BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22214_g2_i2 len=1610 path=[7564:0-457 5951:458-517 10444:518-668
8231:669-696 9621:697-795 9720:796-1122 1508:1123-1168
11603:1169-1274 8837:1275-1302 10170:1303-1379 8942:1380-1438
9001:1439-1609]

Length=1610
                                                                      Score     E

ref|XP_009774930.1|  PREDICTED: probable glycosyltransferase At5g...    602   0.0      
ref|XP_009774931.1|  PREDICTED: probable glycosyltransferase At5g...    602   0.0      
ref|XP_009631064.1|  PREDICTED: probable glycosyltransferase At5g...    599   0.0      
ref|XP_004249790.2|  PREDICTED: probable glycosyltransferase At5g...    581   0.0      
ref|XP_006339310.1|  PREDICTED: probable glycosyltransferase At5g...    575   0.0      
ref|XP_002528630.1|  catalytic, putative                                575   0.0      Ricinus communis
gb|KDP29231.1|  hypothetical protein JCGZ_16620                         568   0.0      
ref|XP_002284018.2|  PREDICTED: probable glycosyltransferase At5g...    563   0.0      Vitis vinifera
emb|CDP15333.1|  unnamed protein product                                556   0.0      
ref|XP_011101498.1|  PREDICTED: probable glycosyltransferase At5g...    556   0.0      
gb|EYU38594.1|  hypothetical protein MIMGU_mgv1a021350mg                555   0.0      
ref|XP_009787886.1|  PREDICTED: probable glycosyltransferase At5g...    551   0.0      
ref|XP_009779883.1|  PREDICTED: probable glycosyltransferase At5g...    554   0.0      
ref|XP_009617934.1|  PREDICTED: probable glycosyltransferase At5g...    554   0.0      
ref|XP_009617933.1|  PREDICTED: probable glycosyltransferase At5g...    554   0.0      
ref|XP_010098868.1|  putative glycosyltransferase                       549   0.0      
ref|XP_004246587.1|  PREDICTED: probable glycosyltransferase At5g...    551   0.0      
ref|XP_010325948.1|  PREDICTED: probable glycosyltransferase At5g...    551   0.0      
ref|XP_004494122.1|  PREDICTED: probable glycosyltransferase At5g...    551   0.0      
gb|EYU41561.1|  hypothetical protein MIMGU_mgv1a004154mg                551   0.0      
ref|XP_011094446.1|  PREDICTED: probable glycosyltransferase At5g...    551   0.0      
ref|XP_006366795.1|  PREDICTED: probable glycosyltransferase At5g...    549   0.0      
ref|XP_010243080.1|  PREDICTED: probable glycosyltransferase At5g...    551   0.0      
ref|XP_010243073.1|  PREDICTED: probable glycosyltransferase At5g...    549   0.0      
ref|XP_007027562.1|  Exostosin family protein                           545   0.0      
ref|XP_010242926.1|  PREDICTED: probable glycosyltransferase At5g...    544   0.0      
ref|XP_010248410.1|  PREDICTED: probable glycosyltransferase At5g...    548   0.0      
gb|KEH24081.1|  glycosyltransferase                                     539   0.0      
ref|XP_006339262.1|  PREDICTED: probable glycosyltransferase At5g...    539   0.0      
ref|XP_007162830.1|  hypothetical protein PHAVU_001G184500g             540   0.0      
ref|XP_004497579.1|  PREDICTED: probable glycosyltransferase At5g...    536   0.0      
ref|XP_008359607.1|  PREDICTED: probable glycosyltransferase At5g...    535   0.0      
ref|XP_011018855.1|  PREDICTED: probable glycosyltransferase At5g...    533   0.0      
ref|XP_004249828.2|  PREDICTED: probable glycosyltransferase At5g...    530   0.0      
ref|XP_003553575.1|  PREDICTED: probable glycosyltransferase At5g...    534   0.0      
gb|KHN02275.1|  Putative glycosyltransferase                            533   0.0      
ref|XP_008392545.1|  PREDICTED: probable glycosyltransferase At5g...    533   0.0      
ref|XP_004303053.1|  PREDICTED: probable glycosyltransferase At5g...    532   0.0      
gb|KHG04052.1|  hypothetical protein F383_28592                         531   2e-180   
ref|XP_006381337.1|  hypothetical protein POPTR_0006s11930g             530   3e-180   
ref|XP_009340969.1|  PREDICTED: probable glycosyltransferase At5g...    531   3e-180   
ref|XP_009375632.1|  PREDICTED: probable glycosyltransferase At5g...    530   5e-180   
ref|XP_003521429.1|  PREDICTED: probable glycosyltransferase At5g...    530   5e-180   
gb|KHN18714.1|  Putative glycosyltransferase                            530   7e-180   
ref|XP_010039041.1|  PREDICTED: probable glycosyltransferase At5g...    530   1e-179   
ref|XP_010543482.1|  PREDICTED: probable glycosyltransferase At5g...    527   1e-179   
ref|XP_009776098.1|  PREDICTED: probable glycosyltransferase At5g...    526   2e-179   
ref|XP_007202112.1|  hypothetical protein PRUPE_ppa006842mg             523   2e-179   
ref|XP_006430348.1|  hypothetical protein CICLE_v10011407mg             529   2e-179   
gb|KDO60990.1|  hypothetical protein CISIN_1g048582mg                   529   2e-179   
gb|KHG20191.1|  hypothetical protein F383_08256                         530   2e-179   
ref|XP_006481931.1|  PREDICTED: probable glycosyltransferase At5g...    528   3e-179   
ref|XP_010039055.1|  PREDICTED: probable glycosyltransferase At5g...    528   1e-178   
ref|XP_009122667.1|  PREDICTED: probable glycosyltransferase At5g...    525   2e-178   
gb|AES60658.2|  exostosin family protein                                523   3e-178   
ref|XP_003590407.1|  hypothetical protein MTR_1g061760                  524   5e-178   
ref|XP_004156325.1|  PREDICTED: probable glycosyltransferase At5g...    524   7e-178   
ref|XP_004143371.1|  PREDICTED: probable glycosyltransferase At5g...    522   2e-177   
gb|KHN24379.1|  Putative glycosyltransferase                            521   3e-177   
ref|XP_003541440.1|  PREDICTED: probable glycosyltransferase At5g...    520   6e-177   
ref|XP_008241335.1|  PREDICTED: probable glycosyltransferase At5g...    522   7e-177   
emb|CDY42006.1|  BnaC04g00840D                                          520   2e-176   
ref|XP_003535253.1|  PREDICTED: probable glycosyltransferase At5g...    520   3e-176   
emb|CBI30213.3|  unnamed protein product                                511   7e-176   
ref|XP_010247793.1|  PREDICTED: probable glycosyltransferase At5g...    521   8e-176   
gb|KCW48746.1|  hypothetical protein EUGRSUZ_K02385                     511   2e-175   
ref|XP_006398838.1|  hypothetical protein EUTSA_v10016080mg             517   2e-175   
ref|XP_003542567.1|  PREDICTED: probable glycosyltransferase At5g...    516   3e-175   
dbj|BAB08605.1|  unnamed protein product                                513   3e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008462519.1|  PREDICTED: probable glycosyltransferase At5g...    516   4e-175   
ref|XP_010683939.1|  PREDICTED: probable glycosyltransferase At5g...    517   7e-175   
ref|NP_001031828.1|  Exostosin family protein                           514   5e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003537031.2|  PREDICTED: probable glycosyltransferase At5g...    512   9e-174   
ref|XP_002873114.1|  hypothetical protein ARALYDRAFT_487158             511   7e-173   
ref|XP_010490872.1|  PREDICTED: probable glycosyltransferase At5g...    510   1e-172   
emb|CDY11270.1|  BnaA03g01060D                                          503   7e-172   
ref|XP_006287392.1|  hypothetical protein CARUB_v10000598mg             510   8e-172   
ref|XP_011094445.1|  PREDICTED: probable glycosyltransferase At5g...    506   2e-171   
emb|CDX80888.1|  BnaC03g01420D                                          507   2e-171   
ref|XP_010423660.1|  PREDICTED: probable glycosyltransferase At5g...    507   2e-171   
gb|EPS64188.1|  hypothetical protein M569_10593                         501   4e-171   
gb|KFK24839.1|  hypothetical protein AALP_AA8G031400                    506   4e-171   
ref|XP_009130782.1|  PREDICTED: probable glycosyltransferase At5g...    506   6e-171   
ref|XP_009413449.1|  PREDICTED: probable glycosyltransferase At5g...    505   9e-171   
ref|XP_007027565.1|  Exostosin family protein, putative                 504   9e-170   
gb|KHN45704.1|  Putative glycosyltransferase                            496   2e-169   
gb|KCW48767.1|  hypothetical protein EUGRSUZ_K02411                     494   7e-169   
ref|XP_010039048.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    495   1e-168   
gb|KEH24082.1|  glycosyltransferase                                     489   3e-166   
ref|XP_011101497.1|  PREDICTED: probable glycosyltransferase At5g...    491   1e-165   
ref|XP_008381668.1|  PREDICTED: probable glycosyltransferase At5g...    491   5e-165   
ref|XP_009593673.1|  PREDICTED: probable glycosyltransferase At5g...    488   2e-164   
gb|EYU41560.1|  hypothetical protein MIMGU_mgv1a005355mg                488   2e-164   
ref|XP_009593674.1|  PREDICTED: probable glycosyltransferase At5g...    483   9e-164   
emb|CBI28483.3|  unnamed protein product                                483   2e-163   
ref|XP_009622709.1|  PREDICTED: probable glycosyltransferase At5g...    485   9e-163   
ref|XP_002524591.1|  catalytic, putative                                484   1e-162   Ricinus communis
ref|XP_002264076.2|  PREDICTED: probable glycosyltransferase At5g...    482   4e-162   Vitis vinifera
ref|XP_010252860.1|  PREDICTED: probable glycosyltransferase At3g...    483   9e-162   
ref|XP_009782027.1|  PREDICTED: probable glycosyltransferase At5g...    483   9e-162   
gb|EMT30821.1|  Exostosin-2                                             483   1e-161   
ref|XP_006354423.1|  PREDICTED: probable glycosyltransferase At5g...    481   2e-161   
ref|XP_002320538.2|  hypothetical protein POPTR_0014s16920g             479   3e-161   Populus trichocarpa [western balsam poplar]
ref|XP_009782025.1|  PREDICTED: probable glycosyltransferase At5g...    482   3e-161   
ref|XP_009782026.1|  PREDICTED: probable glycosyltransferase At5g...    481   3e-161   
ref|XP_009782024.1|  PREDICTED: probable glycosyltransferase At5g...    482   4e-161   
ref|XP_006447859.1|  hypothetical protein CICLE_v10017948mg             480   8e-161   
ref|XP_006469477.1|  PREDICTED: probable glycosyltransferase At5g...    480   1e-160   
ref|XP_008459522.1|  PREDICTED: probable glycosyltransferase At5g...    479   2e-160   
ref|XP_010068733.1|  PREDICTED: probable glycosyltransferase At5g...    478   2e-160   
ref|XP_011009812.1|  PREDICTED: probable glycosyltransferase At5g...    477   7e-160   
ref|XP_010048370.1|  PREDICTED: probable glycosyltransferase At3g...    477   2e-159   
gb|KCW89058.1|  hypothetical protein EUGRSUZ_A01384                     477   4e-159   
ref|XP_008794078.1|  PREDICTED: probable glycosyltransferase At5g...    476   6e-159   
ref|XP_008237734.1|  PREDICTED: probable glycosyltransferase At5g...    471   7e-159   
ref|XP_004239536.1|  PREDICTED: probable glycosyltransferase At5g...    474   3e-158   
ref|XP_010923285.1|  PREDICTED: probable glycosyltransferase At5g...    474   3e-158   
ref|XP_011009813.1|  PREDICTED: probable glycosyltransferase At5g...    468   4e-158   
gb|KGN52623.1|  hypothetical protein Csa_5G647450                       473   6e-158   
ref|XP_004955715.1|  PREDICTED: probable glycosyltransferase At5g...    474   1e-157   
ref|XP_004292405.1|  PREDICTED: probable glycosyltransferase At5g...    472   1e-157   
ref|XP_008796633.1|  PREDICTED: probable glycosyltransferase At5g...    471   2e-157   
ref|NP_001059081.1|  Os07g0188700                                       474   4e-157   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006357695.1|  PREDICTED: probable glycosyltransferase At5g...    469   8e-157   
ref|XP_011085648.1|  PREDICTED: probable glycosyltransferase At5g...    466   1e-156   
ref|XP_004243882.1|  PREDICTED: probable glycosyltransferase At5g...    468   2e-156   
ref|XP_007145275.1|  hypothetical protein PHAVU_007G225300g             467   3e-156   
ref|XP_002320537.2|  hypothetical protein POPTR_0014s16900g             466   4e-156   Populus trichocarpa [western balsam poplar]
ref|XP_011009816.1|  PREDICTED: probable glycosyltransferase At3g...    466   4e-156   
ref|XP_007216463.1|  hypothetical protein PRUPE_ppa024503mg             466   6e-156   
ref|XP_004289488.1|  PREDICTED: probable glycosyltransferase At5g...    462   1e-155   
emb|CDP08577.1|  unnamed protein product                                466   2e-155   
ref|XP_010246563.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    464   1e-154   
ref|XP_008394205.1|  PREDICTED: probable glycosyltransferase At5g...    464   2e-154   
ref|XP_008229804.1|  PREDICTED: probable glycosyltransferase At3g...    461   5e-154   
ref|XP_007049438.1|  Catalytic, putative                                464   5e-154   
ref|XP_004305861.1|  PREDICTED: probable glycosyltransferase At3g...    460   1e-153   
ref|XP_010657501.1|  PREDICTED: probable glycosyltransferase At3g...    458   1e-153   
ref|XP_009379539.1|  PREDICTED: probable glycosyltransferase At5g...    461   2e-153   
gb|EAZ03045.1|  hypothetical protein OsI_25187                          464   3e-153   Oryza sativa Indica Group [Indian rice]
ref|XP_002264111.3|  PREDICTED: probable glycosyltransferase At3g...    458   3e-153   Vitis vinifera
ref|XP_003555678.1|  PREDICTED: probable glycosyltransferase At3g...    459   8e-153   
ref|XP_010933454.1|  PREDICTED: probable glycosyltransferase At5g...    459   1e-152   
ref|XP_008227726.1|  PREDICTED: probable glycosyltransferase At5g...    460   1e-152   
gb|KHN15414.1|  Putative glycosyltransferase                            458   1e-152   
ref|XP_010228257.1|  PREDICTED: probable glycosyltransferase At5g...    460   2e-152   
ref|XP_010228256.1|  PREDICTED: probable glycosyltransferase At5g...    460   2e-152   
gb|AGV54221.1|  glycosyltransferase                                     456   5e-152   
ref|XP_009379540.1|  PREDICTED: probable glycosyltransferase At5g...    458   5e-152   
emb|CDP15733.1|  unnamed protein product                                455   1e-151   
emb|CBI28482.3|  unnamed protein product                                460   3e-151   
ref|XP_004503012.1|  PREDICTED: probable glycosyltransferase At5g...    454   4e-151   
ref|XP_006845223.1|  hypothetical protein AMTR_s00005p00255230          450   5e-151   
ref|XP_002524592.1|  catalytic, putative                                449   2e-150   Ricinus communis
gb|KEH35655.1|  exostosin family protein                                452   2e-150   
ref|XP_008342266.1|  PREDICTED: probable glycosyltransferase At3g...    451   3e-150   
ref|XP_009417384.1|  PREDICTED: probable glycosyltransferase At5g...    447   4e-150   
ref|XP_008227680.1|  PREDICTED: probable glycosyltransferase At5g...    452   5e-150   
ref|XP_009361503.1|  PREDICTED: probable glycosyltransferase At3g...    451   2e-149   
ref|XP_010107365.1|  putative glycosyltransferase                       449   2e-149   
ref|XP_009379541.1|  PREDICTED: probable glycosyltransferase At5g...    450   6e-149   
gb|AGZ15405.1|  limonene cyclase-like protein                           448   1e-148   
ref|XP_010683539.1|  PREDICTED: probable glycosyltransferase At3g...    447   4e-148   
ref|XP_008227724.1|  PREDICTED: probable glycosyltransferase At3g...    447   9e-148   
gb|KHG09514.1|  hypothetical protein F383_01906                         445   1e-147   
ref|XP_004502077.1|  PREDICTED: probable glycosyltransferase At3g...    444   1e-147   
gb|KDP22997.1|  hypothetical protein JCGZ_01719                         453   3e-147   
ref|XP_007137813.1|  hypothetical protein PHAVU_009G157700g             444   4e-147   
ref|XP_011100587.1|  PREDICTED: probable glycosyltransferase At3g...    445   8e-147   
emb|CDP15735.1|  unnamed protein product                                438   4e-146   
gb|AAU04753.1|  EXO                                                     436   5e-146   Cucumis melo [Oriental melon]
gb|KHN09672.1|  Putative glycosyltransferase                            437   7e-146   
ref|XP_006483712.1|  PREDICTED: probable glycosyltransferase At5g...    440   7e-146   
ref|XP_010250232.1|  PREDICTED: probable glycosyltransferase At5g...    440   1e-145   
ref|XP_010250231.1|  PREDICTED: probable glycosyltransferase At5g...    440   1e-145   
gb|EYU42789.1|  hypothetical protein MIMGU_mgv1a009597mg                434   2e-145   
ref|XP_006450385.1|  hypothetical protein CICLE_v10008151mg             439   2e-145   
emb|CDP13539.1|  unnamed protein product                                439   1e-144   
ref|XP_003601437.1|  hypothetical protein MTR_3g080690                  436   2e-144   
gb|AES71688.2|  exostosin family protein                                435   2e-144   
ref|XP_004501350.1|  PREDICTED: probable glycosyltransferase At5g...    435   6e-144   
ref|XP_006856564.1|  hypothetical protein AMTR_s00046p00183980          435   7e-144   
ref|XP_009759830.1|  PREDICTED: probable glycosyltransferase At3g...    434   3e-143   
ref|XP_007200373.1|  hypothetical protein PRUPE_ppa008342mg             428   4e-143   
gb|KEH35171.1|  exostosin family protein                                432   6e-143   
ref|XP_002459470.1|  hypothetical protein SORBIDRAFT_02g005180          436   9e-143   Sorghum bicolor [broomcorn]
ref|XP_010905483.1|  PREDICTED: probable glycosyltransferase At5g...    431   1e-142   
ref|XP_008337560.1|  PREDICTED: probable glycosyltransferase At5g...    428   3e-142   
ref|XP_002515489.1|  catalytic, putative                                431   3e-142   Ricinus communis
ref|XP_010519637.1|  PREDICTED: probable glycosyltransferase At5g...    430   5e-142   
ref|XP_010519636.1|  PREDICTED: probable glycosyltransferase At5g...    430   7e-142   
ref|XP_006856555.1|  hypothetical protein AMTR_s00046p00174470          432   1e-141   
ref|XP_007011817.1|  Exostosin family protein                           429   1e-141   
ref|XP_008794982.1|  PREDICTED: probable glycosyltransferase At5g...    430   2e-141   
ref|XP_007161196.1|  hypothetical protein PHAVU_001G050100g             429   2e-141   
ref|XP_011036587.1|  PREDICTED: probable glycosyltransferase At5g...    429   2e-141   
ref|XP_007213348.1|  hypothetical protein PRUPE_ppa1027150mg            424   6e-141   
ref|XP_004292977.1|  PREDICTED: probable glycosyltransferase At5g...    428   8e-141   
ref|XP_008394108.1|  PREDICTED: probable glycosyltransferase At5g...    427   2e-140   
ref|XP_011085421.1|  PREDICTED: probable glycosyltransferase At3g...    423   3e-140   
ref|XP_009346174.1|  PREDICTED: probable glycosyltransferase At5g...    426   4e-140   
ref|XP_002285237.2|  PREDICTED: probable glycosyltransferase At5g...    426   4e-140   Vitis vinifera
ref|XP_006394779.1|  hypothetical protein EUTSA_v10004121mg             425   6e-140   
ref|XP_009355772.1|  PREDICTED: probable glycosyltransferase At5g...    425   1e-139   
ref|XP_003549290.1|  PREDICTED: probable glycosyltransferase At5g...    424   1e-139   
ref|XP_003603357.1|  hypothetical protein MTR_3g106690                  421   1e-139   
ref|XP_006287596.1|  hypothetical protein CARUB_v10000808mg             424   2e-139   
ref|XP_006856554.1|  hypothetical protein AMTR_s00046p00173940          424   3e-139   
ref|XP_003545455.1|  PREDICTED: probable glycosyltransferase At5g...    423   3e-139   
ref|NP_197913.4|  Exostosin family protein                              423   5e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493785.1|  PREDICTED: probable glycosyltransferase At5g...    422   9e-139   
ref|XP_004288781.1|  PREDICTED: probable glycosyltransferase At5g...    422   9e-139   
ref|XP_010421383.1|  PREDICTED: probable glycosyltransferase At5g...    422   1e-138   
ref|XP_008652150.1|  PREDICTED: probable glycosyltransferase At5g...    425   2e-138   
ref|XP_010454855.1|  PREDICTED: probable glycosyltransferase At5g...    422   2e-138   
ref|XP_011081538.1|  PREDICTED: probable glycosyltransferase At5g...    422   2e-138   
ref|XP_010050741.1|  PREDICTED: probable glycosyltransferase At5g...    421   2e-138   
ref|XP_011085420.1|  PREDICTED: probable glycosyltransferase At3g...    422   2e-138   
tpg|DAA59884.1|  TPA: hypothetical protein ZEAMMB73_690759              425   2e-138   
ref|XP_009151056.1|  PREDICTED: probable glycosyltransferase At5g...    421   3e-138   
ref|XP_009151057.1|  PREDICTED: probable glycosyltransferase At5g...    421   4e-138   
ref|XP_010096418.1|  T-complex protein 1 subunit beta                   437   5e-138   
ref|XP_006856553.1|  hypothetical protein AMTR_s00046p00173420          415   6e-138   
ref|XP_010696519.1|  PREDICTED: probable glycosyltransferase At5g...    419   9e-138   
ref|XP_010418150.1|  PREDICTED: probable glycosyltransferase At3g...    415   7e-137   
ref|XP_010489710.1|  PREDICTED: probable glycosyltransferase At3g...    416   9e-137   
ref|XP_008443936.1|  PREDICTED: probable glycosyltransferase At5g...    417   1e-136   
ref|XP_010464397.1|  PREDICTED: probable glycosyltransferase At3g...    417   1e-136   
emb|CDX80499.1|  BnaC07g29450D                                          417   1e-136   
ref|XP_003550809.2|  PREDICTED: probable glycosyltransferase At3g...    416   2e-136   
ref|XP_004138850.1|  PREDICTED: probable glycosyltransferase At5g...    416   2e-136   
ref|XP_008242869.1|  PREDICTED: probable glycosyltransferase At3g...    413   4e-136   
ref|XP_003542647.2|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    417   4e-136   
ref|XP_009802043.1|  PREDICTED: probable glycosyltransferase At5g...    416   5e-136   
gb|KHN47101.1|  Putative glycosyltransferase                            416   7e-136   
ref|XP_008336982.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    412   8e-136   
ref|XP_009124266.1|  PREDICTED: probable glycosyltransferase At3g...    414   8e-136   
ref|XP_008445236.1|  PREDICTED: probable glycosyltransferase At5g...    413   2e-135   
ref|XP_009393729.1|  PREDICTED: probable glycosyltransferase At5g...    413   2e-135   
ref|XP_007013570.1|  Exostosin family protein                           413   3e-135   
gb|AHL38775.1|  glycosyltransferase                                     412   6e-135   
ref|NP_187419.1|  putative glycosyltransferase                          412   7e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407816.1|  hypothetical protein EUTSA_v10020696mg             411   7e-135   
ref|XP_006299448.1|  hypothetical protein CARUB_v10015613mg             411   9e-135   
ref|XP_008352234.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    409   1e-134   
ref|XP_008242868.1|  PREDICTED: probable glycosyltransferase At3g...    409   1e-134   
ref|XP_008361205.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    409   2e-134   
gb|EYU20247.1|  hypothetical protein MIMGU_mgv1a024162mg                408   2e-134   
ref|XP_006582483.1|  PREDICTED: probable glycosyltransferase At5g...    411   2e-134   
gb|KCW80354.1|  hypothetical protein EUGRSUZ_C01719                     405   3e-134   
ref|XP_002884661.1|  predicted protein                                  410   3e-134   
gb|KGN65113.1|  hypothetical protein Csa_1G226410                       410   6e-134   
gb|KHN47103.1|  Putative glycosyltransferase                            409   7e-134   
ref|XP_007155060.1|  hypothetical protein PHAVU_003G169700g             410   1e-133   
ref|XP_006600735.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    409   3e-133   
ref|XP_007204886.1|  hypothetical protein PRUPE_ppa017740mg             405   3e-133   
ref|XP_006594253.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    408   3e-133   
gb|KHN47102.1|  Xylogalacturonan beta-1,3-xylosyltransferase            408   4e-133   
ref|XP_006594254.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    407   5e-133   
ref|XP_007137001.1|  hypothetical protein PHAVU_009G091800g             406   1e-132   
ref|XP_003541484.1|  PREDICTED: probable glycosyltransferase At3g...    406   1e-132   
gb|EYU20246.1|  hypothetical protein MIMGU_mgv1a006806mg                404   2e-132   
ref|XP_010552074.1|  PREDICTED: probable glycosyltransferase At3g...    405   4e-132   
ref|XP_003550810.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    405   5e-132   
emb|CDY60376.1|  BnaCnng36170D                                          404   6e-132   
ref|XP_008352110.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    402   6e-132   
ref|XP_006345657.1|  PREDICTED: probable glycosyltransferase At5g...    404   7e-132   
ref|XP_008219689.1|  PREDICTED: probable glycosyltransferase At5g...    405   8e-132   
ref|XP_009615070.1|  PREDICTED: probable glycosyltransferase At5g...    405   8e-132   
ref|XP_007204648.1|  hypothetical protein PRUPE_ppa001571mg             415   9e-132   
ref|XP_009407372.1|  PREDICTED: probable glycosyltransferase At5g...    405   9e-132   
gb|KHN15048.1|  Xylogalacturonan beta-1,3-xylosyltransferase            408   1e-131   
ref|XP_004244985.2|  PREDICTED: probable glycosyltransferase At5g...    404   1e-131   
ref|XP_006600734.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    404   1e-131   
ref|XP_009131787.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    403   2e-131   
ref|XP_002324871.2|  exostosin family protein                           398   2e-131   Populus trichocarpa [western balsam poplar]
ref|XP_006389445.1|  hypothetical protein POPTR_0025s00760g             403   2e-131   
ref|XP_010908761.1|  PREDICTED: probable glycosyltransferase At5g...    402   4e-131   
ref|XP_002515488.1|  catalytic, putative                                402   5e-131   Ricinus communis
ref|XP_006289990.1|  hypothetical protein CARUB_v10003620mg             402   6e-131   
ref|XP_004508620.1|  PREDICTED: probable glycosyltransferase At3g...    401   6e-131   
ref|XP_003609423.1|  Xylogalacturonan beta-1,3-xylosyltransferase       399   9e-131   
ref|XP_007013571.1|  Exostosin family protein                           401   1e-130   
gb|AGV54450.1|  glycosyltransferase                                     402   2e-130   
sp|Q3E9A4.3|GLYT5_ARATH  RecName: Full=Probable glycosyltransfera...    400   2e-130   
ref|NP_197526.5|  Exostosin family protein                              400   2e-130   
ref|XP_010493134.1|  PREDICTED: probable glycosyltransferase At5g...    400   2e-130   
ref|XP_011017849.1|  PREDICTED: probable glycosyltransferase At5g...    400   3e-130   
ref|XP_010241628.1|  PREDICTED: probable glycosyltransferase At5g...    400   3e-130   
ref|XP_003550812.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    400   4e-130   
gb|KHN15049.1|  Putative glycosyltransferase                            397   4e-130   
ref|XP_011016249.1|  PREDICTED: probable glycosyltransferase At5g...    399   5e-130   
gb|KCW74795.1|  hypothetical protein EUGRSUZ_E03530                     399   7e-130   
ref|XP_010454331.1|  PREDICTED: probable glycosyltransferase At5g...    399   7e-130   
ref|XP_010491808.1|  PREDICTED: probable glycosyltransferase At5g...    399   1e-129   
ref|XP_010453152.1|  PREDICTED: probable glycosyltransferase At5g...    399   2e-129   
emb|CDY35818.1|  BnaC09g37500D                                          397   2e-129   
ref|XP_007202437.1|  hypothetical protein PRUPE_ppa014750mg             395   2e-129   
ref|XP_006582516.1|  PREDICTED: probable glycosyltransferase At5g...    393   2e-129   
gb|KHN15047.1|  Putative glycosyltransferase                            397   2e-129   
ref|XP_008794981.1|  PREDICTED: probable glycosyltransferase At5g...    395   3e-129   
emb|CDX92476.1|  BnaA10g15150D                                          397   3e-129   
ref|XP_010419667.1|  PREDICTED: probable glycosyltransferase At5g...    398   4e-129   
ref|XP_006400593.1|  hypothetical protein EUTSA_v10015371mg             397   4e-129   
gb|KHN33893.1|  Putative glycosyltransferase                            392   5e-129   
emb|CDY35820.1|  BnaC09g37520D                                          396   7e-129   
ref|XP_010050740.1|  PREDICTED: probable glycosyltransferase At5g...    394   8e-129   
ref|XP_002989572.1|  xylosyltransferase-like protein                    391   8e-129   
ref|XP_003549738.1|  PREDICTED: probable glycosyltransferase At3g...    396   9e-129   
ref|XP_010454330.1|  PREDICTED: probable glycosyltransferase At5g...    396   9e-129   
ref|XP_008457132.1|  PREDICTED: probable glycosyltransferase At3g...    396   9e-129   
ref|XP_009364050.1|  PREDICTED: probable glycosyltransferase At5g...    398   1e-128   
ref|XP_009120823.1|  PREDICTED: probable glycosyltransferase At5g...    396   1e-128   
gb|KGN60712.1|  hypothetical protein Csa_2G008045                       395   1e-128   
ref|XP_008242826.1|  PREDICTED: probable glycosyltransferase At5g...    396   1e-128   
ref|XP_006474664.1|  PREDICTED: probable glycosyltransferase At5g...    393   2e-128   
ref|NP_196674.2|  exostosin family protein                              396   2e-128   
gb|EPS67004.1|  hypothetical protein M569_07774                         391   2e-128   
ref|XP_010250234.1|  PREDICTED: probable glycosyltransferase At5g...    396   2e-128   
ref|XP_007013568.1|  Exostosin family protein, putative isoform 1       396   2e-128   
ref|XP_010250233.1|  PREDICTED: probable glycosyltransferase At5g...    395   2e-128   
ref|XP_002964241.1|  xylosyltransferase-like protein                    390   2e-128   
ref|XP_011020204.1|  PREDICTED: probable glycosyltransferase At5g...    395   2e-128   
ref|XP_010059401.1|  PREDICTED: probable glycosyltransferase At3g...    395   3e-128   
gb|KDP33570.1|  hypothetical protein JCGZ_07141                         395   5e-128   
ref|XP_006453093.1|  hypothetical protein CICLE_v10010441mg             394   6e-128   
ref|XP_009346171.1|  PREDICTED: probable glycosyltransferase At5g...    391   9e-128   
gb|KCW58739.1|  hypothetical protein EUGRSUZ_H01381                     390   1e-127   
ref|XP_006381109.1|  hypothetical protein POPTR_0006s06340g             394   1e-127   
ref|XP_010042007.1|  PREDICTED: probable glycosyltransferase At3g...    390   1e-127   
ref|XP_003561022.1|  PREDICTED: probable glycosyltransferase At5g...    393   2e-127   
ref|XP_006389444.1|  hypothetical protein POPTR_0025s00750g             401   2e-127   
gb|KCW44366.1|  hypothetical protein EUGRSUZ_L02165                     390   2e-127   
gb|AHL38607.1|  glycosyltransferase                                     387   3e-127   
ref|XP_008385236.1|  PREDICTED: probable glycosyltransferase At3g...    394   3e-127   
ref|XP_010057604.1|  PREDICTED: probable glycosyltransferase At3g...    390   3e-127   
ref|XP_010026197.1|  PREDICTED: probable glycosyltransferase At5g...    391   4e-127   
ref|XP_007226606.1|  hypothetical protein PRUPE_ppa023392mg             392   4e-127   
ref|XP_006399613.1|  hypothetical protein EUTSA_v10013399mg             392   5e-127   
gb|AFW85605.1|  hypothetical protein ZEAMMB73_586394                    393   5e-127   
ref|XP_011020203.1|  PREDICTED: probable glycosyltransferase At5g...    392   6e-127   
ref|XP_002872156.1|  exostosin family protein                           387   6e-127   
ref|XP_010041414.1|  PREDICTED: probable glycosyltransferase At5g...    392   8e-127   
gb|AES91622.2|  glycosyltransferase                                     395   2e-126   
emb|CBI21065.3|  unnamed protein product                                388   2e-126   
emb|CDY51109.1|  BnaCnng20120D                                          390   2e-126   
gb|KHN26915.1|  Putative glycosyltransferase                            385   2e-126   
emb|CDX85728.1|  BnaA02g00850D                                          390   2e-126   
ref|XP_001767347.1|  predicted protein                                  385   3e-126   
emb|CDX97082.1|  BnaC09g45430D                                          390   3e-126   
dbj|BAK03842.1|  predicted protein                                      389   3e-126   
ref|XP_006474663.1|  PREDICTED: probable glycosyltransferase At3g...    389   5e-126   
gb|KCW74792.1|  hypothetical protein EUGRSUZ_E03525                     389   5e-126   
ref|XP_007155059.1|  hypothetical protein PHAVU_003G169600g             388   1e-125   
ref|XP_009125787.1|  PREDICTED: probable glycosyltransferase At5g...    388   1e-125   
ref|XP_008336981.1|  PREDICTED: probable glycosyltransferase At3g...    385   1e-125   
ref|XP_007155062.1|  hypothetical protein PHAVU_003G169900g             388   1e-125   
ref|XP_009121991.1|  PREDICTED: probable glycosyltransferase At5g...    388   2e-125   
ref|XP_009117358.1|  PREDICTED: probable glycosyltransferase At3g...    387   2e-125   
ref|XP_006381108.1|  hypothetical protein POPTR_0006s06330g             388   2e-125   
ref|XP_002285239.2|  PREDICTED: probable glycosyltransferase At5g...    387   2e-125   
ref|XP_010454857.1|  PREDICTED: probable glycosyltransferase At5g...    387   3e-125   
ref|XP_009337994.1|  PREDICTED: probable glycosyltransferase At3g...    385   6e-125   
ref|XP_008337219.1|  PREDICTED: probable glycosyltransferase At5g...    384   6e-125   
ref|NP_001052025.1|  Os04g0109900                                       385   8e-125   
ref|XP_009340649.1|  PREDICTED: probable glycosyltransferase At5g...    386   8e-125   
ref|XP_009364051.1|  PREDICTED: probable glycosyltransferase At5g...    383   9e-125   
ref|XP_009337993.1|  PREDICTED: probable glycosyltransferase At5g...    386   1e-124   
ref|XP_010493786.1|  PREDICTED: probable glycosyltransferase At5g...    385   2e-124   
ref|XP_008389683.1|  PREDICTED: probable glycosyltransferase At5g...    382   2e-124   
ref|XP_008660691.1|  PREDICTED: probable glycosyltransferase At5g...    394   2e-124   
emb|CDX88845.1|  BnaA03g08040D                                          394   3e-124   
ref|XP_002308053.2|  hypothetical protein POPTR_0006s06350g             386   3e-124   
ref|XP_006286824.1|  hypothetical protein CARUB_v10003769mg             384   3e-124   
emb|CAH67778.1|  H0201G08.5                                             384   3e-124   
ref|XP_008337135.1|  PREDICTED: probable glycosyltransferase At5g...    384   3e-124   
ref|XP_011020197.1|  PREDICTED: probable glycosyltransferase At5g...    386   4e-124   
ref|XP_004288780.1|  PREDICTED: probable glycosyltransferase At5g...    385   4e-124   
ref|XP_004304808.1|  PREDICTED: probable glycosyltransferase At5g...    385   5e-124   
ref|XP_002531945.1|  catalytic, putative                                383   5e-124   
emb|CDX76960.1|  BnaC08g35460D                                          384   6e-124   
ref|XP_006389446.1|  hypothetical protein POPTR_0025s00770g             385   9e-124   
gb|EMT14849.1|  Exostosin-1c                                            383   1e-123   
ref|XP_010687901.1|  PREDICTED: probable glycosyltransferase At5g...    380   1e-123   
ref|XP_002877250.1|  exostosin family protein                           381   1e-123   
ref|XP_008370810.1|  PREDICTED: probable glycosyltransferase At5g...    383   1e-123   
ref|XP_008370808.1|  PREDICTED: probable glycosyltransferase At5g...    383   2e-123   
emb|CDY13789.1|  BnaA09g42910D                                          380   2e-123   
ref|XP_010520570.1|  PREDICTED: probable glycosyltransferase At5g...    382   2e-123   
ref|XP_010541615.1|  PREDICTED: probable glycosyltransferase At5g...    383   2e-123   
ref|XP_010687902.1|  PREDICTED: probable glycosyltransferase At5g...    383   3e-123   
ref|XP_010491807.1|  PREDICTED: probable glycosyltransferase At5g...    384   3e-123   
ref|XP_004166098.1|  PREDICTED: probable glycosyltransferase At5g...    378   3e-123   
gb|EAY86665.1|  hypothetical protein OsI_08049                          382   4e-123   
ref|XP_011020199.1|  PREDICTED: probable glycosyltransferase At5g...    382   5e-123   
ref|XP_010314106.1|  PREDICTED: probable glycosyltransferase At3g...    380   7e-123   
ref|XP_010656546.1|  PREDICTED: probable glycosyltransferase At3g...    381   8e-123   
emb|CBI25537.3|  unnamed protein product                                381   9e-123   
emb|CDO99716.1|  unnamed protein product                                380   9e-123   
ref|XP_006396181.1|  hypothetical protein EUTSA_v10002345mg             380   1e-122   
ref|XP_004139407.1|  PREDICTED: probable glycosyltransferase At3g...    380   1e-122   
ref|XP_008218430.1|  PREDICTED: probable glycosyltransferase At5g...    382   1e-122   
ref|XP_010099849.1|  putative glycosyltransferase                       380   1e-122   
ref|XP_009337990.1|  PREDICTED: probable glycosyltransferase At5g...    381   1e-122   
ref|XP_004287275.1|  PREDICTED: probable glycosyltransferase At5g...    381   2e-122   
ref|XP_011036586.1|  PREDICTED: probable glycosyltransferase At5g...    380   2e-122   
ref|XP_007155061.1|  hypothetical protein PHAVU_003G169800g             380   2e-122   
emb|CBI25530.3|  unnamed protein product                                377   2e-122   
ref|XP_011015263.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    379   3e-122   
gb|KHN15046.1|  Xylogalacturonan beta-1,3-xylosyltransferase            377   3e-122   
ref|XP_011020198.1|  PREDICTED: probable glycosyltransferase At5g...    380   5e-122   
ref|XP_007205109.1|  hypothetical protein PRUPE_ppa004757mg             379   6e-122   
ref|XP_009340668.1|  PREDICTED: probable glycosyltransferase At5g...    383   8e-122   
ref|XP_006453094.1|  hypothetical protein CICLE_v10010628mg             387   1e-121   
ref|XP_011017844.1|  PREDICTED: probable glycosyltransferase At5g...    380   1e-121   
ref|XP_009337989.1|  PREDICTED: probable glycosyltransferase At5g...    379   1e-121   
ref|XP_002266646.2|  PREDICTED: probable glycosyltransferase At5g...    378   1e-121   
ref|XP_009338023.1|  PREDICTED: probable glycosyltransferase At5g...    378   2e-121   
emb|CDY22124.1|  BnaC01g39770D                                          382   2e-121   
ref|XP_007206344.1|  hypothetical protein PRUPE_ppa017605mg             377   3e-121   
ref|XP_008645924.1|  PREDICTED: probable glycosyltransferase At5g...    377   3e-121   
ref|XP_002266490.3|  PREDICTED: probable glycosyltransferase At5g...    379   3e-121   
ref|XP_006353139.1|  PREDICTED: probable glycosyltransferase At3g...    379   3e-121   
ref|XP_006279358.1|  hypothetical protein CARUB_v10008022mg             377   3e-121   
ref|XP_007011816.1|  Exostosin family protein                           376   4e-121   
gb|EPS58814.1|  hypothetical protein M569_15998                         372   5e-121   
emb|CBI25529.3|  unnamed protein product                                373   8e-121   
ref|XP_010514701.1|  PREDICTED: probable glycosyltransferase At3g...    375   9e-121   
gb|KDP42268.1|  hypothetical protein JCGZ_01592                         373   1e-120   
ref|XP_002324873.2|  hypothetical protein POPTR_0018s01950g             372   1e-120   
ref|XP_008218431.1|  PREDICTED: probable glycosyltransferase At5g...    375   1e-120   
gb|ABA18105.1|  exostosin family protein                                374   1e-120   
ref|XP_004508451.1|  PREDICTED: probable glycosyltransferase At5g...    372   1e-120   
ref|XP_010425790.1|  PREDICTED: probable glycosyltransferase At3g...    374   3e-120   
gb|ABG48476.1|  At3g42180                                               373   3e-120   
ref|XP_009592269.1|  PREDICTED: probable glycosyltransferase At3g...    374   3e-120   
ref|XP_002264880.2|  PREDICTED: probable glycosyltransferase At5g...    374   3e-120   
ref|XP_006345278.1|  PREDICTED: probable glycosyltransferase At5g...    371   4e-120   
gb|EYU23547.1|  hypothetical protein MIMGU_mgv1a009659mg                369   5e-120   
ref|XP_004302151.1|  PREDICTED: probable glycosyltransferase At5g...    374   5e-120   
ref|XP_002264922.2|  PREDICTED: probable glycosyltransferase At5g...    373   7e-120   
ref|XP_004508619.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    373   7e-120   
ref|NP_189804.4|  Exostosin family protein                              373   9e-120   
gb|AES91613.2|  exostosin family protein                                372   1e-119   
ref|XP_002873987.1|  hypothetical protein ARALYDRAFT_326421             379   2e-119   
ref|XP_003609425.1|  Xylogalacturonan beta-1,3-xylosyltransferase       376   4e-119   
ref|XP_010520569.1|  PREDICTED: probable glycosyltransferase At3g...    372   5e-119   
ref|XP_010520568.1|  PREDICTED: probable glycosyltransferase At3g...    372   5e-119   
ref|XP_008218534.1|  PREDICTED: probable glycosyltransferase At5g...    375   5e-119   
gb|KFK38224.1|  hypothetical protein AALP_AA3G084800                    370   5e-119   
gb|KDP30240.1|  hypothetical protein JCGZ_17022                         366   8e-119   
gb|KCW80353.1|  hypothetical protein EUGRSUZ_C01718                     365   1e-118   
ref|XP_008364067.1|  PREDICTED: probable glycosyltransferase At5g...    377   1e-118   
ref|XP_010111057.1|  putative glycosyltransferase                       370   1e-118   
ref|XP_009355880.1|  PREDICTED: probable glycosyltransferase At5g...    366   2e-118   
ref|XP_006450384.1|  hypothetical protein CICLE_v10010549mg             367   2e-118   
emb|CAB96648.1|  putative protein                                       364   3e-118   
ref|XP_006483713.1|  PREDICTED: probable glycosyltransferase At5g...    369   4e-118   
ref|XP_011082204.1|  PREDICTED: probable glycosyltransferase At5g...    367   4e-118   
gb|AES91621.2|  glycosyltransferase                                     364   6e-118   
ref|XP_010533124.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    370   1e-117   
ref|XP_010533123.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    370   1e-117   
emb|CBI25528.3|  unnamed protein product                                379   3e-117   
ref|XP_011036589.1|  PREDICTED: probable glycosyltransferase At5g...    364   1e-116   
gb|KFK38225.1|  hypothetical protein AALP_AA3G084800                    363   1e-116   
ref|XP_002871458.1|  exostosin family protein                           360   2e-116   
gb|KHN31216.1|  Putative glycosyltransferase                            360   2e-116   
gb|AHL38617.1|  glycosyltransferase                                     359   3e-116   
emb|CDP10462.1|  unnamed protein product                                359   3e-116   
ref|XP_010683540.1|  PREDICTED: probable glycosyltransferase At3g...    362   6e-116   
ref|XP_003572711.1|  PREDICTED: probable glycosyltransferase At5g...    363   8e-116   
ref|XP_006647505.1|  PREDICTED: probable glycosyltransferase At5g...    358   9e-116   
ref|XP_007013569.1|  Exostosin family protein isoform 2                 357   2e-115   
gb|EPS67003.1|  hypothetical protein M569_07773                         358   2e-115   
gb|KDO73474.1|  hypothetical protein CISIN_1g048345mg                   357   3e-115   
ref|XP_009802047.1|  PREDICTED: probable glycosyltransferase At5g...    358   1e-114   
ref|XP_009363968.1|  PREDICTED: probable glycosyltransferase At3g...    354   2e-114   
ref|XP_004953090.1|  PREDICTED: probable glycosyltransferase At5g...    354   3e-114   
ref|XP_004292976.1|  PREDICTED: probable glycosyltransferase At5g...    356   4e-114   
ref|XP_009362346.1|  PREDICTED: probable glycosyltransferase At5g...    360   5e-114   
ref|XP_004498960.1|  PREDICTED: probable glycosyltransferase At5g...    357   2e-113   
ref|XP_007223103.1|  hypothetical protein PRUPE_ppa007120mg             353   2e-113   
ref|XP_001781687.1|  predicted protein                                  353   2e-113   
ref|XP_002531944.1|  catalytic, putative                                352   3e-113   
ref|XP_010496528.1|  PREDICTED: probable glycosyltransferase At3g...    351   4e-113   
ref|XP_003609416.1|  Xylogalacturonan beta-1,3-xylosyltransferase       353   4e-113   
ref|XP_008219690.1|  PREDICTED: probable glycosyltransferase At5g...    355   5e-113   
ref|XP_010535859.1|  PREDICTED: probable glycosyltransferase At5g...    350   1e-112   
ref|XP_008344073.1|  PREDICTED: probable glycosyltransferase At3g...    350   4e-112   
ref|XP_010096841.1|  putative glycosyltransferase                       348   7e-112   
emb|CAN73458.1|  hypothetical protein VITISV_022180                     347   9e-112   
dbj|BAD19700.1|  exostosin-like protein                                 347   1e-111   
ref|XP_002308055.2|  hypothetical protein POPTR_0006s06360g             347   2e-111   
ref|XP_002437936.1|  hypothetical protein SORBIDRAFT_10g005120          349   2e-111   
ref|XP_007049437.1|  Exostosin family protein                           350   3e-111   
gb|ABA18091.1|  exostosin family protein                                347   3e-111   
ref|XP_011070139.1|  PREDICTED: probable glycosyltransferase At5g...    349   9e-111   
emb|CDX69782.1|  BnaA10g21310D                                          356   1e-110   
emb|CDY12392.1|  BnaC08g08130D                                          350   3e-110   
emb|CAB68119.1|  putative protein                                       344   3e-110   



