ref|XP_002459470.1| hypothetical protein SORBIDRAFT_02g005180 [Sorghum bicolor]
 gb|EER95991.1| hypothetical protein SORBIDRAFT_02g005180 [Sorghum bicolor]
Length=584

 Score =   440 bits (1131),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 225/410 (55%), Positives = 286/410 (70%), Gaps = 19/410 (5%)
 Frame = +2

Query  614   NGISSDDTEDSRKSKRYTYTNMERIEADLARARASIL---RgggggTQTKDDDSVPVGPM  784
              G S +    + + +R +   +ER+E  LA+AR++I+   R     +   D D VP+GP+
Sbjct  161   TGNSDEVIRATPQVQRSSDIKLERLELGLAKARSAIMEAIRNKDKRSPLPDKDYVPMGPI  220

Query  785   YRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD-FSRFRTTD  961
             YRNA  F RSY EMEK LKVYVYE+G+PPV H GPC+S Y+ EG FIHAM+  +R RT+D
Sbjct  221   YRNAHAFHRSYLEMEKQLKVYVYEEGEPPVFHDGPCRSIYSTEGRFIHAMETATRLRTSD  280

Query  962   PDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFIL  1141
             P +AH++FLPFS+  + K +YEP SHD +P+K T  DY+  ++ KYPFWNRS GADHF+L
Sbjct  281   PSQAHVFFLPFSVVKMVKTIYEPGSHDMAPLKRTVADYLRVISDKYPFWNRSAGADHFML  340

Query  1142  SCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSP  1321
             SCHDWGP +S A   L  NSIR LCNANTSE FD  KDVS+PEI L S   +  +GGPS 
Sbjct  341   SCHDWGPYVSSANAELFGNSIRVLCNANTSEGFDLAKDVSLPEINLRSDAVERQVGGPSA  400

Query  1322  SKRPVLVFYAGGLHGPVRPILLQHW-----ENKDEDVQVHSYLPK--------GVSYNGM  1462
             S+RP L F+AGG HGPVRP LL HW        D DV+V  YLP           +Y  M
Sbjct  401   SRRPFLAFFAGGNHGPVRPALLAHWGPGSGREDDPDVRVSEYLPTRGGRAGASAAAYTDM  460

Query  1463  MRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRG-YVAPFSDVLNWEAFAVIIPVEDI  1639
             MR+SR+C+CP GYEVASPR+ EA+Y+ CVPV++  G Y  PF+DVLNW+AFAV + V D+
Sbjct  461   MRRSRFCLCPGGYEVASPRLAEAVYLECVPVVVDDGEYALPFADVLNWDAFAVRVRVADV  520

Query  1640  PNLKKILTGISQRQYIRMQRRGVKVRRHFEVN-SPPKRFDVFHMILHSIW  1786
             P +K+IL+ +S RQYIRMQRR   VRRHF V+  PP+R+D FHMILHS+W
Sbjct  521   PRIKEILSAVSPRQYIRMQRRVRMVRRHFMVHGGPPRRYDAFHMILHSVW  570



>ref|XP_004502077.1| PREDICTED: probable glycosyltransferase At3g07620-like [Cicer 
arietinum]
Length=465

 Score =   435 bits (1118),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 201/376 (53%), Positives = 275/376 (73%), Gaps = 5/376 (1%)
 Frame = +2

Query  674   NMERIEADLARARASI----LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLK  841
             N+E++EA LA+ARASI    LR           D +P G +YRNA  F RSY  MEK  K
Sbjct  81    NLEKVEASLAKARASIKQALLRINDTLPLEDSHDYIPQGDIYRNAFAFHRSYYLMEKLFK  140

Query  842   VYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKL  1018
             ++VYE+G+PP+ HYGPCK+ Y++EG FI+ ++  ++FRT +PD+AH+YFLPFS+ ++ + 
Sbjct  141   IFVYEEGEPPLFHYGPCKNIYSMEGIFINLLESNTQFRTQNPDEAHVYFLPFSVVMILEH  200

Query  1019  VYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNN  1198
             ++ P   D + +  T  DYV+ ++ KY +WNRS GADHF+LSCHDWGP  ++ +  L+  
Sbjct  201   LFHPVIRDKAVLGRTIGDYVHIISHKYTYWNRSYGADHFMLSCHDWGPRATWYVKELYFI  260

Query  1199  SIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRP  1378
             +IR LCNAN SE F+PKKD S PEI L +G T GL+GG     R +L F+AG +HG +RP
Sbjct  261   AIRVLCNANISEHFNPKKDASFPEINLVTGETTGLIGGYPQWNRTILAFFAGQMHGRIRP  320

Query  1379  ILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVL  1558
             +L QHW+NKD+D+ V+  LP+ VSY+  M+ S+YCICPSGYEVASPR+VEA+Y  CVPV+
Sbjct  321   MLFQHWKNKDKDMLVYEKLPENVSYHETMKMSKYCICPSGYEVASPRIVEAIYAECVPVI  380

Query  1559  IKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNS  1738
             I + YV PFSDVL+W+ F+V I V +IP LK+IL GIS+ +Y+R+     KV+RHF +N+
Sbjct  381   ISQNYVLPFSDVLDWDCFSVQIQVSEIPKLKEILLGISEEKYVRLYEGVKKVQRHFVMNN  440

Query  1739  PPKRFDVFHMILHSIW  1786
             PPKR+DVFHMI+HSIW
Sbjct  441   PPKRYDVFHMIVHSIW  456



>gb|KHG09514.1| hypothetical protein F383_01906 [Gossypium arboreum]
Length=484

 Score =   436 bits (1120),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 213/421 (51%), Positives = 278/421 (66%), Gaps = 13/421 (3%)
 Frame = +2

Query  548   VTGDSRPILLAPETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASI--  721
             +   S  I     +G  DD +    ++   ++++K      +  + +E  LARARASI  
Sbjct  56    IVSTSDQIRAVSTSGSTDDHQHLNRNTTLIKETKK-----LSKEQVLEQGLARARASIRS  110

Query  722   --LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCK  895
               +          +D+ VPVG +YRN S F +SY EME+  KVYVY +G+ P+ H GPCK
Sbjct  111   AAIARIVRTAFFMNDNDVPVGDVYRNPSTFYQSYVEMERRFKVYVYSEGELPIVHDGPCK  170

Query  896   STYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITAL  1069
             + Y IEG FIH M+    RFRT DP +AH+YF+PFS+  + K +Y P S D +P+K    
Sbjct  171   NLYTIEGRFIHEMEHGAKRFRTNDPQRAHVYFMPFSVAWMVKYIYTPLSFDITPLKHFVS  230

Query  1070  DYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPK  1249
             DYV  ++ KYPFWNR+ GADHF+L+CHDWGP  S     L+NNSIR LCNAN SE F+P+
Sbjct  231   DYVKVISIKYPFWNRTHGADHFMLACHDWGPHASQGNSLLYNNSIRVLCNANISEGFNPQ  290

Query  1250  KDVSIPEIVLPSGTTKGLLGGPSP--SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQV  1423
             KDVS+PEI L  G     L  P P  + RP   F+AGGLHGP+RP LLQHW+ +D D+QV
Sbjct  291   KDVSLPEISLIGGYLSHKLIHPPPPNTSRPYFAFFAGGLHGPIRPYLLQHWKGRDNDMQV  350

Query  1424  HSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNW  1603
             + YLPK   Y   M +S++C+CPSGYEVASPR+VEA+Y GCVPV++   YV PFSDVL W
Sbjct  351   YEYLPKNKDYYSYMLESKFCLCPSGYEVASPRIVEAIYSGCVPVILSDNYVLPFSDVLQW  410

Query  1604  EAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSI  1783
             EAF+V +    IP LK+IL+ I + +Y ++Q   + VRRHF +N PPKRFDVFHMILHSI
Sbjct  411   EAFSVQVETTKIPRLKEILSAIPEEKYRKLQEGVIVVRRHFMLNRPPKRFDVFHMILHSI  470

Query  1784  W  1786
             W
Sbjct  471   W  471



>ref|XP_010096418.1| T-complex protein 1 subunit beta [Morus notabilis]
 gb|EXB64089.1| T-complex protein 1 subunit beta [Morus notabilis]
Length=1028

 Score =   452 bits (1164),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 222/412 (54%), Positives = 286/412 (69%), Gaps = 13/412 (3%)
 Frame = +2

Query  557   DSRPILLAPETG--IGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRg  730
             D R I   PE    IG+ E QN   + ++     +K    +++ ++EA L   RASI   
Sbjct  94    DFRTISSTPEAASQIGE-ENQNKSGTQNSRSRDVAKIKLSSSLHKLEARLVEVRASIREA  152

Query  731   gggg--------TQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYG  886
                             D D  P G +YRN + F RSY EMEK +K+YVYE+G+PPV H G
Sbjct  153   ALVARNFTPNSHDSLSDPDFTPKGHIYRNPNAFHRSYLEMEKLMKIYVYEEGEPPVFHDG  212

Query  887   PCKSTYAIEGNFIHAMD-FSRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKIT  1063
             PC+S Y+ EG FIH ++    FRT DP+KA +YFLPFS+  + + +Y P+SHD  PM+  
Sbjct  213   PCRSIYSSEGRFIHEIEKGGLFRTRDPNKALVYFLPFSVVNMVRYLYVPDSHDTKPMRRV  272

Query  1064  ALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFD  1243
              +DY+N +A K+PFWNRSLGADHF+LSCHDWGP  S  +P+L++ SIRALCNANTSE F 
Sbjct  273   VVDYMNLIAHKHPFWNRSLGADHFMLSCHDWGPSTSSFVPHLYHRSIRALCNANTSEGFR  332

Query  1244  PKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQV  1423
             P KDVS PEI L +G  +GL GGPSPSKR +L F+AG LHG +R +LL  W+NKD+DVQV
Sbjct  333   PSKDVSFPEINLLTGEVRGL-GGPSPSKRTILAFFAGRLHGYIRYLLLNQWKNKDQDVQV  391

Query  1424  HSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNW  1603
             +  LP+ VSY  MM+KS++C+CPSGYEVASPR+VEA+Y GCVPVLI  GYV PF+DVLNW
Sbjct  392   YDQLPRRVSYQDMMKKSKFCLCPSGYEVASPRVVEAIYAGCVPVLISDGYVPPFNDVLNW  451

Query  1604  EAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDV  1759
             ++F+V I V DIP +K+IL GIS R Y R+QR    V+RHF VN+ PKR+D+
Sbjct  452   KSFSVQIKVNDIPKIKEILMGISTRHYSRLQRTLKLVQRHFLVNATPKRYDI  503



>ref|XP_009361503.1| PREDICTED: probable glycosyltransferase At3g07620 [Pyrus x bretschneideri]
Length=512

 Score =   436 bits (1121),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 200/375 (53%), Positives = 275/375 (73%), Gaps = 4/375 (1%)
 Frame = +2

Query  674   NMERIEADLARARASI---LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             N++++EA LA ARA I   ++     T  KD D +P G +YRNA  F RSY  MEK  K+
Sbjct  130   NLKKLEAGLAAARALIGEAIKNPNHTTPLKDADYIPKGDIYRNAYAFHRSYLLMEKMFKI  189

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             YVYE+G+ P+ H GPCK+ Y+ EG F+  ++  ++FRT +P+ AH+YFLPFS+ ++ + +
Sbjct  190   YVYEEGELPIFHNGPCKNIYSTEGLFLSFIETDTKFRTREPENAHVYFLPFSVVMIVEYL  249

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             + P   D + ++ T +DYV  ++ +YP+WNRSLGADH +LSCHDWGP  ++ +  L+  +
Sbjct  250   FHPIIRDKAVLERTVVDYVRIISNRYPYWNRSLGADHVMLSCHDWGPRATWYVKQLYFVA  309

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNANTSE F+PKKD S PEI L +G   GL+GG  PSKR +L F+AG +HG +RP 
Sbjct  310   IRVLCNANTSEHFNPKKDASFPEINLETGEITGLIGGLHPSKRTILAFFAGRMHGRIRPF  369

Query  1382  LLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             L +HW+ KD D+ V+  LP+ +SY+ M++KS+YCICPSG+EVASPR+VEA+Y  CVPVLI
Sbjct  370   LFEHWKGKDRDLLVYEKLPEELSYHDMLKKSKYCICPSGHEVASPRIVEAIYAECVPVLI  429

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
              + YV PFSDVLNW++F+V + V +IP LK+IL  I + QY RMQ R  +V+RHF VN+P
Sbjct  430   SQHYVLPFSDVLNWDSFSVQVSVSEIPKLKEILMEIPEEQYRRMQERVKQVQRHFVVNNP  489

Query  1742  PKRFDVFHMILHSIW  1786
             PKRFD+FHMI+HSIW
Sbjct  490   PKRFDIFHMIIHSIW  504



>gb|KHN09672.1| Putative glycosyltransferase, partial [Glycine soja]
Length=399

 Score =   431 bits (1109),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 207/382 (54%), Positives = 275/382 (72%), Gaps = 6/382 (2%)
 Frame = +2

Query  656   KRYTYTNMERIEADLARARASILRgggggTQT---KDDDSVPVGPMYRNASFFLRSYAEM  826
             + + YT +  IEA LA+AR SI         T   +D D VP G +YRNA+ F RSY EM
Sbjct  8     RDHKYTKLGSIEARLAKARYSIREASKIPNFTPTLQDPDYVPQGSIYRNANAFHRSYLEM  67

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSRF-RTTDPDKAHLYFLPFSIT  1003
             EK  K++VYE+G+PP+ H G  K  YA EG FIH M+  R+ RT DPD+A +Y+LPFS+ 
Sbjct  68    EKVFKIFVYEEGEPPLFHNGLSKDIYATEGRFIHEMEKGRYYRTYDPDEAFVYYLPFSVV  127

Query  1004  VLSKLVYEPNS-HDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAI  1180
             +L + VY+  S ++  P+ +   DY+  +A K+PFWNRSLG DH +LSCHDWGP +S  +
Sbjct  128   MLVEYVYDRGSNYNLDPLGLVVKDYIQIIAHKHPFWNRSLGHDHVMLSCHDWGPLVSSYV  187

Query  1181  PNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGL  1360
              +L+NN+IR LCNANTSE F P KDVS PEI L  G  KGL GG  PS+R +L F+AG L
Sbjct  188   DHLYNNAIRVLCNANTSEGFKPAKDVSFPEIKLIKGEVKGL-GGYPPSQRTILAFFAGHL  246

Query  1361  HGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYM  1540
             HG +R +LL  W+NKD+D+Q++  LP+G+SY   +R S++C+CPSGYEVASPR+VEA++ 
Sbjct  247   HGYIRYLLLSTWKNKDQDMQIYEELPEGISYYTKLRSSKFCLCPSGYEVASPRVVEAIFA  306

Query  1541  GCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRR  1720
              CVPVLI   YV PFSDVLNW +F+V + V+DIPN+K+IL  IS++QY+RM +R  +V+R
Sbjct  307   ECVPVLISDSYVPPFSDVLNWNSFSVQVNVKDIPNIKRILMEISEKQYLRMHKRVKQVQR  366

Query  1721  HFEVNSPPKRFDVFHMILHSIW  1786
             HF  N PPKR+D+FHM +HSIW
Sbjct  367   HFVPNEPPKRYDMFHMTVHSIW  388



>ref|XP_007200373.1| hypothetical protein PRUPE_ppa008342mg [Prunus persica]
 gb|EMJ01572.1| hypothetical protein PRUPE_ppa008342mg [Prunus persica]
Length=336

 Score =   428 bits (1101),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 195/323 (60%), Positives = 249/323 (77%), Gaps = 2/323 (1%)
 Frame = +2

Query  824   MEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR--FRTTDPDKAHLYFLPFS  997
             ME+  K+YVYE+G PP+ H GPCKS Y+ EG FIH M+     ++TTDPD+A +YFLPFS
Sbjct  1     MERLFKIYVYEEGDPPIFHNGPCKSIYSTEGRFIHEMEMDNNIYKTTDPDEALVYFLPFS  60

Query  998   ITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFA  1177
             + +L + +Y  +SH+   +    +DYVN ++ K+PFWNRSLGADHF+LSCHDWGP  S  
Sbjct  61    VVMLVQYLYAADSHNTDSIGRAVIDYVNVISDKHPFWNRSLGADHFMLSCHDWGPRTSSY  120

Query  1178  IPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGG  1357
             +P+L++ SIR LCNANTSE F+P KD S PEI L +G  KGL+GG SPS+R +L F+AG 
Sbjct  121   VPHLYHKSIRVLCNANTSEGFNPSKDASFPEIHLRTGEIKGLVGGLSPSRRSILAFFAGR  180

Query  1358  LHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALY  1537
             LHG +R +LL  W+ KD+DVQV+  LP GVSY  M++KSR+C+CPSGYEVASPR+VEA+Y
Sbjct  181   LHGHIRYLLLNEWKEKDQDVQVYDQLPHGVSYELMLKKSRFCLCPSGYEVASPRVVEAIY  240

Query  1538  MGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVR  1717
               C+PVLI   YV PFSDVL+W++F+V I VEDIPN+K IL GISQ QY+RM RR  +V+
Sbjct  241   AECIPVLISDSYVPPFSDVLDWKSFSVQIQVEDIPNIKTILMGISQSQYLRMHRRVKQVQ  300

Query  1718  RHFEVNSPPKRFDVFHMILHSIW  1786
             RHF VN P KRFDVF+MI+HSIW
Sbjct  301   RHFVVNGPSKRFDVFNMIVHSIW  323



>tpg|DAA59884.1| TPA: hypothetical protein ZEAMMB73_690759, partial [Zea mays]
Length=577

 Score =   437 bits (1123),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 223/397 (56%), Positives = 282/397 (71%), Gaps = 20/397 (5%)
 Frame = +2

Query  656   KRYTYTNMERIEADLARARASIL---RgggggTQTKDDDSVPVGPMYRNASFFLRSYAEM  826
             +R     +ER+E  LARAR++I+   R     +   D D VP+GP+YRNA  F RSY EM
Sbjct  171   RRRDDVKLERLELGLARARSAIMEAIRKKDKVSPLPDKDYVPMGPVYRNAHVFHRSYLEM  230

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-------RFRTTDPDKAHLYF  985
             E+ LKVYVYE+G+PPV H GPC+S Y+ EG FIH+M+         R RT DP +AH++F
Sbjct  231   ERQLKVYVYEEGEPPVFHDGPCRSIYSTEGRFIHSMETETEAEEGRRLRTRDPARAHVFF  290

Query  986   LPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPE  1165
             LPFS+  + + +YEP S D +P+K T  DYV  ++ KYP+WNRSLGADHF+LSCHDWGP 
Sbjct  291   LPFSVVKMVQTIYEPGSRDMAPLKRTVADYVRVLSSKYPYWNRSLGADHFMLSCHDWGPY  350

Query  1166  ISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVF  1345
             +S A   L  NSIR LCNANTSE FDP +DVS+P++ L S   +  +GGPS S+RPVL F
Sbjct  351   VSSANAQLFGNSIRVLCNANTSEGFDPARDVSLPQVNLRSDAVERQVGGPSASRRPVLAF  410

Query  1346  YAGGLHGPVRPILLQHW-----ENKDEDVQVHSYLPKG---VSYNGMMRKSRYCICPSGY  1501
             +AGG HGPVRP LL HW        D DV+V  YLP+G    SY  MMR+SR+C+CP GY
Sbjct  411   FAGGNHGPVRPALLAHWGPGGRRGGDPDVRVSEYLPRGGGAPSYADMMRRSRFCLCPGGY  470

Query  1502  EVASPRMVEALYMGCVPVLIKRG-YVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQR  1678
             EVASPR+ EALY+GCVPV++  G Y  PF+DVL+W+AFA+ + V DIP LK+IL  +S R
Sbjct  471   EVASPRLAEALYLGCVPVVVDDGEYALPFADVLDWDAFALRLRVADIPRLKEILAAVSPR  530

Query  1679  QYIRMQRRGVKVRRHFEVN-SPPKRFDVFHMILHSIW  1786
             QYIRMQRR   VRRHF ++  PP+R+D FHMILHS+W
Sbjct  531   QYIRMQRRVRMVRRHFMLHGGPPRRYDAFHMILHSVW  567



>ref|XP_008652150.1| PREDICTED: probable glycosyltransferase At5g03795 [Zea mays]
Length=579

 Score =   436 bits (1122),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 223/397 (56%), Positives = 282/397 (71%), Gaps = 20/397 (5%)
 Frame = +2

Query  656   KRYTYTNMERIEADLARARASIL---RgggggTQTKDDDSVPVGPMYRNASFFLRSYAEM  826
             +R     +ER+E  LARAR++I+   R     +   D D VP+GP+YRNA  F RSY EM
Sbjct  171   RRRDDVKLERLELGLARARSAIMEAIRKKDKVSPLPDKDYVPMGPVYRNAHVFHRSYLEM  230

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-------RFRTTDPDKAHLYF  985
             E+ LKVYVYE+G+PPV H GPC+S Y+ EG FIH+M+         R RT DP +AH++F
Sbjct  231   ERQLKVYVYEEGEPPVFHDGPCRSIYSTEGRFIHSMETETEAEEGRRLRTRDPARAHVFF  290

Query  986   LPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPE  1165
             LPFS+  + + +YEP S D +P+K T  DYV  ++ KYP+WNRSLGADHF+LSCHDWGP 
Sbjct  291   LPFSVVKMVQTIYEPGSRDMAPLKRTVADYVRVLSSKYPYWNRSLGADHFMLSCHDWGPY  350

Query  1166  ISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVF  1345
             +S A   L  NSIR LCNANTSE FDP +DVS+P++ L S   +  +GGPS S+RPVL F
Sbjct  351   VSSANAQLFGNSIRVLCNANTSEGFDPARDVSLPQVNLRSDAVERQVGGPSASRRPVLAF  410

Query  1346  YAGGLHGPVRPILLQHW-----ENKDEDVQVHSYLPKG---VSYNGMMRKSRYCICPSGY  1501
             +AGG HGPVRP LL HW        D DV+V  YLP+G    SY  MMR+SR+C+CP GY
Sbjct  411   FAGGNHGPVRPALLAHWGPGGRRGGDPDVRVSEYLPRGGGAPSYADMMRRSRFCLCPGGY  470

Query  1502  EVASPRMVEALYMGCVPVLIKRG-YVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQR  1678
             EVASPR+ EALY+GCVPV++  G Y  PF+DVL+W+AFA+ + V DIP LK+IL  +S R
Sbjct  471   EVASPRLAEALYLGCVPVVVDDGEYALPFADVLDWDAFALRLRVADIPRLKEILAAVSPR  530

Query  1679  QYIRMQRRGVKVRRHFEVN-SPPKRFDVFHMILHSIW  1786
             QYIRMQRR   VRRHF ++  PP+R+D FHMILHS+W
Sbjct  531   QYIRMQRRVRMVRRHFMLHGGPPRRYDAFHMILHSVW  567



>gb|AES71688.2| exostosin family protein [Medicago truncatula]
Length=445

 Score =   431 bits (1108),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 200/377 (53%), Positives = 277/377 (73%), Gaps = 6/377 (2%)
 Frame = +2

Query  674   NMERIEADLARARA----SILRgggggTQTKDD-DSVPVGPMYRNASFFLRSYAEMEKTL  838
             N+E++E  LA+ARA    ++LR        +D  D VP G +YRNA  F RSY  MEK  
Sbjct  60    NLEKVEGSLAKARALIKQALLRTNDTVVPLEDSHDYVPQGHIYRNAFAFHRSYQLMEKLF  119