>ref|XP_009774930.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana sylvestris]
Length=455

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/394 (70%), Positives = 338/394 (86%), Gaps = 3/394 (1%)
 Frame = +1

Query  289   TLAVYGAKSYTKLEILESGLAQARSSILRGNQL---HSDEHYIPSGSIYWNASSFHRSYV  459
             TL+    K Y+KLE LE+GLA+AR++ILR N      +++ YIP G +Y NA++FHRSY+
Sbjct  60    TLSSVAPKRYSKLEKLEAGLAKARATILRENNNWNNQTEDEYIPHGPMYLNATAFHRSYL  119

Query  460   EMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSV  639
             EMEK  KVYVY++G+PPV H+GPCK  YAIEG+FIHAM+ S+FRT+DP+ AHV+FLP SV
Sbjct  120   EMEKNFKVYVYKEGEPPVFHFGPCKHTYAIEGYFIHAMEISKFRTSDPNKAHVYFLPMSV  179

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
             T+L++ +YV +SH+W  MK  ALDYV  I+ KYPFWNR+LGADHF+L+CHDWGPEIS +I
Sbjct  180   TMLTQFVYVRDSHEWGLMKNIALDYVNIISNKYPFWNRSLGADHFILACHDWGPEISFAI  239

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
             P L K +IRALCNANTSE+FNP KDVSIPEI+LP GTT GL+GGPPP+ERPVLVF+AGGL
Sbjct  240   PYLYKNSIRALCNANTSEKFNPTKDVSIPEIHLPYGTTKGLLGGPPPSERPVLVFFAGGL  299

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HGP+RPILLQHWENKDED++IH YLPK +SY+ M++KSKYC+CPSGYEVASPRMVE LYM
Sbjct  300   HGPIRPILLQHWENKDEDVQIHKYLPKGISYYDMIKKSKYCICPSGYEVASPRMVEGLYM  359

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
             GCVPVLIK  YV PFSDVL+W+ F+V+IPV+DIPNLKKIL DIPQ +Y  +Q+RG+++RR
Sbjct  360   GCVPVLIKDNYVIPFSDVLDWTTFSVLIPVKDIPNLKKILLDIPQEKYLEMQKRGIQMRR  419

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRVHHLN  1461
             HFEVN PPK +DVFHMILHSIWLRRLN+R+ H++
Sbjct  420   HFEVNSPPKIYDVFHMILHSIWLRRLNVRIRHVD  453



>ref|XP_009774931.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana sylvestris]
Length=454

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/432 (65%), Positives = 350/432 (81%), Gaps = 19/432 (4%)
 Frame = +1

Query  223   LSAFLVFRAPNKS---WVFTFPYLK-------------TLAVYGAKSYTKLEILESGLAQ  354
             ++ F+V   P  S   W+ T  YL              TL+    K Y+KLE LE+GLA+
Sbjct  21    VAGFVVVTGPQGSIYNWLSTSHYLYSSSTSTLDEAPNVTLSSVAPKRYSKLEKLEAGLAK  80

Query  355   ARSSILRGNQL---HSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYG  525
             AR++ILR N      +++ YIP G +Y NA++FHRSY+EMEK  KVYVY++G+PPV H+G
Sbjct  81    ARATILRENNNWNNQTEDEYIPHGPMYLNATAFHRSYLEMEKNFKVYVYKEGEPPVFHFG  140

Query  526   PCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTA  705
             PCK  YAIEG+FIHAM+ S+FRT+DP+ AHV+FLP SVT+L++ +YV +SH+W  MK  A
Sbjct  141   PCKHTYAIEGYFIHAMEISKFRTSDPNKAHVYFLPMSVTMLTQFVYVRDSHEWGLMKNIA  200

Query  706   LDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNP  885
             LDYV  I+ KYPFWNR+LGADHF+L+CHDWGPEIS +IP L K +IRALCNANTSE+FNP
Sbjct  201   LDYVNIISNKYPFWNRSLGADHFILACHDWGPEISFAIPYLYKNSIRALCNANTSEKFNP  260

Query  886   KKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIH  1065
              KDVSIPEI+LP GTT GL+GGPPP+ERPVLVF+AGGLHGP+RPILLQHWENKDED++IH
Sbjct  261   TKDVSIPEIHLPYGTTKGLLGGPPPSERPVLVFFAGGLHGPIRPILLQHWENKDEDVQIH  320

Query  1066  SYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWS  1245
              YLPK +SY+ M++KSKYC+CPSGYEVASPRMVE LYMGCVPVLIK  YV PFSDVL+W+
Sbjct  321   KYLPKGISYYDMIKKSKYCICPSGYEVASPRMVEGLYMGCVPVLIKDNYVIPFSDVLDWT  380

Query  1246  AFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIW  1425
              F+V+IPV+DIPNLKKIL DIPQ +Y  +Q+RG+++RRHFEVN PPK +DVFHMILHSIW
Sbjct  381   TFSVLIPVKDIPNLKKILLDIPQEKYLEMQKRGIQMRRHFEVNSPPKIYDVFHMILHSIW  440

Query  1426  LRRLNIRVHHLN  1461
             LRRLN+R+ H++
Sbjct  441   LRRLNVRIRHVD  452



>ref|XP_009631064.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
tomentosiformis]
Length=461

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/394 (69%), Positives = 339/394 (86%), Gaps = 3/394 (1%)
 Frame = +1

Query  289   TLAVYGAKSYTKLEILESGLAQARSSILRGNQL---HSDEHYIPSGSIYWNASSFHRSYV  459
             TL+    K Y+KLE LE+GLA+AR++IL+ N+     +++ YIP G +Y NA++FHRSY+
Sbjct  66    TLSSETPKRYSKLEKLEAGLAKARAAILKENKSWNNQTEDEYIPHGPMYLNATAFHRSYL  125

Query  460   EMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSV  639
             EME   KVYVY++G+PPV H+GPCK  YAIEG+FIH M+ S+FRT+DP+ AHV+FLP SV
Sbjct  126   EMENKFKVYVYKEGEPPVFHFGPCKHTYAIEGYFIHTMEISEFRTSDPNKAHVYFLPMSV  185

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
             T+L++ IYV +SH+W  MK TALDYV  I+ KYP+WNR+LGADHFML+CHDWGPEIS +I
Sbjct  186   TMLTQFIYVHDSHEWGLMKNTALDYVNVISNKYPYWNRSLGADHFMLACHDWGPEISFAI  245

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
             P L K +IRALCNANTSE+FNP KDVSIPEI+LP GTT+GL+GGPPP+ERPVLVF+AGGL
Sbjct  246   PYLYKNSIRALCNANTSEKFNPTKDVSIPEIHLPYGTTEGLLGGPPPSERPVLVFFAGGL  305

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HGP+RPILLQHWENKD+D++IH YLPK +SY+ M++KSKYC+CPSGYEVASPRMVE LYM
Sbjct  306   HGPIRPILLQHWENKDKDVQIHKYLPKGISYYDMIKKSKYCICPSGYEVASPRMVEGLYM  365

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
             GCVPVLIK  YV PFSDVL+W+ F+VIIPV+DIPNLKKIL DIPQ +Y  +Q+RG+++R+
Sbjct  366   GCVPVLIKDNYVIPFSDVLDWNTFSVIIPVKDIPNLKKILLDIPQEKYLEMQKRGIQMRK  425

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRVHHLN  1461
             HFEVN PPKR+DVFHMILHSIWLRRLN+R+  ++
Sbjct  426   HFEVNSPPKRYDVFHMILHSIWLRRLNVRIRDVD  459



>ref|XP_004249790.2| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=472

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/463 (61%), Positives = 354/463 (76%), Gaps = 35/463 (8%)
 Frame = +1

Query  163   TRTSFPTTKLLWLFMVPFVLLSAFLVFRAPNKS--W--VFTFPYLKTLAVYGA-------  309
             ++TS     +LW F++P  L++AF+V   P  S  W  +    YL+TL  +G+       
Sbjct  7     SQTSTVKYHVLW-FILPLFLVAAFVVINNPQGSKFWLSISHHHYLETLN-HGSSTKETNE  64

Query  310   ----------------KSYTKLEILESGLAQARSSIL-----RGNQLHSDEHYIPSGSIY  426
                             K ++K++ LE+GLA++R++IL     + N +  +E YIP G +Y
Sbjct  65    KDEVPIINVNKNTTTPKRFSKIDKLEAGLARSRAAILLSRQNKTNHIEEEEEYIPHGPMY  124

Query  427   WNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPD  606
              NA+SFHRSY+EMEK  KVYVY++G PP+ H+GPCK  YAIEG+FI AM+ S+FRT +P+
Sbjct  125   LNATSFHRSYLEMEKKFKVYVYKEGDPPLYHFGPCKHTYAIEGYFIQAMEVSKFRTENPN  184

Query  607   SAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSC  786
              AHV+FLP S+T+L + IYVA SH+W  MK T +DY+  I++KYP+WN +LGADHFML+C
Sbjct  185   KAHVYFLPLSITMLIEFIYVAESHEWGLMKNTTMDYINVISQKYPYWNTSLGADHFMLAC  244

Query  787   HDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTE  966
             HDWGPEIS +IP L K +IRALCNANTSE+FNP KDVSIPEI+LP GTT GL+GGPPP++
Sbjct  245   HDWGPEISFAIPHLYKNSIRALCNANTSEKFNPTKDVSIPEIHLPLGTTKGLLGGPPPSD  304

Query  967   RPVLVFYAGGLHGPVRPILLQHWEN-KDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYE  1143
             R VLVF+AGG+HGP+RPILLQHWEN KDED++IH YLPK VSY+ M+RKSKYC+CPSGYE
Sbjct  305   RRVLVFFAGGVHGPIRPILLQHWENSKDEDVQIHKYLPKGVSYYDMIRKSKYCICPSGYE  364

Query  1144  VASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQY  1323
             VASPRMVE LYMGCVPVLIK  YV PFSDVL+W  F V I V+DIPNLKKIL DIPQ +Y
Sbjct  365   VASPRMVEGLYMGCVPVLIKDNYVTPFSDVLDWDTFVVTIHVKDIPNLKKILMDIPQHKY  424

Query  1324  EILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
               +Q+RG+++RRHFEVN PPKR+DVFHMILHSIWLRRLN RVH
Sbjct  425   LEMQKRGIQMRRHFEVNSPPKRYDVFHMILHSIWLRRLNFRVH  467



>ref|XP_006339310.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=427

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/393 (68%), Positives = 325/393 (83%), Gaps = 9/393 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQLHSDE--------HYIPSGSIYWNASSFHRSYVEM  465
             K ++K+E LE+GLA+AR++IL   Q  S+          YIP G +Y NA+SFHRSY+EM
Sbjct  33    KRFSKIEKLEAGLARARAAILLLRQNKSNHIEEEEEDDEYIPHGPMYLNATSFHRSYLEM  92

Query  466   EKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTV  645
             EK  KVYVY++G+PP+ H+GPCK  YAIEG+FI A++ S+FRT +P+ AHV+FLP SVT+
Sbjct  93    EKKFKVYVYKEGEPPLYHFGPCKQTYAIEGYFIQAIEVSKFRTENPNKAHVYFLPLSVTM  152

Query  646   LSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPD  825
             L + IYVA SH+W  MK T +DYV  I++KYP+WNR+LGADHFML+CHDW PEIS +IP 
Sbjct  153   LIEFIYVAESHEWGLMKNTTMDYVNVISQKYPYWNRSLGADHFMLACHDWAPEISFAIPH  212

Query  826   LQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHG  1005
             L K +IRALCNANTSE+FNP KDVSIPEI+LP GTT GL+GGPPP++RPVLVF+AGG+HG
Sbjct  213   LYKNSIRALCNANTSEKFNPTKDVSIPEIHLPLGTTKGLLGGPPPSDRPVLVFFAGGVHG  272

Query  1006  PVRPILLQHWEN-KDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMG  1182
             P+RPILLQHWEN KDED++IH YLPK VSY+ M+RKSKYC+CPSGYEVASPRMVE LYMG
Sbjct  273   PIRPILLQHWENSKDEDVQIHKYLPKGVSYYDMIRKSKYCICPSGYEVASPRMVEGLYMG  332

Query  1183  CVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRH  1362
             CVPVLIK  YV PFSDVL+W  F V I V+DIP LKKIL DIPQ +Y  +Q+RG+++RRH
Sbjct  333   CVPVLIKDNYVTPFSDVLDWDTFVVTIHVKDIPKLKKILMDIPQDKYLEMQKRGIQMRRH  392

Query  1363  FEVNWPPKRFDVFHMILHSIWLRRLNIRVHHLN  1461
             FEVN PPKR+DVFHMILHSIWLRRLN RVH ++
Sbjct  393   FEVNSPPKRYDVFHMILHSIWLRRLNFRVHDVD  425



>ref|XP_002528630.1| catalytic, putative [Ricinus communis]
 gb|EEF33733.1| catalytic, putative [Ricinus communis]
Length=574

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/406 (65%), Positives = 324/406 (80%), Gaps = 5/406 (1%)
 Frame = +1

Query  247   APNKSWVFTFPYLKTLAVYGAKSYTKLEILESGLAQARSSILR---GNQLHSDEHYIPSG  417
             + N+S +  +P   ++     K++T LE LE+GL  AR++I     GNQ   D  Y+P G
Sbjct  162   SSNRSSIAAWPNDSSIKTTHQKAFTNLERLEAGLQNARAAIKEAKNGNQTE-DPEYVPIG  220

Query  418   SIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRT  594
              +YWN+  FHRSY+EMEK  KV+VYE+G+PPV H GPCKSIY++EG+FIH M+   QFRT
Sbjct  221   PMYWNSKVFHRSYLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHRMEIDDQFRT  280

Query  595   TDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHF  774
              DP+ AHV+FLPFSV ++ + +YV +SHD+ P+KRT  DYV  +A KYP+WNR+LGADHF
Sbjct  281   KDPEKAHVYFLPFSVAMMVQFVYVRDSHDFGPIKRTVRDYVNLVAGKYPYWNRSLGADHF  340

Query  775   MLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGP  954
             ML+CHDWGPE S S+PDL K +IRALCNANTSERFNP KDVS PEINL  GTT G IGGP
Sbjct  341   MLACHDWGPETSFSLPDLAKNSIRALCNANTSERFNPIKDVSFPEINLQTGTTKGFIGGP  400

Query  955   PPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPS  1134
              P++R +L F+AGGLHGP+RPILL+HWENKD D+K+H YLPK VSY+ MMRKSK+CLCPS
Sbjct  401   SPSKRSILAFFAGGLHGPIRPILLEHWENKDNDMKVHRYLPKGVSYYEMMRKSKFCLCPS  460

Query  1135  GYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQ  1314
             GYEVASPR+VEALY GCVPVLI   YVPPFSDVLNW +F+V +PV DIPNLK+ILT I  
Sbjct  461   GYEVASPRVVEALYTGCVPVLISDHYVPPFSDVLNWKSFSVEVPVSDIPNLKRILTSISS  520

Query  1315  TQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
              QY  +QRR ++VRRHFEVN PPKR+DVFHMILHSIWLRRLN+++H
Sbjct  521   RQYIRMQRRVLQVRRHFEVNSPPKRYDVFHMILHSIWLRRLNVKIH  566



>gb|KDP29231.1| hypothetical protein JCGZ_16620 [Jatropha curcas]
Length=452

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/384 (68%), Positives = 313/384 (82%), Gaps = 4/384 (1%)
 Frame = +1

Query  316   YTKLEILESGLAQARSSIL---RGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVY  486
             Y+ LE LE+GL  ARS+I     GNQ   D  Y+P+G +YWN+  FHRSY+EMEK  +V+
Sbjct  62    YSSLERLEAGLQNARSAIKDAKNGNQTLEDPEYVPTGPMYWNSKVFHRSYLEMEKQFRVF  121