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSK  1015
             K++VYE+G+PP+ HYGPCK+ Y++EG FI+ ++  + FRT +P++AH+YFLPFS+ ++ +
Sbjct  120   KIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLENNTLFRTQNPNEAHVYFLPFSVVMILE  179

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              ++ P   D + +  T  DYV+ ++ KY +WNRS GADHF+LSCHDWGP  ++ +  L+ 
Sbjct  180   HLFHPVIRDKAVLGRTIGDYVHIISHKYAYWNRSYGADHFMLSCHDWGPRATWYVKELYF  239

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
              +IR LCNAN SE F+PKKD S PEI L SG T GLLGG     R +L F+AG ++G +R
Sbjct  240   IAIRVLCNANISEHFNPKKDASFPEINLVSGETTGLLGGYPTWNRTILAFFAGQMNGRIR  299

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
             P+L QHW+NKD+DV V+  LP+ +SY+  M+ S+YCICPSG+EVASPR+VEA+Y  CVP+
Sbjct  300   PVLFQHWKNKDKDVLVYEKLPEKISYHETMKMSKYCICPSGWEVASPRIVEAIYAECVPI  359

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI + YV PFSDVLNW++F+V I V +IP LK+IL GIS+ +Y+R+Q    +V+RHF VN
Sbjct  360   LISQQYVLPFSDVLNWDSFSVQIEVSEIPKLKEILLGISEEKYMRLQEGVKQVQRHFVVN  419

Query  1736  SPPKRFDVFHMILHSIW  1786
             +PPK++DVFHMI+HSIW
Sbjct  420   NPPKKYDVFHMIIHSIW  436



>ref|XP_007011817.1| Exostosin family protein [Theobroma cacao]
 gb|EOY29436.1| Exostosin family protein [Theobroma cacao]
Length=479

 Score =   431 bits (1108),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 212/386 (55%), Positives = 268/386 (69%), Gaps = 7/386 (2%)
 Frame = +2

Query  650   KSKRYTYTNMERIEADLARARASILRgggggTQT---KDDDSVPVGPMYRNASFFLRSYA  820
             + KR   +  + +E  LARARASI         T   ++DD VPVG +YRN S F  SY 
Sbjct  85    QRKRKKPSREQVLEQGLARARASIRSAATARNVTVTFENDDDVPVGDVYRNPSAFYDSYV  144

Query  821   EMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPF  994
             EME+  KVYVY +G+ P+ H GPCK  Y IEG FIH M+    RFRT DP  AH+YF+PF
Sbjct  145   EMERRFKVYVYTEGELPIVHDGPCKEIYTIEGRFIHEMEHGAKRFRTNDPGHAHVYFMPF  204

Query  995   SITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISF  1174
             S+T + K +Y+P S++ SP+K    DYV  V+ KYPFWNR+ GADHF+L+CHDWGP  S 
Sbjct  205   SVTWMVKYIYKPLSYNVSPLKQFVSDYVKVVSTKYPFWNRTHGADHFMLACHDWGPHASQ  264

Query  1175  AIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG-TTKGLLGGPSPS-KRPVLVFY  1348
                +L+ NSIR LCNANTSE F+P+KDVS+PEI L  G  +  LL  P P+  RP L F+
Sbjct  265   GNSHLYTNSIRVLCNANTSEGFNPQKDVSLPEIHLNGGFLSPKLLHPPLPNVSRPHLSFF  324

Query  1349  AGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVE  1528
             AGGLHGP+RP LLQHW+ +D+++QV  YLPK   Y   M +S++C+CPSGYEVASPR+VE
Sbjct  325   AGGLHGPIRPFLLQHWKGRDDEMQVFEYLPKDKDYYSYMLQSKFCLCPSGYEVASPRIVE  384

Query  1529  ALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGV  1708
             A+Y  CVPV++   YV PFSDVL WEAF+V +    IP LK+IL GI + +Y ++Q    
Sbjct  385   AIYSECVPVILSEHYVLPFSDVLRWEAFSVQVETTAIPRLKEILLGIPEEKYRKLQEGVR  444

Query  1709  KVRRHFEVNSPPKRFDVFHMILHSIW  1786
              VRRHF +N P KRFD+FHMILHSIW
Sbjct  445   AVRRHFMLNQPSKRFDMFHMILHSIW  470



>ref|XP_007213348.1| hypothetical protein PRUPE_ppa1027150mg, partial [Prunus persica]
 gb|EMJ14547.1| hypothetical protein PRUPE_ppa1027150mg, partial [Prunus persica]
Length=389

 Score =   427 bits (1099),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/391 (53%), Positives = 274/391 (70%), Gaps = 22/391 (6%)
 Frame = +2

Query  629   DDTEDSRKSKRYTYT-NMERIEADLARARASILRgggggTQT---KDDDSVPVGPMYRNA  796
             DD E + K+     +  ++R+EA L RAR+SI        +T   +D D VP GP+YRN 
Sbjct  3     DDDEGANKTVFMRSSGQLDRLEASLGRARSSIREAAKVRNKTSTHQDADYVPRGPIYRNP  62

Query  797   SFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKA  973
             + F RSY EMEK  K+YVYE+G                +G FIH M+  + +RT DP+KA
Sbjct  63    NAFHRSYLEMEKLFKIYVYEEG----------------DGRFIHEMEKGNMYRTRDPNKA  106

Query  974   HLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHD  1153
              +YFLPFS+  + + +Y PNS+D   MK+  +DYVN +A+K+PFWNRSLGADHF+LSCHD
Sbjct  107   LVYFLPFSVVRMVQYLYMPNSNDRHGMKLAIIDYVNLIAQKHPFWNRSLGADHFMLSCHD  166

Query  1154  WGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRP  1333
             W P  +  +P L + SIR LCNANTSE F+P KD S PEI L +    GL GG SPS R 
Sbjct  167   WAPFTTSFVPLLFHKSIRVLCNANTSEGFNPSKDASFPEINLKTSEMSGL-GGQSPSTRS  225

Query  1334  VLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVAS  1513
              L F+AG LHG +R +LL  W+ KD+DVQV+  LP+GVSY  M++ S++C+CPSGYEVAS
Sbjct  226   TLAFFAGRLHGHIRSLLLNEWKGKDQDVQVYDQLPRGVSYEKMLKGSKFCLCPSGYEVAS  285

Query  1514  PRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRM  1693
             PR+VEA+Y  C+PVLI  GY+ PFSDVL+W++F+V +PV++I ++K IL  IS RQY+RM
Sbjct  286   PRVVEAIYAECIPVLISDGYIPPFSDVLDWKSFSVQVPVKNISDIKNILMSISSRQYLRM  345

Query  1694  QRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             QRR  +V+RHF VN PPKR+DVFHMI+HSIW
Sbjct  346   QRRVKQVQRHFLVNGPPKRYDVFHMIVHSIW  376



>ref|XP_003601437.1| hypothetical protein MTR_3g080690 [Medicago truncatula]
Length=450

 Score =   429 bits (1104),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 200/377 (53%), Positives = 277/377 (73%), Gaps = 6/377 (2%)
 Frame = +2

Query  674   NMERIEADLARARA----SILRgggggTQTKDD-DSVPVGPMYRNASFFLRSYAEMEKTL  838
             N+E++E  LA+ARA    ++LR        +D  D VP G +YRNA  F RSY  MEK  
Sbjct  65    NLEKVEGSLAKARALIKQALLRTNDTVVPLEDSHDYVPQGHIYRNAFAFHRSYQLMEKLF  124

Query  839   KVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSK  1015
             K++VYE+G+PP+ HYGPCK+ Y++EG FI+ ++  + FRT +P++AH+YFLPFS+ ++ +
Sbjct  125   KIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLENNTLFRTQNPNEAHVYFLPFSVVMILE  184

Query  1016  LVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
              ++ P   D + +  T  DYV+ ++ KY +WNRS GADHF+LSCHDWGP  ++ +  L+ 
Sbjct  185   HLFHPVIRDKAVLGRTIGDYVHIISHKYAYWNRSYGADHFMLSCHDWGPRATWYVKELYF  244

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
              +IR LCNAN SE F+PKKD S PEI L SG T GLLGG     R +L F+AG ++G +R
Sbjct  245   IAIRVLCNANISEHFNPKKDASFPEINLVSGETTGLLGGYPTWNRTILAFFAGQMNGRIR  304

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
             P+L QHW+NKD+DV V+  LP+ +SY+  M+ S+YCICPSG+EVASPR+VEA+Y  CVP+
Sbjct  305   PVLFQHWKNKDKDVLVYEKLPEKISYHETMKMSKYCICPSGWEVASPRIVEAIYAECVPI  364

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI + YV PFSDVLNW++F+V I V +IP LK+IL GIS+ +Y+R+Q    +V+RHF VN
Sbjct  365   LISQQYVLPFSDVLNWDSFSVQIEVSEIPKLKEILLGISEEKYMRLQEGVKQVQRHFVVN  424

Query  1736  SPPKRFDVFHMILHSIW  1786
             +PPK++DVFHMI+HSIW
Sbjct  425   NPPKKYDVFHMIIHSIW  441



>ref|XP_006483712.1| PREDICTED: probable glycosyltransferase At5g25310-like [Citrus 
sinensis]
 gb|KDO61790.1| hypothetical protein CISIN_1g011702mg [Citrus sinensis]
Length=479

 Score =   428 bits (1101),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 266/388 (69%), Gaps = 8/388 (2%)
 Frame = +2

Query  647   RKSKRYTYTNMERIEADLARARASILRgggggTQT----KDDDSVPVGPMYRNASFFLRS  814
             R+S     +  E+++  LARARASI +       T       D VP   +YRN   F +S
Sbjct  83    RESSARVLSKYEQLKQGLARARASIRKAASTRNVTSIIKNGVDFVPSAAIYRNPGAFYQS  142

Query  815   YAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFL  988
             Y EMEK  KVYVY +G+ P+ HYGPCK  Y IEG F+  ++    RFRT+DP +AH+Y+L
Sbjct  143   YVEMEKRFKVYVYREGELPITHYGPCKDIYTIEGRFMSEIEHGAKRFRTSDPHRAHVYYL  202

Query  989   PFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEI  1168
             PFS+  + K +Y+P ++D +P+K    DYV  V+ KYPFWNR+ GADHF+L+CHDWGP +
Sbjct  203   PFSVAWMVKYLYKPLTYDLTPLKQFVADYVKVVSSKYPFWNRTCGADHFMLACHDWGPHV  262

Query  1169  SFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSP--SKRPVLV  1342
             S    +L+NNSIR LCNANTSE F+P+KDV++PEI L  G     L  P P  + RP L 
Sbjct  263   SKGNSHLYNNSIRVLCNANTSEGFNPQKDVTLPEIHLYGGYVSPKLLSPPPFNAPRPYLA  322

Query  1343  FYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRM  1522
             F+AGGLHG +R ILLQHW+  D+D+ V  YLPK   Y   M KS++C+CPSGYEVASPR+
Sbjct  323   FFAGGLHGTIRSILLQHWKGHDKDLIVFEYLPKDQDYYSFMLKSKFCLCPSGYEVASPRI  382

Query  1523  VEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRR  1702
             VE++Y  CVPV++ + YV PFSDVL WEAF++ + V +IP LK++L  + + +Y R++  
Sbjct  383   VESIYAQCVPVILSQNYVLPFSDVLRWEAFSIQVDVSEIPRLKEVLMAVPEEKYKRLKEN  442

Query  1703  GVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
                VRRHFE+N P KRFDVFHMILHSIW
Sbjct  443   LKAVRRHFELNHPAKRFDVFHMILHSIW  470



>gb|EYU42789.1| hypothetical protein MIMGU_mgv1a009597mg [Erythranthe guttata]
Length=337

 Score =   422 bits (1086),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 251/325 (77%), Gaps = 4/325 (1%)
 Frame = +2

Query  824   MEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD--FSRFRTTDPDKAHLYFLPFS  997
             MEK  K+YVY++G+ P+ H GPC+S Y+ EG FI+ M+   + +RT DPD+AH+YF+PFS
Sbjct  1     MEKVFKIYVYKEGEAPIFHNGPCRSIYSSEGRFINEMEKHGNHYRTNDPDEAHVYFMPFS  60

Query  998   ITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFA  1177
             + V+ + +YEP + D +P+  T  DYV +++ K+PFWNRSLGADHF+LSCHDWGP  S  
Sbjct  61    VVVMVQYLYEPGALDMNPIGNTLADYVRTISHKHPFWNRSLGADHFMLSCHDWGPHTSSY  120

Query  1178  IPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGG  1357
             +P L  NSIR LCNANTSE F+P KD ++PEI L +G   GLLGGP PS+R  L F+AGG
Sbjct  121   VPLLFKNSIRVLCNANTSEGFNPLKDATLPEINLKTGEITGLLGGPPPSQRKTLAFFAGG  180

Query  1358  LHGPVRPILLQHW--ENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEA  1531
             LHG +R +LL HW  +N+D+D+QV+  LP  +SY  M++ S++C+CPSGYEVASPR+VEA
Sbjct  181   LHGHIRHLLLHHWRDQNQDKDIQVYEKLPSNMSYEKMLKTSKFCLCPSGYEVASPRVVEA  240

Query  1532  LYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVK  1711
             +Y  CVPVLI   YV PFSDVLNW+ FAV++ VEDIPN+K IL GIS+ +Y++MQ+R  +
Sbjct  241   IYAECVPVLISDSYVPPFSDVLNWKKFAVVVAVEDIPNIKNILMGISEGRYLKMQKRVRQ  300

Query  1712  VRRHFEVNSPPKRFDVFHMILHSIW  1786
             V+RHF VN  PKRFD+FHMI+HS+W
Sbjct  301   VQRHFVVNGNPKRFDLFHMIVHSVW  325



>ref|XP_006450385.1| hypothetical protein CICLE_v10008151mg [Citrus clementina]
 gb|ESR63625.1| hypothetical protein CICLE_v10008151mg [Citrus clementina]
Length=479

 Score =   427 bits (1099),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 266/388 (69%), Gaps = 8/388 (2%)
 Frame = +2

Query  647   RKSKRYTYTNMERIEADLARARASILRgggggTQT----KDDDSVPVGPMYRNASFFLRS  814
             R+S     +  E+++  LARARASI +       T       D VP   +YRN   F +S
Sbjct  83    RESSARVLSKNEQLKQGLARARASIRKAASTRNVTSIIKNGVDFVPSAAIYRNPGAFYQS  142

Query  815   YAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFL  988
             Y EMEK  KVYVY +G+ P+ HYGPCK  Y IEG F+  ++    RFRT+DP +AH+Y+L
Sbjct  143   YVEMEKRFKVYVYREGELPITHYGPCKDIYTIEGRFMSEIEHGAKRFRTSDPHRAHVYYL  202

Query  989   PFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEI  1168
             PFS+  + K +Y+P ++D +P+K    DYV  V+ KYPFWNR+ GADHF+L+CHDWGP +
Sbjct  203   PFSVAWMVKYLYKPLTYDLTPLKQFVADYVKVVSSKYPFWNRTCGADHFMLACHDWGPHV  262

Query  1169  SFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSP--SKRPVLV  1342
             S    +L+NNSIR LCNANTSE F+P+KDV++PEI L  G     L  P P  + RP L 
Sbjct  263   SKGNSHLYNNSIRVLCNANTSEGFNPQKDVTLPEIHLYGGYVSPKLLSPPPFNAPRPYLA  322

Query  1343  FYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRM  1522
             F+AGGLHG +R ILLQHW+  D+D+ V  YLPK   Y   M KS++C+CPSGYEVASPR+
Sbjct  323   FFAGGLHGTIRSILLQHWKGHDKDLIVFEYLPKDQDYYSFMLKSKFCLCPSGYEVASPRI  382

Query  1523  VEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRR  1702
             VE++Y  CVPV++ + YV PFSDVL WEAF++ + V +IP LK++L  + + +Y R++  
Sbjct  383   VESIYAQCVPVILSQNYVLPFSDVLRWEAFSIQVDVSEIPRLKEVLMAVPEEKYKRLKEN  442

Query  1703  GVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
                VRRHFE+N P KRFDVFHMILHSIW
Sbjct  443   LKAVRRHFELNHPAKRFDVFHMILHSIW  470



>ref|XP_006856553.1| hypothetical protein AMTR_s00046p00173420 [Amborella trichopoda]
 gb|ERN18020.1| hypothetical protein AMTR_s00046p00173420 [Amborella trichopoda]
Length=332

 Score =   421 bits (1082),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 251/322 (78%), Gaps = 1/322 (0%)
 Frame = +2

Query  824   MEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSI  1000
             MEK LK+++Y++G+PP+AHYGP K  Y++EG FIH +D  +RF T DP+ AHL+F+P S+
Sbjct  1     MEKILKIWIYKEGEPPLAHYGPLKYIYSMEGQFIHELDSGNRFITLDPEHAHLHFIPLSV  60

Query  1001  TVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAI  1180
             T++ + +Y PN +   P+     DYV  ++RKYPFWNR++G+DHFILSCHDW P+ S   
Sbjct  61    TMMVQNLYPPNGYGNGPLHRVVSDYVKVISRKYPFWNRTMGSDHFILSCHDWAPDASIGN  120

Query  1181  PNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGL  1360
              +L +NSIR  CNANTSE FDP++DVS+PEI L      GL+GGPSPS+R VL F+AGG 
Sbjct  121   RDLQHNSIRVFCNANTSEGFDPRRDVSMPEIHLKGWEIDGLIGGPSPSRRSVLAFFAGGK  180

Query  1361  HGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYM  1540
             HG +R +LL+HW++KD +V+VH YLPKG SY+ +M+++++C+CPSG+EVASPR++EA+Y 
Sbjct  181   HGYIRSVLLEHWKDKDSEVRVHEYLPKGQSYSKLMKQAKFCLCPSGWEVASPRIIEAIYT  240

Query  1541  GCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRR  1720
             GCVPV I   YV PFSDVL+W  F+V IPV  IP ++ IL GISQR+Y+++QRR ++V+R
Sbjct  241   GCVPVTISTSYVLPFSDVLDWSKFSVNIPVSRIPEIRTILEGISQRRYLQLQRRVLRVQR  300

Query  1721  HFEVNSPPKRFDVFHMILHSIW  1786
             HF +N P KRFDV HMILHSIW
Sbjct  301   HFVLNRPAKRFDVIHMILHSIW  322



>gb|KEH35171.1| exostosin family protein [Medicago truncatula]
Length=447

 Score =   425 bits (1093),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 197/379 (52%), Positives = 272/379 (72%), Gaps = 8/379 (2%)
 Frame = +2

Query  674   NMERIEADLARARASILRgggggTQT-------KDDDSVPVGPMYRNASFFLRSYAEMEK  832
             N+E++E  LA+ARA I +       T          D VP G +YRNA  F RSY  MEK
Sbjct  60    NLEKVEGSLAKARALIKQALLRTNDTVLALPLEDSHDFVPQGDIYRNAFAFHRSYHLMEK  119

Query  833   TLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVL  1009
               K++VYE+G+PP+ HYGPCK+ Y++EG FI+ ++  + FRT +P++AH YFLPFS+ ++
Sbjct  120   LFKIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLENNTLFRTRNPNEAHAYFLPFSVVMI  179

Query  1010  SKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNL  1189
              + ++ P   D + +  T  DYV+ ++ KY +WNRS GADHF+LSCHDWGP  ++ +  L
Sbjct  180   LEHLFHPVIRDKAVLGRTIGDYVHIISHKYAYWNRSYGADHFMLSCHDWGPRATWYVKEL  239

Query  1190  HNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGP  1369
             +  +IR LCNAN SE F+PKKD S PEI L +G T GLLGG     R +L F+AG +HG 
Sbjct  240   YFIAIRVLCNANISEHFNPKKDASFPEINLVTGETAGLLGGYPTWNRTILAFFAGKMHGK  299

Query  1370  VRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCV  1549
             +RP+L QHW+NKD+DV V+  LP+ +SY+  M+ S+YCICPSG+EVASPR+VEA+Y  CV
Sbjct  300   IRPVLFQHWKNKDKDVLVYEKLPEKISYHETMKMSKYCICPSGWEVASPRIVEAIYAECV  359

Query  1550  PVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFE  1729
             P++I + YV PFSDVL+W++F+V I V +IP LK IL GIS+ +Y+++Q    +V+RHF 
Sbjct  360   PIIISQQYVLPFSDVLDWDSFSVKIEVSEIPKLKDILLGISEEKYMKLQEGVKQVQRHFV  419

Query  1730  VNSPPKRFDVFHMILHSIW  1786
             VN+PPKR+DVFHMI+HSIW
Sbjct  420   VNNPPKRYDVFHMIIHSIW  438



>ref|XP_010250232.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X2 
[Nelumbo nucifera]
Length=473

 Score =   425 bits (1093),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/347 (58%), Positives = 252/347 (73%), Gaps = 4/347 (1%)
 Frame = +2

Query  758   DDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD  937
             D  +P G +YRN S F +SY EMEK  KVYVY+DG PP+ H GPCK  Y IEG FI  M+
Sbjct  111   DADIPKGDIYRNPSEFYQSYVEMEKRFKVYVYQDGDPPMVHEGPCKDIYTIEGRFIEEME  170

Query  938   FSR--FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWN  1111
             F    FRT D  +AH+YFLPFS+T +   +Y+P S+D SP++     YV S++ KYPFWN
Sbjct  171   FGMNGFRTRDAQRAHVYFLPFSVTRMVAYLYQPLSYDISPLQRFVSGYVRSISSKYPFWN  230

Query  1112  RSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGT  1291
             R+ GADHF+LSCHDWGP  +   P L+N SIR LCNANTSE F P+KDVS+PEI L  G 
Sbjct  231   RTQGADHFMLSCHDWGPHATKGNPFLYNTSIRVLCNANTSEGFVPRKDVSLPEINLYDGN  290

Query  1292  -TKGLLGGPSP-SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMM  1465
              +  LL  PS  + RP L F++GGLHGP+RPILLQHW+ +D D++V+ YLPK + Y   M
Sbjct  291   ISPKLLSPPSDDAPRPYLAFFSGGLHGPIRPILLQHWKGQDTDIRVYEYLPKELDYYSFM  350

Query  1466  RKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPN  1645
              +S++C+CPSGYEVASPR+VEA+Y  CVPV++   YV PFSDVL WEAF+V + V DIP 
Sbjct  351   LQSKFCLCPSGYEVASPRIVEAIYAECVPVILSNNYVLPFSDVLRWEAFSVSVRVSDIPR  410

Query  1646  LKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             LKK+L G+S+ +Y +++     VRRHF +N P KRFDVFHMILHSIW
Sbjct  411   LKKVLRGVSEDEYRKLKAGVRAVRRHFVLNQPAKRFDVFHMILHSIW  457



>ref|XP_002285237.2| PREDICTED: probable glycosyltransferase At5g25310 [Vitis vinifera]
 emb|CBI21064.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   425 bits (1093),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/381 (54%), Positives = 271/381 (71%), Gaps = 9/381 (2%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQT-----KDDDSVPVGPMYRNASFFLRSYAEMEKT  835
             T  +  E  LARARASI +      ++     +D++ VP G +YRNA  F +SY EMEK 
Sbjct  89    TRYQGQEEGLARARASIRKAFSNLNRSSEIGGEDNNEVPTGDVYRNAGAFYQSYVEMEKR  148

Query  836   LKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS--RFRTTDPDKAHLYFLPFSITVL  1009
             LKVYVYE+G+ P+ H GPCK  Y IEG FIH ++    +FRT D ++AH+YF+PFS+T +
Sbjct  149   LKVYVYEEGEVPMIHDGPCKDIYTIEGRFIHEIEHGDGKFRTRDAERAHVYFMPFSVTWM  208

Query  1010  SKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNL  1189
              K +Y+P +++ +P++    DYV+ ++ KYPFWN + GADHF+L+CHDWGP  S   P L
Sbjct  209   VKYLYKPLTYNLTPLRQFVSDYVSVISTKYPFWNTTQGADHFMLACHDWGPHASRGHPVL  268

Query  1190  HNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTT--KGLLGGPSPSKRPVLVFYAGGLH  1363
             +N SIR LCNANTSE F+P+KDVS+PEI L  G    K L   P  S RP L F+AGGLH
Sbjct  269   YNTSIRVLCNANTSEGFNPQKDVSLPEIHLYGGNVNPKLLSPPPPNSPRPFLAFFAGGLH  328

Query  1364  GPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMG  1543
             GP+RPIL+QHW  +D D++V+ YLPK + Y  +M +S+YC+CPSG+EVASPR+VEA+Y  
Sbjct  329   GPIRPILIQHWMGRDTDLRVYEYLPKDMDYYSLMLQSKYCLCPSGHEVASPRIVEAIYSE  388

Query  1544  CVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRH  1723
             CVPV++   YV PFSDVL WEAF+V +   +IP LK++L  IS+ +Y R++     VRRH
Sbjct  389   CVPVILSDHYVLPFSDVLRWEAFSVKVEASEIPRLKEVLQAISEEKYTRLKEGVRAVRRH  448

Query  1724  FEVNSPPKRFDVFHMILHSIW  1786
             FE+N P KRFDVFHMILHS+W
Sbjct  449   FELNQPAKRFDVFHMILHSVW  469



>ref|XP_010250231.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Nelumbo nucifera]
Length=482

 Score =   425 bits (1093),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 200/347 (58%), Positives = 252/347 (73%), Gaps = 4/347 (1%)
 Frame = +2

Query  758   DDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD  937
             D  +P G +YRN S F +SY EMEK  KVYVY+DG PP+ H GPCK  Y IEG FI  M+
Sbjct  120   DADIPKGDIYRNPSEFYQSYVEMEKRFKVYVYQDGDPPMVHEGPCKDIYTIEGRFIEEME  179

Query  938   FSR--FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWN  1111
             F    FRT D  +AH+YFLPFS+T +   +Y+P S+D SP++     YV S++ KYPFWN
Sbjct  180   FGMNGFRTRDAQRAHVYFLPFSVTRMVAYLYQPLSYDISPLQRFVSGYVRSISSKYPFWN  239

Query  1112  RSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGT  1291
             R+ GADHF+LSCHDWGP  +   P L+N SIR LCNANTSE F P+KDVS+PEI L  G 
Sbjct  240   RTQGADHFMLSCHDWGPHATKGNPFLYNTSIRVLCNANTSEGFVPRKDVSLPEINLYDGN  299

Query  1292  -TKGLLGGPSP-SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMM  1465
              +  LL  PS  + RP L F++GGLHGP+RPILLQHW+ +D D++V+ YLPK + Y   M
Sbjct  300   ISPKLLSPPSDDAPRPYLAFFSGGLHGPIRPILLQHWKGQDTDIRVYEYLPKELDYYSFM  359

Query  1466  RKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPN  1645
              +S++C+CPSGYEVASPR+VEA+Y  CVPV++   YV PFSDVL WEAF+V + V DIP 
Sbjct  360   LQSKFCLCPSGYEVASPRIVEAIYAECVPVILSNNYVLPFSDVLRWEAFSVSVRVSDIPR  419

Query  1646  LKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             LKK+L G+S+ +Y +++     VRRHF +N P KRFDVFHMILHSIW
Sbjct  420   LKKVLRGVSEDEYRKLKAGVRAVRRHFVLNQPAKRFDVFHMILHSIW  466



>ref|XP_009759830.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
sylvestris]
Length=483

 Score =   425 bits (1092),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 198/385 (51%), Positives = 279/385 (72%), Gaps = 5/385 (1%)
 Frame = +2

Query  647   RKSKRYTYTNMERIEADLARARA----SILRgggggTQTKDDDSVPVGPMYRNASFFLRS  814
             R+ K+    NME+IEA L+ ARA    ++L  G   +  +D D VP G +YRN   F RS
Sbjct  89    RREKKKKDENMEKIEAGLSSARALIRETLLINGTNESPYEDADYVPQGNIYRNPHAFHRS  148

Query  815   YAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAHLYFLP  991
             Y  MEK  K++VY++G+PP+ HYGPCK+ Y++EG FI+ M+ +  F+T +PDKAH+YFLP
Sbjct  149   YLLMEKLFKIFVYKEGEPPLFHYGPCKNIYSMEGMFINLMEANNHFQTLNPDKAHVYFLP  208

Query  992   FSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEIS  1171
             FS+ ++ + +++P   D + ++    DYV +V+ KYP+WNRSLGADHF+LS HDWGP  +
Sbjct  209   FSVVMILEHLFDPIIRDKAVLERILRDYVRTVSTKYPYWNRSLGADHFMLSSHDWGPRAT  268

Query  1172  FAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYA  1351
             + +  ++  SIR LCNANTSE F+P+KDV +PEI L +G   GL+     S + +L F+A
Sbjct  269   WYVHQMYFTSIRVLCNANTSEFFNPRKDVPLPEINLLTGNINGLVEALPKSNKTILGFFA  328

Query  1352  GGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEA  1531
             G  HG +RPIL +HWE KDED++V+S +P  +SY+ MM+ S++C+CPSGYEVASPR+VEA
Sbjct  329   GRSHGRIRPILFRHWEEKDEDIRVYSKIPPELSYDEMMKSSKFCLCPSGYEVASPRIVEA  388

Query  1532  LYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVK  1711
             +Y  CVPVLI + YV PFSDVL+W+ F++ + V ++PNLK IL GIS+ +Y +M     +
Sbjct  389   IYANCVPVLISQNYVLPFSDVLDWDKFSIQVSVSELPNLKNILLGISEERYEKMVEGVRQ  448

Query  1712  VRRHFEVNSPPKRFDVFHMILHSIW  1786
             V+RHF +N PPKR+DVFHMI+HSIW
Sbjct  449   VQRHFVINDPPKRYDVFHMIIHSIW  473



>ref|XP_006856564.1| hypothetical protein AMTR_s00046p00183980 [Amborella trichopoda]
 gb|ERN18031.1| hypothetical protein AMTR_s00046p00183980 [Amborella trichopoda]
Length=462

 Score =   423 bits (1087),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 197/378 (52%), Positives = 271/378 (72%), Gaps = 6/378 (2%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQTKDDDSV--PVGPMYRNASFFLRSYAEMEKTLKV  844
             ++ + IEA LARAR +I         +  +D +  P   ++RN + F RSY EME  LK+
Sbjct  76    SHAQVIEAGLARARKAIKDAASNPNSSLINDPLFSPDPQIFRNPAAFHRSYLEMENRLKI  135

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPFSITVLSKL  1018
             +VY++G+PP+ H GPCK+ Y IEG FIH ++   S F T  P++AHLYFLP S+T +   
Sbjct  136   FVYKEGEPPLVHDGPCKNIYTIEGRFIHELELGTSSFLTKKPEQAHLYFLPLSVTQMVTY  195

Query  1019  VYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNN  1198
             +Y+P S+D +P+K    DYV+ ++ ++PFWN SLGADHF LSCHDW P +S +  NL+N 
Sbjct  196   LYKPLSYDLTPLKRFVSDYVSLISSRHPFWNASLGADHFFLSCHDWAPHVSRSNHNLYNT  255

Query  1199  SIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSK--RPVLVFYAGGLHGPV  1372
             SIR LCNANTSE F+P KD+S+PEI L +G     L  P+  +  RP+L F+AGGLHGP+
Sbjct  256   SIRVLCNANTSEGFNPSKDISLPEINLRTGELPAQLLTPADPRHPRPILAFFAGGLHGPI  315

Query  1373  RPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVP  1552
             RP+LLQ W++KD D++V+ YLPKG++Y  +M KS+YC+CPSGYEVASPR+VEA++ GCVP
Sbjct  316   RPLLLQQWQSKDPDIKVYQYLPKGLNYYDLMSKSKYCLCPSGYEVASPRVVEAIHSGCVP  375

Query  1553  VLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEV  1732
             VLI   YV PFSDVL WEAF V + + +IP +K+IL GI + +Y R++    +VRRHF +
Sbjct  376   VLISNSYVLPFSDVLRWEAFTVSLSLSEIPRVKEILEGIPEGEYQRLRENLGRVRRHFVL  435

Query  1733  NSPPKRFDVFHMILHSIW  1786
             N P +R DVFHM++HS+W
Sbjct  436   NQPAQRLDVFHMVMHSLW  453



>ref|XP_010519637.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X2 
[Tarenaya hassleriana]
Length=465

 Score =   421 bits (1083),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 201/395 (51%), Positives = 272/395 (69%), Gaps = 8/395 (2%)
 Frame = +2

Query  617   GISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNA  796
             G+S   +  S+K ++ T    E +E  LA+ARASILR       T+ +  +P   +Y N 
Sbjct  65    GLSDQSSNISKKQRKLT--KEEELERGLAKARASILRAASDRNTTEYESHLPNAEVYHNP  122

Query  797   SFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDK  970
             + F RSY EMEK  +VYVYE+G  P+ H GPCK  YA+EG FIH ++   +RFRT DP K
Sbjct  123   AAFYRSYVEMEKRFRVYVYEEGVLPLVHDGPCKDVYAVEGRFIHEIERGKTRFRTRDPLK  182

Query  971   AHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCH  1150
             AH+YF+PFS+T L K +Y+ +  D  P+K    DYV +++ KYPFWNRS GADHF+L+CH
Sbjct  183   AHVYFMPFSVTFLVKYLYQGHG-DAKPLKRFVSDYVTTISSKYPFWNRSSGADHFMLACH  241

Query  1151  DWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSP---  1321
             DWGP +S + P+L N SIR LCNAN+SE F+PKKD S+PEI L        L        
Sbjct  242   DWGPLVSKSNPHLFNTSIRVLCNANSSEGFNPKKDASLPEIKLYGSEINPKLTLSKTGDY  301

Query  1322  SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGY  1501
             S+RP L F+AGGLHGP+RPILL+HW+++D D+ VH YLPK +++   M +S++C+CPSGY
Sbjct  302   SQRPYLAFFAGGLHGPIRPILLEHWKHRDPDMPVHEYLPKNLNFYDFMLQSKFCLCPSGY  361

Query  1502  EVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQ  1681
             EVASPR++E++Y  CVPV++ + +V P SDVL WE F+V + V +IP LK+IL  +S+ +
Sbjct  362   EVASPRVIESIYAECVPVILSKNFVLPLSDVLRWETFSVQVDVSEIPRLKEILMSVSEEK  421

Query  1682  YIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             Y  ++R    VRRHF +N PP+RFD FH  LHSIW
Sbjct  422   YRWLRRNLQYVRRHFVLNQPPERFDAFHTTLHSIW  456



>ref|XP_009346174.1| PREDICTED: probable glycosyltransferase At5g25310 [Pyrus x bretschneideri]
Length=492

 Score =   422 bits (1085),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 254/351 (72%), Gaps = 7/351 (2%)
 Frame = +2

Query  755   DDDSVPVGPM-YRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHA  931
             DD   P G + YRN   F +SY EMEK  KVYVY +G PP+ H GPCK  Y+IEG FIH 
Sbjct  133   DDVLFPGGSVVYRNPGAFYQSYTEMEKKFKVYVYSEGDPPMTHDGPCKDIYSIEGRFIHE  192

Query  932   MDFS----RFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKY  1099
             M+      RF+T +P +AH+YF+PFS+T + K VY+P ++D +P++    DYV  V+ ++
Sbjct  193   MENGAAGRRFKTENPQRAHVYFMPFSVTWMVKYVYKPLTYDLTPLRNFVSDYVRMVSVRH  252

Query  1100  PFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVL  1279
             PFWNR+LGADHF+L+CHDW P  S   P L N SIR LCNANTSE F+P+KDVS+PEI L
Sbjct  253   PFWNRTLGADHFMLACHDWAPRASEGNPLLFNTSIRVLCNANTSEGFNPQKDVSLPEIHL  312

Query  1280  PSGTTKGLLGGPSP--SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSY  1453
               GT    L  P P  + RP L F+AGGLHGP+RPILL HW+N+D+D+Q+H YLPKG+ Y
Sbjct  313   YGGTVSSKLISPPPPNTLRPYLAFFAGGLHGPIRPILLAHWKNRDKDLQIHEYLPKGLDY  372

Query  1454  NGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVE  1633
             + M+ KS++C+CPSGYEVASPR+VEA+Y  CVPV++   Y  PFSDVL WEAF+V + V 
Sbjct  373   DSMVLKSKFCLCPSGYEVASPRIVEAIYAECVPVILSEHYALPFSDVLRWEAFSVKVEVS  432

Query  1634  DIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             +I  LK++L GI + +Y R+      VR+HFE+N P KRFDVFHMILHS+W
Sbjct  433   EISRLKEVLMGIPEEKYGRLVENLRVVRKHFELNQPAKRFDVFHMILHSVW  483



>ref|XP_008394108.1| PREDICTED: probable glycosyltransferase At5g25310 [Malus domestica]
Length=492

 Score =   421 bits (1083),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 254/351 (72%), Gaps = 7/351 (2%)
 Frame = +2

Query  755   DDDSVPVGPM-YRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHA  931
             DD   P G + YRN   F +SY EMEK  KVYVY +G PP+ H GPCK  Y+IEG FIH 
Sbjct  133   DDVLFPGGSVVYRNPGAFYQSYTEMEKKFKVYVYSEGDPPMTHDGPCKDIYSIEGRFIHE  192

Query  932   MDFS----RFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKY  1099
             M+      RF+T +P +AH+YF+PFS+T + K +Y+P ++D +P++    DYV  V+ ++
Sbjct  193   MENGAAGRRFKTENPQRAHVYFMPFSVTWMVKYLYKPLTYDLTPLRNFVSDYVRMVSVRH  252

Query  1100  PFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVL  1279
             PFWNR+LGADHF+L+CHDW P  S   P L N SIR LCNANTSE F+P+KDVS+PEI L
Sbjct  253   PFWNRTLGADHFMLACHDWAPRASEGNPLLFNTSIRVLCNANTSEGFNPQKDVSLPEIHL  312

Query  1280  PSGTTKGLLGGPSP--SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSY  1453
               GT    L  P P  + RP L F+AGGLHGP+RPILL HW+N+D+D+Q+H YLPKG+ Y
Sbjct  313   YGGTVSSKLISPPPPNTLRPYLAFFAGGLHGPIRPILLAHWKNRDKDLQIHEYLPKGLDY  372

Query  1454  NGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVE  1633
             + M+ KS++C+CPSGYEVASPR+VEA+Y  CVPV++   Y  PFSDVL WEAF+V + V 
Sbjct  373   DSMVLKSKFCLCPSGYEVASPRIVEAIYAECVPVILSEHYALPFSDVLRWEAFSVKVEVS  432

Query  1634  DIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             +I  LK++L G+ + +Y R+      VR+HFE+N P KRFDVFHMILHSIW
Sbjct  433   EISRLKEVLMGVPEEKYRRLVENLRVVRKHFELNQPAKRFDVFHMILHSIW  483



>ref|XP_007161196.1| hypothetical protein PHAVU_001G050100g [Phaseolus vulgaris]
 gb|ESW33190.1| hypothetical protein PHAVU_001G050100g [Phaseolus vulgaris]
Length=479

 Score =   420 bits (1080),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 209/415 (50%), Positives = 273/415 (66%), Gaps = 19/415 (5%)
 Frame = +2

Query  596   GDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASI-------------LRggg  736
             G ++     +S +   ++ S R     + ++E  LA ARAS+             L    
Sbjct  57    GQNQLHAIANSGELRRNKFSHRTATRKVGKLEQTLAAARASMRNAASESEGERSNLTVAT  116

Query  737   ggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEG  916
                   D + VP G +YRNA  F RSY EMEK  KVYVY DG+ P+AH GPCK  Y+IEG
Sbjct  117   TVHDGGDRNYVPAGAIYRNARLFHRSYLEMEKIFKVYVYPDGELPIAHDGPCKDIYSIEG  176

Query  917   NFIHAMDFS--RFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVA  1090
              F+H M+    RFRT DP+ AH+YFLPFS+T + K +Y P S++ +P+K    DYV  ++
Sbjct  177   RFLHEMEHGAGRFRTNDPNAAHVYFLPFSVTWMVKYLYTPLSYNVTPLKHFVSDYVKVIS  236

Query  1091  RKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPE  1270
              ++PFWNR+ GADHF+L+CHDW P  S     L+N SIR +CNANTSE F+P+KDVS+PE
Sbjct  237   TRHPFWNRTHGADHFMLACHDWAPHASQGNHFLYNTSIRVMCNANTSEGFNPRKDVSLPE  296

Query  1271  IVLPSGTTKGLLGGPSPSK--RPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKG  1444
             I L  G     L  P  +   R  L F++GGLHGP+RPILL HW+N+D D++V  YLPK 
Sbjct  297   IHLYGGEVSPKLLSPQSNNITRRYLAFFSGGLHGPIRPILLHHWKNQDGDIRVFEYLPKD  356

Query  1445  VSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVII  1624
             + Y   M  S++C+CPSG+EVASPR+VEA+Y  CVPV++ + YV PFSDVL WEAF+V +
Sbjct  357   LDYYSFMLNSKFCLCPSGHEVASPRIVEAIYAECVPVILSKYYVLPFSDVLQWEAFSVQV  416

Query  1625  PVEDIPNLKKILTGISQRQYIRMQRRGVK-VRRHFEVNSPPKRFDVFHMILHSIW  1786
              V DIP LK IL+ IS+ +Y R  + GVK VR+HF +N P KRFDVFHMILHSIW
Sbjct  417   DVSDIPRLKDILSAISEDEY-RKLKEGVKAVRKHFTLNRPSKRFDVFHMILHSIW  470



>ref|XP_010519636.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Tarenaya hassleriana]
Length=469

 Score =   420 bits (1079),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/404 (50%), Positives = 273/404 (68%), Gaps = 11/404 (3%)
 Frame = +2

Query  590   GIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSV  769
              +G  ++ + IS    +  RK      T  E +E  LA+ARASILR       T+ +  +
Sbjct  63    SLGLSDQSSNISHQLQKKQRK-----LTKEEELERGLAKARASILRAASDRNTTEYESHL  117

Query  770   PVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--S  943
             P   +Y N + F RSY EMEK  +VYVYE+G  P+ H GPCK  YA+EG FIH ++   +
Sbjct  118   PNAEVYHNPAAFYRSYVEMEKRFRVYVYEEGVLPLVHDGPCKDVYAVEGRFIHEIERGKT  177

Query  944   RFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLG  1123
             RFRT DP KAH+YF+PFS+T L K +Y+ +  D  P+K    DYV +++ KYPFWNRS G
Sbjct  178   RFRTRDPLKAHVYFMPFSVTFLVKYLYQGHG-DAKPLKRFVSDYVTTISSKYPFWNRSSG  236

Query  1124  ADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGL  1303
             ADHF+L+CHDWGP +S + P+L N SIR LCNAN+SE F+PKKD S+PEI L        
Sbjct  237   ADHFMLACHDWGPLVSKSNPHLFNTSIRVLCNANSSEGFNPKKDASLPEIKLYGSEINPK  296

Query  1304  LGGPSP---SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKS  1474
             L        S+RP L F+AGGLHGP+RPILL+HW+++D D+ VH YLPK +++   M +S
Sbjct  297   LTLSKTGDYSQRPYLAFFAGGLHGPIRPILLEHWKHRDPDMPVHEYLPKNLNFYDFMLQS  356

Query  1475  RYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKK  1654
             ++C+CPSGYEVASPR++E++Y  CVPV++ + +V P SDVL WE F+V + V +IP LK+
Sbjct  357   KFCLCPSGYEVASPRVIESIYAECVPVILSKNFVLPLSDVLRWETFSVQVDVSEIPRLKE  416

Query  1655  ILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             IL  +S+ +Y  ++R    VRRHF +N PP+RFD FH  LHSIW
Sbjct  417   ILMSVSEEKYRWLRRNLQYVRRHFVLNQPPERFDAFHTTLHSIW  460



>ref|XP_009355772.1| PREDICTED: probable glycosyltransferase At5g25310 [Pyrus x bretschneideri]
Length=492

 Score =   420 bits (1080),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 254/351 (72%), Gaps = 7/351 (2%)
 Frame = +2

Query  755   DDDSVPVGPM-YRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHA  931
             DD   P G + YRN   F +SY EMEK  KVYVY +G PP+ H GPCK  Y+IEG FIH 
Sbjct  133   DDVLFPGGSVVYRNPGAFYQSYTEMEKKFKVYVYSEGDPPMTHDGPCKDIYSIEGRFIHE  192

Query  932   MDFS----RFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKY  1099
             M+      RF+T +P +AH+YF+PFS+T + K +Y+P ++D +P++    DYV  V+ ++
Sbjct  193   MENGAAGRRFKTENPQRAHVYFMPFSVTWMVKYLYKPLTYDLTPLRNFVSDYVRMVSVRH  252

Query  1100  PFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVL  1279
             PFWNR+LGADHF+L+CHDW P  S   P L N SIR LCNANTSE F+P+KDVS+PEI L
Sbjct  253   PFWNRTLGADHFMLACHDWAPRASEGNPLLFNTSIRVLCNANTSEGFNPQKDVSLPEIHL  312

Query  1280  PSGTTKGLLGGPSP--SKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSY  1453
               GT    L  P P  + RP L F+AGGLHGP+RPILL HW+N+D+D+Q+H YLPKG+ Y
Sbjct  313   YGGTVSPKLISPPPPNTLRPYLAFFAGGLHGPIRPILLAHWKNRDKDLQIHEYLPKGLDY  372

Query  1454  NGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVE  1633
             + M+ KS++C+CPSGYEVASPR+VEA+Y  CVPV++   Y  PFSDVL WEAF+V + V 
Sbjct  373   DSMVLKSKFCLCPSGYEVASPRIVEAIYAECVPVILSEHYALPFSDVLRWEAFSVKVEVS  432

Query  1634  DIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             +I  LK++L G+ + +Y R+      VR+HFE+N P KRFDVFHMILHSIW
Sbjct  433   EISRLKEVLMGVPEEKYGRLVENLRVVRKHFELNQPAKRFDVFHMILHSIW  483



>emb|CDP13539.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   422 bits (1084),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/339 (56%), Positives = 253/339 (75%), Gaps = 4/339 (1%)
 Frame = +2

Query  782   MYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRT  955
             +YRN + F +SYAEMEK  KVYVYE+G+ P+ HYGPCK+ YAIEG FIH M+   +RFRT
Sbjct  193   IYRNPAAFFQSYAEMEKRFKVYVYEEGELPIVHYGPCKNIYAIEGRFIHEMEHGGNRFRT  252

Query  956   TDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHF  1135
              DP   H+YF+PFS+T + K +Y+PN+++ SP+K  A DYV +++  +PFWNR+ GADHF
Sbjct  253   RDPHSGHVYFMPFSVTWMVKYLYKPNTYNISPLKQFASDYVRAISTNHPFWNRTQGADHF  312

Query  1136  ILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGP  1315
             +LSCHDWGP  S   P L+N SIR LCNAN+SE F+P+KDVS+PEI L  G     +  P
Sbjct  313   MLSCHDWGPHASRGNPFLYNTSIRVLCNANSSEGFNPRKDVSLPEIQLYDGDVSSKIRNP  372

Query  1316  SPSKR--PVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCIC  1489
              P+ R  P L F+AGGLHGP+RPIL+QHW+ +D  ++V+ YLPKG+ Y   M KS++C+C
Sbjct  373   PPANRSRPYLAFFAGGLHGPIRPILVQHWKGRDAAIRVYEYLPKGLDYYTFMLKSKFCLC  432