Query  487   VYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMIY  663
             VYE+G+PPV H GPCKSIY++EG+FIH M+   QFRT DPD AHV+FLPFSVT++ + +Y
Sbjct  122   VYEEGEPPVFHNGPCKSIYSMEGNFIHRMEIDDQFRTKDPDKAHVYFLPFSVTMMVRFVY  181

Query  664   VANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAI  843
             V +SHD+ P++RT  DYV  IA KYPFWNR+LGADHFML+CHDWGPE S S+P L K +I
Sbjct  182   VRDSHDFGPIRRTVGDYVSLIAGKYPFWNRSLGADHFMLACHDWGPETSFSVPYLGKNSI  241

Query  844   RALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPIL  1023
             RALCNANTSERFNP KDVS PEINL  G+T GLIGGP P++R +L FYAGGLHGP+RPIL
Sbjct  242   RALCNANTSERFNPIKDVSFPEINLQTGSTKGLIGGPSPSKRSILAFYAGGLHGPIRPIL  301

Query  1024  LQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIK  1203
             L HWENKD+DIK+H YLPK VSY+ MMRKSK+CLCPSGYEVASPR+VEA Y GCVPVLI 
Sbjct  302   LAHWENKDDDIKVHRYLPKGVSYYEMMRKSKFCLCPSGYEVASPRVVEAFYTGCVPVLIS  361

Query  1204  RGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPP  1383
               YVPPFSDVLNW +F+V +PV  IPNLK+ILT I   QY  +QRR  ++RRHFEVN PP
Sbjct  362   DHYVPPFSDVLNWKSFSVEVPVSKIPNLKRILTSISPRQYIRMQRRVQQIRRHFEVNSPP  421

Query  1384  KRFDVFHMILHSIWLRRLNIRVHH  1455
             KR+DVFHMILHSIWLRRLN+R+H+
Sbjct  422   KRYDVFHMILHSIWLRRLNVRIHN  445



>ref|XP_002284018.2| PREDICTED: probable glycosyltransferase At5g03795 [Vitis vinifera]
Length=546

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/386 (68%), Positives = 315/386 (82%), Gaps = 5/386 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILR---GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             + YT LE +E+GL +ARS+I     GN+   D  YIP+G IYWN ++FHRSY+EMEK LK
Sbjct  157   RQYTTLERVEAGLRRARSAIREAKIGNRT-PDPDYIPNGPIYWNVNAFHRSYLEMEKQLK  215

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             VYVY++G+PP+ H GPCKSIY++EG+FIH M+  S FRT DP+ AH+FFLPFSV +L + 
Sbjct  216   VYVYDEGEPPLFHNGPCKSIYSMEGNFIHKMEMDSHFRTKDPEKAHLFFLPFSVAMLVRF  275

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +YV +SHD  P+K+T +DYV  ++ KYP+WNR+LGADHFML+CHDWGPE S SIP L K 
Sbjct  276   VYVRDSHDLGPIKQTVIDYVNVVSTKYPYWNRSLGADHFMLACHDWGPETSFSIPYLHKN  335

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE FNP KDVS PEINL  G+TD  IGGP P+ R +L F+AGGLHGP+RP
Sbjct  336   SIRVLCNANTSEGFNPSKDVSFPEINLLTGSTDSFIGGPSPSHRTLLAFFAGGLHGPIRP  395

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             ILL+HWENKDED+K+H YLPK VSY+ MMRKSKYCLCPSGYEVASPR+VEALY GCVPVL
Sbjct  396   ILLEHWENKDEDVKVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEALYTGCVPVL  455

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPFSDVLNW +F+V +PV +IPNLK+IL DI   QY  +QRRG++ RRHFEVN 
Sbjct  456   ISDHYVPPFSDVLNWKSFSVEVPVREIPNLKRILMDISPRQYIRMQRRGIQARRHFEVNS  515

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVHH  1455
             PPKR+DVFHMILHS+WLRRLN RVHH
Sbjct  516   PPKRYDVFHMILHSLWLRRLNFRVHH  541



>emb|CDP15333.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/382 (67%), Positives = 313/382 (82%), Gaps = 2/382 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI--LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
               Y+ LEILE+ LA+AR++I   R  Q    E ++P G +Y NA++F RSY+EMEK  KV
Sbjct  57    NKYSNLEILEASLAEARAAIKGARIGQEAPHEDFVPKGPMYLNATAFRRSYLEMEKRFKV  116

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKMIY  663
             ++YE+G PPV H GPCK  YAIEG+FI A++ S  RTTDP  AH+++LPFSVT +++ IY
Sbjct  117   FIYEEGGPPVFHVGPCKHTYAIEGYFIQALEVSPIRTTDPSKAHLYYLPFSVTRITEFIY  176

Query  664   VANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAI  843
             V  S +W  MK    DYV +I+ KYP+WNR+LGADHFML+CHDWGPE+S ++P L   +I
Sbjct  177   VPESREWGLMKSFVADYVNTISHKYPYWNRSLGADHFMLACHDWGPELSFAVPYLYTNSI  236

Query  844   RALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPIL  1023
             RALCNANTSERF P +DVSIPEI+LP GTT G+IGGP P++RP+LVFYAGG+HGP+RPIL
Sbjct  237   RALCNANTSERFAPSRDVSIPEIHLPLGTTKGMIGGPSPSKRPILVFYAGGIHGPIRPIL  296

Query  1024  LQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIK  1203
             L++WE+KD D++IH YLPK VSY+GMMRKS+YC+CPSGYEVASPRMVEALYMGCVPVLIK
Sbjct  297   LEYWEDKDADVQIHQYLPKGVSYYGMMRKSRYCICPSGYEVASPRMVEALYMGCVPVLIK  356

Query  1204  RGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPP  1383
              GYV PFSD+LNW AFAV+IPV+DIPNLK+IL  I   QY  +QRRG++VRRHFE+N PP
Sbjct  357   EGYVIPFSDILNWKAFAVVIPVQDIPNLKRILMAISPRQYIRMQRRGIQVRRHFEINTPP  416

Query  1384  KRFDVFHMILHSIWLRRLNIRV  1449
             KR+DVFHMILHSIWLRRLNI V
Sbjct  417   KRYDVFHMILHSIWLRRLNIIV  438



>ref|XP_011101498.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=486

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/386 (68%), Positives = 325/386 (84%), Gaps = 5/386 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQA----RSSILRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTL  477
             K Y+ LE++E+ L QA    R +I+ G     D  YIP+G +YWN+  FHRSY+EMEK L
Sbjct  96    KRYSDLEMVEADLVQAPAAIREAIVTGGNQTEDPDYIPNGPMYWNSKVFHRSYLEMEKRL  155

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKM  657
             K+++YE+G PPV H+GPCK  YAIEG F+  M+ S+FRT D + AH+FFLPFSVT+++++
Sbjct  156   KIFIYEEGDPPVFHFGPCKHTYAIEGIFMANMEVSRFRTFDHNKAHLFFLPFSVTMITQV  215

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             IYV  SH+WS MK TA DY+  IA+K+P+WNRTLGADHFML+CHDWGPEIS +IP+L K 
Sbjct  216   IYVPESHEWSQMKNTASDYINVIAQKHPYWNRTLGADHFMLACHDWGPEISFAIPNLYKN  275

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IRALCNANTSE+FNP +DVSIPEI+LP G T G+IGGPPP++RP+LVFYAGG+HGP+RP
Sbjct  276   SIRALCNANTSEQFNPSRDVSIPEIHLPGGGTRGMIGGPPPSKRPILVFYAGGVHGPIRP  335

Query  1018  ILLQHWENK-DEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
             ILL+HWENK D D++I+ YLP+NVSY+GMMRKS+YC+CPSGYEVASPRMVE LYMGCVPV
Sbjct  336   ILLEHWENKSDPDVQIYKYLPQNVSYYGMMRKSRYCICPSGYEVASPRMVEGLYMGCVPV  395

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             LIK GYV PFSDVLNW  FAVI+PV+DIPNLK ILT IP  +Y  +Q+RG+++RRHFEVN
Sbjct  396   LIKDGYVIPFSDVLNWETFAVIVPVKDIPNLKTILTAIPMKKYVQMQQRGIQMRRHFEVN  455

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRVH  1452
              PPKR+DVFHMILHSIWLRRLN+R+H
Sbjct  456   SPPKRYDVFHMILHSIWLRRLNVRLH  481



>gb|EYU38594.1| hypothetical protein MIMGU_mgv1a021350mg [Erythranthe guttata]
Length=485

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/388 (68%), Positives = 324/388 (84%), Gaps = 6/388 (2%)
 Frame = +1

Query  307   AKSYTKLEILESGLAQARSSILR----GNQLHS-DEHYIPSGSIYWNASSFHRSYVEMEK  471
              ++Y+ LE++E+ LAQ R +I +    GN+    D  Y+P G +YWN   FHRSY+EMEK
Sbjct  92    TRTYSSLEMVEADLAQTRDAISQAKKGGNETRDPDPDYVPDGPMYWNPKVFHRSYLEMEK  151

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLS  651
              +KV+VYE+G PPV H+GPCK  YAIEG FI  M+ S+FRT D D AH+FFLPFSVT+++
Sbjct  152   KMKVFVYEEGDPPVFHFGPCKHTYAIEGIFISNMEVSRFRTMDQDKAHLFFLPFSVTMIT  211

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             ++IYV +SH+W  MK  A DYV  IA+K+P+WNR+LGADHFML+CHDWGPEIS ++P+L 
Sbjct  212   QVIYVKDSHEWGLMKNAASDYVNVIAQKHPYWNRSLGADHFMLACHDWGPEISFAVPNLY  271

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
             K AIRALCNANTSERF+P +DVSIPEI+LP GTT G+IGGPPP++RP+LVFYAGG+HGP+
Sbjct  272   KNAIRALCNANTSERFDPSRDVSIPEIHLPGGTTQGIIGGPPPSKRPILVFYAGGVHGPI  331

Query  1012  RPILLQHWENK-DEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             RPILL+HWENK D D++I+ YLPKN+SY+GMMRKS+YC+CPSGYEVASPRMVE LY+GCV
Sbjct  332   RPILLEHWENKTDPDVQIYRYLPKNMSYYGMMRKSRYCICPSGYEVASPRMVEGLYLGCV  391

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLIK  YV PFSDVLNW  FAVI+PV DIPNLKKILT I   +Y  +QRRGV++RRHFE
Sbjct  392   PVLIKDSYVIPFSDVLNWETFAVIVPVRDIPNLKKILTGISSKEYMKMQRRGVQMRRHFE  451

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             +N PPKR+DVFHMILHSIWLRRLNIR+H
Sbjct  452   INSPPKRYDVFHMILHSIWLRRLNIRLH  479



>ref|XP_009787886.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=460

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/458 (57%), Positives = 334/458 (73%), Gaps = 33/458 (7%)
 Frame = +1

Query  163   TRTSFPTTKLLWLFMVPFVLLSAFLVFRAPNKSWVFTFPYLKTLAVYGA-----------  309
             T TS  +++++WL  V  +L+S +   ++ +     TFP + +   +             
Sbjct  4     TATSSSSSRVVWLISVSLILVSLYFGLQSSS-----TFPLVLSFGNFSQFLATNVSSKKE  58

Query  310   -------------KSYTKLEILESGLAQARSSILRG---NQLHSDEHYIPSGSIYWNASS  441
                          K  + LE LE+GL +AR++I +    NQ   D  Y+P+G IYWN  +
Sbjct  59    SQLNNSQPIVKLQKKLSSLERLEAGLVRARAAIKQAQSKNQTFDDPEYVPTGPIYWNPIA  118

Query  442   FHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVF  621
             FHRSY+EMEK  K+YVYE+G+PPV HY   + I  IEG  IH ++ S+FRT DP+ AHV+
Sbjct  119   FHRSYLEMEKHFKIYVYEEGEPPVFHYSASQGILGIEGILIHQLEISKFRTNDPEKAHVY  178

Query  622   FLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGP  801
             FLPFSV  +   +YV +S +W PM+ TA DY+ +I+RKYP+WNR+LG+DHFML+CHDWGP
Sbjct  179   FLPFSVLSIVSYVYVVDSREWGPMRNTAADYIDNISRKYPYWNRSLGSDHFMLACHDWGP  238

Query  802   EISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLV  981
              IS +IP L K +IR LCNANTSERFNP KDVS+PEI LP GTTDGLIGGP P+ R VLV
Sbjct  239   RISLAIPYLYKNSIRVLCNANTSERFNPSKDVSLPEIYLPQGTTDGLIGGPSPSHRSVLV  298

Query  982   FYAGGLHGPVRPILLQHW-ENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPR  1158
             FYAGG+HG +R +L+++W +N D D++IH YLPKNVSY+GM+RKSKYC+CPSG+EVASPR
Sbjct  299   FYAGGIHGYIRQVLMEYWGKNDDPDVQIHEYLPKNVSYYGMIRKSKYCICPSGWEVASPR  358

Query  1159  MVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQR  1338
             MVEALYMGCVP+L+K  YV PFSDVLNW +FAV +   DIPNLKKIL  IPQ QY  +Q+
Sbjct  359   MVEALYMGCVPILLKDHYVAPFSDVLNWKSFAVEMTSNDIPNLKKILNAIPQRQYIKMQK  418

Query  1339  RGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             RG++VRRHFEVN+PP+R+DVFHMILHSIWLRRLNI VH
Sbjct  419   RGLQVRRHFEVNFPPRRYDVFHMILHSIWLRRLNIHVH  456



>ref|XP_009779883.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=550

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/385 (66%), Positives = 313/385 (81%), Gaps = 6/385 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI----LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTL  477
             + ++ LE LE+ L ++R+SI    + GNQ   D  Y+PSG +YWNA++FHRSY+EMEK  
Sbjct  161   RKFSNLERLEAKLWKSRASIKEAAMSGNQT-DDSDYVPSGPMYWNANAFHRSYLEMEKQF  219

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKM  657
             KV+VYE+G  P+ H GPCKSIYA+EG+FI+ M+ ++FRT DP+ AH+FFLP SVT +   
Sbjct  220   KVFVYEEGDQPIFHNGPCKSIYAMEGNFIYQMETTKFRTRDPEKAHIFFLPISVTAIVHF  279

Query  658   IYVANSHD-WSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
             IY  NS + W+PMK+T  DY+  +A KYP+WNR+LGADHF+L+CHDWGPEIS ++P+L K
Sbjct  280   IYDRNSREHWNPMKQTLRDYINLVAGKYPYWNRSLGADHFILACHDWGPEISKAVPELFK  339

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              +IRALCNANTSE F P KDVS PEI LP GT DGLIGGP P+ R +L F+AGGLHGP+R
Sbjct  340   NSIRALCNANTSEGFKPSKDVSFPEILLPGGTMDGLIGGPSPSRRSILAFFAGGLHGPIR  399

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
             PILL HWENKD+D+++H YLPK VSY+GM+RKSKYCLCPSGYEVASPRMVEALY GCVPV
Sbjct  400   PILLDHWENKDDDMQVHRYLPKGVSYYGMLRKSKYCLCPSGYEVASPRMVEALYTGCVPV  459

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             L+K  YVPPFSDVLNW +F+V +PVE+IPNLK IL  I   QY  LQRRG +VRRHFEVN
Sbjct  460   LLKDHYVPPFSDVLNWKSFSVEVPVEEIPNLKNILAGISTRQYIRLQRRGKQVRRHFEVN  519

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRV  1449
              PPKR+DVFHMILHSIWLRRLN+R+
Sbjct  520   LPPKRYDVFHMILHSIWLRRLNMRL  544



>ref|XP_009617934.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana tomentosiformis]
Length=549

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/385 (67%), Positives = 311/385 (81%), Gaps = 6/385 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI----LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTL  477
             + ++ LE LE+ L + R++I      GNQ   D  YIPSG +YWNA++FHRSY+EMEK  
Sbjct  160   RKFSNLERLEAKLGKFRAAIKEAATSGNQT-DDADYIPSGPMYWNANAFHRSYLEMEKQF  218

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKM  657
             KV+VYE+G  P+ H GPCKSIYA+EG+FI+ M+ ++FRT DP+ AH+FFLP SVT +   
Sbjct  219   KVFVYEEGDQPIFHNGPCKSIYAMEGNFIYQMETTKFRTRDPEKAHIFFLPISVTAIVHF  278

Query  658   IYVANSHD-WSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
             IY  NS + W+PMK+T  DY+  +A KYP+WNR+LGADHFML+CHDWGPEIS ++P+L K
Sbjct  279   IYDRNSKEHWNPMKQTLRDYINLVAGKYPYWNRSLGADHFMLACHDWGPEISKAVPELFK  338

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              +IRALCNANTSE F P KDVS PEI LP GT DGLIGGP P+ R +L F+AGGLHGP+R
Sbjct  339   NSIRALCNANTSEGFKPSKDVSFPEILLPGGTMDGLIGGPSPSHRSILAFFAGGLHGPIR  398

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
             PILL+HWENKD+DI++H YLPK VSY+GM+RKSKYCLCPSGYEVASPRMVEALY GCVPV
Sbjct  399   PILLEHWENKDDDIQVHRYLPKGVSYYGMLRKSKYCLCPSGYEVASPRMVEALYTGCVPV  458

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             LIK  YV PFSDVLNW +F+V + VE+IPNLKKIL  I   QY  LQRRG +VRRHFEVN
Sbjct  459   LIKDHYVLPFSDVLNWKSFSVEVLVEEIPNLKKILAGISTRQYIRLQRRGKQVRRHFEVN  518

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRV  1449
              PPKR+DVFHMILHSIWLRRLN+R+
Sbjct  519   MPPKRYDVFHMILHSIWLRRLNMRI  543



>ref|XP_009617933.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana tomentosiformis]
Length=550

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/385 (67%), Positives = 311/385 (81%), Gaps = 6/385 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI----LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTL  477
             + ++ LE LE+ L + R++I      GNQ   D  YIPSG +YWNA++FHRSY+EMEK  
Sbjct  161   RKFSNLERLEAKLGKFRAAIKEAATSGNQT-DDADYIPSGPMYWNANAFHRSYLEMEKQF  219

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKM  657
             KV+VYE+G  P+ H GPCKSIYA+EG+FI+ M+ ++FRT DP+ AH+FFLP SVT +   
Sbjct  220   KVFVYEEGDQPIFHNGPCKSIYAMEGNFIYQMETTKFRTRDPEKAHIFFLPISVTAIVHF  279

Query  658   IYVANSHD-WSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
             IY  NS + W+PMK+T  DY+  +A KYP+WNR+LGADHFML+CHDWGPEIS ++P+L K
Sbjct  280   IYDRNSKEHWNPMKQTLRDYINLVAGKYPYWNRSLGADHFMLACHDWGPEISKAVPELFK  339

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              +IRALCNANTSE F P KDVS PEI LP GT DGLIGGP P+ R +L F+AGGLHGP+R
Sbjct  340   NSIRALCNANTSEGFKPSKDVSFPEILLPGGTMDGLIGGPSPSHRSILAFFAGGLHGPIR  399

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
             PILL+HWENKD+DI++H YLPK VSY+GM+RKSKYCLCPSGYEVASPRMVEALY GCVPV
Sbjct  400   PILLEHWENKDDDIQVHRYLPKGVSYYGMLRKSKYCLCPSGYEVASPRMVEALYTGCVPV  459

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             LIK  YV PFSDVLNW +F+V + VE+IPNLKKIL  I   QY  LQRRG +VRRHFEVN
Sbjct  460   LIKDHYVLPFSDVLNWKSFSVEVLVEEIPNLKKILAGISTRQYIRLQRRGKQVRRHFEVN  519

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRV  1449
              PPKR+DVFHMILHSIWLRRLN+R+
Sbjct  520   MPPKRYDVFHMILHSIWLRRLNMRI  544



>ref|XP_010098868.1| putative glycosyltransferase [Morus notabilis]
 gb|EXB75956.1| putative glycosyltransferase [Morus notabilis]
Length=465

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/385 (66%), Positives = 311/385 (81%), Gaps = 5/385 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILR---GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             + Y+ LE LE+ L +ARS+I     GN+   D  Y+P+G +YWN+ +FHRSY+EMEK  K
Sbjct  79    REYSDLERLEARLMKARSAISEAKVGNETQ-DPEYVPTGPMYWNSKAFHRSYIEMEKEFK  137

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             V+VYE+G+PP+ H GPCKSIY++EG+FIH ++  SQFRT DP+ AHVFFLPFSVT+L + 
Sbjct  138   VFVYEEGEPPLFHNGPCKSIYSMEGNFIHEIEMNSQFRTKDPNKAHVFFLPFSVTMLVRY  197

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +YV +SHD+ P+K+T +DYV  ++ K+PFWNR+L ADHFMLSCHDWGPE S S   L + 
Sbjct  198   VYVRDSHDFHPIKQTVIDYVNVVSEKHPFWNRSLAADHFMLSCHDWGPEASRSNRFLHQN  257

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE FNP KDVS PEINL  G TDGL+GGP  + RP L F+AGG+HGP+RP
Sbjct  258   SIRVLCNANTSEGFNPSKDVSFPEINLLSGATDGLLGGPSASRRPNLAFFAGGVHGPIRP  317

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             ILL+HWENKDED+KI  YLPK VSY+ M+RKSKYC+CPSGYEVASPR+VEA+Y GCVPVL
Sbjct  318   ILLEHWENKDEDMKIQQYLPKGVSYYDMLRKSKYCICPSGYEVASPRIVEAIYTGCVPVL  377

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPFSDVLNW +F+V +PV+DIPNLK IL  I   QY  +QRR ++VRRHFEVN 
Sbjct  378   ISDHYVPPFSDVLNWKSFSVEVPVKDIPNLKTILMSISPRQYIRMQRRVLKVRRHFEVNS  437

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVH  1452
             PPKRFDVFHMILHS+WLRRLNIR+H
Sbjct  438   PPKRFDVFHMILHSVWLRRLNIRIH  462



>ref|XP_004246587.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Solanum lycopersicum]
Length=534

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/388 (66%), Positives = 312/388 (80%), Gaps = 6/388 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILR----GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTL  477
             K +T LE LE  L +AR++I      GNQ   D  Y+PSG +YWNA +FHRSY+EMEK L
Sbjct  145   KKFTNLEKLEVKLGKARAAIKEAATFGNQT-DDSDYVPSGPMYWNAKAFHRSYLEMEKEL  203

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKM  657
             KV+VYE+G+ P+ H GPCKSIYA+EG+FI+ M+ S+FRT DP+ AHVFFLP SVT +   
Sbjct  204   KVFVYEEGEQPIFHNGPCKSIYAMEGNFIYQMETSKFRTRDPEKAHVFFLPISVTSIVHF  263

Query  658   IYVANSHD-WSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
             IY  NS   W PM++T +DY+  ++ KYP+WNR+LGADHFML+CHDWGPE+S S+P+L K
Sbjct  264   IYDRNSRGHWDPMRQTVMDYINLVSGKYPYWNRSLGADHFMLACHDWGPELSKSVPELFK  323

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              +IRALCNANTSE F P KDVS PEI LP GT +GL+GGP P+ R +L F+AGGLHGP+R
Sbjct  324   NSIRALCNANTSEGFKPSKDVSFPEILLPGGTMNGLLGGPSPSRRSILAFFAGGLHGPIR  383

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
             PILL+HWENKD+DI++H YLPK VSY+GM+R SK+CLCPSGYEVASPRMVEALY GCVPV
Sbjct  384   PILLEHWENKDDDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRMVEALYTGCVPV  443

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             L+K  YVPPFSDVLNW +F+V +PV+ IP+LKKIL+ I   QY  LQRRG +VRRHFEVN
Sbjct  444   LLKDHYVPPFSDVLNWKSFSVEVPVDRIPDLKKILSGISTRQYIRLQRRGKQVRRHFEVN  503

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
                KR+DVFHMILHS+WLRRLN+R+H L
Sbjct  504   MFAKRYDVFHMILHSVWLRRLNMRLHGL  531



>ref|XP_010325948.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Solanum lycopersicum]
Length=535

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/388 (66%), Positives = 312/388 (80%), Gaps = 6/388 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILR----GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTL  477
             K +T LE LE  L +AR++I      GNQ   D  Y+PSG +YWNA +FHRSY+EMEK L
Sbjct  146   KKFTNLEKLEVKLGKARAAIKEAATFGNQT-DDSDYVPSGPMYWNAKAFHRSYLEMEKEL  204

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKM  657
             KV+VYE+G+ P+ H GPCKSIYA+EG+FI+ M+ S+FRT DP+ AHVFFLP SVT +   
Sbjct  205   KVFVYEEGEQPIFHNGPCKSIYAMEGNFIYQMETSKFRTRDPEKAHVFFLPISVTSIVHF  264

Query  658   IYVANSHD-WSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
             IY  NS   W PM++T +DY+  ++ KYP+WNR+LGADHFML+CHDWGPE+S S+P+L K
Sbjct  265   IYDRNSRGHWDPMRQTVMDYINLVSGKYPYWNRSLGADHFMLACHDWGPELSKSVPELFK  324

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              +IRALCNANTSE F P KDVS PEI LP GT +GL+GGP P+ R +L F+AGGLHGP+R
Sbjct  325   NSIRALCNANTSEGFKPSKDVSFPEILLPGGTMNGLLGGPSPSRRSILAFFAGGLHGPIR  384

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
             PILL+HWENKD+DI++H YLPK VSY+GM+R SK+CLCPSGYEVASPRMVEALY GCVPV
Sbjct  385   PILLEHWENKDDDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRMVEALYTGCVPV  444

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             L+K  YVPPFSDVLNW +F+V +PV+ IP+LKKIL+ I   QY  LQRRG +VRRHFEVN
Sbjct  445   LLKDHYVPPFSDVLNWKSFSVEVPVDRIPDLKKILSGISTRQYIRLQRRGKQVRRHFEVN  504

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
                KR+DVFHMILHS+WLRRLN+R+H L
Sbjct  505   MFAKRYDVFHMILHSVWLRRLNMRLHGL  532



>ref|XP_004494122.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=526

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/385 (66%), Positives = 313/385 (81%), Gaps = 5/385 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILR---GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             + ++ L+  E+GL QAR++I +   GNQ   D  Y+P G +Y+N ++FHRSY+EMEK  K
Sbjct  140   RKFSILDRTEAGLLQARAAIRKARNGNQTQ-DIDYVPIGPMYYNPNAFHRSYLEMEKQFK  198

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKM  657
             V+VYE+G+PPV H GPCKSIY++EG+FIH ++ + QFRT DPD AHVFFLPFSV ++ + 
Sbjct  199   VFVYEEGEPPVFHNGPCKSIYSMEGNFIHTIEMNDQFRTRDPDKAHVFFLPFSVAMMVQF  258

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +YV +SHD+SP+K+T  DY+  I+ +YPFWNR+LGADHFMLSCHDWGPE+S S+P+L K 
Sbjct  259   VYVRDSHDFSPIKKTVADYINVISERYPFWNRSLGADHFMLSCHDWGPEVSNSVPNLYKN  318

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IRALCNANTSE F P KDVS PEINL  GT  G +GGP P++R VL F+AGGLHGP+RP
Sbjct  319   SIRALCNANTSEGFKPAKDVSFPEINLQTGTIHGFVGGPSPSKRSVLAFFAGGLHGPIRP  378

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             ILL HWENKDEDI++H YLPK VSY+ M+RKSK+CLCPSGYEVASPR+VEA+Y GCVPVL
Sbjct  379   ILLDHWENKDEDIQVHKYLPKGVSYYDMLRKSKFCLCPSGYEVASPRVVEAIYTGCVPVL  438

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPFSDVLNW +F+V + V+DIPNLKKIL  I   QY  +QRR  +VRRHFEV+ 
Sbjct  439   ISDHYVPPFSDVLNWKSFSVEVSVDDIPNLKKILLSISPRQYIRMQRRVGQVRRHFEVHS  498

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVH  1452
             PPKRFDVFHMILHSIWLRRLN RVH
Sbjct  499   PPKRFDVFHMILHSIWLRRLNFRVH  523



>gb|EYU41561.1| hypothetical protein MIMGU_mgv1a004154mg [Erythranthe guttata]
Length=541

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/389 (66%), Positives = 315/389 (81%), Gaps = 4/389 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI--LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             + ++ L+ILE+ + Q+R++I   R   +  D  Y+PSG IYWN S+FHRSY+EMEK  KV
Sbjct  152   RRFSNLQILEAKMQQSRTAIRDARKESVIHDPDYVPSGPIYWNPSAFHRSYLEMEKNFKV  211

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKMIY  663
             +VYE+G+ P+ H GPC SIY++EG+FI+ ++ S+FRT DP+ AHVFFLPFSVT +   I+
Sbjct  212   FVYEEGEHPIFHNGPCGSIYSMEGNFIYKLEISKFRTRDPEKAHVFFLPFSVTSIVHFIF  271

Query  664   VANSHD-WSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
               NS D W PMK+T  DYV+ +A KYP+WNR+LG+DHFMLSCHDWGPE+S S+P+L   +
Sbjct  272   DKNSRDHWLPMKQTVSDYVELVAAKYPYWNRSLGSDHFMLSCHDWGPELSKSLPELFNNS  331

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IRALCNANT+E F P KDVSIPEINLP G T+GLIGGP P+ RPVLVF+AGGLHGP+RP 
Sbjct  332   IRALCNANTTEGFKPSKDVSIPEINLPGGRTNGLIGGPSPSRRPVLVFFAGGLHGPIRPA  391

Query  1021  LLQHWEN-KDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             LL+HWEN KD+D++IH YLPKNVSY  +MRKSKYC+CPSGYEVASPRMVEALY GCVPVL
Sbjct  392   LLEHWENSKDKDVQIHQYLPKNVSYSALMRKSKYCVCPSGYEVASPRMVEALYTGCVPVL  451

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             +K  YVPPFSDVLNW +FAV IPV DIPNL+ IL  I   QY  +QRRGV VRRHFEVN 
Sbjct  452   VKDHYVPPFSDVLNWKSFAVEIPVGDIPNLRNILLGISTRQYIRMQRRGVTVRRHFEVNL  511

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVHHLNN  1464
              PKR+DVFHMILHSIWLRRLN+R+H + +
Sbjct  512   TPKRYDVFHMILHSIWLRRLNVRLHGVED  540



>ref|XP_011094446.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=559

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/389 (67%), Positives = 315/389 (81%), Gaps = 5/389 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI---LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             + ++ LEILE+ L QAR++I    RGN  + D  YIP+G IYWN S FHRSY+EMEK  K
Sbjct  171   RRFSNLEILEATLQQARAAIRDAQRGNPAY-DPDYIPTGPIYWNPSGFHRSYLEMEKHFK  229

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             V+VYE+G+ P+ H GPC SIY++EG+FI+ ++ S+FRT DP+ AHV+FLPFSVT +   I
Sbjct  230   VFVYEEGEQPIFHNGPCGSIYSMEGNFIYKLETSKFRTRDPERAHVYFLPFSVTSIVHFI  289

Query  661   YVANSHD-WSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             Y    HD W PMK+T  DYV  +A KYP+WNR++G+DH MLSCHDWGPE+S S+P+L K 
Sbjct  290   YDKRVHDHWLPMKQTVKDYVDLVAGKYPYWNRSIGSDHVMLSCHDWGPELSKSLPELFKN  349

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IRALCNANTSE F P KDVSIPEINLP G T+GLIGGP P++RP+LVF+AGGLHGP+RP
Sbjct  350   SIRALCNANTSEGFRPSKDVSIPEINLPGGRTNGLIGGPSPSKRPILVFFAGGLHGPIRP  409

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             ILL+HWENK +D+++H YLPK+VSY  MMRKS++C+CPSGYEVASPRMVEALY GCVPVL
Sbjct  410   ILLEHWENKGQDVQVHRYLPKDVSYSAMMRKSRFCICPSGYEVASPRMVEALYTGCVPVL  469

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             IK  YVPPFSDVLNW +F+V I V DIPNLKKILT I   QY  +QRRGV VRRHFEVN 
Sbjct  470   IKDHYVPPFSDVLNWKSFSVEISVADIPNLKKILTGISMRQYIRMQRRGVAVRRHFEVNL  529

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVHHLNN  1464
              PKR+DVFHM LHSIWLRRLNIR+H + +
Sbjct  530   SPKRYDVFHMTLHSIWLRRLNIRLHGVED  558



>ref|XP_006366795.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=519

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/388 (65%), Positives = 312/388 (80%), Gaps = 6/388 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI----LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTL  477
             K +T LE LE  L +AR++I    + GNQ   D  Y+PSG +YWN  +FHRSY+EMEK  
Sbjct  130   KKFTNLEKLEVKLGKARAAIKEAAVSGNQT-DDSDYVPSGPMYWNPKAFHRSYLEMEKEF  188

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKM  657
             KV+VYE+G+ P+ H GPCKSIYA+EG+FI+ M+ S+FRT DP+ AHVFFLP SVT +   
Sbjct  189   KVFVYEEGEQPIFHNGPCKSIYAMEGNFIYQMETSKFRTRDPEKAHVFFLPISVTSIVHF  248

Query  658   IYVANSHD-WSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
             IY  NS + W+PMK+T  DY+  ++ KYP+WNR+LGADHFML+CHDWGPE+S ++P+L K
Sbjct  249   IYDRNSREHWNPMKQTLTDYINLVSGKYPYWNRSLGADHFMLACHDWGPELSKAVPELFK  308

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              +IRALCNANTSE F P KDVS PEI LP GT +GLIGGP P+ R +L F+AGGLHGP+R
Sbjct  309   NSIRALCNANTSEGFKPSKDVSFPEILLPGGTMNGLIGGPSPSRRSILAFFAGGLHGPIR  368

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
             PILL+HWENKD+DI++H YLPK VSY+GM+R SK+CLCPSGYEVASPRMVEALY GCVPV
Sbjct  369   PILLEHWENKDDDIQVHRYLPKGVSYYGMLRNSKFCLCPSGYEVASPRMVEALYTGCVPV  428

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             L+K  YVPPFSDVLNW +F+V +PV+ IP+LKKIL  I   QY  LQRRG +VRRHFEVN
Sbjct  429   LLKDHYVPPFSDVLNWKSFSVEVPVDRIPDLKKILAGISTRQYIRLQRRGKQVRRHFEVN  488

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
               P+R+DVFHMILHS+WLRRLN+R+H L
Sbjct  489   MIPQRYDVFHMILHSVWLRRLNMRLHGL  516



>ref|XP_010243080.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nelumbo nucifera]
Length=598

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/389 (64%), Positives = 316/389 (81%), Gaps = 7/389 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI-----LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             K++T+LE LE+GLA+ R++I      +GNQ  SD  Y+P G +YWNA +FHRSY+ MEK 
Sbjct  207   KNHTQLERLEAGLAKIRAAIREAAHQKGNQT-SDFDYVPEGPMYWNAQAFHRSYLVMEKQ  265

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLS  651
              K+++YE+G+PP+ H GPC+SIY++EG+FIH ++  + FRT +P+ A+ FFLPFSVT + 
Sbjct  266   FKIFIYEEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPEEAYAFFLPFSVTQMV  325

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + +YV NSHD  P+K+T +DYV  IA KYP+WNR+L ADHFMLSCHDWGP  S  +P L 
Sbjct  326   RFVYVPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSCHDWGPLTSSYVPHLY  385

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
             K  IR LCNANTSE FNP KD S PEINL  G T GLIGGPPP+ RP+L F+AGGLHGP+
Sbjct  386   KNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGLIGGPPPSCRPILAFFAGGLHGPI  445

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             RP+LL+HW+NKDED+K++ YLPK +SY+ MM+KSKYC+CPSGYEVASPR+VEA+Y GCVP
Sbjct  446   RPLLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEVASPRIVEAIYAGCVP  505

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI   YVPPFSDVLNW +F+V +PV +IPNLK+IL  IP  QY+ +QRRG++VRRHFEV
Sbjct  506   VLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSIPTRQYKRMQRRGLKVRRHFEV  565

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             N+PPKRFDV+HMILHS+WLRRLN+R+H L
Sbjct  566   NFPPKRFDVYHMILHSVWLRRLNVRIHDL  594



>ref|XP_010243073.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nelumbo nucifera]
Length=620

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/389 (64%), Positives = 316/389 (81%), Gaps = 7/389 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI-----LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             K++T+LE LE+GLA+ R++I      +GNQ  SD  Y+P G +YWNA +FHRSY+ MEK 
Sbjct  229   KNHTQLERLEAGLAKIRAAIREAAHQKGNQT-SDFDYVPEGPMYWNAQAFHRSYLVMEKQ  287

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLS  651
              K+++YE+G+PP+ H GPC+SIY++EG+FIH ++  + FRT +P+ A+ FFLPFSVT + 
Sbjct  288   FKIFIYEEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPEEAYAFFLPFSVTQMV  347

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + +YV NSHD  P+K+T +DYV  IA KYP+WNR+L ADHFMLSCHDWGP  S  +P L 
Sbjct  348   RFVYVPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSCHDWGPLTSSYVPHLY  407

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
             K  IR LCNANTSE FNP KD S PEINL  G T GLIGGPPP+ RP+L F+AGGLHGP+
Sbjct  408   KNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGLIGGPPPSCRPILAFFAGGLHGPI  467

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             RP+LL+HW+NKDED+K++ YLPK +SY+ MM+KSKYC+CPSGYEVASPR+VEA+Y GCVP
Sbjct  468   RPLLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEVASPRIVEAIYAGCVP  527

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI   YVPPFSDVLNW +F+V +PV +IPNLK+IL  IP  QY+ +QRRG++VRRHFEV
Sbjct  528   VLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSIPTRQYKRMQRRGLKVRRHFEV  587

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             N+PPKRFDV+HMILHS+WLRRLN+R+H L
Sbjct  588   NFPPKRFDVYHMILHSVWLRRLNVRIHDL  616



>ref|XP_007027562.1| Exostosin family protein [Theobroma cacao]
 gb|EOY08064.1| Exostosin family protein [Theobroma cacao]
Length=569

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/380 (65%), Positives = 309/380 (81%), Gaps = 3/380 (1%)
 Frame = +1

Query  319   TKLEILESGLAQARSSI--LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVY  492
             TKL+ LE+GL +AR++I   +   L  D  Y+P G +YW+A +FHRSY+EMEK  K++VY
Sbjct  181   TKLDKLEAGLQRARAAIKEAKNGSLLQDPDYVPIGPMYWDAKAFHRSYLEMEKQFKIFVY  240

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
             ++G+PPV H GPCKSIY++EG+FIH MD  S F+T DP+ AHVF+LPFSV  + + +Y+ 
Sbjct  241   KEGEPPVFHDGPCKSIYSMEGNFIHKMDVDSNFQTKDPEKAHVFYLPFSVAKMVRFVYLR  300

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
             +S D+SP++RT +DYV  IA KYP+WNR+LGADHFML+CHDWGPE S S+P LQK +IRA
Sbjct  301   DSRDFSPIRRTVVDYVNLIAEKYPYWNRSLGADHFMLACHDWGPEASFSLPYLQKNSIRA  360

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSE+FNP KDVSIPEINL  G   GLIGGP  + RP+L F+AGG+HGP+RPILL+
Sbjct  361   LCNANTSEKFNPVKDVSIPEINLLTGKLTGLIGGPSASRRPILAFFAGGVHGPIRPILLE  420

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWE KDEDI++H YLPK V+Y+ MM+ SKYC+CPSGYEVASPR+VEALY GCVPVLI + 
Sbjct  421   HWEGKDEDIRVHKYLPKGVNYYEMMKNSKYCICPSGYEVASPRIVEALYNGCVPVLISKS  480

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YVPPFSDVL W +F+V++ V+DIP LK+ILT I   QY  +QRR ++VRRHF  N PPKR
Sbjct  481   YVPPFSDVLRWKSFSVVVSVDDIPKLKEILTKISSRQYIRMQRRVLQVRRHFAFNSPPKR  540

Query  1390  FDVFHMILHSIWLRRLNIRV  1449
             FDVFHMILHSIWLRRLN+R+
Sbjct  541   FDVFHMILHSIWLRRLNVRI  560



>ref|XP_010242926.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=530

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/390 (63%), Positives = 311/390 (80%), Gaps = 7/390 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI-----LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             K++T+LE LE+GLA+ R++I      +GNQ  SD  Y+P G +YWNA +FHRSY+ MEK 
Sbjct  139   KNHTQLERLEAGLAKIRAAIREAAHQKGNQT-SDFDYVPEGPMYWNAQAFHRSYLVMEKQ  197

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLS  651
              K+++Y++G+PP+ H GPC+SIY++EG+FIH ++  + FRT +P  AH FFLPFSVT + 
Sbjct  198   FKIFIYDEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPKEAHAFFLPFSVTKMV  257

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + +YV NSHD  P+K+T +DYV  IA KYP+WNR+L ADHFMLSCHDWGP  S  +P L 
Sbjct  258   RFVYVPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSCHDWGPLTSSYVPHLY  317

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
             K  IR LCNANTSE FNP KD S PEINL  G T G IGGP P+ RP+L F+AGGLHGP+
Sbjct  318   KNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGFIGGPSPSRRPILXFFAGGLHGPI  377

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             RP+LL+HW+NKDED+K++ YLPK +SY+ MM+KSKYC+CPSGYEVASPR+VEA+Y GCVP
Sbjct  378   RPVLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEVASPRIVEAIYAGCVP  437

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI   YVPPFSDVLNW +F+V +PV +IPNLK+IL  I   QY  +QRRG++VRRHFEV
Sbjct  438   VLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSISTRQYIRMQRRGLKVRRHFEV  497

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVHHLN  1461
             N+PPKRFDV+HMILHS+WLRRLN+R+H L 
Sbjct  498   NFPPKRFDVYHMILHSVWLRRLNVRIHDLQ  527



>ref|XP_010248410.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=646

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/390 (64%), Positives = 316/390 (81%), Gaps = 7/390 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI-----LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             K++++LE +ESGLA+ R++I      +GN+  SD  Y+P G +YWNA +FHRSY+EMEK 
Sbjct  255   KNHSQLERMESGLAKIRAAIREAAHQKGNRT-SDFDYVPEGPMYWNAQAFHRSYLEMEKQ  313

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLS  651
              K+++Y++G+PP+ H GPC+SIY++EG+FIH ++  + FRT +P+ AHVFFLPFSVT + 
Sbjct  314   FKIFIYDEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPEEAHVFFLPFSVTKMV  373

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + +YV NSHD  P+K+T +DYV  IA KYP+WNR+L ADHFMLSCHDWGP  S  +P L 
Sbjct  374   RFVYVPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSCHDWGPLTSSYVPHLY  433

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
             K  IR LCNANTSE FNP KD S PEINL  G T GLIGGPPP+ RP+L F+AGGLHGP+
Sbjct  434   KNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGLIGGPPPSCRPILAFFAGGLHGPI  493

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             RP+LL+HW+NKDED+K++ YLPK +SY+ MM+KSKYC+CPSGYEVASPR+VEA+Y GCVP
Sbjct  494   RPLLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEVASPRIVEAIYAGCVP  553

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI   YVPPFSDVLNW +F+V +PV +IPNLK+IL  I   QY  +QRRG++VRRHFEV
Sbjct  554   VLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSISTRQYIRMQRRGLKVRRHFEV  613

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVHHLN  1461
             N+PPKRFDV+HMILHS+WLRRLN+R+H L 
Sbjct  614   NFPPKRFDVYHMILHSVWLRRLNVRIHDLQ  643



>gb|KEH24081.1| glycosyltransferase [Medicago truncatula]
Length=401

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/384 (65%), Positives = 310/384 (81%), Gaps = 3/384 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI--LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             + ++ L+  E+GL QAR++I   R      D  Y+P+G +Y N +SFHRSY+EMEK  KV
Sbjct  15    RKFSILDRTEAGLLQARAAIRKARNENRTQDIDYVPTGPMYHNPNSFHRSYLEMEKQFKV  74

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMI  660
             +VYE+G+PPV H GPCKSIY++EG+FIHA++ + +FRT DP+ AHVFFLPFSV  + + +
Sbjct  75    FVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDRFRTRDPEKAHVFFLPFSVAKMVQFV  134

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             YV +SHD+SP+++T  DY+  ++ KYPFWNR+LGADHFMLSCHDWGPE S S+P+L K +
Sbjct  135   YVRDSHDFSPIRKTITDYINVVSEKYPFWNRSLGADHFMLSCHDWGPETSKSVPNLYKNS  194

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IRALCNANTSE F P KDVSIPE NL  GT  G++GGP P++R VL F+AGG+HGPVRP+
Sbjct  195   IRALCNANTSEGFKPAKDVSIPETNLQTGTIHGIVGGPSPSKRSVLAFFAGGVHGPVRPV  254

Query  1021  LLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLI  1200
             LL+HWE+KDED+++H YLPK VSY+ M+RKSK+CLCPSGYEVASPR+VEA+Y GCVPVLI
Sbjct  255   LLEHWEHKDEDLQVHKYLPKGVSYYDMLRKSKFCLCPSGYEVASPRVVEAIYTGCVPVLI  314

Query  1201  KRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWP  1380
                YVPPFSDVLNW +F+V + V DIPNLKKILT I   QY  +QRR  +VRRHFEV+ P
Sbjct  315   SDHYVPPFSDVLNWKSFSVEVSVNDIPNLKKILTSISPRQYIRMQRRVGQVRRHFEVHSP  374

Query  1381  PKRFDVFHMILHSIWLRRLNIRVH  1452
             P RFDVFHMILHSIWLRRLN R+H
Sbjct  375   PTRFDVFHMILHSIWLRRLNFRLH  398



>ref|XP_006339262.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=456

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/430 (59%), Positives = 324/430 (75%), Gaps = 9/430 (2%)
 Frame = +1

Query  187   KLLWLFMVPFVLLSAFLVFRAPNKSWVFTFPYLKTLA----VYGAKSYTKLEILESGLAQ  354
             K+LWL  +P +L+S +   ++ + S+V+     + ++        K  + LE +E+GL +
Sbjct  23    KVLWLIAIPLILVSLYFGLKS-STSYVYAKNDHENISPPIVQLEKKLISNLEKVEAGLVR  81

Query  355   ARSSILRG---NQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYG  525
              R +I      NQ   D  Y+P+G IYWN ++FHRSY+EMEK  K+YVYE+G+PPV HY 
Sbjct  82    VRVAIKEAQSKNQTFDDPEYVPTGPIYWNPTAFHRSYMEMEKHFKIYVYEEGEPPVFHYS  141

Query  526   PCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTA  705
               + I  IEG  IH ++ S+FRT DP+ AHV+FLPFSV  +   +YV NS  W PM+ TA
Sbjct  142   ASEGILGIEGILIHHIEISKFRTNDPEKAHVYFLPFSVLSIVSYVYVVNSRSWGPMQNTA  201

Query  706   LDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNP  885
              DY+  I+RKYP+WNR+LGADHFML+CHDW P IS ++P L K +IR LCNANTSERF+P
Sbjct  202   ADYIDGISRKYPYWNRSLGADHFMLACHDWAPTISFAVPYLYKNSIRVLCNANTSERFDP  261

Query  886   KKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHW-ENKDEDIKI  1062
              KDVS+PEI LP G  DGLIGGP P+ R VLVFYAGG+HG +R +L++ W +N D D++I
Sbjct  262   TKDVSLPEIYLPQGKMDGLIGGPSPSHRSVLVFYAGGIHGYIRQVLMELWGKNDDSDVQI  321

Query  1063  HSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNW  1242
             H YLPKN+SY+GM+RKSK+C+CPSGYEVASPRMVEALYMGCVPVL+K  YV PF+DVLNW
Sbjct  322   HEYLPKNMSYYGMIRKSKFCICPSGYEVASPRMVEALYMGCVPVLLKDHYVAPFNDVLNW  381

Query  1243  SAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSI  1422
              +FAV +   DIPNLKKIL  I QTQY  +Q+RG++VRRHFEVN+PP+R+DVFHMILHSI
Sbjct  382   KSFAVQMNSTDIPNLKKILMSISQTQYIRMQKRGLQVRRHFEVNFPPRRYDVFHMILHSI  441

Query  1423  WLRRLNIRVH  1452
             WLRRLNI+VH
Sbjct  442   WLRRLNIQVH  451



>ref|XP_007162830.1| hypothetical protein PHAVU_001G184500g [Phaseolus vulgaris]
 gb|ESW34824.1| hypothetical protein PHAVU_001G184500g [Phaseolus vulgaris]
Length=537

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/386 (64%), Positives = 311/386 (81%), Gaps = 5/386 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILR---GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             + ++ L+  E+GL +AR++I     GNQ   D  Y+P G +Y NA +FHRS++EMEK LK
Sbjct  146   RKFSILDRTEAGLVKARAAIREARNGNQTQ-DADYVPIGPMYMNAKAFHRSFLEMEKQLK  204

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSKM  657
             VYVYE+G+ PV H GPCKSIY++EG+FIH ++ ++ FRT DP+ AHVFFLPFSV +L + 
Sbjct  205   VYVYEEGEAPVFHNGPCKSIYSMEGNFIHGIEMNEKFRTRDPEKAHVFFLPFSVAMLVQF  264

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +YV +SHD+ P+K+T  DYV  IA +YP+WNR+LGADHF ++CHDWGPE S S+P+LQ  
Sbjct  265   VYVRDSHDFGPIKKTVTDYVNVIAGRYPYWNRSLGADHFYIACHDWGPETSRSVPNLQDN  324

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE F P KDVS+PEINL  G+ +GLIGGP  ++RP+L F+AGGLHGP+RP
Sbjct  325   SIRVLCNANTSEGFKPSKDVSLPEINLQSGSINGLIGGPSASKRPLLAFFAGGLHGPIRP  384

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             ILL+HWENK ED+++H YLPK VSY+ M+RKS++CLCPSGYEVASPR+VEA+Y GCVPVL
Sbjct  385   ILLEHWENKQEDMQVHRYLPKGVSYYEMLRKSRFCLCPSGYEVASPRVVEAIYTGCVPVL  444

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPFSDVLNW +F+V + VEDIP LK IL  I  TQY  +QRR V+VRRHFEV+ 
Sbjct  445   ISDHYVPPFSDVLNWKSFSVEVSVEDIPKLKDILLSISPTQYIRMQRRVVQVRRHFEVHS  504

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVHH  1455
             PPKRFDVFHMILHS+WLRRLN +VHH
Sbjct  505   PPKRFDVFHMILHSVWLRRLNFKVHH  530



>ref|XP_004497579.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=518

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/393 (63%), Positives = 307/393 (78%), Gaps = 2/393 (1%)
 Frame = +1

Query  280   YLKTLAVYGAKSYTKLEILESGLAQARSSILRG-NQLHSDEHYIPSGSIYWNASSFHRSY  456
             Y+    +   + ++ L+  E+GL QAR++I    NQ   D  Y+P G +YWNA +FHRSY
Sbjct  123   YVAHQKMKQQRKFSILDRTEAGLLQARAAIREATNQTLQDPDYVPIGPMYWNAKAFHRSY  182

Query  457   VEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPF  633
             +EMEK  KV+VYE+G+PPV H GPCKSIY++EG+FIHA++ + QFRT DPD A VFFLPF
Sbjct  183   LEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPDKAQVFFLPF  242

Query  634   SVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISG  813
             SV +L + +Y+ +S D+ P+++T  DY+  IA KYP+WNR+LGADHFML+CHDWGPE S 
Sbjct  243   SVVMLVRFVYLRDSRDFGPIRKTVNDYINVIAGKYPYWNRSLGADHFMLACHDWGPETSF  302

Query  814   SIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAG  993
             S+P L K +IR LCNANTSE+FNP KDVS PEINL  G+ +G IGGP  ++RP+L F+AG
Sbjct  303   SVPYLHKNSIRVLCNANTSEKFNPSKDVSFPEINLQTGSINGFIGGPSASKRPILAFFAG  362

Query  994   GLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEAL  1173
             GLHG +R ILL HWENKD+DI +  YLPK VSY+ M+RKSK+CLCPSGYEVASPR+VEA+
Sbjct  363   GLHGYIRSILLDHWENKDQDIMVQKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRVVEAI  422

Query  1174  YMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEV  1353
             Y GCVPVLI   YV PFSDVLNW +F+V + VEDIPNLK IL  I  TQY  +QRR  ++
Sbjct  423   YTGCVPVLISEHYVLPFSDVLNWKSFSVEVKVEDIPNLKDILMRISTTQYIRMQRRVGQI  482

Query  1354  RRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             RRHFEV+ PPKRFDVFHMILHS+WLRRLN RVH
Sbjct  483   RRHFEVHSPPKRFDVFHMILHSVWLRRLNFRVH  515



>ref|XP_008359607.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=539

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/360 (67%), Positives = 297/360 (83%), Gaps = 2/360 (1%)
 Frame = +1

Query  376   GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEG  555
             GNQ H D  YIP+G +YWNA++FH SY+EME+  KV+VY +G+PP+ H GPCKSIY++EG
Sbjct  178   GNQTH-DVDYIPNGPMYWNANAFHSSYLEMEEKFKVFVYAEGEPPLFHNGPCKSIYSMEG  236

Query  556   HFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIAR  732
             +FIH ++ + QFRT DP+ AHV+FLPFSVT+L + +YV +SHD+SP+++T  DYV  ++ 
Sbjct  237   NFIHQIEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHDFSPIRQTVRDYVNIVSE  296

Query  733   KYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEI  912
             KYP+WNR+LGADHFML+CHDWGPE S S P L+K +IRALCNANTSE FNP KDVS PEI
Sbjct  297   KYPYWNRSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFNPSKDVSFPEI  356

Query  913   NLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSY  1092
             NL  G T G +GGP P  R  L F+AGG+HGP+RPILL+HWENKD D+++H YLPK VSY
Sbjct  357   NLQTGDTHGFLGGPSPRLRSNLAFFAGGVHGPIRPILLEHWENKDPDMRVHQYLPKGVSY  416

Query  1093  HGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVE  1272
             + MMR+S++CLCPSGYEVASPR+VEA+Y GCVPVLI   YVPPFSD+LNW +F+V + V 
Sbjct  417   YNMMRQSRFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDILNWKSFSVEVSVS  476

Query  1273  DIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             DIPNLKKILT I   QY  +QRR ++VR+HFEVN PPKRFDVFHMILHSIWLRRLN+RVH
Sbjct  477   DIPNLKKILTSISSRQYVRMQRRVLQVRKHFEVNSPPKRFDVFHMILHSIWLRRLNVRVH  536



>ref|XP_011018855.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
 ref|XP_011018857.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
 ref|XP_011018858.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
Length=513

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/385 (63%), Positives = 307/385 (80%), Gaps = 3/385 (1%)
 Frame = +1

Query  316   YTKLEILESGLAQARSSI--LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYV  489
             +T LE LE+GL +AR ++   +  +   D  Y+P+G +YWNA  FHRSY+EME+  KV+V
Sbjct  121   HTSLEKLEAGLQKARVALKEAKNGKQADDPDYVPAGPMYWNAKVFHRSYLEMEEQFKVFV  180

Query  490   YEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMIYV  666
             YE+G+PP+ H GPC+SIY++EG+FIH M+ +  FRT DPD AHV+FLPFSV ++ + +Y 
Sbjct  181   YEEGEPPLFHNGPCRSIYSMEGNFIHMMEINGHFRTKDPDKAHVYFLPFSVAMMVRFVYE  240

Query  667   ANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIR  846
               S D+ P++RT  DY+  I+RKY FWNR+LGADHFML+CHDWGPE S S+P L K +IR
Sbjct  241   RQSRDFGPIRRTVSDYINLISRKYSFWNRSLGADHFMLACHDWGPEASFSVPHLGKISIR  300

Query  847   ALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILL  1026
             ALCNANTSE+FNP KDVS+PEINL  G+  G +GG  P++R +L F+AG LHGP+RP++L
Sbjct  301   ALCNANTSEKFNPVKDVSLPEINLLTGSIKGFVGGLSPSKRLILAFFAGRLHGPIRPVVL  360

Query  1027  QHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKR  1206
             +HWENKD+DIK+H  LPK VSY+ MMR SK+CLCPSGYEVASPR+VEALY GCVPVLI  
Sbjct  361   EHWENKDDDIKVHQQLPKGVSYYEMMRGSKFCLCPSGYEVASPRIVEALYAGCVPVLISD  420

Query  1207  GYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPK  1386
              YVPPFSDVLNW +F+V +PV DIP+LKKILT I   QY  +QRR ++VRRHFEVN+PPK
Sbjct  421   HYVPPFSDVLNWKSFSVEVPVSDIPSLKKILTSISPRQYIRMQRRVLQVRRHFEVNYPPK  480

Query  1387  RFDVFHMILHSIWLRRLNIRVHHLN  1461
             RFDVFHMILHSIWLRRLNI +H + 
Sbjct  481   RFDVFHMILHSIWLRRLNIGIHDVQ  505



>ref|XP_004249828.2| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=431

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/385 (63%), Positives = 303/385 (79%), Gaps = 4/385 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRG---NQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             K  + LE +E+GL + R +I      NQ   D  Y+P+G IYWN ++FHRSY+EMEK  K
Sbjct  42    KFISNLEKVEAGLVRVRVAIKEAQSKNQTLDDPEYVPTGPIYWNPTAFHRSYMEMEKHFK  101

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             ++VYE+G+PPV HY   + I  IEG  IH ++ S+FRT DP+ AHV+FLPFSV  +   +
Sbjct  102   IFVYEEGEPPVFHYSASEGILGIEGILIHQIEISKFRTNDPEKAHVYFLPFSVLSIVSYV  161

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             YV +S  W PM+ TA DY+ SI+RKYP+WNR+LG+DHFML+CHDW P IS ++P L K +
Sbjct  162   YVVDSRSWGPMQNTAADYIDSISRKYPYWNRSLGSDHFMLACHDWAPTISFAVPYLYKNS  221

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNANTSERF+P KDVS+PEI LP G  DGLIGGP P+ R VLVFYAGG+HG +R +
Sbjct  222   IRVLCNANTSERFDPTKDVSLPEIYLPQGKMDGLIGGPSPSHRSVLVFYAGGIHGYIRQV  281

Query  1021  LLQHW-ENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             L++HW +N D D++IH YLPKN+SY+GM+RKSK+C+CPSGYEVASPRMVEALYMGCVPVL
Sbjct  282   LMEHWGKNDDLDVQIHEYLPKNMSYYGMIRKSKFCICPSGYEVASPRMVEALYMGCVPVL  341

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             +K  YV PFSDVLNW +F+V +   DIPNLKKIL  I QTQY  +Q+RG++VRRHFEVN+
Sbjct  342   LKDHYVAPFSDVLNWKSFSVQMNSRDIPNLKKILMSISQTQYIRMQKRGLQVRRHFEVNF  401

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVH  1452
             PPKR+DVFHMILHSIW RRLNI+VH
Sbjct  402   PPKRYDVFHMILHSIWFRRLNIQVH  426



>ref|XP_003553575.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=537

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/385 (64%), Positives = 308/385 (80%), Gaps = 5/385 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILR---GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             + ++ L+  E+GL QAR++I     GNQ   D  Y+P G +Y NA++FHRSY+EMEK  K
Sbjct  151   RKFSILDRTEAGLRQARAAIREARNGNQTQ-DIDYVPVGPMYNNANAFHRSYLEMEKQFK  209

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKM  657
             V+VYE+G+PPV H GPCKSIY++EG+FIHA++ + QFRT DP+ AHVFFLPFSV +L + 
Sbjct  210   VFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPEEAHVFFLPFSVAMLVQF  269

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +YV +SHD+ P+K+T  DYV  I  +YP+WNR+LGADHF L+CHDWGPE S SIP+L K 
Sbjct  270   VYVRDSHDFGPIKKTVTDYVNVIGGRYPYWNRSLGADHFYLACHDWGPETSRSIPNLNKN  329

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE F P KDVS PEINL  G+ +G IGGP  + RP+L F+AGGLHGP+RP
Sbjct  330   SIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASRRPLLAFFAGGLHGPIRP  389

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             +LL+HWENKDEDI++H YLPK VSY+ M+RKSK+CLCPSGYEVASPR+VEA+Y GCVPVL
Sbjct  390   VLLEHWENKDEDIQVHKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRVVEAIYTGCVPVL  449

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPF+DVLNW +F+V + V+DIP LK+IL  I   QY  +QRR  +VRRHFEV+ 
Sbjct  450   ISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRQYIRMQRRVGQVRRHFEVHS  509

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVH  1452
             PPKR+DVFHMILHS+WLRRLN RVH
Sbjct  510   PPKRYDVFHMILHSVWLRRLNFRVH  534



>gb|KHN02275.1| Putative glycosyltransferase [Glycine soja]
Length=537

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/385 (64%), Positives = 308/385 (80%), Gaps = 5/385 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILR---GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             + ++ L+  E+GL QAR++I     GNQ   D  Y+P G +Y NA++FHRSY+EMEK  K
Sbjct  151   RKFSILDRTEAGLRQARAAIREARNGNQTQ-DIDYVPVGPMYNNANAFHRSYLEMEKQFK  209

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKM  657
             V+VYE+G+PPV H GPCKSIY++EG+F+HA++ + QFRT DP+ AHVFFLPFSV +L + 
Sbjct  210   VFVYEEGEPPVFHNGPCKSIYSMEGNFVHAIEMNDQFRTRDPEEAHVFFLPFSVAMLVQF  269

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +YV +SHD+ P+K+T  DYV  I  +YP+WNR+LGADHF L+CHDWGPE S SIP+L K 
Sbjct  270   VYVRDSHDFGPIKKTVTDYVNVIGGRYPYWNRSLGADHFYLACHDWGPETSRSIPNLNKN  329

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE F P KDVS PEINL  G+ +G IGGP  + RP+L F+AGGLHGP+RP
Sbjct  330   SIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASRRPLLAFFAGGLHGPIRP  389

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             +LL+HWENKDEDI++H YLPK VSY+ M+RKSK+CLCPSGYEVASPR+VEA+Y GCVPVL
Sbjct  390   VLLEHWENKDEDIQVHKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRVVEAIYTGCVPVL  449

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPF+DVLNW +F+V + V+DIP LK+IL  I   QY  +QRR  +VRRHFEV+ 
Sbjct  450   ISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRQYIRMQRRVGQVRRHFEVHS  509

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVH  1452
             PPKR+DVFHMILHS+WLRRLN RVH
Sbjct  510   PPKRYDVFHMILHSVWLRRLNFRVH  534



>ref|XP_008392545.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=542

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/360 (67%), Positives = 296/360 (82%), Gaps = 2/360 (1%)
 Frame = +1

Query  376   GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEG  555
             GNQ   D  YIP+G +YWNA++FHRSY+EME+  KV+VY +G+PP+ H GPCKSIY++EG
Sbjct  181   GNQTR-DVDYIPNGPMYWNANAFHRSYLEMEEXFKVFVYGEGEPPLFHNGPCKSIYSMEG  239

Query  556   HFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIAR  732
             +FIH ++ + QFRT DP+ AHV+FLPFSVT+L + +YV +SHD+ P++RT  DYV  ++ 
Sbjct  240   NFIHEIEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHDFGPIRRTVRDYVNIVSE  299