Query  1490  PSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGI  1669
             PSG+EVASPR+VEA+Y  CVPV++ + YV PFSDVL WEAF++ + + +IP LK+IL  I
Sbjct  433   PSGHEVASPRIVEAIYAECVPVILSKHYVLPFSDVLRWEAFSIKVEISEIPRLKEILMAI  492

Query  1670  SQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
                +Y R++     VRRHF +N P +RFD+FHMILHS+W
Sbjct  493   PDDEYKRLKEGLRAVRRHFVLNHPAQRFDMFHMILHSVW  531



>ref|XP_006394779.1| hypothetical protein EUTSA_v10004121mg [Eutrema salsugineum]
 gb|ESQ32065.1| hypothetical protein EUTSA_v10004121mg [Eutrema salsugineum]
Length=477

 Score =   419 bits (1077),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 206/398 (52%), Positives = 269/398 (68%), Gaps = 16/398 (4%)
 Frame = +2

Query  620   ISSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNAS  799
             I S +T   RK K+ +   M  +E  L +ARASIL        T  +  +P   +YRN S
Sbjct  78    IRSSNTSSQRKPKKLSRRKM--VEQGLGKARASILEAASNRDATLFNIDLPNPQVYRNPS  135

Query  800   FFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKA  973
                RSY EMEK  KVYVYE+G+ P+AH GPCKS YA+EG FI  M+   ++FRT DPD+A
Sbjct  136   ALYRSYLEMEKRFKVYVYEEGERPLAHDGPCKSVYAVEGRFITEMEKRKTKFRTYDPDQA  195

Query  974   HLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHD  1153
             H+YFLPFS+T L + +YE N HD  P++  A DY+  ++  +PFWNR+ GADHF+L+CHD
Sbjct  196   HVYFLPFSVTWLVRYLYEGN-HDAKPLRTFASDYIRLISINHPFWNRTSGADHFMLACHD  254

Query  1154  WGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGT-------TKGLLGG  1312
             WGP  S A  +L N SIR LCNAN+SE F+P KDV++PE+ L  G        +K L+  
Sbjct  255   WGPLTSKANKDLFNKSIRVLCNANSSEGFNPTKDVTLPEVSLHGGEVHPQLRFSKTLMAS  314

Query  1313  PSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICP  1492
             P    RP L F+AGG+HGPVRPILL+HW+ +D D+ V  YLPK ++Y   MR S++C CP
Sbjct  315   P----RPHLAFFAGGVHGPVRPILLKHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCP  370

Query  1493  SGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGIS  1672
             SGYEVASPR+ EA++  C+PV++   +V PFSDVL W+ F+V + V +IP LK+IL  IS
Sbjct  371   SGYEVASPRVTEAIFSECIPVILSVNFVLPFSDVLRWDTFSVQVDVSEIPRLKEILMSIS  430

Query  1673  QRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
               +Y  ++R    VRRHFE+N PPKRFD FHM LHSIW
Sbjct  431   DEKYEWLKRNLRYVRRHFELNDPPKRFDAFHMTLHSIW  468



>ref|XP_004501350.1| PREDICTED: probable glycosyltransferase At5g25310-like [Cicer 
arietinum]
Length=476

 Score =   417 bits (1073),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/398 (52%), Positives = 270/398 (68%), Gaps = 18/398 (5%)
 Frame = +2

Query  635   TEDSRKSKRYTYTNMERIEADLARARASILRgggggTQTK---------DDDSVPVGPMY  787
             T + RK K    +  E+ E  LARAR SI +   G  ++          +D  +P G +Y
Sbjct  74    TREVRKVK----SKEEKREEGLARARGSIRKAALGDDRSNLSLSKSPHNNDGYIPAGAVY  129

Query  788   RNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD--FSRFRTTD  961
              N   F +SY EMEK  KVYVY DG  P+ H GPCK  Y+IEG F+H M+    RFRT D
Sbjct  130   HNPRLFYQSYLEMEKIFKVYVYPDGDLPIVHDGPCKDIYSIEGRFLHEMEHGVGRFRTND  189

Query  962   PDKAHLYFLPFSITVLSKLVYEPNS-HDWSPMKITALDYVNSVARKYPFWNRSLGADHFI  1138
             P+ AH+YFLPFS+T + K +Y P+S +D +P+K    DYV  V+ +YPFWN++ GADHF+
Sbjct  190   PNAAHVYFLPFSVTWMVKYLYTPSSNYDITPLKQFVSDYVRMVSMRYPFWNKTRGADHFM  249

Query  1139  LSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG--TTKGLLGG  1312
             L+CHDWGP  S   P L+N SIR LCNANTSE F+P KDV++PEI L  G  + K L   
Sbjct  250   LACHDWGPHASKGNPFLYNTSIRVLCNANTSEGFNPLKDVTLPEIHLYGGEVSPKLLSLP  309

Query  1313  PSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICP  1492
             P  + R  L F+AGG+HGP+RPILL HW+N+D D+ V+ YLPKG+ Y  +M  S++C+CP
Sbjct  310   PENAPRRYLAFFAGGMHGPIRPILLHHWKNRDSDINVYEYLPKGLDYYSLMLNSKFCLCP  369

Query  1493  SGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGIS  1672
             SG+EVASPR+VE++Y  CVPV++   YV PFSDVL WEAF+V + V +IP LK++L  I 
Sbjct  370   SGHEVASPRIVESIYAECVPVILSNYYVLPFSDVLRWEAFSVQVDVSNIPRLKEVLNAIP  429

Query  1673  QRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             + +Y ++++    VRRHF +N P KRFDVFHMILHSIW
Sbjct  430   ESKYRKLKQGVRAVRRHFTLNQPAKRFDVFHMILHSIW  467



>ref|XP_011036587.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Populus euphratica]
Length=490

 Score =   418 bits (1074),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 259/378 (69%), Gaps = 9/378 (2%)
 Frame = +2

Query  680   ERIEADLARARASI-----LRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             E +E  LARARA+I     L G         D++   G +Y NA  F +SY EMEK  KV
Sbjct  104   EEMEHGLARARATIRKAASLTGNISRIVADGDENDVAGAIYLNARAFYQSYMEMEKRFKV  163

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPFSITVLSKL  1018
             +VY +G+ P+ H GPCK  Y IEG FIH M+    RF+T DP +AH+YF+PFS+  + K 
Sbjct  164   HVYSEGELPIVHDGPCKDIYTIEGRFIHEMEHGAKRFKTRDPLRAHVYFMPFSVAWMVKY  223

Query  1019  VYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNN  1198
             +Y+P ++D + MK    DYV  V+ KYPFWNR+ GADHF+LSCHDWGP  S   P L+N 
Sbjct  224   LYKPLTYDHTAMKQFVADYVRVVSSKYPFWNRTQGADHFMLSCHDWGPHASHGNPFLYNT  283

Query  1199  SIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSP--SKRPVLVFYAGGLHGPV  1372
             SIR LCNAN+SE F P+KDVS+PEI L  G     L  P P  S RP L F++GGLHGP+
Sbjct  284   SIRVLCNANSSEGFSPRKDVSLPEIHLYGGNVPPKLISPPPATSPRPYLAFFSGGLHGPI  343

Query  1373  RPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVP  1552
             RPILL HW+ +D D+QVH YLPK + Y   M +S++C+CPSG+EVASPR+VEA+Y  CVP
Sbjct  344   RPILLDHWKGRDPDLQVHEYLPKDLDYYSFMLRSKFCLCPSGHEVASPRIVEAIYAECVP  403

Query  1553  VLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEV  1732
             V++   YV PFSDVL WEAFA+ + V +IP LK++L  + + +Y R++     +R+HF +
Sbjct  404   VILSDHYVLPFSDVLRWEAFAIQVNVSEIPRLKEVLISVPEEKYRRLKEGLRAIRKHFVL  463

Query  1733  NSPPKRFDVFHMILHSIW  1786
             N P KRFDVFHMILHSIW
Sbjct  464   NQPAKRFDVFHMILHSIW  481



>ref|XP_011085421.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Sesamum indicum]
Length=410

 Score =   415 bits (1066),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 196/378 (52%), Positives = 269/378 (71%), Gaps = 9/378 (2%)
 Frame = +2

Query  674   NMERIEADLARARA----SILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLK  841
              MERIEA L++ARA    +IL+        +D D VP G +YRNA  F RSY  MEK  K
Sbjct  25    KMERIEAGLSKARAFIKDAILKSRYSPPLAQDTDYVPRGDIYRNAYVFQRSYMLMEKMFK  84

Query  842   VYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKL  1018
             +YVYE+G+ P+ HYGP K  Y+ EG F+  ++  ++FRT D D+AH+YFLPFS+ ++ + 
Sbjct  85    IYVYEEGEAPLFHYGPSKDIYSTEGIFLGLIESNTQFRTYDADEAHVYFLPFSVVMILQH  144

Query  1019  VYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNN  1198
             +++P + D   ++    DYV+ V+ KYP+WNRSLGADHF+LSCHDWGP  ++   +L+  
Sbjct  145   LFDPVTRDKGVLERVVGDYVHIVSTKYPYWNRSLGADHFMLSCHDWGPRATWYEHHLYFT  204

Query  1199  SIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRP  1378
             S+R LCNANTSE F+P+KD+S PEI L +G   GL  G S   R +L F+AG LHG +RP
Sbjct  205   SMRVLCNANTSEFFNPRKDISFPEINLRTGDLTGLTSGSS--NRTILAFFAGRLHGRIRP  262

Query  1379  ILLQHWENKDEDVQVHSYLPKG--VSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVP  1552
             +L QHW++KD DV+V+  LP+   +SY  MM +S+YC+CPSGYEVASPR+VEA+Y  CVP
Sbjct  263   VLFQHWKDKDSDVKVYERLPENSPLSYKEMMERSKYCLCPSGYEVASPRIVEAIYAECVP  322

Query  1553  VLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEV  1732
             VLI   YV PFSDVL+W+ F++ + V ++P LK+IL GI + +Y  + R   +V+RHF V
Sbjct  323   VLISENYVLPFSDVLDWDKFSIKVSVRELPELKRILMGIGEDEYKALHRGVRQVQRHFVV  382

Query  1733  NSPPKRFDVFHMILHSIW  1786
             N PPKR+DVFHM++HS+W
Sbjct  383   NDPPKRYDVFHMMIHSLW  400



>ref|XP_004288781.1| PREDICTED: probable glycosyltransferase At5g20260-like [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   417 bits (1073),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/380 (51%), Positives = 266/380 (70%), Gaps = 8/380 (2%)
 Frame = +2

Query  671   TNMERIEADLARARASILRggggg--TQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             T++ERIE DLA+ARASIL        +  K++  +P G +Y+N   F +S+ EM K  K+
Sbjct  93    TSLERIEEDLAKARASILEAIQSKNYSSEKEESFIPRGSIYKNPYAFHQSHLEMMKRFKM  152

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPFSITVLSKL  1018
             + YE+G+ P+ H+GP  + Y IEG+FI  ++   S FR T PD+AH++FLPFS+  + + 
Sbjct  153   WSYEEGEQPLVHFGPMNNIYGIEGHFIDEIEREGSPFRATHPDEAHMFFLPFSVANIVQY  212

Query  1019  VYEP--NSHDW--SPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPN  1186
             VY P     D+    ++  A+DY+  VA KYP+WNRS GADHF+ SCHDW PEIS   P 
Sbjct  213   VYLPITKKQDYHRDRLQQIAMDYIGVVAHKYPYWNRSKGADHFMASCHDWAPEISVGKPE  272

Query  1187  LHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHG  1366
             L  N IR LCNANTSE F PK+DV +PEI +P+G       G +P+ R +L F+AG +HG
Sbjct  273   LFRNFIRVLCNANTSEGFQPKRDVPLPEIFVPTGKLGPPNLGQAPNNRQILAFFAGRVHG  332

Query  1367  PVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGC  1546
             P+RPILL+HW++KD +V+VH  LPKG++Y  +M +S++C+CPSG+EVASPR+VEALY GC
Sbjct  333   PIRPILLEHWKDKDNEVRVHEKLPKGMNYTKLMGQSKFCLCPSGFEVASPRVVEALYAGC  392

Query  1547  VPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHF  1726
             VPVLI   Y  PFSDVL+W  F++ +PV  IP +K IL  I   +Y++MQRR +KV+RHF
Sbjct  393   VPVLISDNYSLPFSDVLDWSQFSIQVPVAKIPEIKTILQAIPNEEYLKMQRRVLKVQRHF  452

Query  1727  EVNSPPKRFDVFHMILHSIW  1786
              +N P K FDV HM+LHS+W
Sbjct  453   VLNKPAKPFDVIHMVLHSVW  472



>ref|XP_010683539.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=496

 Score =   418 bits (1074),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/391 (52%), Positives = 284/391 (73%), Gaps = 14/391 (4%)
 Frame = +2

Query  638   EDSRKSKRYTYTNMERIEADLARARASILRgggggTQTKD------DDSVPVGPMYRNAS  799
             +D +K ++     +E IE  L RAR S+++       T +       D VP G +Y+NA 
Sbjct  101   KDRKKDQK-----VEIIEVTLGRAR-SLIKEAIQSRNTSNLFVEDQVDYVPHGNIYKNAF  154

Query  800   FFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS-RFRTTDPDKAH  976
              F RSY  MEK  K+Y+YE+G+PP+ HYGPCK+ Y++EG FI+ ++ + +FR  DPD+A 
Sbjct  155   AFHRSYLLMEKMFKIYIYEEGEPPLFHYGPCKNIYSMEGIFINLLEKNNQFRAKDPDEAQ  214

Query  977   LYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDW  1156
             +YFLPFS+ ++ + +++P   D + ++ T LDYV+ ++ KYP+WNRSLGADHF+LSCHDW
Sbjct  215   VYFLPFSVVMILQHLFDPIIRDKAVLERTILDYVSVISHKYPYWNRSLGADHFMLSCHDW  274

Query  1157  GPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLL-GGPSPSKRP  1333
             GP  ++  P L+ +SIRALCNANTSE F+P+KD SIPEI L +G    LL G   PS+R 
Sbjct  275   GPRATWYHPLLYFHSIRALCNANTSENFNPRKDASIPEINLKTGEFAALLHGSLPPSERT  334

Query  1334  VLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVAS  1513
             +L F+AG +HG +RP LL +W++KD+D+QV+  LPK +SY  MM++S+YC+CPSG+EVAS
Sbjct  335   ILAFFAGRMHGHIRPALLTYWKDKDKDLQVYEELPKEISYGEMMKRSKYCLCPSGFEVAS  394

Query  1514  PRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRM  1693
             PR+VEA+Y  CVPVLI + Y+ PFSDVL+W +F+V + V +IPNLKKIL  I   +Y++M
Sbjct  395   PRIVEAIYAECVPVLISQNYILPFSDVLDWSSFSVQVSVSEIPNLKKILMEIPYDKYLQM  454

Query  1694  QRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             Q    +V+RHF +N PPKRFDVFHMI+HSIW
Sbjct  455   QEGVKQVQRHFVMNDPPKRFDVFHMIIHSIW  485



>ref|NP_197913.4| Exostosin family protein [Arabidopsis thaliana]
 sp|Q3E7Q9.2|GLYT6_ARATH RecName: Full=Probable glycosyltransferase At5g25310 [Arabidopsis 
thaliana]
 gb|AED93425.1| Exostosin family protein [Arabidopsis thaliana]
Length=480

 Score =   416 bits (1069),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 208/421 (49%), Positives = 272/421 (65%), Gaps = 18/421 (4%)
 Frame = +2

Query  539   ENNVTGDSRPILLAPETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARAS  718
             EN V  DSR +             Q  ++   T  + +SK         +E  LA+ARAS
Sbjct  64    ENRVVVDSRHV------------SQQILTVRSTNSTLQSKPEKLNRRNLVEQGLAKARAS  111

Query  719   ILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKS  898
             IL        T     +P   +YRN S   RSY EMEK  KVYVYE+G+PP+ H GPCKS
Sbjct  112   ILEASSNVNTTLFKSDLPNSEIYRNPSALYRSYLEMEKRFKVYVYEEGEPPLVHDGPCKS  171

Query  899   TYAIEGNFIHAMDFSR--FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALD  1072
              YA+EG FI  M+  R  FRT DP++A++YFLPFS+T L + +YE NS D  P+K    D
Sbjct  172   VYAVEGRFITEMEKRRTKFRTYDPNQAYVYFLPFSVTWLVRYLYEGNS-DAKPLKTFVSD  230

Query  1073  YVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKK  1252
             Y+  V+  +PFWNR+ GADHF+L+CHDWGP  S A  +L N SIR +CNAN+SE F+P K
Sbjct  231   YIRLVSTNHPFWNRTNGADHFMLTCHDWGPLTSQANRDLFNTSIRVMCNANSSEGFNPTK  290

Query  1253  DVSIPEIVLPSGTTKGLL---GGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQV  1423
             DV++PEI L  G     L      S S RP L F+AGG+HGPVRPILL+HW+ +D D+ V
Sbjct  291   DVTLPEIKLYGGEVDHKLRLSKTLSASPRPYLGFFAGGVHGPVRPILLKHWKQRDLDMPV  350

Query  1424  HSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNW  1603
             + YLPK ++Y   MR S++C CPSGYEVASPR++EA+Y  C+PV++   +V PF+DVL W
Sbjct  351   YEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRVIEAIYSECIPVILSVNFVLPFTDVLRW  410

Query  1604  EAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSI  1783
             E F+V++ V +IP LK+IL  IS  +Y  ++     VRRHFE+N PP+RFD FH+ LHSI
Sbjct  411   ETFSVLVDVSEIPRLKEILMSISNEKYEWLKSNLRYVRRHFELNDPPQRFDAFHLTLHSI  470

Query  1784  W  1786
             W
Sbjct  471   W  471



>ref|XP_004292977.1| PREDICTED: probable glycosyltransferase At5g25310-like [Fragaria 
vesca subsp. vesca]
Length=497

 Score =   414 bits (1063),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 199/397 (50%), Positives = 264/397 (66%), Gaps = 11/397 (3%)
 Frame = +2

Query  629   DDTEDSRKSKRYTYTNMERIEADLARARASILRggggg-----TQTKDDDSVPVGPMYRN  793
             + T     +KR   +   ++E  LARAR+SI            +    +D V  G +YRN
Sbjct  92    NQTPPREAAKRKRRSGRSKMEEGLARARSSIRTAAAASGDPNRSSPPQNDVVSHGVVYRN  151

Query  794   ASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFS----RFRTTD  961
                F +SY EME+  KVYVY +G  P+ H GPCK  Y+IEG FIH M+      RFRT +
Sbjct  152   PRAFHQSYLEMERKFKVYVYSEGDLPITHDGPCKDIYSIEGRFIHEMETGAKAGRFRTKN  211

Query  962   PDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFIL  1141
             P +AH+YF+PFS+T + K +Y+P S+D  P++    DYV  V+ KYPFWNR+ GADHF+L
Sbjct  212   PKEAHVYFMPFSVTWMVKYLYKPLSYDLRPLREYVSDYVRLVSEKYPFWNRTSGADHFML  271

Query  1142  SCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSP  1321
             +CHDW P  S   P L+N SIR LCNANTSE F P+KDVS+PEI L  G     L  P P
Sbjct  272   ACHDWAPHASAGNPFLYNTSIRVLCNANTSEGFRPQKDVSLPEIHLYGGYVSSKLISPPP  331

Query  1322  SK--RPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPS  1495
             +   RP L F+AGGLHGP+RPILL +W+ +DE ++V  YLPK + YN MM +S++C+CPS
Sbjct  332   TNTPRPYLAFFAGGLHGPIRPILLDYWKGRDESLRVFEYLPKTLDYNSMMLESKFCLCPS  391

Query  1496  GYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQ  1675
             G+EVASPR+VEA+Y  CVPV+I   Y  PFSDVL WEAF++ + V +I  LK+IL  + +
Sbjct  392   GHEVASPRIVEAIYAECVPVIISEHYALPFSDVLRWEAFSIKVEVSEIKRLKEILEAVPE  451

Query  1676  RQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
              +Y  +++    VR+HFE+N P KRFDVFHMI+HS+W
Sbjct  452   EKYRWLKKNLKVVRKHFELNHPAKRFDVFHMIMHSVW  488



>ref|XP_011085420.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Sesamum indicum]
Length=513

 Score =   414 bits (1065),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 196/377 (52%), Positives = 269/377 (71%), Gaps = 9/377 (2%)
 Frame = +2

Query  677   MERIEADLARARA----SILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             MERIEA L++ARA    +IL+        +D D VP G +YRNA  F RSY  MEK  K+
Sbjct  129   MERIEAGLSKARAFIKDAILKSRYSPPLAQDTDYVPRGDIYRNAYVFQRSYMLMEKMFKI  188

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-SRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             YVYE+G+ P+ HYGP K  Y+ EG F+  ++  ++FRT D D+AH+YFLPFS+ ++ + +
Sbjct  189   YVYEEGEAPLFHYGPSKDIYSTEGIFLGLIESNTQFRTYDADEAHVYFLPFSVVMILQHL  248

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             ++P + D   ++    DYV+ V+ KYP+WNRSLGADHF+LSCHDWGP  ++   +L+  S
Sbjct  249   FDPVTRDKGVLERVVGDYVHIVSTKYPYWNRSLGADHFMLSCHDWGPRATWYEHHLYFTS  308

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             +R LCNANTSE F+P+KD+S PEI L +G   GL  G S   R +L F+AG LHG +RP+
Sbjct  309   MRVLCNANTSEFFNPRKDISFPEINLRTGDLTGLTSGSS--NRTILAFFAGRLHGRIRPV  366

Query  1382  LLQHWENKDEDVQVHSYLPKG--VSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
             L QHW++KD DV+V+  LP+   +SY  MM +S+YC+CPSGYEVASPR+VEA+Y  CVPV
Sbjct  367   LFQHWKDKDSDVKVYERLPENSPLSYKEMMERSKYCLCPSGYEVASPRIVEAIYAECVPV  426

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             LI   YV PFSDVL+W+ F++ + V ++P LK+IL GI + +Y  + R   +V+RHF VN
Sbjct  427   LISENYVLPFSDVLDWDKFSIKVSVRELPELKRILMGIGEDEYKALHRGVRQVQRHFVVN  486

Query  1736  SPPKRFDVFHMILHSIW  1786
              PPKR+DVFHM++HS+W
Sbjct  487   DPPKRYDVFHMMIHSLW  503



>ref|XP_010696519.1| PREDICTED: probable glycosyltransferase At5g25310 [Beta vulgaris 
subsp. vulgaris]
Length=475

 Score =   412 bits (1059),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/345 (56%), Positives = 249/345 (72%), Gaps = 4/345 (1%)
 Frame = +2

Query  764   SVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF-  940
             + P   +YRN   F +SY EME+ LKVYVYE+G  P+ H GPCK  Y IEG FIH ++  
Sbjct  122   NAPSTFIYRNPRAFYQSYLEMERRLKVYVYEEGDLPIVHDGPCKDIYTIEGRFIHEVEHG  181

Query  941   -SRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRS  1117
              +RFRT DP+ AH+YF+PFS+T + K +Y+P S++ +P++    DYVN ++ KY FWNR+
Sbjct  182   AARFRTRDPNHAHIYFMPFSVTWMVKYLYKPMSYNVTPLRHFVSDYVNVISTKYAFWNRT  241

Query  1118  LGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTT-  1294
              GADHF+L+CHDWGP  S   PNL+NNSIR LCNAN+SE F+P+KDVS+PEI L  G   
Sbjct  242   QGADHFMLACHDWGPHASSGNPNLYNNSIRVLCNANSSEGFNPQKDVSLPEIHLYDGNIS  301

Query  1295  -KGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRK  1471
              K L   P  S RP L F+AGGLHGP+RPILL  W+ +D D+QVH YLPK + Y  MM +
Sbjct  302   PKLLSIPPQTSPRPYLAFFAGGLHGPIRPILLNQWKGRDPDLQVHEYLPKDLDYYTMMLQ  361

Query  1472  SRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLK  1651
             S++C+CPSG+EVASPR+VEA+Y  CVPV++ + YV PFSDVL WEAF++ + V +IP LK
Sbjct  362   SKFCLCPSGHEVASPRLVEAIYAECVPVILSKNYVLPFSDVLKWEAFSIEVDVSEIPRLK  421

Query  1652  KILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             +IL  +   +Y R+      VR HF +N P KRFDVFHMILHS+W
Sbjct  422   EILRAVPDEKYRRLIEGIRAVREHFVLNRPAKRFDVFHMILHSVW  466



>ref|XP_006287596.1| hypothetical protein CARUB_v10000808mg [Capsella rubella]
 gb|EOA20494.1| hypothetical protein CARUB_v10000808mg [Capsella rubella]
Length=493

 Score =   412 bits (1060),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 213/445 (48%), Positives = 284/445 (64%), Gaps = 24/445 (5%)
 Frame = +2

Query  485   SRLPALVTTEEEIDKGLHENNVTGDSRPILLAPETGIGDDERQNGISSDDTEDS-RKSKR  661
             S +  +   EEEI+       V  DSR +             Q  +S   T  S ++SK 
Sbjct  53    SNVYTITAAEEEIENRAAAAVVVVDSRHV------------SQQILSLRSTNSSLQQSKP  100

Query  662   YTYTNMERIEADLARARASILRgggggTQTKDDDSV-----PVGPMYRNASFFLRSYAEM  826
                  +  +E  LA+ARASIL        +  + ++     P   +YRN S   RSY EM
Sbjct  101   EKLNRINSVERGLAKARASILEASSSSPSSHRNTTLFSIDLPNPEIYRNPSALHRSYLEM  160

Query  827   EKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPFSI  1000
             EK  KVYVYE+G+PP+ H GPCKS YA+EG FI+ M+   +RFRT DP++A++YFLPFS+
Sbjct  161   EKRFKVYVYEEGEPPLVHDGPCKSVYAVEGRFIYEMERRKARFRTYDPNQAYVYFLPFSV  220

Query  1001  TVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAI  1180
             T L + +YE NS D  P++    DYV  V+  +PFWNR+ GADHF+L+CHDWGP  S A 
Sbjct  221   TWLVRYLYEGNS-DAKPLRTFVSDYVRLVSTNHPFWNRTNGADHFMLACHDWGPLTSRAN  279

Query  1181  PNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTK---GLLGGPSPSKRPVLVFYA  1351
              +L N SIR LCNAN+SE F+P KDV++PEI L  G       L    S S RP L F+A
Sbjct  280   KHLFNTSIRVLCNANSSEGFNPTKDVTLPEIKLVGGEVDPKLRLSATLSASPRPYLAFFA  339

Query  1352  GGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEA  1531
             GG+HGPVRPILL+HW+ +D D+ V  YLPK ++Y   MR S++C CPSGYEVASPR++E+
Sbjct  340   GGVHGPVRPILLKHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRVIES  399

Query  1532  LYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVK  1711
             +Y  C+PV++   +V PF+DVL WE F+V++ V +IP LK+IL  IS  +Y  ++R    
Sbjct  400   IYSECIPVILSVNFVLPFTDVLRWETFSVLVDVSEIPRLKEILMSISDEKYEWLKRNLRS  459

Query  1712  VRRHFEVNSPPKRFDVFHMILHSIW  1786
             VRRHFE+N PPKR+D FH+ LHSIW
Sbjct  460   VRRHFELNDPPKRYDAFHLTLHSIW  484



>ref|XP_009407372.1| PREDICTED: probable glycosyltransferase At5g25310 [Musa acuminata 
subsp. malaccensis]
Length=502

 Score =   412 bits (1060),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 251/347 (72%), Gaps = 13/347 (4%)
 Frame = +2

Query  782   MYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR-----  946
             +YRN + F RSY EME+  +VYVYE+G+PP+ H GPCK+ Y  EG FI  M+ +R     
Sbjct  148   IYRNPTAFFRSYTEMERRFRVYVYEEGEPPLVHEGPCKNIYTTEGRFIEEMEITRPDSGS  207

Query  947   ---FRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRS  1117
                 RT DP +AH +FLPFS+T +   ++ P+ +D +  K    DYV+ +A K+PFWNRS
Sbjct  208   RRRLRTWDPARAHAFFLPFSVTNMVHFIHRPSPYDHTTFKRFVADYVDVIASKHPFWNRS  267

Query  1118  LGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG-TT  1294
              GADHF+LSCHDWGP  S + PNL+ NSIRALCNANTSE FDP+KDVSIPEI L +G   
Sbjct  268   AGADHFMLSCHDWGPHASRSNPNLYENSIRALCNANTSEGFDPRKDVSIPEINLYTGHVP  327

Query  1295  KGLLGG--PSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMR  1468
             + LL    P  + RP L F+AGGLHGP+R +LL+HW+ +D  + VH YLP G+ Y   M 
Sbjct  328   RQLLAPRLPGLASRPYLAFFAGGLHGPIRHLLLRHWKGRDAGLPVHEYLPHGLDYYSFML  387

Query  1469  KSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNL  1648
             +SR+C+CPSGYEVASPR+VEA+Y  CVPV+I + YV PFSDVL WE+F+V + VEDIP L
Sbjct  388   RSRFCLCPSGYEVASPRVVEAIYAECVPVIISKSYVLPFSDVLRWESFSVSVAVEDIPRL  447

Query  1649  KKILTGISQRQYIRMQRRGVK-VRRHFEVNSPPKRFDVFHMILHSIW  1786
             K++L G+S  +  ++ R GVK V+RHF +N P KRFDVFHMILHS+W
Sbjct  448   KQVLEGVSMAELSKL-RDGVKAVKRHFVLNQPAKRFDVFHMILHSVW  493



>ref|XP_002515489.1| catalytic, putative [Ricinus communis]
 gb|EEF46938.1| catalytic, putative [Ricinus communis]
Length=481

 Score =   412 bits (1058),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 194/373 (52%), Positives = 261/373 (70%), Gaps = 5/373 (1%)
 Frame = +2

Query  680   ERIEADLARARASILRgggggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYED  859
             E +E  LARARASI +    G+     D V    +YRN + F +SY EME+  KVYVY +
Sbjct  101   EELEQGLARARASIRKAVTFGSDVNRSDVVR-NVIYRNPAAFYQSYMEMERRFKVYVYSE  159

Query  860   GQPPVAHYGPCKSTYAIEGNFIHAMDFS--RFRTTDPDKAHLYFLPFSITVLSKLVYEPN  1033
             G PP+ H GPCK  Y IEG FIH M+    R+RT DP +AH+YF+PFS+T + K +Y+P 
Sbjct  160   GDPPIVHDGPCKDIYTIEGRFIHEMEHGARRYRTRDPKRAHVYFMPFSVTWMVKYLYKPL  219

Query  1034  SHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRAL  1213
             ++D SP++    DYV  ++ KYPFWNR+ GADHF+L+CHDWGP  S     L+N SIR L
Sbjct  220   TYDHSPLRQFVADYVRVLSTKYPFWNRTHGADHFMLACHDWGPHASRGDHLLYNTSIRVL  279

Query  1214  CNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSK--RPVLVFYAGGLHGPVRPILL  1387
             CNANTSE F+P+KDVS+PEI L  G     L  P P+   RP L F+AGGLHGP+RP+LL
Sbjct  280   CNANTSEGFNPRKDVSLPEIHLYGGNVPPQLLSPPPANTTRPHLAFFAGGLHGPIRPLLL  339

Query  1388  QHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKR  1567
             +HW++++ D++V  YLPK + Y   M +S++C+CPSG+EVASPR+VE++Y  CVPV++  
Sbjct  340   KHWKDRESDLRVFEYLPKHLDYYSFMLRSKFCLCPSGHEVASPRIVESIYAECVPVILSD  399

Query  1568  GYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPK  1747
              YV PFSDVL W+AF++ + V +IP L+++L  + + +Y R++     VR HF +N P K
Sbjct  400   HYVLPFSDVLRWDAFSIQLNVSEIPRLEEVLRSVPEEKYERLKEGLRTVRTHFMLNQPAK  459

Query  1748  RFDVFHMILHSIW  1786
             RFDVFHMILHSIW
Sbjct  460   RFDVFHMILHSIW  472



>ref|XP_009151056.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Brassica rapa]
 emb|CDX88169.1| BnaA06g27600D [Brassica napus]
Length=480

 Score =   411 bits (1057),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 206/399 (52%), Positives = 269/399 (67%), Gaps = 16/399 (4%)
 Frame = +2

Query  623   SSDDTEDSRKSKRYTYTNMER-IEADLARARASILRgggg-gTQTKDDDSVPVGPMYRNA  796
             S +DT  S+  K+    N  R +E  L++ARASI          T     +P   +YRN 
Sbjct  78    SRNDTLQSKPEKKKKKLNRRRTVEVGLSKARASIREAASSNRNATLFSVDLPNAQVYRNP  137

Query  797   SFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR--FRTTDPDK  970
             S   +SY EMEK  KVYVYE+G+PP+ H GPCKS YA+EG FI  M+ SR  FRT DPD+
Sbjct  138   SALSQSYLEMEKRFKVYVYEEGEPPLVHDGPCKSVYAVEGRFIMEMEKSRTKFRTYDPDQ  197

Query  971   AHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCH  1150
             AH+YFLPFS+T L   +Y+ N +D  P++  A DYV  ++ K+PFWNR+ GADHF+L+CH
Sbjct  198   AHVYFLPFSVTWLVTYLYQYN-YDAEPLRTFASDYVRLISSKHPFWNRTSGADHFMLACH  256

Query  1151  DWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG-------TTKGLLG  1309
             DWGP  S A  +L + SIR +CNAN+SE F+P KD ++PEI L  G        +K L+ 
Sbjct  257   DWGPLTSKANEDLFHKSIRVMCNANSSEGFNPAKDATLPEIKLYGGEVHPQLRLSKILMT  316

Query  1310  GPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCIC  1489
              P    RP L F+AGG+HGPVRPILL HW+ +D D+ V  YLPK ++Y   MR S++C C
Sbjct  317   SP----RPHLAFFAGGVHGPVRPILLDHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFC  372

Query  1490  PSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGI  1669
             PSGYEVASPR++EA+Y  C+PV++   +V PFSD+L WE F+V + V +IP LK+ILT I
Sbjct  373   PSGYEVASPRLIEAIYSECIPVILSVNFVLPFSDILRWETFSVQVDVSEIPRLKEILTSI  432

Query  1670  SQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             S  +Y  ++R    VRRHFE+N PPKR+D FHMILHSIW
Sbjct  433   SDEKYQSLKRNLRYVRRHFELNDPPKRYDAFHMILHSIW  471



>ref|XP_003549290.1| PREDICTED: probable glycosyltransferase At5g25310-like [Glycine 
max]
Length=482

 Score =   411 bits (1057),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 204/365 (56%), Positives = 253/365 (69%), Gaps = 12/365 (3%)
 Frame = +2

Query  725   RgggggTQTKDDDS----VPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPC  892
             R       T  DDS    VP G +YRNA  F RSY EMEK  KVYVY DG  P+AH GPC
Sbjct  110   RSNLSVATTARDDSYHRYVPAGAIYRNARLFYRSYLEMEKIFKVYVYPDGDLPIAHDGPC  169

Query  893   KSTYAIEGNFIHAMDFS--RFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITA  1066
             K  Y+IEG F+H M+    RFRT DP+ AH++FLPFS+T + K +Y P S + +P+K   
Sbjct  170   KDIYSIEGRFLHEMEHGAGRFRTNDPNAAHVFFLPFSVTWMVKYLYTPLSFNVTPLKKFV  229

Query  1067  LDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDP  1246
              DYV  V+ ++PFWN + GADHF+L+CHDWGP  S   P L+N SIR LCNANTSE F+P
Sbjct  230   SDYVRVVSTRHPFWNITHGADHFMLACHDWGPHASQGNPFLYNTSIRVLCNANTSEGFNP  289

Query  1247  KKDVSIPEIVLPSGTTKGLLGGPSPSKRP--VLVFYAGGLHGPVRPILLQHWENKDED--  1414
             +KDVS+PEI L  G     L  P P   P   L F++GGLHGP+RP LL HW+N DE+  
Sbjct  290   RKDVSLPEIHLYGGEVSPKLLSPPPDTAPRRYLAFFSGGLHGPIRPALLGHWKNHDENDV  349

Query  1415  VQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDV  1594
             ++V+ YLPK + Y   M  S++C+CPSG+EVASPR+VEA+Y  CVPV++   YV PFSDV
Sbjct  350   IRVYEYLPKDLDYYSFMLTSKFCLCPSGHEVASPRIVEAIYAECVPVILSEYYVLPFSDV  409

Query  1595  LNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVK-VRRHFEVNSPPKRFDVFHMI  1771
             L WEAF+V + V DIP LK+IL+ IS+ +Y R  + GVK VRRHF +N P KRFDVFHMI
Sbjct  410   LQWEAFSVQVDVSDIPRLKEILSAISEDKY-RKLKEGVKAVRRHFTLNRPAKRFDVFHMI  468

Query  1772  LHSIW  1786
             LHSIW
Sbjct  469   LHSIW  473



>ref|XP_003603357.1| hypothetical protein MTR_3g106690 [Medicago truncatula]
 gb|AES73608.1| glycosyltransferase [Medicago truncatula]
Length=393

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/334 (57%), Positives = 245/334 (73%), Gaps = 4/334 (1%)
 Frame = +2

Query  797   SFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD--FSRFRTTDPDK  970
             S++ RSY EMEK  KVYVY DG  P+ H GPCK  Y+ EG F+H M+    +FRT DP+ 
Sbjct  50    SYYYRSYLEMEKIFKVYVYPDGDLPIVHDGPCKDIYSTEGRFLHEMERGVGKFRTNDPNA  109

Query  971   AHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCH  1150
             AH+YFLPFS+T + K +Y P+S+D +P+     DYV  V+ +YPFWNR+ GADHF+L+CH
Sbjct  110   AHVYFLPFSVTWMVKYLYTPSSYDITPLTQFVSDYVRVVSMRYPFWNRTHGADHFMLACH  169

Query  1151  DWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG--TTKGLLGGPSPS  1324
             DWGP  S   P L+N SIR LCNANTSE F+P KDVS+PEI L  G  + K L   P  +
Sbjct  170   DWGPHASKGNPFLYNTSIRVLCNANTSEGFNPLKDVSLPEIHLYGGEVSPKLLSLPPENA  229

Query  1325  KRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYE  1504
              R  L F+AGG+HGP+RPILLQHW+N+D+D+ V+ YLPKG+ Y  +M  S++C+CPSG+E
Sbjct  230   PRRYLAFFAGGMHGPIRPILLQHWKNRDKDILVNEYLPKGIDYYSIMLSSKFCLCPSGFE  289

Query  1505  VASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQY  1684
             VASPR+VE++Y  CVPV++   YV PFSDVL WEAF+V + V DIP LK+IL+ I + +Y
Sbjct  290   VASPRIVESIYAECVPVILSNYYVLPFSDVLQWEAFSVQVDVSDIPRLKEILSAIPESKY  349

Query  1685  IRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
              ++++    VRRHF +N P KRFDVFHMILHSIW
Sbjct  350   KKLKQGVRAVRRHFTLNQPAKRFDVFHMILHSIW  383



>ref|XP_010418150.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=423

 Score =   408 bits (1049),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 255/375 (68%), Gaps = 7/375 (2%)
 Frame = +2

Query  683   RIEADLARARASILRgggggTQTK-----DDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++EA+LA ARA I         T      D D +P G +YRN   F RSY  MEK  K+Y
Sbjct  40    KVEAELATARALIREAQLNSNATSSSPLGDKDYIPHGDIYRNPYAFHRSYLLMEKIFKIY  99

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAM--DFSRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             VYE+G PP+ HYG CK  Y++EG F++ M  D  ++RT DPDKAH+YFLPFS+ ++   +
Sbjct  100   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  159

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             ++P   D + ++    DY+  +++KYP+WN S G DHF+LSCHDWG   ++ +  L  NS
Sbjct  160   FDPVVRDKAVLERVIADYIQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  219

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNAN SE F+P+KD   PEI L +G    L GG  P+ R  L F+AG  HG +RP+
Sbjct  220   IRVLCNANISEYFNPEKDAPFPEINLLTGEINNLTGGLDPTSRTTLAFFAGKSHGKIRPV  279

Query  1382  LLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             LL HW+ KD+D+ V+  LP G+ Y  MMRKSR+CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  280   LLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEAIYSGCVPVLI  339

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
                YV PFSDVLNWE F+V + V++IP LK+IL  I + +Y+R+     KV+RH  VN P
Sbjct  340   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYMRLYEGVKKVKRHILVNDP  399

Query  1742  PKRFDVFHMILHSIW  1786
             PKR+DVF+MI+HSIW
Sbjct  400   PKRYDVFNMIIHSIW  414



>ref|XP_011081538.1| PREDICTED: probable glycosyltransferase At5g25310 [Sesamum indicum]
Length=485

 Score =   410 bits (1054),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 192/374 (51%), Positives = 263/374 (70%), Gaps = 6/374 (2%)
 Frame = +2

Query  683   RIEADLARARASILRgggggTQTK--DDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYE  856
             ++E  LARARA+IL        +    ++++    +Y N S F +SY EME+  KVYVY+
Sbjct  103   KLEQGLARARAAILDAASATNPSIIIKNNNILSPAIYWNPSAFYQSYKEMERRFKVYVYQ  162

Query  857   DGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPFSITVLSKLVYEP  1030
             +G+ P+ H GPCK  Y+ EG FIH M+   +RF+T++   AH+YF+PFS+T + K +Y+P
Sbjct  163   EGELPIVHDGPCKDIYSSEGRFIHEMEHGNNRFKTSNAQAAHVYFMPFSVTWMVKYLYKP  222

Query  1031  NSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRA  1210
             N+++ +P+K    DYV  ++ K+PFWNR+ GADHF+LSCHDWGP+ S     L+N SIR 
Sbjct  223   NTYNVTPLKAFVSDYVKLISTKHPFWNRTQGADHFMLSCHDWGPKASQGNGLLYNTSIRV  282

Query  1211  LCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSK--RPVLVFYAGGLHGPVRPIL  1384
             LCNAN+SE FDP KDVS+PEI L  G     L  P PS   RP L F+AGG+HGP+RPIL
Sbjct  283   LCNANSSEGFDPTKDVSLPEIHLYGGIVNPKLISPPPSNISRPDLAFFAGGIHGPIRPIL  342

Query  1385  LQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  1564
             L+HW  KD D+ V+ YLPK   Y   M +S++C+CPSGYEVASPR+VEA+Y  C+PV++ 
Sbjct  343   LKHWRGKDTDLHVYEYLPKDQDYYDSMLRSKFCLCPSGYEVASPRIVEAIYAECIPVILS  402

Query  1565  RGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPP  1744
               YV PFSDVL WEAF++ + + +IP LK+IL  +S+ +Y+R++     VRRHF +N P 
Sbjct  403   DHYVLPFSDVLRWEAFSIQVDISEIPRLKEILVAVSEDEYLRLKEGLRAVRRHFLLNQPV  462

Query  1745  KRFDVFHMILHSIW  1786
             KRFD+FHMILHS+W
Sbjct  463   KRFDMFHMILHSVW  476



>ref|XP_010489710.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=459

 Score =   409 bits (1051),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/375 (52%), Positives = 256/375 (68%), Gaps = 7/375 (2%)
 Frame = +2

Query  683   RIEADLARARASILRgggggTQTK-----DDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             R+EA+LA ARA I         T      D++ +P G +YRN   F RSY  MEK  K+Y
Sbjct  76    RVEAELATARALIREAQLNSNSTSSSPLGDEEYIPHGDIYRNPYAFHRSYLLMEKIFKIY  135

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAM--DFSRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             VYE+G PP+ HYG CK  Y++EG F++ M  D  ++RT DPDKAH++FLPFS+ ++   +
Sbjct  136   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVFFLPFSVVMILHHL  195

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             ++P   D + ++    DYV  +++KYP+WN S G DHF+LSCHDWG   ++ +  L  NS
Sbjct  196   FDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  255

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNAN SE F+P+KD   PEI L +G  K L GG  P  R  L F+AG  HG +RP+
Sbjct  256   IRVLCNANISEYFNPEKDAPFPEINLLTGEIKNLTGGLDPISRTTLAFFAGKSHGKIRPV  315

Query  1382  LLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             LL HW+ KD+D+ V+  LP G+ Y  MMRKSR+CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  316   LLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEAIYSGCVPVLI  375

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
                YV PFSDVLNWE F+V + V++IP LK+IL  I + +Y+R+     KV+RH  VN P
Sbjct  376   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYLRLYEGVKKVKRHILVNDP  435

Query  1742  PKRFDVFHMILHSIW  1786
             PKR+DVF+MI+HSIW
Sbjct  436   PKRYDVFNMIIHSIW  450



>ref|XP_006594254.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
isoform X2 [Glycine max]
Length=486

 Score =   410 bits (1053),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/382 (51%), Positives = 262/382 (69%), Gaps = 10/382 (3%)
 Frame = +2

Query  671   TNMERIEADLARARASILRggggg--TQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             T++E+IE  LA+ARASI         T  + +  VP G +YRN   FL+S+ EM K  KV
Sbjct  94    TSLEKIEESLAQARASIQESILSRNYTSQRREIFVPKGSIYRNPHAFLQSHIEMVKRFKV  153

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD----FSRFRTTDPDKAHLYFLPFSITVLS  1012
             +VY++G+ P+ H GP  + YAIEG F+  MD    +S+FR   P++AH++FLP SI  + 
Sbjct  154   WVYQEGEQPLVHDGPVNNIYAIEGQFMDEMDNNGKWSQFRARHPEEAHVFFLPISIANVV  213

Query  1013  KLVYEP--NSHDWSPMKITAL--DYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAI  1180
               VY+P     D+ P+++  L  DY+  +  KYP+WNRS+GADHF+LSCHDWGP++S+  
Sbjct  214   HYVYKPILKQSDYEPVRLQHLVEDYIGVIQDKYPYWNRSIGADHFLLSCHDWGPKVSYGN  273

Query  1181  PNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGL  1360
             P L    IRALCNANTSE F P +DVSIPE+ LP G       G  P+ R  L F+AGG+
Sbjct  274   PELFQTFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPASLGQHPNSRTTLAFFAGGV  333

Query  1361  HGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYM  1540
             HG +R ILL+HW++KD +V VH YLPKG  Y  +M +S++C+CPSG+EVASPR+VEA++ 
Sbjct  334   HGEIRKILLKHWKDKDNEVLVHEYLPKGQDYTKLMGQSKFCLCPSGHEVASPRVVEAIHA  393

Query  1541  GCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRR  1720
             GCVPV+I   Y  PFSDVLNW  F+V IPVE IP +K IL  IS+ +Y+R+    ++VRR
Sbjct  394   GCVPVIICDNYSLPFSDVLNWSQFSVEIPVEKIPEIKSILQSISRNKYLRLHMNVLRVRR  453