Query  733   KYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEI  912
             KYP+WNR+LGADHFML+CHDWGPE S S P L+K +IRALCNANTSE FNP KDVS PEI
Sbjct  300   KYPYWNRSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFNPSKDVSFPEI  359

Query  913   NLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSY  1092
             NL  G T G IGGP P  R +L F+AGG+HGP+RPILL+HWENKD D+++H YLPK VSY
Sbjct  360   NLQTGDTHGFIGGPSPRLRSILGFFAGGVHGPIRPILLEHWENKDPDLRVHQYLPKGVSY  419

Query  1093  HGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVE  1272
             + MMR+S++CLCPSGYEVASPR+VEA+Y GC+PVLI   YVPPFSDVLNW +F++ +   
Sbjct  420   YDMMRQSRFCLCPSGYEVASPRVVEAIYTGCIPVLISDHYVPPFSDVLNWRSFSIEVSAS  479

Query  1273  DIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             DIPNLKKILT I   QY  +QRR ++VRRHFEVN PPKRFDVFHMILHSIWLRRLN+RVH
Sbjct  480   DIPNLKKILTSISSRQYLRMQRRVLQVRRHFEVNSPPKRFDVFHMILHSIWLRRLNVRVH  539



>ref|XP_004303053.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=549

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/385 (64%), Positives = 307/385 (80%), Gaps = 5/385 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRG---NQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             K YT L  LE  L +AR +I      N+ H D  YIP+G +YWNA++F RSY+EMEK  K
Sbjct  163   KEYTHLGRLEGRLRRARVAIREAKFANKTH-DADYIPNGPMYWNANAFQRSYLEMEKRFK  221

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKM  657
             V+VYE+G+PP+ H GPCKSIY++EG+FIH ++ + QFRT +P+ AHV+FLP+SVT+L + 
Sbjct  222   VFVYEEGEPPLFHNGPCKSIYSMEGNFIHEIEVNKQFRTRNPEEAHVYFLPYSVTMLVRF  281

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +YV +SHD+SP+++T  DYV  I+ KYP+WNR+L ADHF ++CHDWGPE S S P L+K 
Sbjct  282   VYVRDSHDFSPIRQTVRDYVNIISTKYPYWNRSLAADHFTVACHDWGPETSNSDPYLRKN  341

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE FNP KDVS PE+NL  G T G +GGP P  R +L F+AGG+HGP+RP
Sbjct  342   SIRGLCNANTSEGFNPSKDVSFPEVNLQTGDTHGFLGGPSPRLRSILAFFAGGVHGPIRP  401

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             ILL+HWENKD+D+++H YLPK VSY+ MM+KSK+CLCPSGYEVASPR+VEA+Y GCVPVL
Sbjct  402   ILLEHWENKDKDMRVHQYLPKGVSYYDMMKKSKFCLCPSGYEVASPRVVEAIYTGCVPVL  461

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPFSDVLNW +F+V + V DIPNLK ILT I   QY  +Q+R ++VR+HFEVN 
Sbjct  462   ISDHYVPPFSDVLNWKSFSVEVSVSDIPNLKNILTSISTRQYLRMQKRVIQVRKHFEVNS  521

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVH  1452
             PPKRFDVFHMILHSIWLRRLN+RVH
Sbjct  522   PPKRFDVFHMILHSIWLRRLNVRVH  546



>gb|KHG04052.1| hypothetical protein F383_28592 [Gossypium arboreum]
Length=541

 Score =   531 bits (1368),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 241/385 (63%), Positives = 307/385 (80%), Gaps = 3/385 (1%)
 Frame = +1

Query  319   TKLEILESGLAQARSSI--LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVY  492
             TKL+ LE+ L +AR++I   + +    D  Y+P G +YW+A +FHRSY+EMEK  KV+VY
Sbjct  153   TKLDKLEARLQRARAAIKDAKNSSQLLDPEYVPIGPMYWDAKAFHRSYMEMEKQFKVFVY  212

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
             ++G+PPV H GPCKSIY++EG+FI+ MD  ++FRT DP+ AH F+LPFSV  + + +Y+ 
Sbjct  213   KEGEPPVFHDGPCKSIYSMEGNFIYQMDVNTKFRTNDPEKAHAFYLPFSVAKMVQFVYLR  272

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
             +S D+ P++RT +DYV  ++ KYP+WNR+LGADHFML+CHDWGPE S S P L K +IRA
Sbjct  273   DSRDFGPIRRTVIDYVNVVSEKYPYWNRSLGADHFMLACHDWGPEASFSNPYLGKNSIRA  332

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSE+FNP KDVSIPE+NL  G   GLIGGP  + RP+L F+AGG+HGP+RPILL+
Sbjct  333   LCNANTSEKFNPVKDVSIPEMNLRTGKLTGLIGGPSASRRPILAFFAGGVHGPIRPILLE  392

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWE KD++IK+H YLPK ++Y+ MMR SKYCLCPSGYEVASPR+VEALY GCVPVLI + 
Sbjct  393   HWEGKDDEIKVHKYLPKGINYYEMMRSSKYCLCPSGYEVASPRIVEALYNGCVPVLISKS  452

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YVPPFSDVL W +F+V++ VEDIP LK+IL  I   QY  +QRR ++VRRHFE + PPKR
Sbjct  453   YVPPFSDVLRWKSFSVVVSVEDIPRLKEILMKISSRQYIRMQRRVLQVRRHFEFHSPPKR  512

Query  1390  FDVFHMILHSIWLRRLNIRVHHLNN  1464
             FDVFHMILHSIWLRRLN+RV   N+
Sbjct  513   FDVFHMILHSIWLRRLNVRVSDGND  537



>ref|XP_006381337.1| hypothetical protein POPTR_0006s11930g [Populus trichocarpa]
 gb|ERP59134.1| hypothetical protein POPTR_0006s11930g [Populus trichocarpa]
Length=510

 Score =   530 bits (1364),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 302/382 (79%), Gaps = 3/382 (1%)
 Frame = +1

Query  316   YTKLEILESGLAQARSSI--LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYV  489
             +T LE LE+GL +AR ++   +  +   D  Y P+G +YWNA  FHRSY+EMEK  KV+V
Sbjct  121   HTSLEKLEAGLQKARVALKEAKNGKQADDPDYAPAGPMYWNAEVFHRSYLEMEKQFKVFV  180

Query  490   YEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYV  666
             Y +G+PPV H GPC+SIY++EG+FIH M+    FRT DPD AHV+FLPFSV ++ + +Y 
Sbjct  181   YGEGEPPVFHNGPCRSIYSMEGNFIHRMEIDGHFRTKDPDKAHVYFLPFSVAMMVRFVYE  240

Query  667   ANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIR  846
               S D+ P++RT  DY+  I+ KYPFWNR+LGADHFML+CHDWGPE S S+P L K +IR
Sbjct  241   RESRDFGPIRRTVSDYINLISGKYPFWNRSLGADHFMLACHDWGPEASFSVPHLGKISIR  300

Query  847   ALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILL  1026
             ALCNANTSE+FNP KDVS+PEINL  G+  G +GG  P++R +L F+AG LHGP+RP++L
Sbjct  301   ALCNANTSEKFNPIKDVSLPEINLRTGSIKGFVGGLSPSKRSILAFFAGRLHGPIRPVVL  360

Query  1027  QHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKR  1206
             +HWENKD+DIK+H  LPK VSY+ MMR SK+CLCPSGYEVASPR+VEALY GCVPVLI  
Sbjct  361   EHWENKDDDIKVHQQLPKGVSYYEMMRGSKFCLCPSGYEVASPRIVEALYAGCVPVLISD  420

Query  1207  GYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPK  1386
              YVPPFSDVLNW +F+V +PV DIP+LKKILT I   QY  +QRR ++VRRHFEVN PPK
Sbjct  421   HYVPPFSDVLNWKSFSVEVPVSDIPSLKKILTSISPRQYIRMQRRVLQVRRHFEVNSPPK  480

Query  1387  RFDVFHMILHSIWLRRLNIRVH  1452
             RFDVFHMILHSIWLRRLN+ +H
Sbjct  481   RFDVFHMILHSIWLRRLNVGIH  502



>ref|XP_009340969.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=542

 Score =   531 bits (1367),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 239/360 (66%), Positives = 296/360 (82%), Gaps = 2/360 (1%)
 Frame = +1

Query  376   GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEG  555
             GNQ   D  YIP+G +YWNA++FHRSY+EME+  KV+VY +G+PP+ H GPCKSIY++EG
Sbjct  181   GNQTR-DVDYIPNGPMYWNANAFHRSYLEMEEKFKVFVYAEGEPPLFHNGPCKSIYSMEG  239

Query  556   HFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIAR  732
             +FIH ++ + QFRT DP+ AHV+FLPFSVT+L + +YV +SHD+SP+++T  DYV  ++ 
Sbjct  240   NFIHEIEVNKQFRTQDPEKAHVYFLPFSVTMLVRFVYVRDSHDFSPIRQTVRDYVNIVSE  299

Query  733   KYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEI  912
             KYP+WNR+LGADHFML+CHDWGPE S S P L+K +IRALCNANTSE FNP +DVS PEI
Sbjct  300   KYPYWNRSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFNPSRDVSFPEI  359

Query  913   NLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSY  1092
             NL  G T G +GGP P  R  L F+AGG+HGP+RPILL+HWENKD D+++H YLPK  SY
Sbjct  360   NLQTGDTHGFLGGPSPRLRSNLAFFAGGVHGPIRPILLEHWENKDPDMRVHQYLPKGASY  419

Query  1093  HGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVE  1272
             + MMR+S++CLCPSGYEVASPR+VEA+Y GCVPVLI   YVPPFSD+LNW +F+V + V 
Sbjct  420   YDMMRQSRFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDILNWKSFSVEVSVS  479

Query  1273  DIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             DIPNLKKILT I   QY  +QRR ++VR+HFEVN PPKRFDVFHMILHSIWLRRLN+RVH
Sbjct  480   DIPNLKKILTRISSRQYVRMQRRVLQVRKHFEVNSPPKRFDVFHMILHSIWLRRLNVRVH  539



>ref|XP_009375632.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=543

 Score =   530 bits (1365),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 240/360 (67%), Positives = 297/360 (83%), Gaps = 2/360 (1%)
 Frame = +1

Query  376   GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEG  555
             GNQ    + YIP+G +YWNA++FHRSY+EME+  KV+VY +G+PP+ H GPCKSIY++EG
Sbjct  182   GNQTRGVD-YIPNGPMYWNANAFHRSYLEMEEKFKVFVYGEGEPPLFHNGPCKSIYSMEG  240

Query  556   HFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIAR  732
             +FIH ++ + QFRT DP+ AHV+FLPFSVT+L + +YV +SHD+ P++RT  DYV  ++ 
Sbjct  241   NFIHEIEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHDFGPIRRTVRDYVNIVSE  300

Query  733   KYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEI  912
             KYP+WNR+LGADHFML+CHDWGPE S S P L+K +IRALCNANTSE F P KDVS PEI
Sbjct  301   KYPYWNRSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFKPSKDVSFPEI  360

Query  913   NLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSY  1092
             NL  G T G IGGP P  R +L F+AGG+HGP+RPILL+HWENKD D+++H YLPK VSY
Sbjct  361   NLQTGDTHGFIGGPSPRLRSILGFFAGGVHGPIRPILLEHWENKDPDLRVHQYLPKGVSY  420

Query  1093  HGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVE  1272
             + MMR+S++CLCPSGYEVASPR+VEA+Y GCVPVLI   YVPPFSDVLNW++F++ + V 
Sbjct  421   YDMMRQSRFCLCPSGYEVASPRVVEAIYAGCVPVLISDHYVPPFSDVLNWNSFSIEVSVS  480

Query  1273  DIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             DIPNLKKILT I   +Y  +QRR ++VRRHFEVN PPKRFDVFHMILHSIWLRRLN+RVH
Sbjct  481   DIPNLKKILTSISSRRYLRMQRRMLQVRRHFEVNSPPKRFDVFHMILHSIWLRRLNVRVH  540



>ref|XP_003521429.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=534

 Score =   530 bits (1364),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 249/389 (64%), Positives = 309/389 (79%), Gaps = 8/389 (2%)
 Frame = +1

Query  310   KSYTKLEIL---ESGLAQARSSI---LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K   KL IL   E+GL QAR++I     GNQ   D+ Y+P G +Y NA++FHRSY+EMEK
Sbjct  145   KLQRKLSILDRTEAGLIQARAAISEARNGNQTQ-DKDYVPVGPMYNNANAFHRSYLEMEK  203

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVL  648
               KV+VYE+G+PPV H GPCKSIY++EG+FIHA++ + QFRT DP+ AHVFFLPFSV +L
Sbjct  204   QFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPEKAHVFFLPFSVAML  263

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +YV +SHD+ P+K+T  DYV  IA +YP+WNR+LGADHF L+CHDWGPE S SIP+L
Sbjct  264   VQFVYVRDSHDFGPIKKTVTDYVNVIAGRYPYWNRSLGADHFYLACHDWGPETSRSIPNL  323

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
              + +IR LCNANTSE F P KDVS PEINL  G+ +G IGGP  + RP+L F+AGGLHGP
Sbjct  324   NENSIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASGRPLLAFFAGGLHGP  383

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +RP+LL+HWEN+DEDI++H YLPK VSY+ M+RKS++CLCPSGYEVASPR+VEA+Y GCV
Sbjct  384   IRPVLLEHWENRDEDIQVHKYLPKGVSYYEMLRKSRFCLCPSGYEVASPRVVEAIYTGCV  443

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPF+DVLNW +F+V + V+DIP LK+IL  I    Y  +QRR   VRRHFE
Sbjct  444   PVLISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRHYIRMQRRVGLVRRHFE  503

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVHH  1455
             V+ PPKR+DVFHMILHS+WLRRLN RVHH
Sbjct  504   VHSPPKRYDVFHMILHSVWLRRLNFRVHH  532



>gb|KHN18714.1| Putative glycosyltransferase [Glycine soja]
Length=546

 Score =   530 bits (1365),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 249/389 (64%), Positives = 309/389 (79%), Gaps = 8/389 (2%)
 Frame = +1

Query  310   KSYTKLEIL---ESGLAQARSSI---LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K   KL IL   E+GL QAR++I     GNQ   D+ Y+P G +Y NA++FHRSY+EMEK
Sbjct  157   KLQRKLSILDRTEAGLIQARAAISEARNGNQTQ-DKDYVPVGPMYNNANAFHRSYLEMEK  215

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVL  648
               KV+VYE+G+PPV H GPCKSIY++EG+FIHA++ + QFRT DP+ AHVFFLPFSV +L
Sbjct  216   QFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPEKAHVFFLPFSVAML  275

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +YV +SHD+ P+K+T  DYV  IA +YP+WNR+LGADHF L+CHDWGPE S SIP+L
Sbjct  276   VQFVYVRDSHDFGPIKKTVTDYVNVIAGRYPYWNRSLGADHFYLACHDWGPETSRSIPNL  335

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
              + +IR LCNANTSE F P KDVS PEINL  G+ +G IGGP  + RP+L F+AGGLHGP
Sbjct  336   NENSIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASGRPLLAFFAGGLHGP  395

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +RP+LL+HWEN+DEDI++H YLPK VSY+ M+RKS++CLCPSGYEVASPR+VEA+Y GCV
Sbjct  396   IRPVLLEHWENRDEDIQVHKYLPKGVSYYEMLRKSRFCLCPSGYEVASPRVVEAIYTGCV  455

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPF+DVLNW +F+V + V+DIP LK+IL  I    Y  +QRR   VRRHFE
Sbjct  456   PVLISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRHYIRMQRRVGLVRRHFE  515

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVHH  1455
             V+ PPKR+DVFHMILHS+WLRRLN RVHH
Sbjct  516   VHSPPKRYDVFHMILHSVWLRRLNFRVHH  544



>ref|XP_010039041.1| PREDICTED: probable glycosyltransferase At5g03795 [Eucalyptus 
grandis]
Length=562

 Score =   530 bits (1365),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 250/410 (61%), Positives = 311/410 (76%), Gaps = 5/410 (1%)
 Frame = +1

Query  226   SAFLVFRAPNKSWVFTFPYLKTLAVYGAKSYTKLEILESGLAQARSSILR---GNQLHSD  396
             S F V  A N    F   Y      +  +  T LE LE+GL +ARS I     GN +  D
Sbjct  148   SDFSVNVARNNVPAFNESYGFVEKAWQKRVDTDLERLEAGLRRARSGIREAKTGNPME-D  206

Query  397   EHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD  576
               Y+P G +Y NA++FHRSY+EMEK  K++VY++G PPV H GPCKSIYA EG+FIH ++
Sbjct  207   PDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPVFHNGPCKSIYAKEGNFIHMVE  266

Query  577   FSQ-FRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNR  753
              ++ FRT DP  AHVFFLPFSV ++ + +YV +SHD+ P+KRT +DY+  +A KYP+WNR
Sbjct  267   INKRFRTGDPRKAHVFFLPFSVAMMVQFVYVRDSHDFGPIKRTVIDYIDVVASKYPYWNR  326

Query  754   TLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTT  933
             +LGADHFML+CHDWGPE S ++P LQ+ +IR LCNANTSE F+P KDVS PE+NL  G  
Sbjct  327   SLGADHFMLACHDWGPEASFAVPHLQRNSIRVLCNANTSEGFDPSKDVSFPEVNLHTGAI  386

Query  934   DGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKS  1113
              GLIGGP P+ R +L F+AGGLHGP+RPILLQHWENKDED+K+H YLP+ VSY+ MMR+S
Sbjct  387   SGLIGGPSPSHRSILAFFAGGLHGPIRPILLQHWENKDEDVKVHRYLPRGVSYYDMMRRS  446

Query  1114  KYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKK  1293
             K+C+CPSGYEVASPR+VEA+Y GCVPVLI   YVPPFSDVLNW +F+V + V +IPNLK 
Sbjct  447   KFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWRSFSVEVTVREIPNLKT  506

Query  1294  ILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNI  1443
             IL  I   QY  +QRR  +VRRHFEV+ PPKR+DVFHMILHS+WLRRLN+
Sbjct  507   ILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMILHSVWLRRLNV  556



>ref|XP_010543482.1| PREDICTED: probable glycosyltransferase At5g03795 [Tarenaya hassleriana]
Length=489

 Score =   527 bits (1357),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 238/384 (62%), Positives = 307/384 (80%), Gaps = 5/384 (1%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSD---EHYIPSGSIYWNASSFHRSYVEMEKTLKVYV  489
             + +E +E+ L +AR++I +G     D     Y+P G +YWNA  FHRSY+EMEK  K++V
Sbjct  107   SNMEKIEAELQRARAAI-KGASFEDDMDDPDYVPLGPMYWNAKVFHRSYLEMEKQFKIFV  165

Query  490   YEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYV  666
             Y++G+PP+ H GPCKSIY++EG+FI+ M+  ++FRTTDPD AH F+LP SV  + + +Y 
Sbjct  166   YKEGEPPLFHDGPCKSIYSMEGNFIYQMETDTRFRTTDPDRAHAFYLPLSVVKMVRYVYE  225

Query  667   ANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIR  846
              +SHD+SP+++T  DY+  +  KYP+WNR++GADHF+LSCHDWGPE S S P L + +IR
Sbjct  226   RDSHDFSPIRKTVRDYIDLVDGKYPYWNRSIGADHFILSCHDWGPEASFSHPQLGENSIR  285

Query  847   ALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILL  1026
             ALCNANTSERF P+KDVSIPEINL  GT  GL+GGP P+ RP+L F+AGG+HGPVRPILL
Sbjct  286   ALCNANTSERFKPRKDVSIPEINLRTGTLTGLVGGPSPSRRPILAFFAGGVHGPVRPILL  345

Query  1027  QHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKR  1206
             +HWEN+DED+++H YLPK  SY  MMR SK+C+CPSGYEVASPR+VEALY GCVPVLI  
Sbjct  346   KHWENRDEDVRVHKYLPKGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVPVLINE  405

Query  1207  GYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPK  1386
             GYVPPFSDVLNW +F+V++PVE+IPNLKKIL  I   QY  + RR ++V+RHF+VN PPK
Sbjct  406   GYVPPFSDVLNWRSFSVVVPVEEIPNLKKILMGISPRQYIRMYRRVLKVQRHFQVNSPPK  465

Query  1387  RFDVFHMILHSIWLRRLNIRVHHL  1458
             RFDVFHMILHSIW+RRLN+R+  +
Sbjct  466   RFDVFHMILHSIWVRRLNVRIREI  489



>ref|XP_009776098.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=484

 Score =   526 bits (1356),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 240/390 (62%), Positives = 300/390 (77%), Gaps = 6/390 (2%)
 Frame = +1

Query  298   VYGAKSYTKLEILESGLAQARSSILRG-----NQLHSDEHYIPSGSIYWNASSFHRSYVE  462
             ++  K  + L  +E+GL + R +I        NQ   D  Y+P G  YWN S+FHRSY+E
Sbjct  92    IFSKKKLSNLGRVEAGLGKVRGAIREAQSNSNNQTFDDSEYVPRGPCYWNPSAFHRSYIE  151

Query  463   MEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVT  642
             MEK  K+YVYE G+PPV HY   + I  IEG  IH ++ S+FRT DP+ AHV+FLPFSV 
Sbjct  152   MEKHFKIYVYEKGEPPVFHYSSSEGILGIEGIMIHQIEISKFRTNDPEKAHVYFLPFSVF  211

Query  643   VLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIP  822
              +   +YV +SH W PMK T  DY+  I+ KYP+WNR+LG+DHFML+CHDW PEIS ++P
Sbjct  212   SIVSYVYVVDSHQWGPMKNTVADYIDGISTKYPYWNRSLGSDHFMLACHDWAPEISTAVP  271

Query  823   DLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLH  1002
              L K +IR LCNANTSERFNP KDV++PEI LP GT  GLIGGP P++R VLVF+AGG+H
Sbjct  272   YLYKNSIRVLCNANTSERFNPSKDVTLPEIYLPQGTMKGLIGGPSPSQRSVLVFHAGGIH  331

Query  1003  GPVRPILLQHW-ENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             G +R +L++ W +N D++++IH YLPKNVSY+GM+RKSK+C+CPSG+EVASPRMVEALYM
Sbjct  332   GYIRQVLMEKWGKNDDQEVQIHEYLPKNVSYYGMIRKSKFCICPSGWEVASPRMVEALYM  391

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
             GCVPVL+K  YV PFSDVLNW +FAV +   DIPNLKKIL  I Q QY  +Q+RG++VRR
Sbjct  392   GCVPVLLKDHYVAPFSDVLNWKSFAVEMTSNDIPNLKKILMAISQKQYIKMQKRGLQVRR  451

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             HFEVN+PPKR+DVFHMILHSIWLRRLNI+V
Sbjct  452   HFEVNFPPKRYDVFHMILHSIWLRRLNIQV  481



>ref|XP_007202112.1| hypothetical protein PRUPE_ppa006842mg [Prunus persica]
 gb|EMJ03311.1| hypothetical protein PRUPE_ppa006842mg [Prunus persica]
Length=393

 Score =   523 bits (1347),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 239/360 (66%), Positives = 293/360 (81%), Gaps = 2/360 (1%)
 Frame = +1

Query  376   GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEG  555
             GNQ   D  YIP+G +YWNA++F RSY+EMEK  KV+VY +G+PP+ H GPCKSIY++EG
Sbjct  32    GNQTQ-DVDYIPNGPMYWNANAFQRSYLEMEKRFKVFVYGEGEPPLFHNGPCKSIYSMEG  90

Query  556   HFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIAR  732
             +FIH ++ + QFRT DP+ AHV+FLPFSVT+L + +YV +SHD+ P+++T  DYV  ++ 
Sbjct  91    NFIHEIEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHDFGPIRQTVRDYVNIVSG  150

Query  733   KYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEI  912
             KYP+WNR+LGADHFML+CHDWGPE S S P L+K +IR LCNANTSE FNP KDVS PEI
Sbjct  151   KYPYWNRSLGADHFMLACHDWGPETSNSDPHLRKNSIRVLCNANTSEGFNPSKDVSFPEI  210

Query  913   NLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSY  1092
             NL  G T G +GGP P  R +L F+AGG+HGP+RP+LL+HWENKDED+++H YLPK +SY
Sbjct  211   NLQTGDTHGFLGGPSPRLRSILAFFAGGVHGPIRPVLLEHWENKDEDLRVHQYLPKGISY  270

Query  1093  HGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVE  1272
             + MMR SK+CLCPSGYEVASPR+VEA+Y GCVPVLI   YVPPFSDVLNW +F+V + V 
Sbjct  271   YDMMRHSKFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVKVS  330

Query  1273  DIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             +IPNLK IL  I   QY  +QRR V+VRRHFEVN PPKRFDVFHMILHSIWLRRLN+RVH
Sbjct  331   EIPNLKNILMSISTKQYIRMQRRVVQVRRHFEVNSPPKRFDVFHMILHSIWLRRLNVRVH  390



>ref|XP_006430348.1| hypothetical protein CICLE_v10011407mg [Citrus clementina]
 gb|ESR43588.1| hypothetical protein CICLE_v10011407mg [Citrus clementina]
Length=552

 Score =   529 bits (1363),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 251/386 (65%), Positives = 308/386 (80%), Gaps = 5/386 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILR---GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             ++ TKLE LE+GL +AR +I     GNQ   D  ++P G +YW++ +FHRSY+EME+  K
Sbjct  161   RAVTKLEKLEAGLQRARVAIKEASIGNQTQ-DPDFVPLGPMYWDSKAFHRSYLEMEQKFK  219

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKM  657
             V+VYE+G+PPV H GPCKSIY++EG+FI+ M+ + QFRT + D AHVFFLPFSV  L + 
Sbjct  220   VFVYEEGEPPVFHDGPCKSIYSMEGNFIYTMEVNKQFRTKEADKAHVFFLPFSVVKLVRF  279

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +YV +SHD+ P++RT +DYV  IA KYP+WNR+LGADHFML+CHDWGPE S S+P L K 
Sbjct  280   VYVRDSHDFGPIRRTVIDYVNLIAGKYPYWNRSLGADHFMLACHDWGPETSFSVPYLGKN  339

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE+F+P KDVS PEINL  G   GLIGGP P+ R +L F+AGG+HGP+RP
Sbjct  340   SIRVLCNANTSEKFSPVKDVSFPEINLQTGGLTGLIGGPSPSRRSILAFFAGGVHGPIRP  399

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             +LL+HWENKDEDI++H YLPK VSY+ MMRKSKYCLCPSGYEVASPR+VEA+Y GCVPVL
Sbjct  400   VLLEHWENKDEDIRVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEAIYTGCVPVL  459

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPFSDVLNW +F+V +   DIPNLK ILT I   QY  + RR V+VRRHFE N 
Sbjct  460   ISEHYVPPFSDVLNWKSFSVALSTRDIPNLKSILTSISPRQYIRMHRRVVQVRRHFEFNS  519

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVHH  1455
             PPKRFDVFHMILHSIWLRRLN+R+ +
Sbjct  520   PPKRFDVFHMILHSIWLRRLNVRIQN  545



>gb|KDO60990.1| hypothetical protein CISIN_1g048582mg [Citrus sinensis]
Length=555

 Score =   529 bits (1363),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 251/386 (65%), Positives = 308/386 (80%), Gaps = 5/386 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILR---GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             ++ TKLE LE+GL +AR +I     GNQ   D  ++P G +YW++ +FHRSY+EME+  K
Sbjct  164   RAVTKLEKLEAGLQRARVAIKEASIGNQTQ-DPDFVPLGPMYWDSKAFHRSYLEMEQKFK  222

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKM  657
             V+VYE+G+PPV H GPCKSIY++EG+FI+ M+ + QFRT + D AHVFFLPFSV  L + 
Sbjct  223   VFVYEEGEPPVFHDGPCKSIYSMEGNFIYTMEVNKQFRTKEADKAHVFFLPFSVVKLVRF  282

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +YV +SHD+ P++RT +DYV  IA KYP+WNR+LGADHFML+CHDWGPE S S+P L K 
Sbjct  283   VYVRDSHDFGPIRRTVIDYVNLIAGKYPYWNRSLGADHFMLACHDWGPETSFSVPYLGKN  342

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE+F+P KDVS PEINL  G   GLIGGP P+ R +L F+AGG+HGP+RP
Sbjct  343   SIRVLCNANTSEKFSPVKDVSFPEINLQTGGLTGLIGGPSPSRRSILAFFAGGVHGPIRP  402

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             +LL+HWENKDEDI++H YLPK VSY+ MMRKSKYCLCPSGYEVASPR+VEA+Y GCVPVL
Sbjct  403   VLLEHWENKDEDIRVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEAIYTGCVPVL  462

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPFSDVLNW +F+V +   DIPNLK ILT I   QY  + RR V+VRRHFE N 
Sbjct  463   ISEHYVPPFSDVLNWKSFSVALSTRDIPNLKSILTSISPRQYIRMHRRVVQVRRHFEFNS  522

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVHH  1455
             PPKRFDVFHMILHSIWLRRLN+R+ +
Sbjct  523   PPKRFDVFHMILHSIWLRRLNVRIQN  548



>gb|KHG20191.1| hypothetical protein F383_08256 [Gossypium arboreum]
Length=575

 Score =   530 bits (1364),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 243/411 (59%), Positives = 322/411 (78%), Gaps = 11/411 (3%)
 Frame = +1

Query  238   VFRAPNKSWVFTFPYLKTLAV---YGAKSYTKLEILESGLAQARSSILR---GNQLHSDE  399
             + R PN +   T    +T+A+   +  +  TKL+ +E+GL +ARS+I     G+QL   +
Sbjct  160   INRTPNNA---TTSLNETIALPLKHSRQVRTKLDKVEAGLQRARSAIREAKNGSQLQESD  216

Query  400   HYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF  579
              Y+P G +YW+A +FHRSY+EMEK  KV+VY++G+PPV H GPCKSIY++EG+FI+ +D 
Sbjct  217   -YVPIGPMYWDAKAFHRSYLEMEKQFKVFVYKEGEPPVFHDGPCKSIYSMEGNFIYKLDV  275

Query  580   -SQFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRT  756
              ++F+T DP  AHVF+LPFSV  + + +Y  +S D+SP++RT +DY+  +A+KYP+WNR+
Sbjct  276   DTKFQTKDPQKAHVFYLPFSVAKMVRFVYSRDSRDFSPIRRTVVDYINLVAQKYPYWNRS  335

Query  757   LGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTD  936
              GADHFML+CHDWGPE S S+P L+K +IRALCNANTSERFNP KDVSIPEINL      
Sbjct  336   HGADHFMLACHDWGPEASFSLPHLEKNSIRALCNANTSERFNPVKDVSIPEINLITDKLT  395

Query  937   GLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSK  1116
             GL+GGP  ++R +L F+AGG+HGP+RP+LL+HWE+KDEDIK+H YLP+ V+Y+ MMR SK
Sbjct  396   GLMGGPSASQRQILAFFAGGVHGPIRPVLLEHWEDKDEDIKVHKYLPRGVNYYDMMRNSK  455

Query  1117  YCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKI  1296
             YC+CPSGYEVASPR+VEALY GCVPVLI + YV PFSDVL W +F+V + V+DIP LK+I
Sbjct  456   YCICPSGYEVASPRIVEALYNGCVPVLISKSYVAPFSDVLRWKSFSVTVSVDDIPKLKEI  515

Query  1297  LTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             L +I   QY  +QRR ++VRRHFE N PPKR+DVFHMILHS+WLRRLN+R+
Sbjct  516   LMNISTRQYIRMQRRVLQVRRHFEFNSPPKRYDVFHMILHSVWLRRLNVRI  566



>ref|XP_006481931.1| PREDICTED: probable glycosyltransferase At5g03795-like [Citrus 
sinensis]
Length=555

 Score =   528 bits (1361),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 251/386 (65%), Positives = 308/386 (80%), Gaps = 5/386 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILR---GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             ++ TKLE LE+GL +AR +I     GNQ   D  ++P G +YW++ +FHRSY+EME+  K
Sbjct  164   RAVTKLEKLEAGLQRARVAIKEASIGNQTQ-DPDFVPLGPMYWDSKAFHRSYLEMEQKFK  222

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKM  657
             V+VYE+G+PPV H GPCKSIY++EG+FI+ M+ + QFRT + D AHVFFLPFSV  L + 
Sbjct  223   VFVYEEGEPPVFHDGPCKSIYSMEGNFIYTMEVNKQFRTKEADKAHVFFLPFSVVKLVRF  282

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +YV +SHD+ P++RT +DYV  IA KYP+WNR+LGADHFML+CHDWGPE S S+P L K 
Sbjct  283   VYVRDSHDFGPIRRTVVDYVNLIAGKYPYWNRSLGADHFMLACHDWGPETSFSVPYLGKN  342

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE+F+P KDVS PEINL  G   GLIGGP P+ R +L F+AGG+HGP+RP
Sbjct  343   SIRVLCNANTSEKFSPVKDVSFPEINLQTGGLTGLIGGPSPSRRSILAFFAGGVHGPIRP  402

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             +LL+HWENKDEDI++H YLPK VSY+ MMRKSKYCLCPSGYEVASPR+VEA+Y GCVPVL
Sbjct  403   VLLEHWENKDEDIRVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEAIYTGCVPVL  462

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPFSDVLNW +F+V +   DIPNLK ILT I   QY  + RR V+VRRHFE N 
Sbjct  463   ISEHYVPPFSDVLNWKSFSVALSTRDIPNLKSILTSISPRQYIRMHRRVVQVRRHFEFNS  522

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVHH  1455
             PPKRFDVFHMILHSIWLRRLN+R+ +
Sbjct  523   PPKRFDVFHMILHSIWLRRLNVRIQN  548



>ref|XP_010039055.1| PREDICTED: probable glycosyltransferase At5g03795 [Eucalyptus 
grandis]
Length=562

 Score =   528 bits (1359),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 248/410 (60%), Positives = 311/410 (76%), Gaps = 5/410 (1%)
 Frame = +1

Query  226   SAFLVFRAPNKSWVFTFPYLKTLAVYGAKSYTKLEILESGLAQARSSILR---GNQLHSD  396
             S F V  A N    F   Y      +  +  T LE LE+GL +ARS I     GN +  D
Sbjct  148   SDFSVNVARNNVPAFNESYGFVEKAWQKRVDTDLERLEAGLRRARSGIREAKTGNPME-D  206

Query  397   EHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD  576
               Y+P G +Y NA++FHRSY+EMEK  K++VY++G PPV H GPCKSIYA+EG+FIH ++
Sbjct  207   PDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPVFHNGPCKSIYAMEGNFIHMVE  266

Query  577   FSQ-FRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNR  753
              ++ FRT DP  AHVFFLPFSV ++ + +YV +SHD+ P+KRT +DY+  +A KYP+WNR
Sbjct  267   INKRFRTEDPREAHVFFLPFSVAMMVQFVYVRDSHDFGPIKRTVIDYIDVVASKYPYWNR  326

Query  754   TLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTT  933
             +LGADHFML+CHDWGPE S ++P L + +IR LCNANTSE F+P KDVS PE+NL  G  
Sbjct  327   SLGADHFMLACHDWGPEASFAVPHLHRNSIRVLCNANTSEGFDPSKDVSFPEVNLHTGAI  386

Query  934   DGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKS  1113
              GLIGGP P+ R +L F+AGGLHGP+RPILLQHWENKDED+K+H YLP+ VSY+ MM++S
Sbjct  387   GGLIGGPSPSHRSILAFFAGGLHGPIRPILLQHWENKDEDVKVHRYLPRGVSYYDMMKRS  446

Query  1114  KYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKK  1293
             K+C+CPSGYEVASPR+VEA+Y GCVPVLI   YVPPFSDVLNW +F+V + V +IPNLK 
Sbjct  447   KFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWRSFSVEVTVREIPNLKT  506

Query  1294  ILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNI  1443
             IL  I   QY  +QRR  +VRRHFEV+ PPKR+DVFHMILHS+WLRRLN+
Sbjct  507   ILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMILHSVWLRRLNV  556



>ref|XP_009122667.1| PREDICTED: probable glycosyltransferase At5g03795 [Brassica rapa]
 emb|CDX70282.1| BnaA10g26310D [Brassica napus]
Length=501

 Score =   525 bits (1351),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 239/393 (61%), Positives = 305/393 (78%), Gaps = 3/393 (1%)
 Frame = +1

Query  289   TLAVYGAKSYTKLEILESGLAQARSSILRG--NQLHSDEHYIPSGSIYWNASSFHRSYVE  462
             +L +   +  + LE +E  L +AR +I     N    D  Y P G +YWNA +FHRSY+E
Sbjct  109   SLKLMKKRVISNLEKIEFELQKARVAIKAASMNDPLDDPDYAPLGPMYWNAKAFHRSYLE  168

Query  463   MEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSV  639
             MEK  K++VY++G+PP+ H GPCKSIY++EG+FI+ M+  ++FRT +P+ AH F+LP SV
Sbjct  169   MEKQFKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYEMETNTRFRTNNPEKAHAFYLPLSV  228

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
               + + +Y  +SHD+SP+++T  DY+  +  KYP+WNR++GADHF+LSCHDWGPE S S 
Sbjct  229   VKMVRYVYERDSHDFSPIRKTVRDYIDLVGDKYPYWNRSIGADHFILSCHDWGPEASFSH  288

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
             P L + +IRALCNANTSERF P+KDVSIPEINL  G+  GL+GGP P+ RP+L F+AGG+
Sbjct  289   PHLGQNSIRALCNANTSERFKPRKDVSIPEINLLTGSLKGLVGGPSPSSRPILAFFAGGV  348

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HGPVRP+LLQHWENKD DI++H YLPK  SY  MMR SK+C+CPSGYEVASPR+VEALY 
Sbjct  349   HGPVRPVLLQHWENKDSDIRVHKYLPKGTSYSDMMRNSKFCICPSGYEVASPRIVEALYS  408

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
             GCVPVLI  GYVPPFSDVLNW++F+VI+ VEDIPNLK ILT I   QY  + RR ++VRR
Sbjct  409   GCVPVLINSGYVPPFSDVLNWASFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVRR  468

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             HFEVN P KRFDVFHMILHSIW+RRLN+R+  +
Sbjct  469   HFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  501



>gb|AES60658.2| exostosin family protein [Medicago truncatula]
Length=488

 Score =   523 bits (1348),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 243/385 (63%), Positives = 303/385 (79%), Gaps = 4/385 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGN--QLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             + ++ L+  E+GL  AR++I   +      D  Y+P G +YWNA +FHRSY+EMEK  KV
Sbjct  101   RKFSILDRTEAGLLHARAAIREASYSTQTQDPDYVPIGPMYWNAKAFHRSYLEMEKQFKV  160

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMI  660
             +VYE+G+PPV H GPCKSIY++EG+FIHA++ + QFRT DP  AHV+FLPFSV +L + +
Sbjct  161   FVYEEGEPPVFHNGPCKSIYSMEGNFIHAIELNDQFRTRDPQKAHVYFLPFSVVMLVRFV  220

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             Y+ +S D+ P+++T  DY+  IA KYP+WNR+LGADHFML+CHDWGPE S S+P L K +
Sbjct  221   YLRDSRDFGPIRKTVTDYINVIAGKYPYWNRSLGADHFMLACHDWGPETSFSVPYLHKNS  280

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNANTSERFNP KDVS PEINL  G+ +G +GG   ++RP+L F+AGGLHG +R I
Sbjct  281   IRVLCNANTSERFNPAKDVSFPEINLQTGSINGFLGGLSASKRPILAFFAGGLHGHIRAI  340

Query  1021  LLQHWE-NKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             LL+HWE NKD+D+ I  YLPK VSY+ M+RKSK+CLCPSGYEVASPR+VEA+Y GCVPVL
Sbjct  341   LLEHWENNKDQDMMIQKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRIVEAIYTGCVPVL  400

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPFSDVLNW +F+V I VEDIP LK IL  I  TQY  +QRR V++RRHFEV+ 
Sbjct  401   ISDHYVPPFSDVLNWKSFSVEISVEDIPKLKDILMRISPTQYIRMQRRVVQIRRHFEVHS  460

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVH  1452
             PPKRFDVFHMILHS+WLRRLN RVH
Sbjct  461   PPKRFDVFHMILHSVWLRRLNFRVH  485



>ref|XP_003590407.1| hypothetical protein MTR_1g061760 [Medicago truncatula]
Length=508

 Score =   524 bits (1349),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 243/385 (63%), Positives = 303/385 (79%), Gaps = 4/385 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGN--QLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             + ++ L+  E+GL  AR++I   +      D  Y+P G +YWNA +FHRSY+EMEK  KV
Sbjct  121   RKFSILDRTEAGLLHARAAIREASYSTQTQDPDYVPIGPMYWNAKAFHRSYLEMEKQFKV  180

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMI  660
             +VYE+G+PPV H GPCKSIY++EG+FIHA++ + QFRT DP  AHV+FLPFSV +L + +
Sbjct  181   FVYEEGEPPVFHNGPCKSIYSMEGNFIHAIELNDQFRTRDPQKAHVYFLPFSVVMLVRFV  240

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             Y+ +S D+ P+++T  DY+  IA KYP+WNR+LGADHFML+CHDWGPE S S+P L K +
Sbjct  241   YLRDSRDFGPIRKTVTDYINVIAGKYPYWNRSLGADHFMLACHDWGPETSFSVPYLHKNS  300

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNANTSERFNP KDVS PEINL  G+ +G +GG   ++RP+L F+AGGLHG +R I
Sbjct  301   IRVLCNANTSERFNPAKDVSFPEINLQTGSINGFLGGLSASKRPILAFFAGGLHGHIRAI  360

Query  1021  LLQHWE-NKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             LL+HWE NKD+D+ I  YLPK VSY+ M+RKSK+CLCPSGYEVASPR+VEA+Y GCVPVL
Sbjct  361   LLEHWENNKDQDMMIQKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRIVEAIYTGCVPVL  420

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPFSDVLNW +F+V I VEDIP LK IL  I  TQY  +QRR V++RRHFEV+ 
Sbjct  421   ISDHYVPPFSDVLNWKSFSVEISVEDIPKLKDILMRISPTQYIRMQRRVVQIRRHFEVHS  480

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVH  1452
             PPKRFDVFHMILHS+WLRRLN RVH
Sbjct  481   PPKRFDVFHMILHSVWLRRLNFRVH  505



>ref|XP_004156325.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cucumis 
sativus]
Length=516

 Score =   524 bits (1349),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 241/375 (64%), Positives = 302/375 (81%), Gaps = 3/375 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQLHS--DEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             + YTKLE +E+GL +AR++I     L+   D  ++PSG +YWN+ +FHRSY+EMEK +K+
Sbjct  133   REYTKLERIEAGLRRARAAIREAKFLNQTQDPDFVPSGPMYWNSKAFHRSYLEMEKEMKI  192

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             +VYE+G+PP+ H GPCKSIY+ EG+FIHA++  SQFRT DP+ AHVFFLP SV +L + +
Sbjct  193   FVYEEGEPPLFHNGPCKSIYSTEGNFIHAIEMDSQFRTKDPNKAHVFFLPLSVAMLVRFV  252

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             YV +SHD++P++ T +DY+  I  KYPFWNR+LGADHFMLSCHDWGPE S S+P+L K +
Sbjct  253   YVHDSHDFTPIRHTVVDYINVIGTKYPFWNRSLGADHFMLSCHDWGPEASKSVPNLYKNS  312

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNANTSE FNP KDVS PEINL  G   G +GGP P+ RP+L F+AGGLHGP+RPI
Sbjct  313   IRVLCNANTSEGFNPSKDVSFPEINLQTGHLTGFLGGPSPSHRPILAFFAGGLHGPIRPI  372

Query  1021  LLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLI  1200
             L+Q WEN+D+DI++H YLPK VSY  MMRKSK+CLCPSGYEVASPR+VEA+Y GCVPVLI
Sbjct  373   LIQQWENQDQDIQVHQYLPKGVSYIDMMRKSKFCLCPSGYEVASPRIVEAIYTGCVPVLI  432

Query  1201  KRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWP  1380
                YVPPFSDV+NW +F+V + V+DIPNLK ILT I   QY  + RR V+VRRHFEVN P
Sbjct  433   SDHYVPPFSDVINWKSFSVEVSVDDIPNLKTILTGISTRQYLRMYRRVVKVRRHFEVNSP  492

Query  1381  PKRFDVFHMILHSIW  1425
             PKR+DV+HMILHS+W
Sbjct  493   PKRYDVYHMILHSVW  507



>ref|XP_004143371.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cucumis 
sativus]
 gb|KGN48221.1| hypothetical protein Csa_6G449280 [Cucumis sativus]
Length=516

 Score =   522 bits (1345),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 240/375 (64%), Positives = 302/375 (81%), Gaps = 3/375 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQLHS--DEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             + YTKLE +E+GL +AR++I     L+   D  ++PSG +YWN+ +FHRSY+EMEK +K+
Sbjct  133   REYTKLERIEAGLRRARAAIREAKFLNQTQDPDFVPSGPMYWNSKAFHRSYLEMEKEMKI  192

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             +VYE+G+PP+ H GPCKSIY+ EG+FIHA++  SQFRT DP+ AHVFFLP SV +L + +
Sbjct  193   FVYEEGEPPLFHNGPCKSIYSTEGNFIHAIEMDSQFRTKDPNKAHVFFLPLSVAMLVRFV  252

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             YV +SHD++P++ T +DY+  I  KYPFWNR+LGADHFMLSCHDWGPE S S+P+L K +
Sbjct  253   YVHDSHDFTPIRHTVVDYINVIGTKYPFWNRSLGADHFMLSCHDWGPEASKSVPNLYKNS  312

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNANTSE FNP KDVS PEINL  G   G +GGP P+ RP++ F+AGGLHGP+RPI
Sbjct  313   IRVLCNANTSEGFNPSKDVSFPEINLQTGHLTGFLGGPSPSHRPIMAFFAGGLHGPIRPI  372

Query  1021  LLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLI  1200
             L+Q WEN+D+DI++H YLPK VSY  MMRKSK+CLCPSGYEVASPR+VEA+Y GCVPVLI
Sbjct  373   LIQRWENQDQDIQVHQYLPKGVSYIDMMRKSKFCLCPSGYEVASPRIVEAIYTGCVPVLI  432

Query  1201  KRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWP  1380
                YVPPFSDV+NW +F+V + V+DIPNLK ILT I   QY  + RR V+VRRHFEVN P
Sbjct  433   SDHYVPPFSDVINWKSFSVEVSVDDIPNLKTILTGISTRQYLRMYRRVVKVRRHFEVNSP  492

Query  1381  PKRFDVFHMILHSIW  1425
             PKR+DV+HMILHS+W
Sbjct  493   PKRYDVYHMILHSVW  507



>gb|KHN24379.1| Putative glycosyltransferase [Glycine soja]
Length=502

 Score =   521 bits (1343),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 242/379 (64%), Positives = 295/379 (78%), Gaps = 3/379 (1%)
 Frame = +1

Query  325   LEILESGLAQARSSILRGNQ--LHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYED  498
             L+  E  LAQAR++I       L  D  Y+P G +YWNA  FHRSY+EMEK  KV+VYE+
Sbjct  113   LDRTEVVLAQARATIREAKNWNLTQDSDYVPIGPMYWNAKEFHRSYLEMEKQFKVFVYEE  172

Query  499   GQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSKMIYVANS  675
             G+ PV H GPC SIY+ EG FIHA++ ++ FRT DP  A+VFFLPFS+  + + +Y+ NS
Sbjct  173   GELPVFHDGPCSSIYSTEGSFIHAIEMNEHFRTRDPKKANVFFLPFSIAWMVRYVYIRNS  232

Query  676   HDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALC  855
             +D+ P+KRT  DYV  IA +YP+WNR+LGADHFMLSCHDWGPE S SIP L+K +IR LC
Sbjct  233   YDFGPIKRTVRDYVNVIATRYPYWNRSLGADHFMLSCHDWGPETSKSIPYLRKNSIRVLC  292

Query  856   NANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHW  1035
             NANTSE F+P KD S PEINL  G  D  IGGPP ++R +L F+AGG HGP+RPILL+HW
Sbjct  293   NANTSEGFDPIKDASFPEINLQPGLKDSFIGGPPASKRSILAFFAGGNHGPIRPILLEHW  352

Query  1036  ENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYV  1215
             ENKDEDI++H YLPK VSY+GM+R SK+CLCPSGYEVASPR+VEA+Y GCVPVLI   YV
Sbjct  353   ENKDEDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRVVEAIYTGCVPVLISEHYV  412

Query  1216  PPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFD  1395
             PPFSDVLNW  F+V + V++IPNLK ILT I   QY  +Q+R  ++RRHFEV+ PPKR+D
Sbjct  413   PPFSDVLNWKMFSVNVSVKEIPNLKDILTSISPRQYIRMQKRVGQIRRHFEVHSPPKRYD  472

Query  1396  VFHMILHSIWLRRLNIRVH  1452
             VFHMILHS+WLRRLN RVH
Sbjct  473   VFHMILHSVWLRRLNFRVH  491



>ref|XP_003541440.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
 gb|KHN48210.1| Putative glycosyltransferase [Glycine soja]
Length=491

 Score =   520 bits (1340),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 240/383 (63%), Positives = 302/383 (79%), Gaps = 3/383 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI--LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             + ++ L+  E  LAQAR++I   R      D  Y+P+G +YWNA +FHRSY+EMEK  KV
Sbjct  105   RKFSFLDRTEVVLAQARAAIREARNRNRTLDSDYVPTGPMYWNAKAFHRSYLEMEKQFKV  164

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMI  660
             +VYE+G+ PV H GPCKSIY++EG+FIHA++ +  FRT DP  AHVFFLPFSV ++ + +
Sbjct  165   FVYEEGETPVFHNGPCKSIYSMEGNFIHAIEMNDHFRTKDPKKAHVFFLPFSVVMMVRFV  224

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             Y  +S D+ P+K+T +DYV  IA +YP+WNR+LGADHFML+CHDWGPE S S+P L K +
Sbjct  225   YERDSRDFGPIKKTVIDYVNLIATRYPYWNRSLGADHFMLACHDWGPEASFSLPYLHKNS  284

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNANTSE F P KDVS PEINL  G+ +G +GGP  ++R +L F+AGG+HGP+RPI
Sbjct  285   IRVLCNANTSEGFKPAKDVSFPEINLQTGSINGFVGGPSASKRSILAFFAGGVHGPIRPI  344

Query  1021  LLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLI  1200
             LL+HWENKDEDI++H YLPK VSY+GM+RKSK+CLCPSGYEVASPR+VEA+Y GCVPVLI
Sbjct  345   LLEHWENKDEDIQVHKYLPKGVSYYGMLRKSKFCLCPSGYEVASPRVVEAIYTGCVPVLI  404

Query  1201  KRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWP  1380
                YVPPFSDVLNW +F+V + V+DIP LK IL  I   Q+  +QRR  ++RRHFEV+ P
Sbjct  405   SEHYVPPFSDVLNWKSFSVELSVKDIPILKDILMSISPRQHIRMQRRVGQIRRHFEVHSP  464

Query  1381  PKRFDVFHMILHSIWLRRLNIRV  1449
             PKRFDVFHMILHS+WLRRLN RV
Sbjct  465   PKRFDVFHMILHSVWLRRLNFRV  487



>ref|XP_008241335.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=541

 Score =   522 bits (1344),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 238/360 (66%), Positives = 292/360 (81%), Gaps = 2/360 (1%)
 Frame = +1

Query  376   GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEG  555
             GNQ   D  YIP+G +YW A++F RSY+EMEK  KV+VY +G+PP+ H GPCKSIY++EG
Sbjct  180   GNQTQ-DVDYIPNGPMYWKANAFQRSYLEMEKRFKVFVYGEGEPPLFHNGPCKSIYSMEG  238

Query  556   HFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIAR  732
             +FIH ++ + QFRT DP+ AHV+FLPFSVT+L + +YV +SHD+ P+++T  DYV  ++ 
Sbjct  239   NFIHEIEVNKQFRTHDPEKAHVYFLPFSVTMLVRFVYVRDSHDFGPIRQTVRDYVNIVSG  298

Query  733   KYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEI  912
             KYP+WNR+LGADHFML+CHDWGPE S S P L+K +IR LCNANTSE FNP KDVS PEI
Sbjct  299   KYPYWNRSLGADHFMLACHDWGPETSNSDPHLRKNSIRVLCNANTSEGFNPSKDVSFPEI  358

Query  913   NLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSY  1092
             NL  G T G +GGP P  R +L F+AGG+HGP+RP+LL+HWENKDED+++H YLPK +SY
Sbjct  359   NLQTGDTHGFLGGPSPRLRSILAFFAGGVHGPIRPVLLEHWENKDEDLRVHQYLPKGISY  418

Query  1093  HGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVE  1272
             + MMR SK+CLCPSGYEVASPR+VEA+Y GCVPVLI   YVPPFSDVLNW +F+V + V 
Sbjct  419   YDMMRHSKFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVKVS  478

Query  1273  DIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             +IPNLK IL  I   QY  +QRR V+VRRHFEVN PPKRFDVFHMILHSIWLRRLN+RVH
Sbjct  479   EIPNLKNILMSISTKQYIRMQRRVVQVRRHFEVNSPPKRFDVFHMILHSIWLRRLNVRVH  538



>emb|CDY42006.1| BnaC04g00840D [Brassica napus]
Length=506

 Score =   520 bits (1338),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 237/393 (60%), Positives = 304/393 (77%), Gaps = 3/393 (1%)
 Frame = +1

Query  289   TLAVYGAKSYTKLEILESGLAQARSSILRG--NQLHSDEHYIPSGSIYWNASSFHRSYVE  462
             +L +   +  + L+ +E  L +AR +I     N    D  Y+P G +YWNA +FHRSY+E
Sbjct  114   SLKLMKKRVISNLKKIEFELQKARVAIKAASINDPLDDPDYVPLGPMYWNAKAFHRSYLE  173

Query  463   MEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSV  639
             MEK  K++VY++G+PP+ H GPCKSIY++EG+FI+ M+  ++FRT +P+ AH F+LP SV
Sbjct  174   MEKQFKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYEMETDTRFRTNNPEKAHAFYLPLSV  233

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
               + + +Y  +SHD+SP+++T  DY+  +  KYP+WNR++GADHF+LSCHDWGPE S S 
Sbjct  234   VKMVRYVYERDSHDFSPIRKTVRDYIDLVGDKYPYWNRSIGADHFILSCHDWGPEASFSH  293

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
             P L + +IRALCNANTSERF P+KDVSIPEINL  G+  GL+GGP P+ RP+L F+AGG+
Sbjct  294   PHLGQNSIRALCNANTSERFKPRKDVSIPEINLLTGSLKGLVGGPSPSSRPILAFFAGGV  353

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HGPVRP+LLQHWENKD DI++H YLPK  SY   MR SK+C+CPSGYEVASPR+VEALY 
Sbjct  354   HGPVRPVLLQHWENKDSDIRVHKYLPKGTSYSDTMRNSKFCICPSGYEVASPRIVEALYS  413

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
             GCVPVLI  GYVPPFSDVLNW +F+VI+ VEDIPNLK ILT I   QY  + RR ++VRR
Sbjct  414   GCVPVLINSGYVPPFSDVLNWPSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVRR  473

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             HFEVN P KRFDVFHMILHSIW+RRLN+R+  +
Sbjct  474   HFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  506



>ref|XP_003535253.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=523

 Score =   520 bits (1339),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 241/379 (64%), Positives = 295/379 (78%), Gaps = 3/379 (1%)
 Frame = +1

Query  325   LEILESGLAQARSSILRGNQ--LHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYED  498
             L+  E  LAQAR++I       L  D  Y+P G +YWNA  FHRSY+EMEK  KV+VYE+
Sbjct  134   LDRTEVVLAQARATIREAKNWNLTQDSDYVPIGPMYWNAKEFHRSYLEMEKQFKVFVYEE  193

Query  499   GQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSKMIYVANS  675
             G+ PV H GPC SIY+ EG FIHA++ ++ FRT DP  A+VFFLPFS+  + + +Y+ NS
Sbjct  194   GELPVFHDGPCSSIYSTEGSFIHAIEMNEHFRTRDPKKANVFFLPFSIAWMVRYVYIRNS  253

Query  676   HDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALC  855
             +D+ P+KRT  DYV  IA +YP+WNR+LGADHFMLSCHDWGPE S SIP L+K +IR LC
Sbjct  254   YDFGPIKRTVRDYVNVIATRYPYWNRSLGADHFMLSCHDWGPETSKSIPYLRKNSIRVLC  313

Query  856   NANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHW  1035
             NANTSE F+P KD S PEINL  G  D  +GGPP ++R +L F+AGG HGP+RPILL+HW
Sbjct  314   NANTSEGFDPIKDASFPEINLQPGLKDSFVGGPPASKRSILAFFAGGNHGPIRPILLEHW  373

Query  1036  ENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYV  1215
             ENKDEDI++H YLPK VSY+GM+R SK+CLCPSGYEVASPR+VEA+Y GCVPVLI   YV
Sbjct  374   ENKDEDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRVVEAIYTGCVPVLISEHYV  433

Query  1216  PPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFD  1395
             PPFSDVLNW  F+V + V++IPNLK ILT I   QY  +Q+R  ++RRHFEV+ PPKR+D
Sbjct  434   PPFSDVLNWKMFSVNVSVKEIPNLKDILTSISPRQYIRMQKRVGQIRRHFEVHSPPKRYD  493

Query  1396  VFHMILHSIWLRRLNIRVH  1452
             VFHMILHS+WLRRLN RVH
Sbjct  494   VFHMILHSVWLRRLNFRVH  512



>emb|CBI30213.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   511 bits (1317),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 234/332 (70%), Positives = 277/332 (83%), Gaps = 1/332 (0%)
 Frame = +1

Query  463   MEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSV  639
             MEK LKVYVY++G+PP+ H GPCKSIY++EG+FIH M+  S FRT DP+ AH+FFLPFSV
Sbjct  1     MEKQLKVYVYDEGEPPLFHNGPCKSIYSMEGNFIHKMEMDSHFRTKDPEKAHLFFLPFSV  60

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
              +L + +YV +SHD  P+K+T +DYV  ++ KYP+WNR+LGADHFML+CHDWGPE S SI
Sbjct  61    AMLVRFVYVRDSHDLGPIKQTVIDYVNVVSTKYPYWNRSLGADHFMLACHDWGPETSFSI  120

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
             P L K +IR LCNANTSE FNP KDVS PEINL  G+TD  IGGP P+ R +L F+AGGL
Sbjct  121   PYLHKNSIRVLCNANTSEGFNPSKDVSFPEINLLTGSTDSFIGGPSPSHRTLLAFFAGGL  180

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HGP+RPILL+HWENKDED+K+H YLPK VSY+ MMRKSKYCLCPSGYEVASPR+VEALY 
Sbjct  181   HGPIRPILLEHWENKDEDVKVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEALYT  240

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
             GCVPVLI   YVPPFSDVLNW +F+V +PV +IPNLK+IL DI   QY  +QRRG++ RR
Sbjct  241   GCVPVLISDHYVPPFSDVLNWKSFSVEVPVREIPNLKRILMDISPRQYIRMQRRGIQARR  300

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRVHH  1455
             HFEVN PPKR+DVFHMILHS+WLRRLN RVHH
Sbjct  301   HFEVNSPPKRYDVFHMILHSLWLRRLNFRVHH  332



>ref|XP_010247793.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=592

 Score =   521 bits (1342),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 241/394 (61%), Positives = 300/394 (76%), Gaps = 7/394 (2%)
 Frame = +1

Query  289   TLAVYGAKSYTKLEILESGLAQARSSILRG-----NQLHSDEHYIPSGSIYWNASSFHRS  453
              +A    K  +KLE LE+GL++AR +I        NQ   D  Y+P G +YWNA +FHRS
Sbjct  196   AVAEVQKKRRSKLERLEAGLSRARVTIREAAHQKRNQT-PDLDYVPQGPMYWNAQAFHRS  254

Query  454   YVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLP  630
             Y+EMEK  KV+VYE+G+PP+ H GPC SIY+ EG+FIH M+  + FRT  P+ AHVFFLP
Sbjct  255   YLEMEKQFKVFVYEEGEPPLFHNGPCGSIYSSEGNFIHQMEMDKRFRTQHPEEAHVFFLP  314

Query  631   FSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEIS  810
             FSV ++ + +YV +SHD  P+K T  DYV  IA KYP+WNR+L ADHFMLSCHDWGP  S
Sbjct  315   FSVAMMVRFVYVRDSHDIGPIKHTVTDYVNIIAGKYPYWNRSLAADHFMLSCHDWGPATS  374

Query  811   GSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYA  990
               +P L    IR LCNANTSE FNP KD S PEIN+      GLIGGP P+ RP L F+A
Sbjct  375   TYVPHLYNNGIRVLCNANTSEGFNPAKDASFPEINMVTREIKGLIGGPSPSHRPTLAFFA  434

Query  991   GGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             G LHGPVRP+L +HW+NKDED++++  LP+ +SY+ MMRKSKYC+CPSGYEVASPR+VEA
Sbjct  435   GKLHGPVRPVLFEHWKNKDEDVQVYESLPRGLSYYDMMRKSKYCICPSGYEVASPRVVEA  494

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
             LY+GCVPVLI   YVPPFSD+LNW +F+V +PV +IPNLK+IL +I   QY  +QRRG+ 
Sbjct  495   LYVGCVPVLISDHYVPPFSDILNWRSFSVEVPVNEIPNLKRILLNISSKQYIRMQRRGLL  554

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             VR+HFEVN+PPKRFDV+HMILHS+WLRRLN+R+H
Sbjct  555   VRKHFEVNFPPKRFDVYHMILHSVWLRRLNVRIH  588



>gb|KCW48746.1| hypothetical protein EUGRSUZ_K02385, partial [Eucalyptus grandis]
Length=352

 Score =   511 bits (1316),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 230/351 (66%), Positives = 285/351 (81%), Gaps = 1/351 (0%)
 Frame = +1

Query  391   SDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHA  570
              D  Y+P G +Y NA++FHRSY+EMEK  K++VY++G PPV H GPCKSIYA EG+FIH 
Sbjct  2     EDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPVFHNGPCKSIYAKEGNFIHM  61

Query  571   MDFSQ-FRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFW  747
             ++ ++ FRT DP  AHVFFLPFSV ++ + +YV +SHD+ P+KRT +DY+  +A KYP+W
Sbjct  62    VEINKRFRTGDPRKAHVFFLPFSVAMMVQFVYVRDSHDFGPIKRTVIDYIDVVASKYPYW  121

Query  748   NRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDG  927
             NR+LGADHFML+CHDWGPE S ++P LQ+ +IR LCNANTSE F+P KDVS PE+NL  G
Sbjct  122   NRSLGADHFMLACHDWGPEASFAVPHLQRNSIRVLCNANTSEGFDPSKDVSFPEVNLHTG  181