Query  1721  HFEVNSPPKRFDVFHMILHSIW  1786
             HF +N P K FD+ HMILHSIW
Sbjct  454   HFMINRPTKPFDMMHMILHSIW  475



>gb|KHN47102.1| Xylogalacturonan beta-1,3-xylosyltransferase [Glycine soja]
Length=486

 Score =   409 bits (1052),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 196/382 (51%), Positives = 262/382 (69%), Gaps = 10/382 (3%)
 Frame = +2

Query  671   TNMERIEADLARARASILRggggg--TQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             T++E+IE  LA+ARASI         T  + +  VP G +YRN   FL+S+ EM K  KV
Sbjct  94    TSLEKIEESLAQARASIQESILSRNYTSQRREIFVPKGSIYRNPHAFLQSHIEMVKRFKV  153

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD----FSRFRTTDPDKAHLYFLPFSITVLS  1012
             +VY++G+ P+ H GP  + YAIEG F+  MD    +S+FR   P++AH++FLP SI  + 
Sbjct  154   WVYQEGEQPLVHDGPVNNIYAIEGQFMDEMDNNGKWSQFRARHPEEAHVFFLPISIANVV  213

Query  1013  KLVYEP--NSHDWSPMKITAL--DYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAI  1180
               VY+P     D+ P+++  L  DY+  +  KYP+WNRS+GADHF+LSCHDWGP++S+  
Sbjct  214   HYVYKPILKQSDYEPVRLQHLVEDYIGVIQDKYPYWNRSIGADHFLLSCHDWGPKVSYGN  273

Query  1181  PNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGL  1360
             P L    IRALCNANTSE F P +DVSIPE+ LP G       G  P+ R  L F+AGG+
Sbjct  274   PELFQTFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPASLGQHPNSRTTLAFFAGGV  333

Query  1361  HGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYM  1540
             HG +R ILL+HW++KD +V VH YLPKG  Y  +M +S++C+CPSG+EVASPR+VEA++ 
Sbjct  334   HGEIRKILLKHWKDKDNEVLVHEYLPKGQDYTKLMGQSKFCLCPSGHEVASPRVVEAIHA  393

Query  1541  GCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRR  1720
             GCVPV+I   Y  PFSDVLNW  F+V IPVE IP +K IL  IS+ +Y+R+    ++VRR
Sbjct  394   GCVPVIICDNYSLPFSDVLNWSQFSVEIPVEKIPEIKSILQSISRNKYLRLHMNVLRVRR  453

Query  1721  HFEVNSPPKRFDVFHMILHSIW  1786
             HF +N P K FD+ HMILHSIW
Sbjct  454   HFMINRPTKPFDMMHMILHSIW  475



>ref|XP_003545455.1| PREDICTED: probable glycosyltransferase At5g25310-like [Glycine 
max]
Length=483

 Score =   409 bits (1051),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 199/350 (57%), Positives = 249/350 (71%), Gaps = 7/350 (2%)
 Frame = +2

Query  755   DDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAM  934
             D   VP G +YRNA  F RSY EMEK  KVYVY DG  P+AH GPCK  Y+IEG F+H M
Sbjct  126   DHRYVPAGAIYRNARLFYRSYLEMEKIFKVYVYPDGDLPIAHDGPCKDIYSIEGRFLHEM  185

Query  935   DFS--RFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFW  1108
             +    RFRT DP+ AH+YFLPFS+T + K +Y P S + +P+K    DYV  ++ ++PFW
Sbjct  186   EHGAGRFRTNDPNAAHVYFLPFSVTWMVKYLYTPLSFNVTPLKQFVSDYVRVISTRHPFW  245

Query  1109  NRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG  1288
             N + GADHF+L+CHDWGP  S   P L+N SIR LCNANTSE F+P+KDVS+PEI L  G
Sbjct  246   NITHGADHFMLACHDWGPHASQGNPFLYNTSIRVLCNANTSEGFNPRKDVSLPEIHLYGG  305

Query  1289  TTKGLLGGPSPSKRP--VLVFYAGGLHGPVRPILLQHWEN-KDEDVQVHSYLPKGVSYNG  1459
                  L  P P   P   L F++GGLHGP+RP LL+HW+N  D+D++V+ YLPK + Y  
Sbjct  306   EVSPKLLSPPPDTAPRRYLAFFSGGLHGPIRPALLRHWKNDNDDDIRVYEYLPKDLDYYS  365

Query  1460  MMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDI  1639
              M  S++C+CPSG+EVASPR+VEA+Y  CVPV++   YV PFSDVL WEAF+V + V DI
Sbjct  366   FMLNSKFCLCPSGHEVASPRIVEAIYAECVPVILSEYYVLPFSDVLQWEAFSVQVDVSDI  425

Query  1640  PNLKKILTGISQRQYIRMQRRGVK-VRRHFEVNSPPKRFDVFHMILHSIW  1786
             P LK+IL+ IS+ +Y R  + GVK VR HF +N P KRFDVFHMILHSIW
Sbjct  426   PRLKEILSAISEDKY-RKLKEGVKAVRGHFTLNRPAKRFDVFHMILHSIW  474



>gb|AHL38775.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=459

 Score =   408 bits (1049),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/375 (52%), Positives = 255/375 (68%), Gaps = 7/375 (2%)
 Frame = +2

Query  683   RIEADLARARASILRgggggTQTK-----DDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++EA+LA AR  I       + T      D+D VP G +YRN   F RSY  MEK  K+Y
Sbjct  76    KVEAELATARVLIREAQLNYSSTTSSPLGDEDYVPHGDIYRNPYAFHRSYLLMEKMFKIY  135

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAM--DFSRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             VYE+G PP+ HYG CK  Y++EG F++ M  D  ++RT DPDKAH+YFLPFS+ ++   +
Sbjct  136   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  195

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             ++P   D + ++    DYV  +++KYP+WN S G DHF+LSCHDWG   ++ +  L  NS
Sbjct  196   FDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  255

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNAN SE F+P+KD   PEI L +G    L GG  P  R  L F+AG  HG +RP+
Sbjct  256   IRVLCNANISEYFNPEKDAPFPEINLLTGDINNLTGGLDPISRTTLAFFAGKSHGKIRPV  315

Query  1382  LLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             LL HW+ KD+D+ V+  LP G+ Y  MMRKSR+CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  316   LLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRVPEAIYSGCVPVLI  375

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
                YV PFSDVLNWE F+V + V++IP LK+IL  I + +Y+R+     KV+RH  VN P
Sbjct  376   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEERYMRLYEGVKKVKRHILVNDP  435

Query  1742  PKRFDVFHMILHSIW  1786
             PKR+DVF+MI+HSIW
Sbjct  436   PKRYDVFNMIIHSIW  450



>ref|NP_187419.1| putative glycosyltransferase [Arabidopsis thaliana]
 sp|Q9SSE8.1|GLYT1_ARATH RecName: Full=Probable glycosyltransferase At3g07620 [Arabidopsis 
thaliana]
 gb|AAF13080.1|AC009176_7 hypothetical protein [Arabidopsis thaliana]
 gb|AEE74576.1| putative glycosyltransferase [Arabidopsis thaliana]
Length=470

 Score =   409 bits (1050),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/375 (52%), Positives = 255/375 (68%), Gaps = 7/375 (2%)
 Frame = +2

Query  683   RIEADLARARASILRgggggTQTK-----DDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++EA+LA AR  I       + T      D+D VP G +YRN   F RSY  MEK  K+Y
Sbjct  87    KVEAELATARVLIREAQLNYSSTTSSPLGDEDYVPHGDIYRNPYAFHRSYLLMEKMFKIY  146

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAM--DFSRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             VYE+G PP+ HYG CK  Y++EG F++ M  D  ++RT DPDKAH+YFLPFS+ ++   +
Sbjct  147   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  206

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             ++P   D + ++    DYV  +++KYP+WN S G DHF+LSCHDWG   ++ +  L  NS
Sbjct  207   FDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  266

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNAN SE F+P+KD   PEI L +G    L GG  P  R  L F+AG  HG +RP+
Sbjct  267   IRVLCNANISEYFNPEKDAPFPEINLLTGDINNLTGGLDPISRTTLAFFAGKSHGKIRPV  326

Query  1382  LLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             LL HW+ KD+D+ V+  LP G+ Y  MMRKSR+CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  327   LLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRVPEAIYSGCVPVLI  386

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
                YV PFSDVLNWE F+V + V++IP LK+IL  I + +Y+R+     KV+RH  VN P
Sbjct  387   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEERYMRLYEGVKKVKRHILVNDP  446

Query  1742  PKRFDVFHMILHSIW  1786
             PKR+DVF+MI+HSIW
Sbjct  447   PKRYDVFNMIIHSIW  461



>ref|XP_007137001.1| hypothetical protein PHAVU_009G091800g [Phaseolus vulgaris]
 gb|ESW08995.1| hypothetical protein PHAVU_009G091800g [Phaseolus vulgaris]
Length=470

 Score =   408 bits (1049),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/351 (54%), Positives = 247/351 (70%), Gaps = 7/351 (2%)
 Frame = +2

Query  749   TKDDDSVPV-GPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFI  925
             T+D+D +P  G +YRN   F +SY EMEK  KV+VY DG  P+ H GPCK  Y+IEG F+
Sbjct  113   TRDNDDIPAAGFLYRNPLLFYQSYLEMEKIFKVFVYPDGDLPIVHDGPCKDIYSIEGRFL  172

Query  926   HAMD--FSRFRTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKY  1099
             H M+    RFRT DP  AH+YFLPFS+T + K +Y P  +D +P+K    DYV  ++ +Y
Sbjct  173   HEMEHGVGRFRTNDPTAAHVYFLPFSVTWMVKYLYTP--YDVTPLKNFVSDYVRVISTRY  230

Query  1100  PFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVL  1279
             PFWN++ GADHF+++CHDWGP  S   P L+N SIR LCNANTSE F+P+KDV +PEI L
Sbjct  231   PFWNKTQGADHFMVACHDWGPYASKGNPFLYNTSIRVLCNANTSEGFNPQKDVPLPEIHL  290

Query  1280  PSGTTKGLLGGPSPSKRP--VLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSY  1453
               G     L  P P   P   L F+AGG+HGP+RPIL+ HWEN+D D++V+ YLPK + Y
Sbjct  291   YGGEVSPKLLSPPPENAPRRYLAFFAGGMHGPIRPILIHHWENQDNDMRVYQYLPKDLDY  350

Query  1454  NGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVE  1633
                M  S++C+CPSGYEVASPR+VE++Y  CVPV++ + Y  PF DVL WEAF+V + V 
Sbjct  351   YSFMLDSKFCLCPSGYEVASPRIVESIYAECVPVILSKNYTLPFGDVLQWEAFSVQVDVS  410

Query  1634  DIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             DIP LK++L+GI +R+Y +++      RRHF +N P KRFD FHMILHSIW
Sbjct  411   DIPRLKELLSGIPEREYRKLKHGVRAARRHFTLNQPAKRFDAFHMILHSIW  461



>ref|XP_009151057.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X2 
[Brassica rapa]
Length=478

 Score =   409 bits (1050),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 199/377 (53%), Positives = 259/377 (69%), Gaps = 15/377 (4%)
 Frame = +2

Query  686   IEADLARARASILRgggg-gTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDG  862
             +E  L++ARASI          T     +P   +YRN S   +SY EMEK  KVYVYE+G
Sbjct  98    VEVGLSKARASIREAASSNRNATLFSVDLPNAQVYRNPSALSQSYLEMEKRFKVYVYEEG  157

Query  863   QPPVAHYGPCKSTYAIEGNFIHAMDFSR--FRTTDPDKAHLYFLPFSITVLSKLVYEPNS  1036
             +PP+ H GPCKS YA+EG FI  M+ SR  FRT DPD+AH+YFLPFS+T L   +Y+ N 
Sbjct  158   EPPLVHDGPCKSVYAVEGRFIMEMEKSRTKFRTYDPDQAHVYFLPFSVTWLVTYLYQYN-  216

Query  1037  HDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALC  1216
             +D  P++  A DYV  ++ K+PFWNR+ GADHF+L+CHDWGP  S A  +L + SIR +C
Sbjct  217   YDAEPLRTFASDYVRLISSKHPFWNRTSGADHFMLACHDWGPLTSKANEDLFHKSIRVMC  276

Query  1217  NANTSERFDPKKDVSIPEIVLPSG-------TTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             NAN+SE F+P KD ++PEI L  G        +K L+  P    RP L F+AGG+HGPVR
Sbjct  277   NANSSEGFNPAKDATLPEIKLYGGEVHPQLRLSKILMTSP----RPHLAFFAGGVHGPVR  332

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
             PILL HW+ +D D+ V  YLPK ++Y   MR S++C CPSGYEVASPR++EA+Y  C+PV
Sbjct  333   PILLDHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRLIEAIYSECIPV  392

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             ++   +V PFSD+L WE F+V + V +IP LK+ILT IS  +Y  ++R    VRRHFE+N
Sbjct  393   ILSVNFVLPFSDILRWETFSVQVDVSEIPRLKEILTSISDEKYQSLKRNLRYVRRHFELN  452

Query  1736  SPPKRFDVFHMILHSIW  1786
              PPKR+D FHMILHSIW
Sbjct  453   DPPKRYDAFHMILHSIW  469



>ref|XP_007204886.1| hypothetical protein PRUPE_ppa017740mg, partial [Prunus persica]
 gb|EMJ06085.1| hypothetical protein PRUPE_ppa017740mg, partial [Prunus persica]
Length=392

 Score =   405 bits (1041),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 195/380 (51%), Positives = 257/380 (68%), Gaps = 8/380 (2%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgg--gggTQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             T++E+IE DLA+ARA+IL        T  K +  VP G +Y+N   F +S+ EM K  KV
Sbjct  3     TSLEKIEEDLAKARAAILEAIRFKKYTSEKTETFVPRGTIYKNPYAFHQSHIEMVKRFKV  62

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPFSITVLSKL  1018
             + Y++G+ P+ H+GP  + Y IEG FI  ++   S FR T PD+AH +FLP S+  +   
Sbjct  63    WSYKEGEQPLVHFGPVNNIYGIEGQFIDEIEREESPFRATHPDEAHTFFLPVSVANIVHY  122

Query  1019  VYEP--NSHDW--SPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPN  1186
             VY P     D+    ++   +DY+  VA KYP+WNRS GADHF+ SCHDW PE+S   P 
Sbjct  123   VYMPITRKQDYYRDRLQRVVMDYIGVVANKYPYWNRSNGADHFMASCHDWAPEVSVGKPE  182

Query  1187  LHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHG  1366
             L  N IR LCNANTSE F PK+DVS+PEI LP G       G +P+ RP+L F+AG +HG
Sbjct  183   LFTNFIRVLCNANTSEGFQPKRDVSLPEIYLPYGRLGPPSLGQAPNNRPILAFFAGRVHG  242

Query  1367  PVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGC  1546
             P+RP+LL +W+ KD++VQVH  LPKG++Y  +M +S+YC+CPSG+EVASPR+VEA Y GC
Sbjct  243   PIRPMLLDYWKGKDDEVQVHEKLPKGLNYTKLMGQSKYCLCPSGFEVASPRVVEAFYAGC  302

Query  1547  VPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHF  1726
             VPVLI   Y  PFSDVLNW  F+V IPV  IP +K IL  I   +Y++MQ+R  +V RHF
Sbjct  303   VPVLISDNYTLPFSDVLNWSQFSVQIPVARIPEIKTILQSIPYEKYLKMQKRVSRVHRHF  362

Query  1727  EVNSPPKRFDVFHMILHSIW  1786
              +N P K FDV HM+LHS+W
Sbjct  363   VLNRPSKPFDVIHMVLHSVW  382



>ref|XP_010050741.1| PREDICTED: probable glycosyltransferase At5g25310 [Eucalyptus 
grandis]
Length=470

 Score =   408 bits (1048),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 191/343 (56%), Positives = 256/343 (75%), Gaps = 9/343 (3%)
 Frame = +2

Query  782   MYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF----SRF  949
             +YRN   F++SY EME+  KVYVY +G+PP+ H GPCK  Y +EG FIH M+     +RF
Sbjct  120   VYRNRRAFIQSYMEMERRFKVYVYSEGEPPIVHDGPCKDIYTVEGRFIHEMEHGSAAARF  179

Query  950   RTTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGAD  1129
              T DP +AH+YF+PFS+T +   +Y+P ++D +P++    DYV +V+ KYPFWNR+ GAD
Sbjct  180   GTRDPRRAHVYFMPFSVTRMVTYLYKPPTYDVTPLRRFVADYVQAVSAKYPFWNRTRGAD  239

Query  1130  HFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGT-TKGLL  1306
             HF+++CHDWGP  S    +L+ NSIRALCNAN SE F+P+KDVS+PEI L  G  +  LL
Sbjct  240   HFMVACHDWGPHASLGDAHLYKNSIRALCNANASEGFNPQKDVSLPEIYLLDGNISPKLL  299

Query  1307  GGPSPS-KRPVLVFYAGGLHGPVRPILLQHWENK-DEDVQVHSYLPKGVSYNGMMRKSRY  1480
               P P   RP+L F+AGGLHGP+RPILL HW++K D DV+V+ YLPK + Y  ++ +S++
Sbjct  300   SLPPPHVPRPLLTFFAGGLHGPIRPILLHHWKDKGDPDVRVYGYLPKHLDYYTLILQSKF  359

Query  1481  CICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKIL  1660
             C+CPSG+EVASPR+VEA+Y  CVPV+I   YV PFSDVLNW+AF+V + V +IP LK+IL
Sbjct  360   CLCPSGHEVASPRIVEAIYAECVPVIISEHYVLPFSDVLNWDAFSVKVEVSEIPRLKEIL  419

Query  1661  TGISQRQYIRMQRRGVK-VRRHFEVNSPPKRFDVFHMILHSIW  1786
               + + +Y R+ R+G+K VRRHF +N P KRFDVFHM+LHSIW
Sbjct  420   KAVPEDEYRRL-RQGLKAVRRHFVLNQPAKRFDVFHMVLHSIW  461



>ref|XP_006407816.1| hypothetical protein EUTSA_v10020696mg [Eutrema salsugineum]
 gb|ESQ49269.1| hypothetical protein EUTSA_v10020696mg [Eutrema salsugineum]
Length=459

 Score =   407 bits (1047),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 255/375 (68%), Gaps = 7/375 (2%)
 Frame = +2

Query  683   RIEADLARARASILRgggggTQT-----KDDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++EA+LA ARA I         T     +D+D VP G +YRN   F RSY  MEK  K+Y
Sbjct  76    KVEAELATARALIREAQLNPNSTTSSPLRDEDYVPHGDIYRNPYAFHRSYLLMEKMFKIY  135

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAM--DFSRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             VYE+G PP+ HYG CK  Y++EG F++ M  D   +RT DPD+AH+YFLPFS+ ++   +
Sbjct  136   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDILNYRTRDPDRAHVYFLPFSVVMILHHL  195

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             ++P   D + ++   +DYV  ++ KYP+WN S G DHF+LSCHDWG   ++ +  L  NS
Sbjct  196   FDPVVRDKAVLERVIVDYVRIISNKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  255

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNAN SE F+P+KD   PEI LP+G    L GG  P  R  L F+AG  HG +RP+
Sbjct  256   IRVLCNANISEYFNPEKDAPFPEINLPTGEINNLTGGLDPISRTTLAFFAGKSHGKIRPV  315

Query  1382  LLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             LL HW+ KD+D+ V+  LP G+ Y  +MR+SR+CICPSG+EVASPR+ EA+Y  CVPVLI
Sbjct  316   LLNHWKEKDKDILVYENLPDGLDYKDLMRRSRFCICPSGHEVASPRIPEAIYSECVPVLI  375

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
                YV PFSDVLNWE F+V + V++IP LK+IL  I + +YIR+     KV+RH  VN P
Sbjct  376   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYIRLHEGVKKVKRHILVNDP  435

Query  1742  PKRFDVFHMILHSIW  1786
             PKR+DVF+MI+HSIW
Sbjct  436   PKRYDVFNMIIHSIW  450



>ref|XP_007013571.1| Exostosin family protein [Theobroma cacao]
 gb|EOY31190.1| Exostosin family protein [Theobroma cacao]
Length=476

 Score =   408 bits (1048),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 203/389 (52%), Positives = 260/389 (67%), Gaps = 21/389 (5%)
 Frame = +2

Query  671   TNMERIEADLARARASILRggggg--TQTKDDDSVPVGPMYRNASFFLR-----SYAEME  829
             +N ERIE DLAR RA+IL+       T  K+D  VP G +YRNA+ F +     S+ EM 
Sbjct  82    SNSERIEEDLARTRAAILKAVQLQNFTSEKEDIFVPRGSIYRNANAFYQLSTFMSHTEMI  141

Query  830   KTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR--FRTTDPDKAHLYFLPFSIT  1003
             K  KV+ Y +G+ P+ H GP    YAIEG FI  M+     FR   PD+AH++FLP S+T
Sbjct  142   KRFKVWTYREGEIPLVHNGPLNDIYAIEGQFIDEMESKNNPFRARHPDEAHVFFLPISVT  201

Query  1004  VLSKLVYEP----NSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEIS  1171
              +   VY+P      +    ++   LDY+N+VA K+P+WNRS GADHF++SCHDW PE+S
Sbjct  202   GVIHYVYKPITSVKEYSRDRLQRLVLDYINTVASKHPYWNRSNGADHFMVSCHDWAPEVS  261

Query  1172  FAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPS----PSKRPVL  1339
              A P L  N IR LCNANTSE F PK DVS+PEI LP G     LG P+    P+ RP+L
Sbjct  262   QANPELFKNFIRVLCNANTSEGFRPKIDVSLPEIYLPFGK----LGPPNLSQGPNNRPIL  317

Query  1340  VFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPR  1519
              F+AG  HG +R ILL+ W++KD +VQVHS LP GV+Y  MM +S++C+CPSG+EVASPR
Sbjct  318   AFFAGSAHGYIRKILLEQWKDKDNEVQVHSRLPTGVNYTKMMGQSKFCLCPSGFEVASPR  377

Query  1520  MVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQR  1699
              +EA+Y GC+PV+I   Y  PFSDVL W  F+V IPVE IP +K IL GI  R+Y+ M  
Sbjct  378   EIEAIYAGCIPVVISANYTLPFSDVLKWSQFSVQIPVEKIPEIKTILQGIPNRKYLMMHE  437

Query  1700  RGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             R  +VRRHFE+N P K FDV HM+LHS+W
Sbjct  438   RVKRVRRHFELNRPAKPFDVIHMVLHSVW  466



>ref|XP_010464397.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=474

 Score =   408 bits (1048),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 194/375 (52%), Positives = 255/375 (68%), Gaps = 7/375 (2%)
 Frame = +2

Query  683   RIEADLARARASILRgggggTQTK-----DDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++EA+LA ARA I         T      D+D +P G +YRN   F RSY  MEK  K+Y
Sbjct  91    KVEAELATARALIREAQLNSHATSSSPLGDEDYIPHGDIYRNPYAFHRSYLLMEKIFKIY  150

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAM--DFSRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             VYE+G PP+ HYG CK  Y++EG F++ M  D  ++RT DPDKAH+YFLPFS+ ++   +
Sbjct  151   VYEEGDPPIFHYGICKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  210

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             ++P   D + ++    DYV  +++KYP+WN S G DHF+LSCHDWG   ++ +  L  NS
Sbjct  211   FDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  270

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNAN SE F+P+KD   PEI L +G    L GG  P  R  L F+AG  HG +RP+
Sbjct  271   IRVLCNANISEYFNPEKDAPFPEINLMTGEINNLTGGLDPISRTTLAFFAGKSHGKIRPV  330

Query  1382  LLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             LL HW+ KD+D+ V+  LP G+ Y  MMRKSR+CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  331   LLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEAIYSGCVPVLI  390