Query  928   TTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMR  1107
                GLIGGP P+ R +L F+AGGLHGP+RPILLQHWENKDED+K+H YLP+ VSY+ MMR
Sbjct  182   AISGLIGGPSPSHRSILAFFAGGLHGPIRPILLQHWENKDEDVKVHRYLPRGVSYYDMMR  241

Query  1108  KSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNL  1287
             +SK+C+CPSGYEVASPR+VEA+Y GCVPVLI   YVPPFSDVLNW +F+V + V +IPNL
Sbjct  242   RSKFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWRSFSVEVTVREIPNL  301

Query  1288  KKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLN  1440
             K IL  I   QY  +QRR  +VRRHFEV+ PPKR+DVFHMILHS+WLRRLN
Sbjct  302   KTILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMILHSVWLRRLN  352



>ref|XP_006398838.1| hypothetical protein EUTSA_v10016080mg [Eutrema salsugineum]
 gb|ESQ40291.1| hypothetical protein EUTSA_v10016080mg [Eutrema salsugineum]
Length=517

 Score =   517 bits (1332),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 235/383 (61%), Positives = 299/383 (78%), Gaps = 3/383 (1%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHYIPS--GSIYWNASSFHRSYVEMEKTLKVYVY  492
             + LE +E  L +AR +I   +     +       G +YWNA  FHRSY+EMEK  K++VY
Sbjct  135   SNLEKIEFELQKARVAIKAASMDDPVDDPDYVPLGPMYWNAKVFHRSYLEMEKQFKIFVY  194

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
             ++G+PP+ H GPCKSIY++EG+FI+ M+  ++FRT +PD AH F+LP SV  + + +YV+
Sbjct  195   KEGEPPLFHDGPCKSIYSMEGNFIYEMETDTRFRTNNPDKAHAFYLPLSVVKMVRYVYVS  254

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
             NSHD+SP+++T  DY+  ++ KY +WNR++GADHF+LSCHDWGPE S S P L + +IRA
Sbjct  255   NSHDFSPIRKTVRDYIDLVSDKYSYWNRSIGADHFILSCHDWGPEASFSHPHLGQNSIRA  314

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSERF P+KDVSIPEINL  G+  GL+GGP P+ RP+L F+AGG+HGPVRP+LLQ
Sbjct  315   LCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSSRPILAFFAGGVHGPVRPVLLQ  374

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWENKD DI++H YLP+  SY  MMR SK+C+CPSGYEVASPR+VEALY GCVPVLI  G
Sbjct  375   HWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVPVLINSG  434

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YVPPFSDVLNW +F+VI+ VEDIPNLK ILT I   QY  + RR ++VRRHFEVN P KR
Sbjct  435   YVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVRRHFEVNSPAKR  494

Query  1390  FDVFHMILHSIWLRRLNIRVHHL  1458
             FDVFHMILHSIW+RRLN+R+  +
Sbjct  495   FDVFHMILHSIWVRRLNVRIREV  517



>ref|XP_003542567.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
 gb|KHN48212.1| Putative glycosyltransferase [Glycine soja]
Length=505

 Score =   516 bits (1330),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 236/383 (62%), Positives = 300/383 (78%), Gaps = 3/383 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQLHS--DEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             + ++ L+  E+ LAQAR++I      +   D  Y+P G +YWN   FHRSY+EMEK  KV
Sbjct  119   RKFSFLDKTEAVLAQARAAIREAENWNQTQDSDYVPVGPMYWNPKEFHRSYLEMEKQFKV  178

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSKMI  660
             +VYE+G+ PV H GPC SIY+ EG FIHA++ ++ FRT DP  AHVFFLPFSV ++ + +
Sbjct  179   FVYEEGELPVFHEGPCASIYSTEGSFIHAIEMNEHFRTRDPKKAHVFFLPFSVVMMVRYV  238

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             Y+ +SHD+ P+KRT  DY+  IA +YP+WNR+LGADHFMLSCHDWGPE S   P L+K +
Sbjct  239   YIRDSHDFGPIKRTVRDYINVIAARYPYWNRSLGADHFMLSCHDWGPEASKFSPYLRKNS  298

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNANTSE F+P+KDVS PEINL  G  DGL+GGP  ++R +L F+AGG+HGP+RPI
Sbjct  299   IRVLCNANTSEGFDPRKDVSFPEINLQRGPIDGLLGGPSASQRSILAFFAGGIHGPIRPI  358

Query  1021  LLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLI  1200
             LL+HWE KDEDI++H YLPK VSY+GM+RKSK+CLCPSGYEVASPR+VEA+Y GCVPVLI
Sbjct  359   LLEHWEKKDEDIQVHQYLPKGVSYYGMLRKSKFCLCPSGYEVASPRVVEAIYTGCVPVLI  418

Query  1201  KRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWP  1380
                YVPPFSDVLNW  F+V + +++IPNLK IL +I   +Y  +Q+R  ++RRHFEV+ P
Sbjct  419   SDHYVPPFSDVLNWKMFSVEVSMKEIPNLKDILMNISPRKYIRMQKRVRQIRRHFEVHSP  478

Query  1381  PKRFDVFHMILHSIWLRRLNIRV  1449
             PKR+DVFHMILHS+WLRRLN RV
Sbjct  479   PKRYDVFHMILHSVWLRRLNFRV  501



>dbj|BAB08605.1| unnamed protein product [Arabidopsis thaliana]
Length=408

 Score =   513 bits (1320),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 236/383 (62%), Positives = 296/383 (77%), Gaps = 3/383 (1%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHYIPS--GSIYWNASSFHRSYVEMEKTLKVYVY  492
             + LE +E  L +AR+SI   +     +       G +YWNA  FHRSY+EMEK  K+YVY
Sbjct  26    SNLEKIEFKLQKARASIKAASMDDPVDDPDYVPLGPMYWNAKVFHRSYLEMEKQFKIYVY  85

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
             ++G+PP+ H GPCKSIY++EG FI+ ++  ++FRT +PD AHVF+LPFSV  + + +Y  
Sbjct  86    KEGEPPLFHDGPCKSIYSMEGSFIYEIETDTRFRTNNPDKAHVFYLPFSVVKMVRYVYER  145

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
             NS D+SP++ T  DY+  +  KYP+WNR++GADHF+LSCHDWGPE S S P L   +IRA
Sbjct  146   NSRDFSPIRNTVKDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFSHPHLGHNSIRA  205

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSERF P+KDVSIPEINL  G+  GL+GGP P+ RP+L F+AGG+HGPVRP+LLQ
Sbjct  206   LCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGGVHGPVRPVLLQ  265

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWENKD DI++H YLP+  SY  MMR SK+C+CPSGYEVASPR+VEALY GCVPVLI  G
Sbjct  266   HWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVPVLINSG  325

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YVPPFSDVLNW +F+VI+ VEDIPNLK ILT I   QY  + RR ++VRRHFEVN P KR
Sbjct  326   YVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVRRHFEVNSPAKR  385

Query  1390  FDVFHMILHSIWLRRLNIRVHHL  1458
             FDVFHMILHSIW+RRLN+++  +
Sbjct  386   FDVFHMILHSIWVRRLNVKIREV  408



>ref|XP_008462519.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
Length=518

 Score =   516 bits (1330),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 240/376 (64%), Positives = 302/376 (80%), Gaps = 4/376 (1%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQLHS--DEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             + YTKLE +E+GL +AR++I     L+   D  ++PSG +YWN+ +FHRSY+EMEK +K+
Sbjct  134   REYTKLERIEAGLRRARAAIREAKFLNQTQDPDFVPSGPMYWNSKAFHRSYLEMEKEMKI  193

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             +VYE+G+PP+ H GPCKSIY+ EG+FIHA++  SQFRT DP+ AHVFFLP SV +L + +
Sbjct  194   FVYEEGEPPLFHNGPCKSIYSTEGNFIHAIEMDSQFRTKDPNKAHVFFLPLSVAMLVRFV  253

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             YV +SHD++P++ T +DY+  I  KYPFWNR+LGADHFMLSCHDWGPE S S+P+L K +
Sbjct  254   YVHDSHDFTPIRHTVIDYINVIGTKYPFWNRSLGADHFMLSCHDWGPEASKSVPNLYKNS  313

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNANTSE FNP KDVS PEINL  G   G +GGP P+ RP+L F+AGGLHGP+RPI
Sbjct  314   IRVLCNANTSEGFNPSKDVSFPEINLQTGYLTGFLGGPSPSHRPILAFFAGGLHGPIRPI  373

Query  1021  LLQHWENKDEDIKIHSYLPKN-VSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             L+Q WEN+D+DI++H YLPK  VSY  MMRKSK+CLCPSGYEVASPR+VEA+Y GCVPVL
Sbjct  374   LIQQWENQDQDIQVHQYLPKGVVSYIDMMRKSKFCLCPSGYEVASPRIVEAIYTGCVPVL  433

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YVPPFSDV+NW +F+V + V++IPNLK ILT I   QY  + RR V+VRRHFEVN 
Sbjct  434   ISDHYVPPFSDVINWKSFSVEVSVDEIPNLKTILTGISTRQYLRMYRRVVKVRRHFEVNS  493

Query  1378  PPKRFDVFHMILHSIW  1425
             PPKR+DV+HMILHS+W
Sbjct  494   PPKRYDVYHMILHSVW  509



>ref|XP_010683939.1| PREDICTED: probable glycosyltransferase At5g03795 [Beta vulgaris 
subsp. vulgaris]
Length=538

 Score =   517 bits (1331),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 243/415 (59%), Positives = 314/415 (76%), Gaps = 10/415 (2%)
 Frame = +1

Query  244   RAPNKSWVFTFPYLKTLA-----VYGAKSYTKLEILESGLAQARSSILRG---NQLHSDE  399
             + PN + +F   + +T A     +   K  T L+ LE GL Q+R++I      N+ + D 
Sbjct  121   KTPNTTDIFVTVFNETHAPPMRKLELEKMATDLDRLEIGLQQSRAAIKEAKYTNRTYDDP  180

Query  400   HYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF  579
              + P G +YWNA++FHRSY+EME+  KVYVYE+G+PP+ H GPCKSIY+ EG+FIH M+ 
Sbjct  181   DFKPLGPMYWNANAFHRSYLEMERRFKVYVYEEGEPPLFHNGPCKSIYSTEGNFIHLMEI  240

Query  580   S-QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRT  756
             + QFRT   D AHVFFLPFSV ++   +Y+ +SHD+ P+++T  DY+  ++ KYP+WNR+
Sbjct  241   NDQFRTKKLDEAHVFFLPFSVVMMVHFVYLRDSHDFGPIRQTVRDYINVVSTKYPYWNRS  300

Query  757   LGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTD  936
             LGADHFMLSCHDWGPE S S+P L K +IR LCNANTSE F P KDVS+PEINL  G  +
Sbjct  301   LGADHFMLSCHDWGPETSFSVPYLAKNSIRVLCNANTSEGFKPHKDVSLPEINLRTGAIN  360

Query  937   GLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDE-DIKIHSYLPKNVSYHGMMRKS  1113
             G +GGP P+ R +L F+AGGLHGP+RPILL+HW NKD+ D+KI +YLPK VSY+ M+R S
Sbjct  361   GFVGGPSPSRRSILAFFAGGLHGPIRPILLEHWGNKDDKDLKIFTYLPKGVSYYDMLRNS  420

Query  1114  KYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKK  1293
             K+C+CPSGYEVASPR+VEA+Y GCVPVLI   YVPPFSDVLNW +F+V + V+DIPNLK 
Sbjct  421   KFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVSVKDIPNLKT  480

Query  1294  ILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             ILT+I   +Y  + RR ++VRRHFEV+ PPKR+D FHMILHS+WLRRLN+ VH L
Sbjct  481   ILTNISTKKYLKMYRRVLQVRRHFEVHAPPKRYDFFHMILHSVWLRRLNVHVHDL  535



>ref|NP_001031828.1| Exostosin family protein [Arabidopsis thaliana]
 sp|Q9FFN2.2|GLYT3_ARATH RecName: Full=Probable glycosyltransferase At5g03795 [Arabidopsis 
thaliana]
 gb|AED90655.1| Exostosin family protein [Arabidopsis thaliana]
Length=518

 Score =   514 bits (1323),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 236/383 (62%), Positives = 296/383 (77%), Gaps = 3/383 (1%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHYIPS--GSIYWNASSFHRSYVEMEKTLKVYVY  492
             + LE +E  L +AR+SI   +     +       G +YWNA  FHRSY+EMEK  K+YVY
Sbjct  136   SNLEKIEFKLQKARASIKAASMDDPVDDPDYVPLGPMYWNAKVFHRSYLEMEKQFKIYVY  195

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
             ++G+PP+ H GPCKSIY++EG FI+ ++  ++FRT +PD AHVF+LPFSV  + + +Y  
Sbjct  196   KEGEPPLFHDGPCKSIYSMEGSFIYEIETDTRFRTNNPDKAHVFYLPFSVVKMVRYVYER  255

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
             NS D+SP++ T  DY+  +  KYP+WNR++GADHF+LSCHDWGPE S S P L   +IRA
Sbjct  256   NSRDFSPIRNTVKDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFSHPHLGHNSIRA  315

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSERF P+KDVSIPEINL  G+  GL+GGP P+ RP+L F+AGG+HGPVRP+LLQ
Sbjct  316   LCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGGVHGPVRPVLLQ  375

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWENKD DI++H YLP+  SY  MMR SK+C+CPSGYEVASPR+VEALY GCVPVLI  G
Sbjct  376   HWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVPVLINSG  435

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YVPPFSDVLNW +F+VI+ VEDIPNLK ILT I   QY  + RR ++VRRHFEVN P KR
Sbjct  436   YVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVRRHFEVNSPAKR  495

Query  1390  FDVFHMILHSIWLRRLNIRVHHL  1458
             FDVFHMILHSIW+RRLN+++  +
Sbjct  496   FDVFHMILHSIWVRRLNVKIREV  518



>ref|XP_003537031.2| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=491

 Score =   512 bits (1319),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 233/374 (62%), Positives = 294/374 (79%), Gaps = 3/374 (1%)
 Frame = +1

Query  337   ESGLAQARSSI--LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPP  510
             E  LAQAR++I   +      D  Y+P G +YWNA +FHRSY+EMEK  KV+VYE+G+ P
Sbjct  114   EVVLAQARAAIREAKNENQTQDSDYVPIGPMYWNAKTFHRSYLEMEKQFKVFVYEEGETP  173

Query  511   VAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWS  687
             V H GPCKSIY++EG+FIHA++ +  FRT DP  AHVFFLPFSV ++ + +Y  +S D+ 
Sbjct  174   VFHNGPCKSIYSMEGNFIHAIEMNDHFRTKDPKKAHVFFLPFSVVMMVRFVYQRDSRDFG  233

Query  688   PMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANT  867
             P+++T +DY+  IA +Y +WNR+LGADHFML+CHDWGPE S S+P L K +IR LCNANT
Sbjct  234   PIRKTVIDYINLIAARYSYWNRSLGADHFMLACHDWGPEASLSLPYLHKNSIRVLCNANT  293

Query  868   SERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKD  1047
             SE F P KDVS PEINL  G+ +G IGGP  ++R +L F+AGG+HGP+RPILL+HWENKD
Sbjct  294   SEGFKPAKDVSFPEINLQTGSINGFIGGPSASKRSILAFFAGGVHGPIRPILLEHWENKD  353

Query  1048  EDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFS  1227
             EDI++H YLPK VSY+  +R SK+CLCPSGYEVASPR+VEA+Y GCVPVLI   YVPPFS
Sbjct  354   EDIQVHKYLPKGVSYYDKLRNSKFCLCPSGYEVASPRVVEAIYTGCVPVLISEHYVPPFS  413

Query  1228  DVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHM  1407
             DVLNW +F+V + V+DIPNLK IL  I   QY  +QRR ++++RHFEV+ PPKRFDVFHM
Sbjct  414   DVLNWKSFSVELSVKDIPNLKDILMSISPRQYIRMQRRVIQIQRHFEVHSPPKRFDVFHM  473

Query  1408  ILHSIWLRRLNIRV  1449
             ILHS+WLRRLN R+
Sbjct  474   ILHSVWLRRLNFRM  487



>ref|XP_002873114.1| hypothetical protein ARALYDRAFT_487158 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49373.1| hypothetical protein ARALYDRAFT_487158 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   511 bits (1316),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 235/383 (61%), Positives = 295/383 (77%), Gaps = 3/383 (1%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHYIPS--GSIYWNASSFHRSYVEMEKTLKVYVY  492
             + LE +E  L +AR+SI   +     +       G +YWNA  FHRSY+EMEK  K+YVY
Sbjct  137   SNLEKIEFELQKARASIKAASMDDPVDDPDYVPLGPMYWNAKVFHRSYLEMEKQFKIYVY  196

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
             ++G+PP+ H GPCKSIY++EG FI+ M+  ++FRT +PD AH F+LPFSV  + + +Y  
Sbjct  197   KEGEPPLFHDGPCKSIYSMEGSFIYEMETDTRFRTNNPDKAHAFYLPFSVVKMVRYVYER  256

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
             NS D+SP++ T  DY+  +  KYP+WNR++GADHF+LSCHDWGPE S S P L   +IRA
Sbjct  257   NSRDFSPIRNTVRDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFSHPHLGHNSIRA  316

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSE+F P+KDVSIPEINL  G+  GL+GGP P+ RP+L F+AGG+HGPVRP+LL+
Sbjct  317   LCNANTSEKFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGGVHGPVRPVLLE  376

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWENKD DI++H YLP+  SY  MMR SK+C+CPSGYEVASPR+VEALY GCVPVLI  G
Sbjct  377   HWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVPVLINSG  436

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YVPPFSDVLNW +F+VI+ VEDIPNLK ILT I   QY  + RR ++VRRHFEVN P KR
Sbjct  437   YVPPFSDVLNWRSFSVIVSVEDIPNLKTILTAISPRQYLRMYRRVLKVRRHFEVNSPAKR  496

Query  1390  FDVFHMILHSIWLRRLNIRVHHL  1458
             FDVFHMILHSIW+RRLN+R+  +
Sbjct  497   FDVFHMILHSIWVRRLNVRIREV  519



>ref|XP_010490872.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
Length=521

 Score =   510 bits (1314),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 235/383 (61%), Positives = 294/383 (77%), Gaps = 3/383 (1%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHYIPS--GSIYWNASSFHRSYVEMEKTLKVYVY  492
             + L+ +E  L +AR+SI   +     +       G +YWNA  FHRSY+EMEK  K+YVY
Sbjct  139   SNLQKIEFELQKARASIKAASMDDPVDDPDYVPLGPMYWNAKIFHRSYLEMEKQFKIYVY  198

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
             ++G+PP+ H GPCKSIY++EG FI+ M+  ++FRT +PD AH F+LPFSV  + + +Y  
Sbjct  199   KEGEPPLFHDGPCKSIYSMEGSFIYEMETNTRFRTNNPDKAHAFYLPFSVVKMVRFVYER  258

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
             NS D+ P++ T  DY+  +  KYP+WNR++GADHFMLSCHDWGPE S S P L   +IRA
Sbjct  259   NSRDFGPIRNTVRDYINLVGDKYPYWNRSIGADHFMLSCHDWGPEASFSHPHLGHNSIRA  318

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSERF P+KDVSIPEINL  G+  GL+GGP P+ RP+L F+AGG+HGPVRP+LL+
Sbjct  319   LCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGGVHGPVRPVLLE  378

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWENKD DI++H YLP+  SY  MMR SK+C+CPSGYEVASPR+VEALY GCVPVLI  G
Sbjct  379   HWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVPVLINSG  438

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YVPPFSDVLNW +F+VI+ VEDIPNLK ILT I   QY  + RR ++VRRHFEVN P KR
Sbjct  439   YVPPFSDVLNWKSFSVIVSVEDIPNLKTILTAISPRQYLRMYRRVLKVRRHFEVNSPAKR  498

Query  1390  FDVFHMILHSIWLRRLNIRVHHL  1458
             FDVFHMILHSIW+RRLN+R+  +
Sbjct  499   FDVFHMILHSIWVRRLNVRIREV  521



>emb|CDY11270.1| BnaA03g01060D [Brassica napus]
Length=389

 Score =   503 bits (1296),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 233/382 (61%), Positives = 294/382 (77%), Gaps = 3/382 (1%)
 Frame = +1

Query  322   KLEILESGLAQARSSILRGNQLHSDEHYIPS--GSIYWNASSFHRSYVEMEKTLKVYVYE  495
             K++ +E  L +AR +I   +     +       G +YWNA  FHRSY+EMEK  K++VY+
Sbjct  8     KIDKIEFELQKARVAIKAASMDDPVDDPDYVPIGPMYWNAKVFHRSYLEMEKQFKIFVYK  67

Query  496   DGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVAN  672
             +G PP+ H GPCKSIY++EG+FI+ M+  + FRT +PD AH F+LP SV  + + +Y  +
Sbjct  68    EGDPPLFHDGPCKSIYSMEGNFIYEMERDTHFRTNNPDKAHAFYLPLSVVKMVRYVYQRD  127

Query  673   SHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRAL  852
             SHD+ P++RT  DY+  ++ +YP+WNR++GADHF+LSCHDWGPE S S P L + +IRAL
Sbjct  128   SHDFGPIRRTVRDYIDLVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPHLGQNSIRAL  187

Query  853   CNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQH  1032
             CNANTSERF P+KDVSIPEINL  G+  GL+GGP P+ RP+L F+AGG+HGPVRP+LLQH
Sbjct  188   CNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSIRPILAFFAGGVHGPVRPVLLQH  247

Query  1033  WENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGY  1212
             WENKD+DI +H YLPK  SY  MMR SK+CLCPSGYEVASPR+VEALY GCVPVLI  GY
Sbjct  248   WENKDKDISVHKYLPKGTSYPDMMRSSKFCLCPSGYEVASPRIVEALYSGCVPVLINSGY  307

Query  1213  VPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRF  1392
             VPPFSDVLNW +F+VI+ VEDIP LK ILT I   QY  + RR ++VRRHFEVN P KRF
Sbjct  308   VPPFSDVLNWRSFSVIVSVEDIPKLKTILTSISPRQYLKMYRRVLKVRRHFEVNSPAKRF  367

Query  1393  DVFHMILHSIWLRRLNIRVHHL  1458
             DVFHMILHSIW+RRLN+R+  +
Sbjct  368   DVFHMILHSIWVRRLNVRIREV  389



>ref|XP_006287392.1| hypothetical protein CARUB_v10000598mg, partial [Capsella rubella]
 gb|EOA20290.1| hypothetical protein CARUB_v10000598mg, partial [Capsella rubella]
Length=562

 Score =   510 bits (1313),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 234/383 (61%), Positives = 293/383 (77%), Gaps = 3/383 (1%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHYIPS--GSIYWNASSFHRSYVEMEKTLKVYVY  492
             + LE +E  L +AR+SI   +     +       G +YWNA  FHRSY+EMEK  K+YVY
Sbjct  180   SNLEKIELELQKARASIKAASMDDPVDDPDYVPLGPMYWNAKVFHRSYLEMEKQFKIYVY  239

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
             ++G+PP+ H GPCKSIY++EG FI+ M+  ++FRT +PD AH F+LPFSV  + + +Y  
Sbjct  240   KEGEPPLFHDGPCKSIYSMEGSFIYEMETDTRFRTNNPDKAHAFYLPFSVVKMVRYVYER  299

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
             NS D+ P++ T  DY+  +  KYP+WNR++GADHF+LSCHDWGPE S S P L   +IRA
Sbjct  300   NSRDFGPIRNTVRDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFSHPHLGHNSIRA  359

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSERF P+KDVSIPEINL  G+  GL+GGP P+ RP+L F+AGG+HGPVRP+LL 
Sbjct  360   LCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSSRPILAFFAGGVHGPVRPVLLD  419

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWE+KD DI++H YLP+  SY  MMR SK+C+CPSGYEVASPR+VEALY GCVPVLI  G
Sbjct  420   HWEDKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVPVLINSG  479

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YVPPFSDVLNW +F+VI+ VEDIPNLK ILT I   QY  + RR ++VRRHFEVN P KR
Sbjct  480   YVPPFSDVLNWKSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVRRHFEVNSPAKR  539

Query  1390  FDVFHMILHSIWLRRLNIRVHHL  1458
             FDVFHMILHSIW+RRLN+R+  +
Sbjct  540   FDVFHMILHSIWVRRLNVRIREV  562



>ref|XP_011094445.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=497

 Score =   506 bits (1304),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 235/388 (61%), Positives = 297/388 (77%), Gaps = 6/388 (2%)
 Frame = +1

Query  307   AKSYTKLE---ILESGLAQARSSIL---RGNQLHSDEHYIPSGSIYWNASSFHRSYVEME  468
              K+YT L+   ++E+ LAQAR++I    R N+   D  Y+P+G +Y N ++F RSY+EME
Sbjct  105   GKTYTNLDNLDMVEASLAQARATIQEAQRNNETSYDPDYVPTGPMYRNPNAFLRSYLEME  164

Query  469   KTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVL  648
             K  K+YVYEDG+PP+ HY     I  IEG  IH ++ S+FRT DP  AHV+F+P SV  +
Sbjct  165   KLFKIYVYEDGEPPLYHYSKSLGILGIEGILIHQIEISKFRTRDPGKAHVYFIPLSVQSI  224

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
                 YV ++  WSP++  A DYV+ I+ KYP+WNRTLG DHF+L CHDW P IS ++PDL
Sbjct  225   VAYAYVRHNRAWSPLQNIARDYVKLISTKYPYWNRTLGCDHFILGCHDWTPMISNAVPDL  284

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
              K +IR LCNANTSE F P  DVS+PEI LP GT DGLIGG PP+ER VLVFYAGG+HG 
Sbjct  285   FKNSIRVLCNANTSEGFKPSTDVSLPEIYLPHGTMDGLIGGMPPSERSVLVFYAGGIHGY  344

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R +L+  W++KD DI+IH YLPKN+SY+ M RKSKYC+CPSG+EVASPRMVE LYMGCV
Sbjct  345   IRQVLMDQWKDKDPDIQIHEYLPKNMSYYSMFRKSKYCICPSGWEVASPRMVEGLYMGCV  404

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVL+K  Y  PF+DVL+WS F+V +PV  IP+LKKILT IPQ QY+ +Q+ G+ VRRHFE
Sbjct  405   PVLLKDHYAKPFNDVLDWSTFSVDVPVNQIPDLKKILTAIPQEQYQEMQKTGILVRRHFE  464

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             VN+PPKR+DVFHMILHSIWLRR+NI++H
Sbjct  465   VNFPPKRYDVFHMILHSIWLRRINIQLH  492



>emb|CDX80888.1| BnaC03g01420D [Brassica napus]
Length=515

 Score =   507 bits (1305),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 233/382 (61%), Positives = 293/382 (77%), Gaps = 3/382 (1%)
 Frame = +1

Query  322   KLEILESGLAQARSSILRGNQLHSDEHYIPS--GSIYWNASSFHRSYVEMEKTLKVYVYE  495
             K++ +E  L +AR +I   +     +       G +YWNA  FHRSY+EMEK  K++VY 
Sbjct  134   KIDKIEFELQKARVAIKAASMDDPVDDPDYVPIGPMYWNAKVFHRSYLEMEKQFKIFVYR  193

Query  496   DGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVAN  672
             +G PP+ H GPCKSIY++EG+FI+ M+  + FRT +PD AH F+LP SV  + + +Y  +
Sbjct  194   EGDPPLFHDGPCKSIYSMEGNFIYEMERDTHFRTNNPDKAHAFYLPLSVVKMVRYVYQRD  253

Query  673   SHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRAL  852
             SHD+ P++RT  DY+  ++ +YP+WNR++GADHF+LSCHDWGPE S S P L + +IRAL
Sbjct  254   SHDFGPIRRTVRDYIDLVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPHLGQNSIRAL  313

Query  853   CNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQH  1032
             CNANTSERF P+KDVSIPEINL  G+  GL+GGP P+ RP+L F+AGG+HGPVRP+LLQH
Sbjct  314   CNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSVRPILAFFAGGVHGPVRPVLLQH  373

Query  1033  WENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGY  1212
             WENKD DI++H YLPK  SY  MMR SK+CLCPSGYEVASPR+VEALY GCVPVLI  GY
Sbjct  374   WENKDNDIRVHKYLPKGTSYPDMMRSSKFCLCPSGYEVASPRIVEALYSGCVPVLINSGY  433

Query  1213  VPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRF  1392
             VPPFSDVLNW +F+VI+ VEDIP LK ILT I   QY  + RR ++VRRHFEVN P KRF
Sbjct  434   VPPFSDVLNWRSFSVIVSVEDIPKLKTILTSISPRQYLKMYRRVLKVRRHFEVNSPAKRF  493

Query  1393  DVFHMILHSIWLRRLNIRVHHL  1458
             DVFHMILHSIW+RRLN+R+  +
Sbjct  494   DVFHMILHSIWVRRLNVRIREV  515



>ref|XP_010423660.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
Length=514

 Score =   507 bits (1305),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 233/383 (61%), Positives = 292/383 (76%), Gaps = 3/383 (1%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHYIPS--GSIYWNASSFHRSYVEMEKTLKVYVY  492
             + LE +E  L +AR+SI   +     +       G +YWNA  FHRSY+EMEK  K+YVY
Sbjct  132   SNLEKIEFELQKARASIKAASMDDPVDDPDYVPLGPMYWNAKVFHRSYLEMEKQFKIYVY  191

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
             ++G+PP+ H GPCKSIY++EG FI+ M+  ++FRT  PD AH F+LPFSV  + + +Y  
Sbjct  192   KEGEPPLFHDGPCKSIYSMEGSFIYEMETNTRFRTNKPDKAHAFYLPFSVVKMVRFVYER  251

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
             NS D+ P++ T  DY+  +  KYP+WNR++GADHF+LSCHDWGPE S S P L   +IRA
Sbjct  252   NSRDFGPIRNTVRDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFSHPHLGHNSIRA  311

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSERF P+KDVSIPEINL  G+  GL+GG  P+ RP+L F+AGG+HGPVRP+LL+
Sbjct  312   LCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGRSPSSRPILAFFAGGVHGPVRPVLLE  371

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWENKD DI++H YLP+  SY  MMR SK+C+CPSGYEVASPR+VEALY GCVPVLI  G
Sbjct  372   HWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVPVLINSG  431

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YVPPFSDVLNW +F+V++ VEDIPNLK ILT I   QY  + RR ++VRRHFEVN P KR
Sbjct  432   YVPPFSDVLNWKSFSVVVSVEDIPNLKTILTAISPRQYLRMYRRVLKVRRHFEVNSPAKR  491

Query  1390  FDVFHMILHSIWLRRLNIRVHHL  1458
             FDVFHMILHSIW+RRLN+R+  +
Sbjct  492   FDVFHMILHSIWVRRLNVRIREV  514



>gb|EPS64188.1| hypothetical protein M569_10593, partial [Genlisea aurea]
Length=383

 Score =   501 bits (1291),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 239/381 (63%), Positives = 293/381 (77%), Gaps = 4/381 (1%)
 Frame = +1

Query  322   KLEILESGLAQARSSIL--RGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYE  495
              L ILE+ L +AR+SI   R      D  Y+P G +Y + S+FHRSY EMEK  +V+VY 
Sbjct  1     NLHILEAKLKRARNSIRESRNGTAIDDPDYVPYGPVYHSPSAFHRSYKEMEKHFRVFVYG  60

Query  496   DGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKMIYVANS  675
             +G+ P+ H GPC SIY+ EG+FI+ ++ S FRT DP+ A VFFLP SV  + + +Y  NS
Sbjct  61    EGEHPIFHNGPCGSIYSTEGNFIYTVEGSSFRTRDPEKASVFFLPLSVAAIVRFVYDRNS  120