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
                YV PFSDVLNWE F+V + V++IP LK+IL  I + +Y+R+     KV+RH  VN P
Sbjct  391   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYMRLYEGVKKVKRHILVNDP  450

Query  1742  PKRFDVFHMILHSIW  1786
             PKR+DVF+MI+HSIW
Sbjct  451   PKRYDVFNMIIHSIW  465



>ref|XP_006299448.1| hypothetical protein CARUB_v10015613mg [Capsella rubella]
 gb|EOA32346.1| hypothetical protein CARUB_v10015613mg [Capsella rubella]
Length=462

 Score =   407 bits (1045),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 256/375 (68%), Gaps = 7/375 (2%)
 Frame = +2

Query  683   RIEADLARARASILRgggggTQTK-----DDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++EA+LA ARA I         T      D+D VP G +YRN   F RSY  MEK  K+Y
Sbjct  79    KVEAELAMARALIREAQVNSNSTSSSPLGDEDYVPHGDIYRNPYAFHRSYLLMEKIFKIY  138

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAM--DFSRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             VYE+G PP+ HYG CK  Y++EG F++ M  D  ++RT DPDKAH+YFLPFS+ ++   +
Sbjct  139   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  198

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             ++P   D + ++    DYV  +++KYP+WN S G DHF+LSCHDWG   ++ +  L  NS
Sbjct  199   FDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  258

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNAN SE F+P+KD   PEI L +G    L GG  P+ R  L F+AG  HG +RP+
Sbjct  259   IRVLCNANISEYFNPEKDAPFPEINLVTGEINNLTGGLDPTSRTTLAFFAGKSHGKIRPV  318

Query  1382  LLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             LL +W+ KD+D+ V+  LP G+ Y  MMRKSR+CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  319   LLNNWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEAIYSGCVPVLI  378

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
                YV PFSDVLNWE F+V + V++IP +K+IL  I + +Y+R+     KV+RH  VN P
Sbjct  379   SENYVLPFSDVLNWEKFSVSVSVKEIPEMKRILMNIPEDRYMRLYEGVKKVKRHILVNDP  438

Query  1742  PKRFDVFHMILHSIW  1786
             PKR+DVF+MI+HSIW
Sbjct  439   PKRYDVFNMIIHSIW  453



>ref|XP_008242868.1| PREDICTED: probable glycosyltransferase At3g42180 [Prunus mume]
Length=404

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/380 (51%), Positives = 256/380 (67%), Gaps = 8/380 (2%)
 Frame = +2

Query  671   TNMERIEADLARARASILRggggg--TQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             T++E+IE DLA+ARA+IL        T  K +  VP G +Y+N   F +S+ EM K  KV
Sbjct  15    TSLEKIEEDLAKARAAILEAIRFKNYTSEKTETFVPRGTIYKNPYAFHQSHIEMVKRFKV  74

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPFSITVLSKL  1018
             + Y++G+ P+ H+GP  + Y IEG FI  ++   S FR T PD+AH +FLP S+  +   
Sbjct  75    WSYKEGEQPLVHFGPVNNIYGIEGQFIDEIEREESPFRATHPDEAHTFFLPVSVANIVHY  134

Query  1019  VYEP--NSHDW--SPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPN  1186
             VY P     D+    ++   +DY+  VA KYP+WNRS GADHF+ SCHDW PE+S   P 
Sbjct  135   VYMPITRKQDYYRDRLQRVVMDYIGVVANKYPYWNRSNGADHFMASCHDWAPEVSVGKPE  194

Query  1187  LHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHG  1366
             L  N IR LCNANTSE F PK+DVS+PEI LP G       G +P+ RP+L F+AG +HG
Sbjct  195   LFTNFIRVLCNANTSEGFQPKRDVSLPEIYLPYGRLGPPSLGQAPNNRPILAFFAGRVHG  254

Query  1367  PVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGC  1546
             P+RP+LL +W+ KD++VQVH  LPKG++Y  +M +S+YC+CPSG+EVASPR+VEA Y GC
Sbjct  255   PIRPMLLDYWKGKDDEVQVHEKLPKGLNYTKLMGQSKYCLCPSGFEVASPRVVEAFYAGC  314

Query  1547  VPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHF  1726
             VPVLI   Y  PF DVLNW  F+V IPV  IP +K IL  I   +Y++MQ+R  +V RHF
Sbjct  315   VPVLISDNYALPFGDVLNWSQFSVQIPVARIPEIKTILESIPYEKYLKMQKRVSRVHRHF  374

Query  1727  EVNSPPKRFDVFHMILHSIW  1786
              +N P K FDV HM+LHS+W
Sbjct  375   VLNRPSKSFDVIHMVLHSVW  394



>ref|XP_010421383.1| PREDICTED: probable glycosyltransferase At5g25310 [Camelina sativa]
Length=493

 Score =   407 bits (1046),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 198/376 (53%), Positives = 258/376 (69%), Gaps = 10/376 (3%)
 Frame = +2

Query  686   IEADLARARASILRggggg----TQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVY  853
             +E  LA+ARASIL          T T     +P   +YRN S   RSY EMEK  KVYVY
Sbjct  110   VEEGLAKARASILEASSSSNRNNTTTLFKIDLPNPEIYRNPSALHRSYLEMEKRFKVYVY  169

Query  854   EDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPFSITVLSKLVYE  1027
             E+G+PP+ H GPCKS YA+EG FI  ++   +RFRT DP +A++YFLPFS+T L + +YE
Sbjct  170   EEGEPPLVHDGPCKSVYAVEGRFITELENRKTRFRTYDPSQAYVYFLPFSVTWLVRYLYE  229

Query  1028  PNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIR  1207
              NS+   P++    DY+  V+  +PFWNR+ GADHF+L+CHDWGP  S A  +L N SIR
Sbjct  230   GNSNA-EPLRTFVSDYIRLVSTNHPFWNRTSGADHFMLACHDWGPLTSHANKDLFNTSIR  288

Query  1208  ALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGP---SPSKRPVLVFYAGGLHGPVRP  1378
              +CNANTSE F+P KDV++PEI L  G     L      S S RP L F+AGG+HGPVRP
Sbjct  289   VMCNANTSEGFNPAKDVTLPEIKLYGGEVDPKLRSSKTLSASPRPYLGFFAGGVHGPVRP  348

Query  1379  ILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVL  1558
             ILL+HW+ +D ++ V+ YLPK ++Y   MR S++C CPSGYEVASPR+ EA+Y  C+PV+
Sbjct  349   ILLKHWKQRDPEMPVYEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRVTEAIYSECIPVI  408

Query  1559  IKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNS  1738
             +   +V PF+DVL WE F+V++ V +IP LK+IL  IS  +Y  ++R    VRRHFE+N 
Sbjct  409   LSVNFVLPFTDVLRWETFSVLVDVSEIPRLKEILMSISDEKYEWLKRNLRSVRRHFELND  468

Query  1739  PPKRFDVFHMILHSIW  1786
             PPKRFD FH+ LHSIW
Sbjct  469   PPKRFDAFHLTLHSIW  484



>ref|XP_010493785.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Camelina sativa]
Length=487

 Score =   407 bits (1045),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 198/377 (53%), Positives = 262/377 (69%), Gaps = 14/377 (4%)
 Frame = +2

Query  686   IEADLARARASILRgggggTQTKDDDSV-----PVGPMYRNASFFLRSYAEMEKTLKVYV  850
             +E  LA+ARASIL      + T++D ++     P   +YRN S   RSY EMEK  KVYV
Sbjct  106   VEEGLAKARASILEAS---SSTRNDTTLFKIDLPNPEIYRNPSALHRSYLEMEKRFKVYV  162

Query  851   YEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPFSITVLSKLVY  1024
             YE+G+PP+ H GPCKS YA+EG FI  ++   +RFRT DP +A++YFLPFS+T L + +Y
Sbjct  163   YEEGEPPLVHDGPCKSVYAVEGRFILELEKRKTRFRTYDPSQAYVYFLPFSVTWLVRYLY  222

Query  1025  EPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSI  1204
             E NS+   P++    DY+  V+  +PFWNR+ GADHF+L+CHDWGP  S A  +L N SI
Sbjct  223   EGNSNA-EPLRTFVSDYIRLVSTNHPFWNRTNGADHFMLACHDWGPLTSHANKDLFNTSI  281

Query  1205  RALCNANTSERFDPKKDVSIPEIVLPSGTTK---GLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             R +CNAN+SE F+P KDV++PEI L  G       L    S S RP L F+AGG+HGPVR
Sbjct  282   RVMCNANSSEGFNPAKDVTLPEIKLYGGEVDPKLRLSKTLSASPRPYLGFFAGGVHGPVR  341

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
             PILL+HW+ +D D+ V+ YLPK ++Y   MR S++C CPSGYEVASPR+ EA+Y  C+PV
Sbjct  342   PILLKHWKQRDPDMPVYEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRVTEAIYSECIPV  401

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             ++   +V PF+DVL WE F+V++ V +IP LK+IL  IS  +Y  ++R    VRRHFE+N
Sbjct  402   ILSVNFVLPFTDVLRWETFSVLVDVSEIPRLKEILMSISDEKYEWLKRNLRSVRRHFELN  461

Query  1736  SPPKRFDVFHMILHSIW  1786
              PPKRFD FH+ LHSIW
Sbjct  462   DPPKRFDAFHLTLHSIW  478



>ref|XP_010454855.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Camelina sativa]
 ref|XP_010454856.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Camelina sativa]
Length=484

 Score =   406 bits (1044),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 201/398 (51%), Positives = 267/398 (67%), Gaps = 11/398 (3%)
 Frame = +2

Query  623   SSDDTEDSRKSKRYTYTNMERIEADLARARASILRgggg-----gTQTKDDDSVPVGPMY  787
             S+ ++  + +SK       + +E  LA+ARASIL           T T     +P   +Y
Sbjct  79    STTNSSVTLQSKPEKLNRRDLVEEGLAKARASILEASSSSNRNNTTTTLFKIDLPNPDIY  138

Query  788   RNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTD  961
             RN S   RSY EMEK  KVYVYE+G+PP+ H GPCKS YA+EG FI  ++   +RFRT D
Sbjct  139   RNPSALHRSYLEMEKRFKVYVYEEGEPPLVHDGPCKSVYAVEGRFITELEKRKTRFRTYD  198

Query  962   PDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFIL  1141
             P +A++YFLPFS++ L + +YE NS+   P++    DY+  V+  +PFWNR+ GADHF+L
Sbjct  199   PSQAYVYFLPFSVSWLVRYLYEGNSNA-EPLRTFVSDYIRLVSTNHPFWNRTNGADHFML  257

Query  1142  SCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTK---GLLGG  1312
             +CHDWGP  S A  +L N SIR +CNAN+SE F+P KDV++PEI L  G       L   
Sbjct  258   ACHDWGPLTSKANKDLFNTSIRVMCNANSSEGFNPAKDVTLPEIKLYGGVVDPKLRLSKT  317

Query  1313  PSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICP  1492
              S S RP L F+AGG+HGPVRPILL+HW+ +D D+ V+ YLPK ++Y   MR S++C CP
Sbjct  318   LSASPRPYLGFFAGGVHGPVRPILLKHWKQRDPDMPVYEYLPKHLNYYDFMRSSKFCFCP  377

Query  1493  SGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGIS  1672
             SGYEVASPR+ EA+Y  C+PV++   +V PF+DVL WE F+V++ V DIP LK+IL  IS
Sbjct  378   SGYEVASPRVTEAIYSECIPVILSVNFVLPFTDVLRWETFSVLVDVSDIPRLKEILMSIS  437

Query  1673  QRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
               +Y  ++R    VRRHFE+N PPKRFD FH+ LHSIW
Sbjct  438   DEKYEWLKRNLRSVRRHFELNDPPKRFDAFHLTLHSIW  475



>ref|XP_008794982.1| PREDICTED: probable glycosyltransferase At5g20260 [Phoenix dactylifera]
Length=498

 Score =   407 bits (1045),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 197/389 (51%), Positives = 265/389 (68%), Gaps = 8/389 (2%)
 Frame = +2

Query  635   TEDSRKSKRYTYTNMERIEADLARARASILRggggg--TQTKDDDSVPVGPMYRNASFFL  808
              + +R SKR     +  IE  LARAR SI         T +K +D +P G +YRNA  F 
Sbjct  103   NDTARLSKR---VKVGIIEEGLARARNSIRHAALARNYTTSKVEDFIPRGAVYRNAHAFH  159

Query  809   RSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDFSR--FRTTDPDKAHLY  982
             +SY EMEK  KV+ Y++G+PP+ H GP  S  AIEG+FI  ++  +  FR   PD+AH++
Sbjct  160   QSYIEMEKRFKVWTYKEGEPPIIHGGPGASINAIEGHFISEIEDKKNPFRARHPDEAHVF  219

Query  983   FLPFSITVLSKLVYEPNSHD-WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWG  1159
             FLPFS+  + + VY+P   D W P+K    DY+  V+ K+P+WNRSLGADHF++SCHDW 
Sbjct  220   FLPFSVVNIVQYVYKPKVSDYWGPLKRLIADYIGVVSEKHPYWNRSLGADHFMVSCHDWA  279

Query  1160  PEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVL  1339
             P +S A   L+ NSIR +CNANTSE F   KDV++PE+ LP G     +   S + R +L
Sbjct  280   PHLSDANLQLYENSIRVICNANTSEGFKLGKDVTLPEVHLPDGLLSQPVRHRSLTDRTIL  339

Query  1340  VFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPR  1519
              F+AGG HG +R IL  HW  KD+++ VH YLPKG++Y  +M K+++C+CPSGYEVASPR
Sbjct  340   AFFAGGSHGYIREILFHHWRGKDQEILVHEYLPKGLNYAALMSKTKFCLCPSGYEVASPR  399

Query  1520  MVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQR  1699
             +VE+++MGCVPV+I   Y  PF DVL+W  F+V IPVE IP +K IL GIS+R+Y  +Q 
Sbjct  400   IVESIFMGCVPVIISVNYPPPFGDVLDWSKFSVQIPVEKIPEIKTILRGISERRYRILQM  459

Query  1700  RGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             R ++V+RHF +N P KRFDV HM+LHSIW
Sbjct  460   RVLQVQRHFVLNRPAKRFDVIHMVLHSIW  488



>ref|XP_006594253.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
isoform X1 [Glycine max]
Length=487

 Score =   406 bits (1044),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 197/383 (51%), Positives = 262/383 (68%), Gaps = 11/383 (3%)
 Frame = +2

Query  671   TNMERIEADLARARASILRggggg--TQTKDDDSVPVGPMYRNASFFL-RSYAEMEKTLK  841
             T++E+IE  LA+ARASI         T  + +  VP G +YRN   FL RS+ EM K  K
Sbjct  94    TSLEKIEESLAQARASIQESILSRNYTSQRREIFVPKGSIYRNPHAFLHRSHIEMVKRFK  153

Query  842   VYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD----FSRFRTTDPDKAHLYFLPFSITVL  1009
             V+VY++G+ P+ H GP  + YAIEG F+  MD    +S+FR   P++AH++FLP SI  +
Sbjct  154   VWVYQEGEQPLVHDGPVNNIYAIEGQFMDEMDNNGKWSQFRARHPEEAHVFFLPISIANV  213

Query  1010  SKLVYEP--NSHDWSPMKITAL--DYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFA  1177
                VY+P     D+ P+++  L  DY+  +  KYP+WNRS+GADHF+LSCHDWGP++S+ 
Sbjct  214   VHYVYKPILKQSDYEPVRLQHLVEDYIGVIQDKYPYWNRSIGADHFLLSCHDWGPKVSYG  273

Query  1178  IPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGG  1357
              P L    IRALCNANTSE F P +DVSIPE+ LP G       G  P+ R  L F+AGG
Sbjct  274   NPELFQTFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPASLGQHPNSRTTLAFFAGG  333

Query  1358  LHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALY  1537
             +HG +R ILL+HW++KD +V VH YLPKG  Y  +M +S++C+CPSG+EVASPR+VEA++
Sbjct  334   VHGEIRKILLKHWKDKDNEVLVHEYLPKGQDYTKLMGQSKFCLCPSGHEVASPRVVEAIH  393

Query  1538  MGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVR  1717
              GCVPV+I   Y  PFSDVLNW  F+V IPVE IP +K IL  IS+ +Y+R+    ++VR
Sbjct  394   AGCVPVIICDNYSLPFSDVLNWSQFSVEIPVEKIPEIKSILQSISRNKYLRLHMNVLRVR  453

Query  1718  RHFEVNSPPKRFDVFHMILHSIW  1786
             RHF +N P K FD+ HMILHSIW
Sbjct  454   RHFMINRPTKPFDMMHMILHSIW  476



>ref|XP_010241628.1| PREDICTED: probable glycosyltransferase At5g20260 [Nelumbo nucifera]
Length=482

 Score =   406 bits (1044),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/377 (50%), Positives = 264/377 (70%), Gaps = 5/377 (1%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQT--KDDDSVPVGPMYRNASFFLRSYAEMEKTLKV  844
             +++ R+E  LARARA+IL+       T  K+D+ V  G +YRN   F +S+ EM K  KV
Sbjct  96    SSLNRVEESLARARAAILQAARSRNNTRPKEDEFVSKGSIYRNPYAFYQSHNEMVKRFKV  155

Query  845   YVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD--FSRFRTTDPDKAHLYFLPFSITVLSKL  1018
             +VY +G+PP+ H GP  + Y+ EG FI  M+   S F    PD+AH +FLPFSI    + 
Sbjct  156   WVYREGEPPLVHNGPLNNIYSSEGQFIDEMESGHSPFAARHPDEAHAFFLPFSIANAVQY  215

Query  1019  VYEP-NSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHN  1195
             +Y+P  S+   P++    DY+  V+ KYP+WNRS GADHF++SCHDW P++S A P L  
Sbjct  216   LYKPLTSYARDPLQHVVEDYIGVVSNKYPYWNRSHGADHFMVSCHDWAPDVSTAHPELFK  275

Query  1196  NSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             + IR +CNAN +E F P  D ++PE+  P GT      G +PSKR +L F+AGG HG +R
Sbjct  276   HFIRVICNANITEGFRPGIDAALPELNTPFGTLGRPSFGQAPSKRTLLAFFAGGAHGYIR  335

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
              +LL+HW++KD+DVQVH YLPKG++Y  +M ++++C+CPSGYEVASPR+VEA+  GC+P 
Sbjct  336   KVLLEHWKDKDKDVQVHEYLPKGMNYAKLMGQAKFCLCPSGYEVASPRIVEAIQAGCIPT  395

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             +I  GY  PFSDVL+W  F+V IPVE IP++KKIL G+SQ +Y++MQ++  +VRRHF +N
Sbjct  396   IISDGYWLPFSDVLDWSQFSVQIPVERIPDIKKILQGVSQNRYLQMQKKVRQVRRHFVLN  455

Query  1736  SPPKRFDVFHMILHSIW  1786
              P +RFDV HMILHS+W
Sbjct  456   RPAQRFDVIHMILHSVW  472



>ref|XP_002884661.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60920.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=470

 Score =   404 bits (1039),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/375 (51%), Positives = 255/375 (68%), Gaps = 7/375 (2%)
 Frame = +2

Query  683   RIEADLARARASILRgggggTQTK-----DDDSVPVGPMYRNASFFLRSYAEMEKTLKVY  847
             ++EA+LA ARA I         T      D+D VP G +YRN   F RSY  ME+  K+Y
Sbjct  87    KVEAELATARALIREAQLNSNSTASSPLGDEDYVPHGDIYRNPYAFHRSYLLMERMFKIY  146

Query  848   VYEDGQPPVAHYGPCKSTYAIEGNFIHAM--DFSRFRTTDPDKAHLYFLPFSITVLSKLV  1021
             VYE+G PP+ HYG CK  Y++EG F++ M  D  ++RT DPDKAH+YFLPFS+ ++   +
Sbjct  147   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  206

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             ++P   D + ++    DYV  +++KYP+WN S G DHF+LSCHDWG   ++ +  L  NS
Sbjct  207   FDPVVRDKAVLESVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  266

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPI  1381
             IR LCNAN SE F+P+KD   PEI L +G    L GG  P  R  L F+AG  HG +RP+
Sbjct  267   IRVLCNANISEYFNPEKDAPFPEINLLTGEINNLTGGLDPISRKTLAFFAGKSHGKIRPV  326

Query  1382  LLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLI  1561
             LL HW+ KD+D+ V+  LP+ ++Y  MMRK+R+CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  327   LLNHWKEKDKDILVYENLPEDLNYTEMMRKTRFCICPSGHEVASPRIPEAIYSGCVPVLI  386

Query  1562  KRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSP  1741
                YV PFSDVLNWE F+V + V++IP LK+IL  I + +Y+R+     KV+ H  VN P
Sbjct  387   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEERYMRLYEGVKKVKMHILVNDP  446

Query  1742  PKRFDVFHMILHSIW  1786
             PKR+DVF+MI+HSIW
Sbjct  447   PKRYDVFNMIIHSIW  461



>ref|XP_010552074.1| PREDICTED: probable glycosyltransferase At3g07620 [Tarenaya hassleriana]
Length=477

 Score =   404 bits (1039),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 198/398 (50%), Positives = 261/398 (66%), Gaps = 5/398 (1%)
 Frame = +2

Query  608   RQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASI---LRgggggTQTKDDDSVPVG  778
             R+NG   +    S       +  + ++E  LA ARA I   L      +   D D VP G
Sbjct  71    RRNGSHPNQDWGSGLGTDPGWKRVVKVEKQLASARALIREALSNPNSSSPLMDKDYVPHG  130

Query  779   PMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAM--DFSRFR  952
              +YRN   F RSY  MEK  K+YVYE+G+PP+ HYG CK+ Y++EG F++ M  D  R+R
Sbjct  131   EIYRNPYAFHRSYLLMEKLFKIYVYEEGEPPMFHYGLCKNIYSMEGLFLNFMENDVVRYR  190

Query  953   TTDPDKAHLYFLPFSITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADH  1132
             T DPD+AH+YFLPFS+ ++ + +++P   D   ++   +DY+  V+ KYP+WN S G DH
Sbjct  191   TLDPDEAHVYFLPFSVVMILQHLFDPVFRDKGVLERVIVDYIRVVSTKYPYWNTSDGFDH  250

Query  1133  FILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGG  1312
             F+LSCHDWG   S+ +  L  NSIR LCNAN SE F+P KD   PEI L +G    L GG
Sbjct  251   FMLSCHDWGHRASWYVKKLFFNSIRVLCNANMSEYFNPVKDAPFPEINLVTGEITDLTGG  310

Query  1313  PSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICP  1492
               P  R  L F+AG LHG +RP+LL HW+ KD D+ V+  LP  + Y GMMRKSR+CICP
Sbjct  311   LDPVNRTTLAFFAGKLHGKIRPVLLNHWKEKDRDILVYENLPDELDYTGMMRKSRFCICP  370

Query  1493  SGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGIS  1672
             SG+EVASPR+ EA+Y GCVPVLI   YV PFSDVL W+ F+V + V++IP LK+IL GI 
Sbjct  371   SGHEVASPRIPEAIYAGCVPVLISEYYVLPFSDVLEWDKFSVWVSVKEIPELKRILLGIP  430

Query  1673  QRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             + +Y R+      V+RHF VN PPKR+DVF+MI+HS+W
Sbjct  431   EDRYRRLYEGVKNVQRHFLVNDPPKRYDVFNMIIHSVW  468



>ref|XP_004138850.1| PREDICTED: probable glycosyltransferase At5g25310-like [Cucumis 
sativus]
 ref|XP_004172108.1| PREDICTED: probable glycosyltransferase At5g25310-like [Cucumis 
sativus]
 gb|KGN62965.1| hypothetical protein Csa_2G382390 [Cucumis sativus]
Length=465

 Score =   404 bits (1037),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 195/386 (51%), Positives = 264/386 (68%), Gaps = 6/386 (2%)
 Frame = +2

Query  647   RKSKRYTYTNMERIEADLARARASILRgggggT-QTKDDDSVPVGPMYRNASFFLRSYAE  823
             RK ++   +  E++E  LA+ARASI +        T   D +P   +Y N   F +SY E
Sbjct  71    RKVRKTRLSREEKLELGLAQARASIRKAANDSNLSTSSIDYIPSSSVYHNPRAFYQSYVE  130

Query  824   MEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD--FSRFRTTDPDKAHLYFLPFS  997
             MEK  KVYVY +G+ P+ H GPCK+ Y IEG FIH M+   + FRT DP +AH+ F+PFS
Sbjct  131   MEKRFKVYVYPEGELPITHAGPCKNIYTIEGRFIHEMEDGGNGFRTVDPSRAHVLFMPFS  190

Query  998   ITVLSKLVYEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFA  1177
             +  + K +Y+  S+D +P+++   DYV  V++KYPFWN++ GADHFIL+CHDWGP  +  
Sbjct  191   VAWMVKYLYKDGSYDQTPLRMFVSDYVEVVSKKYPFWNKTNGADHFILACHDWGPIATEG  250

Query  1178  IPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSG--TTKGLLGGPSPSKRPVLVFYA  1351
                L+N SIR LCNAN+SE F+P+KDVS+PEI L  G  + K L    S   RP L F+A
Sbjct  251   NRFLYNTSIRVLCNANSSEGFNPQKDVSLPEIHLYDGEISPKLLSASNSHHHRPHLAFFA  310

Query  1352  GGLHGPVRPILLQHWENKDE-DVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVE  1528
             GGLHGP+RPILL HW+N+   ++ V+ YLPK + Y   M +SR+C+CPSGYEVASPR+VE
Sbjct  311   GGLHGPIRPILLNHWKNRTHTNIHVYEYLPKQLDYYDEMLQSRFCLCPSGYEVASPRIVE  370

Query  1529  ALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGV  1708
             A+Y  CVPV+I   YV PFSDVL WE F++ + V +IP L++IL G+S+ +Y ++ +   
Sbjct  371   AIYAECVPVIISERYVLPFSDVLRWEGFSIEVSVSEIPRLEEILMGVSEERYEKLIQGLR  430

Query  1709  KVRRHFEVNSPPKRFDVFHMILHSIW  1786
              VR+HF +N P KRFD FHMILHS+W
Sbjct  431   TVRKHFVLNRPAKRFDAFHMILHSVW  456



>ref|XP_008219689.1| PREDICTED: probable glycosyltransferase At5g25310 [Prunus mume]
Length=496

 Score =   404 bits (1039),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 201/377 (53%), Positives = 263/377 (70%), Gaps = 10/377 (3%)
 Frame = +2

Query  686   IEADLARARASILRgggg--gTQTKDDD-SVPVGPM-YRNASFFLRSYAEMEKTLKVYVY  853
             +E  LARARASI R       + T DDD S P G + YRN   F +SY EMEK  KVYVY
Sbjct  111   LEQGLARARASIRRTVRSPNRSSTFDDDVSFPGGSVVYRNPGAFYQSYLEMEKKFKVYVY  170

Query  854   EDGQPPVAHYGPCKSTYAIEGNFIHAMDFS----RFRTTDPDKAHLYFLPFSITVLSKLV  1021
              +G PP+AH GPCK  Y+IEG F+H M+      RF+T  P +AH+YF+PFS+T + K +
Sbjct  171   TEGDPPMAHDGPCKDIYSIEGRFMHEMENGAAGRRFKTKSPKRAHVYFMPFSVTWMVKYL  230

Query  1022  YEPNSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNS  1201
             Y+P +++ +P++    DYV  ++ ++PFWNR+ GADHF+LSCHDW P  S     L+N S
Sbjct  231   YKPFTYNLTPLRDFVADYVRVISTRHPFWNRTHGADHFMLSCHDWAPHASAGNQFLYNTS  290

Query  1202  IRALCNANTSERFDPKKDVSIPEIVLPSGT--TKGLLGGPSPSKRPVLVFYAGGLHGPVR  1375
             IR LCNANTSE F+P+KDVS+PEI L  G   +K +   P  + RP L F+AGGLHGP+R
Sbjct  291   IRVLCNANTSEGFNPQKDVSLPEIYLYGGNVPSKLISPPPPQTPRPYLGFFAGGLHGPIR  350

Query  1376  PILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPV  1555
             PILL HW+ +DED++V+ YLP+G  Y  MM KSR+C+CPSG+EVASPR+VEA+Y  CVPV
Sbjct  351   PILLAHWKTRDEDLRVYEYLPEGEDYASMMLKSRFCLCPSGHEVASPRIVEAIYAECVPV  410

Query  1556  LIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVN  1735
             ++   Y  PFSDVL WEAF+V + V +I  LK++L  + + +Y  +      VRRHFE+N
Sbjct  411   ILSEHYALPFSDVLRWEAFSVRVEVSEIWRLKEVLMAVPEEKYRWLVENLRVVRRHFELN  470

Query  1736  SPPKRFDVFHMILHSIW  1786
              P KRFDVFHMILHS+W
Sbjct  471   QPAKRFDVFHMILHSVW  487



>ref|XP_006600735.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
[Glycine max]
Length=499

 Score =   404 bits (1038),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 198/383 (52%), Positives = 256/383 (67%), Gaps = 10/383 (3%)
 Frame = +2

Query  668   YTNMERIEADLARARASILRgggggTQTKDD--DSVPVGPMYRNASFFLRSYAEMEKTLK  841
             Y ++E+IE  LARARASI         T  +  + VP G +Y N   F +S+ EM K  K
Sbjct  103   YPSLEKIEEGLARARASIQESIRSRNYTSANRVNFVPKGSIYLNPHAFHQSHEEMLKRFK  162

Query  842   VYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMD----FSRFRTTDPDKAHLYFLPFSITVL  1009
             V+VYE+G+ P+ H GP    Y+IEG FI  +D    +S FR   PD+A ++FLPFSI  +
Sbjct  163   VWVYEEGEQPLVHDGPANDIYSIEGQFIDEIDNDAKWSHFRAEHPDQAQVFFLPFSIANV  222

Query  1010  SKLVYEP--NSHDWSPMKITAL--DYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFA  1177
                VY+P     D+ P+++  L  DY+  +A KYP+WNRS GADHF+LSCHDWGP++S+ 
Sbjct  223   VHYVYKPIRKHSDYEPIRLQRLVEDYIGVIANKYPYWNRSEGADHFLLSCHDWGPKVSYG  282

Query  1178  IPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGG  1357
              P L  N IR LCNANTSE F P KDVSIPE+ LP G       G  P+ R +L F+AG 
Sbjct  283   NPKLFKNFIRVLCNANTSEGFLPNKDVSIPEVYLPKGKLGPPNLGQRPNDRSILAFFAGR  342

Query  1358  LHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALY  1537
              HG +R ILL HW+ KD D+QVH YLPKG +Y  +M +S++C+CPSGYEVASPR+VEA++
Sbjct  343   EHGDIRKILLNHWKGKDNDIQVHEYLPKGKNYTQLMGQSKFCLCPSGYEVASPRVVEAIH  402

Query  1538  MGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVR  1717
              GCVPVLI   Y  PF+DVLNW  F+V IPVE I  +K IL  IS+ +Y+R+    ++VR
Sbjct  403   AGCVPVLISSSYSPPFTDVLNWSQFSVEIPVEKISEIKTILQSISRNRYLRLHMNVLRVR  462

Query  1718  RHFEVNSPPKRFDVFHMILHSIW  1786
             RHF +N P K FD+ HMILHSIW
Sbjct  463   RHFMLNRPAKPFDLMHMILHSIW  485



>ref|XP_010905483.1| PREDICTED: probable glycosyltransferase At5g20260 [Elaeis guineensis]
Length=461

 Score =   402 bits (1033),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/372 (51%), Positives = 259/372 (70%), Gaps = 5/372 (1%)
 Frame = +2

Query  686   IEADLARARASILRggggg--TQTKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYED  859
             IE  LARAR +I         +  K +  +P G +YRNA  F +SY EMEK  KV+ Y++
Sbjct  80    IEEGLARARNAIRHAAIARNYSSEKVEKFIPRGAVYRNAYAFHQSYIEMEKRFKVWTYKE  139

Query  860   GQPPVAHYGPCKSTYAIEGNFIHAMDFSR--FRTTDPDKAHLYFLPFSITVLSKLVYEPN  1033
             G+PP+ H GP  S YAIEG+FI  ++  +  FR   PD+AH++FLPFS+  + + VY+PN
Sbjct  140   GEPPIIHEGPGASIYAIEGHFISEIEDEKNPFRAHHPDEAHVFFLPFSVVNIVQYVYKPN  199

Query  1034  SHD-WSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRA  1210
               D W P+K    DY+  ++ KYP+WNRSLG DHF++SCHDW P +S A   L+ NSIR 
Sbjct  200   VSDYWKPLKRLIADYIGVISEKYPYWNRSLGVDHFMVSCHDWAPHLSDANLQLYRNSIRV  259

Query  1211  LCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQ  1390
             +CNANTSE F   KDV++PE+ LP G     +   S ++R +L F++GG HG +R ILL 
Sbjct  260   ICNANTSEGFKLGKDVTLPEVHLPDGLLSQPVRHRSLAERTILAFFSGGSHGYIREILLH  319

Query  1391  HWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRG  1570
             HW+ KD ++  + YLPKG++Y  +MRK+++C+CPSGYEVASPR+VE+++MGCVPV+I   
Sbjct  320   HWKGKDHEILAYEYLPKGLNYAELMRKTKFCLCPSGYEVASPRIVESIFMGCVPVIISVN  379

Query  1571  YVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKR  1750
             Y  PF DVL+W  F+V IPVE IP +K +L GIS+R+Y  +Q R ++V+RHF +N P KR
Sbjct  380   YPPPFGDVLDWSKFSVQIPVEKIPEIKTLLKGISERRYRILQSRVLQVQRHFVLNRPAKR  439

Query  1751  FDVFHMILHSIW  1786
             FDV HM+LHSIW
Sbjct  440   FDVIHMVLHSIW  451



>ref|XP_007202437.1| hypothetical protein PRUPE_ppa014750mg, partial [Prunus persica]
 gb|EMJ03636.1| hypothetical protein PRUPE_ppa014750mg, partial [Prunus persica]
Length=390

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/378 (49%), Positives = 262/378 (69%), Gaps = 6/378 (2%)
 Frame = +2

Query  671   TNMERIEADLARARASILRgggggTQTKDDDS---VPVGPMYRNASFFLRSYAEMEKTLK  841
             +N+ERIEADLARAR +I +       +K +D    +P G +YRNA  F +S+ EME+ LK
Sbjct  3     SNLERIEADLARARDAIRKAVQAKNHSKGNDDEGFIPTGSIYRNAHSFHQSHVEMEERLK  62

Query  842   VYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPFSITVLSK  1015
             V++Y +G+PP+ H GP  + Y IEG FI  M+   SRF    PD+A+L+ +P S+  +  
Sbjct  63    VWIYREGEPPLVHDGPLNNIYGIEGQFIDEMESGKSRFMARHPDEANLFLIPISVVNIVN  122

Query  1016  LVYEP-NSHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLH  1192
              +Y P  ++    ++   LDY+  ++ +YP+WNRS GADHF++SCHDW P+IS A P L+
Sbjct  123   TLYNPLVTYSRDQLQRVVLDYIGIISERYPYWNRSQGADHFLVSCHDWAPDISEANPKLY  182

Query  1193  NNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLVFYAGGLHGPV  1372
             +  IR LCNANTSE F P++DVSIPEI +P G         SP KR +L F+AGG HG +
Sbjct  183   DKFIRVLCNANTSEGFKPQRDVSIPEINIPYGKLGPTPQRASPDKRSILAFFAGGAHGNI  242

Query  1373  RPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVP  1552
             R ILL+HW++KD++VQVH YL K  +Y  +M KS++C+CPSGYEVASPR+V A+ +GCVP
Sbjct  243   RHILLEHWKDKDKEVQVHEYLDKKKNYFKLMGKSKFCLCPSGYEVASPRVVTAISVGCVP  302

Query  1553  VLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEV  1732
             VLI   Y  PFSDVL+W  F+V IP E IP +K IL GIS ++Y+++Q+R  +V RHF +
Sbjct  303   VLISDYYALPFSDVLDWTKFSVYIPSEKIPEIKTILKGISPKRYLKLQKRVTEVHRHFMI  362

Query  1733  NSPPKRFDVFHMILHSIW  1786
             + P + +D+ HM+LHS+W
Sbjct  363   HRPAQPYDMIHMLLHSVW  380



>emb|CDX80499.1| BnaC07g29450D [Brassica napus]
Length=482

 Score =   402 bits (1032),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 259/378 (69%), Gaps = 16/378 (4%)
 Frame = +2

Query  686   IEADLARARASILRgggggTQ--TKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYED  859
             +E  L++ARASI   G    +  T  +  +P   +YRN S   +SY EMEK  KVYVYE+
Sbjct  101   VEVGLSKARASIREAGASSNRNATLFNVDLPNAQVYRNPSALHQSYLEMEKRFKVYVYEE  160

Query  860   GQPPVAHYGPCKSTYAIEGNFIHAMDFSR--FRTTDPDKAHLYFLPFSITVLSKLVYEPN  1033
             G+PP+ H GPCKS YA+EG FI  M+ SR  FRT DPDKAH+YFLPFS+T L   +Y+ N
Sbjct  161   GEPPLVHDGPCKSVYAVEGRFIMEMEKSRTKFRTHDPDKAHVYFLPFSVTWLVTNLYD-N  219

Query  1034  SHDWSPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRAL  1213
             + D  P++  A DYV  ++ K+PFWNR+ GADHF+L+CHDWGP  S A  +L + SIR +
Sbjct  220   NFDVEPLRTFASDYVRLISSKHPFWNRTSGADHFMLACHDWGPLTSKANEDLFSKSIRVM  279

Query  1214  CNANTSERFDPKKDVSIPEIVLPSG-------TTKGLLGGPSPSKRPVLVFYAGGLHGPV  1372
             CNAN+SE F+P KD ++PEI L  G        +K L+  P    RP L F+AGG+HGPV
Sbjct  280   CNANSSEGFNPAKDATLPEIKLYGGEVHPQLRLSKTLMTSP----RPHLAFFAGGVHGPV  335

Query  1373  RPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVP  1552
             RPILL HW+ +D D+ V  YLPK ++Y   MR S++C CPSGYEVASPR++EA+Y  C+P
Sbjct  336   RPILLDHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRLIEAIYSECIP  395

Query  1553  VLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEV  1732
             V++   +V PFSD+L  E F+V + V +IP LK+IL  IS  +Y  ++R    VRRHFE+
Sbjct  396   VILSVNFVLPFSDILRLETFSVQVDVSEIPRLKEILMSISDEKYQSLKRNLRYVRRHFEL  455

Query  1733  NSPPKRFDVFHMILHSIW  1786
             N PPKR+D FHM LHSIW
Sbjct  456   NDPPKRYDAFHMTLHSIW  473



>ref|XP_010250233.1| PREDICTED: probable glycosyltransferase At5g20260 isoform X1 
[Nelumbo nucifera]
Length=484

 Score =   401 bits (1031),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/409 (48%), Positives = 270/409 (66%), Gaps = 8/409 (2%)
 Frame = +2

Query  575   LAPETGIGDDERQNGISSDDTEDSRKSKRYTYTNMERIEADLARARASILRggggg--TQ  748
             L  E+  G        S     D+R  K+    ++++IE  LARARA+IL+       T 
Sbjct  66    LMQESSTGSPVPSFEFSPTTVTDTRIKKK---GSLDKIEEGLARARAAILQAVRSHNCTT  122

Query  749   TKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIH  928
               +D+ +P G +YRN   F +S+ EMEK  KV+VY++G+PP+ H GP  + Y+ EG FI 
Sbjct  123   LTEDEFIPRGSIYRNPFAFHQSHIEMEKRFKVWVYKEGEPPLVHDGPLNNIYSTEGQFID  182

Query  929   AMD--FSRFRTTDPDKAHLYFLPFSITVLSKLVYEP-NSHDWSPMKITALDYVNSVARKY  1099
              MD   S F    PD+AH +FLP S+  + + +Y+P  S+    ++    DY+  ++ KY
Sbjct  183   EMDNGHSPFLARHPDEAHAFFLPLSVVNVVRFIYKPVTSYARDRLQHVVEDYIGVISSKY  242

Query  1100  PFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVL  1279
             P+WN S GADHF++SCHDW P++S A P L  + IR LCNAN +E F P  D S+PEI  
Sbjct  243   PYWNISQGADHFMVSCHDWAPDVSDANPELFKHFIRVLCNANITEGFRPGIDASLPEINT  302

Query  1280  PSGTTKGLLGGPSPSKRPVLVFYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNG  1459
             P GT      G +P KR +L F+AGG HG +R +LLQ W++KD+DVQVH YLPKG++Y  
Sbjct  303   PFGTLGQPNFGQAPHKRTLLAFFAGGAHGYIRRVLLQQWKDKDKDVQVHEYLPKGMNYTR  362

Query  1460  MMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDI  1639
             +M +S++C+CPSGYEVASPR+VEA+Y GCVP +I   Y  PFSDVL+W  F+V IPVE I
Sbjct  363   LMGQSKFCLCPSGYEVASPRIVEAIYAGCVPAIISDNYWLPFSDVLDWSQFSVQIPVEKI  422

Query  1640  PNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             P +K IL GISQ +Y++MQ++  +V+RHF +N P +RFDV HMILHS+W
Sbjct  423   PEIKTILQGISQDKYLKMQKKVRRVQRHFVLNRPAQRFDVIHMILHSVW  471



>ref|XP_006582483.1| PREDICTED: probable glycosyltransferase At5g25310-like [Glycine 
max]
Length=474

 Score =   400 bits (1029),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 189/353 (54%), Positives = 246/353 (70%), Gaps = 7/353 (2%)
 Frame = +2

Query  749   TKDDDSVPVGPMYRNASFFLRSYAEMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIH  928
             T D+D +  G +YRN   F +SY EMEK  KVYVY DG  P+ H  PCK  Y+IEG F+H
Sbjct  113   THDNDDILAGTVYRNPRLFHQSYLEMEKLFKVYVYPDGDLPIVHDAPCKDIYSIEGRFLH  172

Query  929   AMD--FSRFRTTDPDKAHLYFLPFSITVLSKLVYE-PNSHDWSPMKITALDYVNSVARKY  1099
              M+    RFRT DP  AH+YFLPFS+T + K  Y  P+S+D +P+K    DYV  ++ KY
Sbjct  173   EMEHGVGRFRTNDPTAAHVYFLPFSVTWMVKYFYSTPHSYDVTPLKNFVSDYVRVISTKY  232

Query  1100  PFWNRSLGADHFILSCHDWGPEISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVL  1279
             PFWN++ GADHF+++CHDWGP  S   P L+N SIR LCNANTSE F+P+KDV +PEI L
Sbjct  233   PFWNKTHGADHFMVACHDWGPYASEGNPFLYNTSIRVLCNANTSEGFNPQKDVPLPEIHL  292

Query  1280  PSGTTKGLLGGPSP--SKRPVLVFYAGGLHGPVRPILLQHWENKD--EDVQVHSYLPKGV  1447
               G     L  P P  + R  L F+AGG+HGP+RPILL HW N+D  +D++V+ YLPK +
Sbjct  293   YGGEVSPKLLSPPPGNATRRYLAFFAGGMHGPIRPILLHHWNNRDINDDMRVYEYLPKDL  352

Query  1448  SYNGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIP  1627
              Y   M  S++C+CPSGYEVASPR+VE++Y  CVPV++ + Y  PFSDVL WE+F+V + 
Sbjct  353   DYYSFMLNSKFCLCPSGYEVASPRIVESIYAECVPVILSKNYTLPFSDVLRWESFSVQVD  412

Query  1628  VEDIPNLKKILTGISQRQYIRMQRRGVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
             V DIP LK++L+ I + +Y +++     VRRHF +N P KR DVFHMILHSIW
Sbjct  413   VSDIPRLKEVLSAIPESEYQKLKHGVRAVRRHFTLNQPAKRLDVFHMILHSIW  465



>ref|XP_008242869.1| PREDICTED: probable glycosyltransferase At3g42180 [Prunus mume]
Length=407

 Score =   398 bits (1022),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 194/388 (50%), Positives = 258/388 (66%), Gaps = 8/388 (2%)
 Frame = +2

Query  647   RKSKRYTYTNMERIEADLARARASILRgggggT--QTKDDDSVPVGPMYRNASFFLRSYA  820
             R+S     T++ERIE DLA+ARA+I            + +  +P G +Y+N   F +S+ 
Sbjct  4     RRSGHKNKTSLERIEEDLAQARAAIREAIQSRNYKSERTETFIPRGSIYKNPYAFHQSHI  63

Query  821   EMEKTLKVYVYEDGQPPVAHYGPCKSTYAIEGNFIHAMDF--SRFRTTDPDKAHLYFLPF  994
             EM K  KV+ Y++G+ P+ H GP  + Y IEG+FI  ++   S FR T PD+AH +FLP 
Sbjct  64    EMRKMFKVWSYKEGELPLVHIGPMTNIYGIEGHFIDEIEREESPFRATHPDQAHTFFLPV  123

Query  995   SITVLSKLVYEP--NSHDW--SPMKITALDYVNSVARKYPFWNRSLGADHFILSCHDWGP  1162
             S+  + + VY P     D+    ++   +DY+  VARKYP+WNRS GADHF+ SCHDWGP
Sbjct  124   SVANIVEYVYLPITRKQDYYRDRLQRIVVDYIGVVARKYPYWNRSHGADHFMASCHDWGP  183

Query  1163  EISFAIPNLHNNSIRALCNANTSERFDPKKDVSIPEIVLPSGTTKGLLGGPSPSKRPVLV  1342
             EIS   P L  N IR LCNANTSE F P++DV +PEI +PS        G  P+ RP+L 
Sbjct  184   EISVGQPELFKNFIRVLCNANTSEGFQPRRDVPLPEIYVPSRKLGPPYFGQPPNNRPILA  243

Query  1343  FYAGGLHGPVRPILLQHWENKDEDVQVHSYLPKGVSYNGMMRKSRYCICPSGYEVASPRM  1522
             F+AG +HG +RPILL +W++KD++VQVH  LP   +Y  +M KS+YC+CPSG+EVASPR+
Sbjct  244   FFAGRVHGSIRPILLDNWKDKDDEVQVHEKLPLDQNYTKLMGKSKYCLCPSGFEVASPRV  303

Query  1523  VEALYMGCVPVLIKRGYVAPFSDVLNWEAFAVIIPVEDIPNLKKILTGISQRQYIRMQRR  1702
             VEA Y GCVPVLI   Y  PFSDVLNW  F++ IPV  IP +K IL GI   +Y+RMQ+R
Sbjct  304   VEAFYAGCVPVLISDNYTLPFSDVLNWSQFSIQIPVAKIPEIKTILQGIPYEKYLRMQKR  363

Query  1703  GVKVRRHFEVNSPPKRFDVFHMILHSIW  1786
               KV+RHF +N P + FDV HM+LHS+W
Sbjct  364   VSKVKRHFVLNRPSQPFDVIHMVLHSVW  391



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5681893186740