Query  676   HD-WSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRAL  852
              D W PMKRT  DYV  +A +YP+WNR+LG+DH MLSCHDWGPE+S S+P+L K +IRAL
Sbjct  121   GDQWGPMKRTVKDYVDLVAMRYPYWNRSLGSDHVMLSCHDWGPELSKSVPELFKNSIRAL  180

Query  853   CNANTSERFNPKKDVSIPEINLPDGT-TDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             CNANT+E F P KDV+IPEINLP G  T GLIGG   ++R +L F+AGG+HGPVRPILL+
Sbjct  181   CNANTTEGFKPAKDVAIPEINLPGGGRTKGLIGGLSASKRTILAFFAGGVHGPVRPILLE  240

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWENKD D++++ YLPK +SY   MRKS++C+CPSGYEVASPR+VEALY GCVPVLI   
Sbjct  241   HWENKDPDVQVYQYLPKRLSYSDQMRKSRFCICPSGYEVASPRIVEALYNGCVPVLINDH  300

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YVPPF DVLNW AFAV +PV +IPNLKKILT I   QY  L+RRG  VRRHFEVN+PPKR
Sbjct  301   YVPPFGDVLNWKAFAVEVPVGEIPNLKKILTAISTRQYIRLKRRGETVRRHFEVNFPPKR  360

Query  1390  FDVFHMILHSIWLRRLNIRVH  1452
             +DVFHM LHSIWLRRLN+R+H
Sbjct  361   YDVFHMTLHSIWLRRLNLRLH  381



>gb|KFK24839.1| hypothetical protein AALP_AA8G031400 [Arabis alpina]
Length=498

 Score =   506 bits (1302),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 232/383 (61%), Positives = 295/383 (77%), Gaps = 3/383 (1%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHYIPS--GSIYWNASSFHRSYVEMEKTLKVYVY  492
             + LE +E  L +AR++I   +     +       G +YWNA  FHRSY+EMEK  K++VY
Sbjct  116   SNLEKVEFELQKARAAIKASSIDDPVDDPDYVPLGPMYWNAKVFHRSYLEMEKQFKIFVY  175

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
             ++G+PP+ H GPCKSIY++EG FI+ M+  + FRT +PD AH F+LP SV  + + +Y  
Sbjct  176   KEGEPPLFHDGPCKSIYSMEGSFIYEMETNTHFRTNNPDKAHAFYLPLSVVKMVRFVYDR  235

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
             NS D+ P++ T  DY++ ++ +YP+WNR++GADHF+LSCHDWGPE S S P L + +IRA
Sbjct  236   NSRDFGPIRNTVRDYIELVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPHLGQNSIRA  295

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSERF P+KDVSIPEINL  G+  GL+GGP P+ RP+L F+AGG+HGPVRPILL+
Sbjct  296   LCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGGVHGPVRPILLE  355

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWENKD DI++H YLPK  SY  MMR SK+C+CPSGYEVASPR+VEALY GCVPVLI  G
Sbjct  356   HWENKDNDIRVHKYLPKGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVPVLINSG  415

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YVPPFSDVLNW +F+VI+ VE+IPNLK ILT I   QY  + RR ++VRRHFEVN P KR
Sbjct  416   YVPPFSDVLNWKSFSVIVSVEEIPNLKTILTSISPRQYLRMYRRVLKVRRHFEVNSPAKR  475

Query  1390  FDVFHMILHSIWLRRLNIRVHHL  1458
             FDVFHMILHSIW+RRLN+R+  +
Sbjct  476   FDVFHMILHSIWVRRLNVRIREV  498



>ref|XP_009130782.1| PREDICTED: probable glycosyltransferase At5g03795 [Brassica rapa]
Length=518

 Score =   506 bits (1303),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 232/382 (61%), Positives = 293/382 (77%), Gaps = 3/382 (1%)
 Frame = +1

Query  322   KLEILESGLAQARSSILRGNQLHSDEHYIPS--GSIYWNASSFHRSYVEMEKTLKVYVYE  495
             K++ +E  L +AR +I   +     +       G +YWNA  FHRSY+EMEK  K++VY+
Sbjct  137   KIDKIEFELQKARVAIKAASMDDPVDDPDYVPIGPMYWNAKVFHRSYLEMEKQFKIFVYK  196

Query  496   DGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVAN  672
             +G PP+ H GPCKSIY++EG+FI+ M+  + FRT +PD AH F+LP SV  + + +Y  +
Sbjct  197   EGDPPLFHDGPCKSIYSMEGNFIYEMERDTHFRTNNPDKAHAFYLPLSVVKMVRYVYQRD  256

Query  673   SHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRAL  852
             SHD+ P++RT  DY+  ++ +YP+WNR++GADHF+LSCHDWGPE S S P L + +IRAL
Sbjct  257   SHDFGPIRRTVRDYIDLVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPHLGQNSIRAL  316

Query  853   CNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQH  1032
             CNANTSERF P+KDVSIPEINL  G+  GL+GGP P+ RP+L F+AGG+HGPVRP+LLQH
Sbjct  317   CNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSIRPILAFFAGGVHGPVRPVLLQH  376

Query  1033  WENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGY  1212
             WENKD DI++H YLPK  SY  MMR SK+CLCPSGYEVA PR+VEALY GCVPVLI  GY
Sbjct  377   WENKDNDIRVHKYLPKGTSYPDMMRSSKFCLCPSGYEVAGPRIVEALYSGCVPVLINSGY  436

Query  1213  VPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRF  1392
             VPPFSDVLNW +F+VI+ VEDIP LK ILT I   QY  + RR ++VRRHFEVN P KRF
Sbjct  437   VPPFSDVLNWRSFSVIVSVEDIPKLKTILTSISPRQYLKMYRRVLKVRRHFEVNSPAKRF  496

Query  1393  DVFHMILHSIWLRRLNIRVHHL  1458
             DVFHMILHSIW+RRLN+R+  +
Sbjct  497   DVFHMILHSIWVRRLNVRIREV  518



>ref|XP_009413449.1| PREDICTED: probable glycosyltransferase At5g03795 [Musa acuminata 
subsp. malaccensis]
Length=514

 Score =   505 bits (1301),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 240/389 (62%), Positives = 300/389 (77%), Gaps = 7/389 (2%)
 Frame = +1

Query  307   AKSYTKLEILESGLAQARSSILR-----GNQLH-SDEHYIPSGSIYWNASSFHRSYVEME  468
              K YTKL+ LE GL +AR++I +     GN+    D+ Y+P G +Y NA +FHRSY+EME
Sbjct  120   GKRYTKLQRLELGLGRARAAIKKAFRNAGNRTALPDKDYVPQGPLYRNAYAFHRSYLEME  179

Query  469   KTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTV  645
             K  KVYVYE+G+PP+ H GPC+SIY+ EG FI++M+  S++RT +PD AHVFFLPFSV  
Sbjct  180   KLFKVYVYEEGEPPLFHDGPCRSIYSSEGRFINSMEMDSRYRTRNPDLAHVFFLPFSVAK  239

Query  646   LSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPD  825
             + K IY   S D SP+K+T  DY+  +A +YP+WNR+LGADHFMLSCHDWGP  S ++P+
Sbjct  240   MVKFIYKPESFDISPIKKTIADYIDVVAERYPYWNRSLGADHFMLSCHDWGPHSSKAVPN  299

Query  826   LQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHG  1005
             L   ++R LCNANTSE F+P KDVS+PEIN+       ++GGP  + RP+L F+AGG HG
Sbjct  300   LYGNSVRVLCNANTSEGFDPSKDVSLPEINIKTDVMADMMGGPSASHRPILAFFAGGDHG  359

Query  1006  PVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGC  1185
             PVRP+LL+ W++KD D+++H YLPK VSY+  MRKSKYCLCPSGYEVASPR+VEA+Y+GC
Sbjct  360   PVRPLLLEAWKDKDPDVQVHEYLPKGVSYYDTMRKSKYCLCPSGYEVASPRIVEAIYLGC  419

Query  1186  VPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHF  1365
             VPV I   YV PFSDVL+W AF+V I VEDIPN+KKIL  I  TQY  LQRRG  V+RHF
Sbjct  420   VPVTINDHYVLPFSDVLDWKAFSVQISVEDIPNIKKILMGISPTQYIRLQRRGAMVQRHF  479

Query  1366  EVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
              VN PP+RFDVFHMILHSIWLRRLNIR+H
Sbjct  480   VVNSPPRRFDVFHMILHSIWLRRLNIRMH  508



>ref|XP_007027565.1| Exostosin family protein, putative [Theobroma cacao]
 gb|EOY08067.1| Exostosin family protein, putative [Theobroma cacao]
Length=546

 Score =   504 bits (1298),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 242/387 (63%), Positives = 301/387 (78%), Gaps = 12/387 (3%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI---LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             + YTKL+ LE GL +AR++I   + G+QL  D  YIP G IY NA  FHRSY+EMEK  K
Sbjct  156   RVYTKLDRLEDGLRKARAAIKKAMNGSQLQ-DPDYIPDGPIYRNAKFFHRSYLEMEKKFK  214

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSKM  657
             +YVY++G+ P+ H GPC+ +Y +EG FI+ M+ ++ FRT +P+ AHVF+LP+SVT + + 
Sbjct  215   IYVYKEGELPLFHDGPCRLLYTMEGQFINKMEVNKKFRTYNPEKAHVFYLPYSVTRMVQY  274

Query  658   IYVANSHDWSPMKRTA---LDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              +V  +    PMKR     LDYV  IA KYPFWNR+LGADHFMLSCHDWGP  S  +PDL
Sbjct  275   NWVRGT----PMKRLGGIVLDYVNVIAGKYPFWNRSLGADHFMLSCHDWGPATSFYVPDL  330

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
              K +IRALCNANTSERFNP KDVSIPEI+L     +GLIGGP P++R +L F+AGG HG 
Sbjct  331   VKNSIRALCNANTSERFNPMKDVSIPEISLKSSRLEGLIGGPSPSQRTILAFFAGGNHGF  390

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             VRPIL +HWE KD  I++H+YLP+ V Y+ +MR+SKYCLCPSGYEVASPR+VEALY GCV
Sbjct  391   VRPILFRHWEKKDPAIRVHNYLPRRVPYYDLMRQSKYCLCPSGYEVASPRVVEALYNGCV  450

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI + YVPPFSDVLNW  F+V++ +EDIPNLKKIL  IP+ QY  +Q+R V+VRRHFE
Sbjct  451   PVLISKSYVPPFSDVLNWKMFSVMVSLEDIPNLKKILMSIPERQYIKMQKRVVQVRRHFE  510

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             ++  PKRFDVFHMILHSIWLRRLN++V
Sbjct  511   LHVTPKRFDVFHMILHSIWLRRLNVKV  537



>gb|KHN45704.1| Putative glycosyltransferase [Glycine soja]
Length=348

 Score =   496 bits (1276),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 222/344 (65%), Positives = 279/344 (81%), Gaps = 1/344 (0%)
 Frame = +1

Query  421   IYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTT  597
             +YWNA +FHRSY+EMEK  KV+VYE+G+ PV H GPCKSIY++EG+FIHA++ +  FRT 
Sbjct  1     MYWNAKTFHRSYLEMEKQFKVFVYEEGETPVFHNGPCKSIYSMEGNFIHAIEMNDHFRTK  60

Query  598   DPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFM  777
             DP  AHVFFLPFSV ++ + +Y  +S D+ P+++T +DY+  IA +Y +WNR+LGADHFM
Sbjct  61    DPKKAHVFFLPFSVVMMVRFVYQRDSRDFGPIRKTVIDYINLIAARYSYWNRSLGADHFM  120

Query  778   LSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPP  957
             L+CHDWGPE S S+P L K +IR LCNANTSE F P KDVS PEINL  G+ +G IGGP 
Sbjct  121   LACHDWGPEASLSLPYLHKNSIRVLCNANTSEGFKPAKDVSFPEINLQTGSINGFIGGPS  180

Query  958   PTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSG  1137
              ++R +L F+AGG+HGP+RPILL+HWENKDEDI++H YLPK VSY+  +R SK+CLCPSG
Sbjct  181   ASKRSILAFFAGGVHGPIRPILLEHWENKDEDIQVHKYLPKGVSYYDKLRNSKFCLCPSG  240

Query  1138  YEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQT  1317
             YEVASPR+VEA+Y GCVPVLI   YVPPFSDVLNW +F+V + V+DIPNLK IL  I   
Sbjct  241   YEVASPRVVEAIYTGCVPVLISEHYVPPFSDVLNWKSFSVELSVKDIPNLKDILMSISPR  300

Query  1318  QYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             QY  +QRR ++++RHFEV+ PPKRFDVFHMILHS+WLRRLN R+
Sbjct  301   QYIRMQRRVIQIQRHFEVHSPPKRFDVFHMILHSVWLRRLNFRM  344



>gb|KCW48767.1| hypothetical protein EUGRSUZ_K02411, partial [Eucalyptus grandis]
Length=345

 Score =   494 bits (1272),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 222/344 (65%), Positives = 278/344 (81%), Gaps = 1/344 (0%)
 Frame = +1

Query  391   SDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHA  570
              D  Y+P G +Y NA++FHRSY+EMEK  K++VY++G PPV H GPCKSIYA+EG+FIH 
Sbjct  2     EDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPVFHNGPCKSIYAMEGNFIHM  61

Query  571   MDFSQ-FRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFW  747
             ++ ++ FRT DP  AHVFFLPFSV ++ + +YV +SHD+ P+KRT +DY+  +A KYP+W
Sbjct  62    VEINKRFRTEDPREAHVFFLPFSVAMMVQFVYVRDSHDFGPIKRTVIDYIDVVASKYPYW  121

Query  748   NRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDG  927
             NR+LGADHFML+CHDWGPE S ++P L + +IR LCNANTSE F+P KDVS PE+NL  G
Sbjct  122   NRSLGADHFMLACHDWGPEASFAVPHLHRNSIRVLCNANTSEGFDPSKDVSFPEVNLHTG  181

Query  928   TTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMR  1107
                GLIGGP P+ R +L F+AGGLHGP+RPILLQHWENKDED+K+H YLP+ VSY+ MM+
Sbjct  182   AIGGLIGGPSPSHRSILAFFAGGLHGPIRPILLQHWENKDEDVKVHRYLPRGVSYYDMMK  241

Query  1108  KSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNL  1287
             +SK+C+CPSGYEVASPR+VEA+Y GCVPVLI   YVPPFSDVLNW +F+V + V +IPNL
Sbjct  242   RSKFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWRSFSVEVTVREIPNL  301

Query  1288  KKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHS  1419
             K IL  I   QY  +QRR  +VRRHFEV+ PPKR+DVFHMILHS
Sbjct  302   KTILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMILHS  345



>ref|XP_010039048.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At5g03795 [Eucalyptus grandis]
Length=382

 Score =   495 bits (1274),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 228/370 (62%), Positives = 289/370 (78%), Gaps = 11/370 (3%)
 Frame = +1

Query  337   ESGLAQARSSILRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVA  516
              SG+ +A++    GN +  D  Y+P G +Y NA++FHRSY+EMEK  K++VY++G PPV 
Sbjct  17    RSGIREAKT----GNPM-EDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPVF  71

Query  517   HYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPM  693
             H GPCKSIYA E +FIH ++ ++ FRT DP  AHVFFLPFSV ++ + +YV +SHD+ P+
Sbjct  72    HNGPCKSIYATERNFIHMVEINKRFRTGDPRKAHVFFLPFSVAMMVQFVYVRDSHDFGPI  131

Query  694   KRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSE  873
             KRT +DY+  +A KYP+WNR+LGADHFML+CHDWGP     +P L + +IR LCNANTSE
Sbjct  132   KRTVIDYIDVVAGKYPYWNRSLGADHFMLACHDWGP-----VPRLHRNSIRVLCNANTSE  186

Query  874   RFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDED  1053
              F+P KDVS PE+NL  G   GLIG   P+ R +L F+AGGLHGP+RPILLQHWENKDED
Sbjct  187   GFDPSKDVSFPEVNLHTGAISGLIGEASPSHRSILAFFAGGLHGPIRPILLQHWENKDED  246

Query  1054  IKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDV  1233
             +K+H YLP+ VSY+ MM++SK+C+CPSGYEVASPR+VEA+Y GCVPVLI   YVPPFSDV
Sbjct  247   VKVHRYLPRGVSYYDMMKRSKFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDV  306

Query  1234  LNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMIL  1413
             LNW +F+V + V +IPNLK IL  I   QY  +QRR  +VRRHFEV+ PPKR+DVFHMIL
Sbjct  307   LNWRSFSVEVTVREIPNLKTILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMIL  366

Query  1414  HSIWLRRLNI  1443
             HS+WLRRLN+
Sbjct  367   HSVWLRRLNV  376



>gb|KEH24082.1| glycosyltransferase [Medicago truncatula]
Length=402

 Score =   489 bits (1260),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 227/386 (59%), Positives = 299/386 (77%), Gaps = 5/386 (1%)
 Frame = +1

Query  307   AKSYTKLEILESGLAQARSSI---LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTL  477
             A   + L+ +E+ L QAR++I   + G Q   D  Y+P+G +Y   + FHRSY+EMEK  
Sbjct  15    AGKLSNLDRVEADLLQARAAIRKAVNGKQTQ-DIDYVPTGPMYHKPNLFHRSYLEMEKRF  73

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSK  654
             KV+VYE+G+PPV H GPC+ IY++EG FI+ M+ + +F T DP+ AHVFFL +SV ++  
Sbjct  74    KVFVYEEGEPPVFHDGPCRDIYSMEGIFINQMEMNDKFITKDPEKAHVFFLSYSVAMMVH  133

Query  655   MIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
              +YV +S  +  ++ T  DY+  ++ KYP+WNR+ GADHF+L+CHDWGPE+S ++P+L K
Sbjct  134   YVYVRDSRAYDLLRITVKDYINVLSEKYPYWNRSHGADHFILACHDWGPEVSNAVPNLYK  193

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              +IRA CNANTSE F P KDVSIPEIN+  G  D L+GGP P++R +L F+AGGLHG +R
Sbjct  194   NSIRAFCNANTSEGFKPVKDVSIPEINVRTGIIDDLLGGPSPSKRSILAFFAGGLHGDIR  253

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
              +LL+HWE+KDEDI++H YLPK VSY+ M+RKSK+CLCPSG+EVASPR+VEA+Y GCVPV
Sbjct  254   NVLLEHWEHKDEDIQVHKYLPKGVSYYAMLRKSKFCLCPSGWEVASPRVVEAIYTGCVPV  313

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             LI   YVPPFSDVLNW +F+V + V DIPNLKKIL++I   QY  +QRR  +VR+HFEVN
Sbjct  314   LISDHYVPPFSDVLNWKSFSVEVSVNDIPNLKKILSNISPRQYIRMQRRVGQVRKHFEVN  373

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRVH  1452
              PPKRFDVFHMILHSIWLRRLN+++H
Sbjct  374   SPPKRFDVFHMILHSIWLRRLNLKLH  399



>ref|XP_011101497.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=465

 Score =   491 bits (1263),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 238/452 (53%), Positives = 307/452 (68%), Gaps = 28/452 (6%)
 Frame = +1

Query  181   TTKLLWLFMVPFVLLSAFLVFRAPNKSWVFTFPYLKTLAVYGAK----------------  312
             ++KL++  ++P +L SA ++      S  +++P         AK                
Sbjct  9     SSKLVYFVVIPLILASALVLILNQKPSTTYSWPDSGAPPPVSAKDRELTSWAPPPPTAAA  68

Query  313   ---------SYTKLEILESGLAQARSSIL---RGNQLHSDEHYIPSGSIYWNASSFHRSY  456
                      +Y+ LE  E+ LA+AR+ I    R NQ   D  Y+PSG +Y N ++FHRSY
Sbjct  69    TMEDQIVEKNYSDLERAEASLARARARIQEAQRSNQTSYDPDYVPSGPMYRNPNAFHRSY  128

Query  457   VEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFS  636
             +EMEK  ++YVYEDG PP+ HY     I  IEG  IH ++ S FRT DP  AHVFF+P S
Sbjct  129   LEMEKLFRIYVYEDGDPPLFHYSKSLGILGIEGILIHHIEISNFRTRDPGKAHVFFVPIS  188

Query  637   VTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGS  816
                ++   YV ++  WSP++  A DYV  I+ KYP+WNRTLG DHFML+CHDW P+IS  
Sbjct  189   AQSIANYAYVIHNRAWSPLQNIARDYVNLISTKYPYWNRTLGHDHFMLACHDWAPKISKG  248

Query  817   IPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGG  996
             +P L K +IR LCNANTSE F P  DVS+PEI LP G  DGLIGGPPP+ R VLVFY+GG
Sbjct  249   VPLLFKNSIRVLCNANTSEGFKPSVDVSMPEIYLPGGKMDGLIGGPPPSTRSVLVFYSGG  308

Query  997   LHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALY  1176
             +HG +R IL+  W++KD +++IH YLP+N+SY+GM RKSKYC+CPSG+EVASPR VEALY
Sbjct  309   VHGYIRQILMDQWKDKDPEVQIHEYLPRNMSYYGMFRKSKYCICPSGWEVASPRTVEALY  368

Query  1177  MGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVR  1356
              GCVPVL+K  Y  PF DVL+WS F+V I V  IP LK +L  IP+ +Y  +QR GVEVR
Sbjct  369   TGCVPVLLKDHYAKPFDDVLDWSKFSVDIRVSQIPELKNVLKAIPEERYIEMQRIGVEVR  428

Query  1357  RHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             RHFEVN+PPKR+DVFHMILHSIWLRR+N+++H
Sbjct  429   RHFEVNFPPKRYDVFHMILHSIWLRRMNVQLH  460



>ref|XP_008381668.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=526

 Score =   491 bits (1264),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 228/388 (59%), Positives = 290/388 (75%), Gaps = 7/388 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y++LE LE+ LA  R+SI    ++      H D  Y+P G IY NA++FHRSY++MEK
Sbjct  134   KRYSRLEKLEANLAGVRASIREAARVRNLTSTHEDPDYVPRGPIYRNANAFHRSYLKMEK  193

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVL  648
               K+YVYE+G+PP+ H GPCKSIY+ EG FIH M+    +RT DPD A V+FLPFSV +L
Sbjct  194   HFKIYVYEEGEPPIFHNGPCKSIYSTEGRFIHEMEMENIYRTRDPDQALVYFLPFSVVML  253

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +YVA+SHD  P+ R  +DYV  I+ K+PFWNR+LGADHFMLSCHDWGP  S  +P L
Sbjct  254   VQYLYVADSHDTQPIGRAVVDYVNVISDKHPFWNRSLGADHFMLSCHDWGPSTSAYVPHL  313

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
              + +IR LCNANTSE FNP KDVS PEI+L  G T GL+GG  P+ R +L F+AG LHG 
Sbjct  314   YQNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGETKGLLGGLSPSRRSILAFFAGRLHGH  373

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R +LL  W+ KD+D++++  LP  VSY  M++KS++CLCPSGYEVASPR+VEA+Y  CV
Sbjct  374   IRYLLLNEWKEKDQDVQVYDQLPNGVSYESMLKKSRFCLCPSGYEVASPRVVEAIYAECV  433

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPFSDVL W +F+V + V+DIPN+K+IL  I Q+QY  +QRR  +V+RHF 
Sbjct  434   PVLISDSYVPPFSDVLEWKSFSVQVQVKDIPNIKRILMGISQSQYLRMQRRVKQVQRHFV  493

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             VN P KRFDVFHMI+HSIWLRRLNIR+ 
Sbjct  494   VNGPSKRFDVFHMIVHSIWLRRLNIRIE  521



>ref|XP_009593673.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana tomentosiformis]
Length=486

 Score =   488 bits (1257),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 233/441 (53%), Positives = 302/441 (68%), Gaps = 42/441 (10%)
 Frame = +1

Query  178   PTTKLLWLFMVPFVLLSAFLVFRAPNKSWVFTF---PYLKTLAVY---------------  303
             P ++++WL +VP VLL+A+ +    +K+ +      P  K +  Y               
Sbjct  8     PPSRVVWLIIVPLVLLAAWYLGVQSSKNSILVLSSQPSAKNVPTYTNLSAISATVAELAK  67

Query  304   --------------------GAKSYTKLEILESGLAQARSSILRG---NQLHSDEHYIPS  414
                                   K+ + LE +E+GL + R++I      N    D  Y P 
Sbjct  68    DQLPKQDGLDVTRKEPQMISSKKNLSNLEKVEAGLGKVRAAIREAQTKNLTSDDSEYAPK  127

Query  415   GSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRT  594
             G  YWN+S+FHRSY+EMEK  K+YVYE+G+PPV HY   + I  IEG  IH ++ S+FRT
Sbjct  128   GPCYWNSSAFHRSYLEMEKHFKIYVYEEGEPPVFHYSSSEGILGIEGILIHQIEISKFRT  187

Query  595   TDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHF  774
               P+ AHV+FLPFSV  +   +YV +SH W PMK TA DY+ SI+RKYPFWNR+LG+DHF
Sbjct  188   NYPEKAHVYFLPFSVFSIVSYVYVVDSHQWGPMKNTAADYIDSISRKYPFWNRSLGSDHF  247

Query  775   MLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGP  954
             ML+CHDW PEIS ++P L K +IR LCNANTSERFNP KDV++PEI LP GT +GLIGGP
Sbjct  248   MLACHDWAPEISTAVPYLYKNSIRVLCNANTSERFNPSKDVTLPEIYLPQGTMEGLIGGP  307

Query  955   PPTERPVLVFYAGGLHGPVRPILLQHW-ENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCP  1131
              P++R +LVFYAGG+HG +R +L++ W EN D +++IH YLPKNVSY+GM+RKSK+C+CP
Sbjct  308   SPSQRSILVFYAGGIHGYIRQVLMEQWGENDDPEVQIHEYLPKNVSYYGMIRKSKFCICP  367

Query  1132  SGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIP  1311
             SG+EVASPRMVEA Y+GCVPVL+K  YV PFSDVLNW +FAV +   DIPNLKKIL  I 
Sbjct  368   SGWEVASPRMVEAFYIGCVPVLLKDNYVAPFSDVLNWKSFAVEMTSNDIPNLKKILMSIS  427

Query  1312  QTQYEILQRRGVEVRRHFEVN  1374
             Q QY  +Q+RG++VRRHFEVN
Sbjct  428   QKQYIKMQKRGLQVRRHFEVN  448



>gb|EYU41560.1| hypothetical protein MIMGU_mgv1a005355mg [Erythranthe guttata]
Length=487

 Score =   488 bits (1257),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 224/381 (59%), Positives = 291/381 (76%), Gaps = 4/381 (1%)
 Frame = +1

Query  322   KLEILESGLAQARSSILRG---NQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVY  492
              L+++E+ LA+AR ++ +    N+   D  Y+P GSIY NA++FHRSY+EMEK  K+YVY
Sbjct  102   NLDMVEASLAKARETMHQARLNNETSFDPDYVPEGSIYRNANAFHRSYLEMEKLFKIYVY  161

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVLSKMIYVAN  672
             EDG PP+ HY   K I  IEG  IH ++ S+FRT DP  AHV+F+P SV  ++   YV +
Sbjct  162   EDGDPPLFHYSKSKGILGIEGILIHQIEISKFRTRDPGKAHVYFIPLSVQSIATYAYVIH  221

Query  673   SHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRAL  852
             +  WSP++  A DYV+ I+ KYP WN+TLG DHF+L CHDW P IS  +P L K +IR L
Sbjct  222   NRAWSPLQNIARDYVKLISTKYPHWNQTLGRDHFILGCHDWTPTISHGVPLLFKNSIRVL  281

Query  853   CNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQH  1032
             CNANTSE F P  DVS+PEI LP+GT DGLIGGPPP++R +LVFYAGG+HGP+R +L+  
Sbjct  282   CNANTSEGFKPSIDVSMPEIYLPEGTMDGLIGGPPPSDRSILVFYAGGVHGPIRQMLMDQ  341

Query  1033  W-ENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             W +NKD +++IH YLPKN+SY+ + R+SKYC+CPSG+EVASPRMVEALYMGCVPVL+K  
Sbjct  342   WKDNKDPEVQIHEYLPKNMSYYDVFRRSKYCICPSGWEVASPRMVEALYMGCVPVLLKES  401

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             Y  PF DVL+WS FAV + V++I +LKKIL  I   +Y  +QR G+ VRRHFEVN+PPKR
Sbjct  402   YAKPFDDVLDWSTFAVDVRVDEIRDLKKILMGISTEKYVEMQREGIRVRRHFEVNFPPKR  461

Query  1390  FDVFHMILHSIWLRRLNIRVH  1452
             +DVFHM+LHSIWLRR+N+++H
Sbjct  462   YDVFHMVLHSIWLRRINVQLH  482



>ref|XP_009593674.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana tomentosiformis]
Length=402

 Score =   483 bits (1244),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 220/363 (61%), Positives = 278/363 (77%), Gaps = 4/363 (1%)
 Frame = +1

Query  298   VYGAKSYTKLEILESGLAQARSSILRG---NQLHSDEHYIPSGSIYWNASSFHRSYVEME  468
             +   K+ + LE +E+GL + R++I      N    D  Y P G  YWN+S+FHRSY+EME
Sbjct  2     ISSKKNLSNLEKVEAGLGKVRAAIREAQTKNLTSDDSEYAPKGPCYWNSSAFHRSYLEME  61

Query  469   KTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTTDPDSAHVFFLPFSVTVL  648
             K  K+YVYE+G+PPV HY   + I  IEG  IH ++ S+FRT  P+ AHV+FLPFSV  +
Sbjct  62    KHFKIYVYEEGEPPVFHYSSSEGILGIEGILIHQIEISKFRTNYPEKAHVYFLPFSVFSI  121

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
                +YV +SH W PMK TA DY+ SI+RKYPFWNR+LG+DHFML+CHDW PEIS ++P L
Sbjct  122   VSYVYVVDSHQWGPMKNTAADYIDSISRKYPFWNRSLGSDHFMLACHDWAPEISTAVPYL  181

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
              K +IR LCNANTSERFNP KDV++PEI LP GT +GLIGGP P++R +LVFYAGG+HG 
Sbjct  182   YKNSIRVLCNANTSERFNPSKDVTLPEIYLPQGTMEGLIGGPSPSQRSILVFYAGGIHGY  241

Query  1009  VRPILLQHW-ENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGC  1185
             +R +L++ W EN D +++IH YLPKNVSY+GM+RKSK+C+CPSG+EVASPRMVEA Y+GC
Sbjct  242   IRQVLMEQWGENDDPEVQIHEYLPKNVSYYGMIRKSKFCICPSGWEVASPRMVEAFYIGC  301

Query  1186  VPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHF  1365
             VPVL+K  YV PFSDVLNW +FAV +   DIPNLKKIL  I Q QY  +Q+RG++VRRHF
Sbjct  302   VPVLLKDNYVAPFSDVLNWKSFAVEMTSNDIPNLKKILMSISQKQYIKMQKRGLQVRRHF  361

Query  1366  EVN  1374
             EVN
Sbjct  362   EVN  364



>emb|CBI28483.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   483 bits (1243),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 229/398 (58%), Positives = 295/398 (74%), Gaps = 7/398 (2%)
 Frame = +1

Query  280   YLKTLAVYGAKSYTKLEILESGLAQARSSI---LRGNQL---HSDEHYIPSGSIYWNASS  441
             Y K    +  K Y+KLE LE+GLA+ARSSI    R   L   H D  Y+P G IY NA++
Sbjct  18    YEKKQETWKDKRYSKLERLEAGLARARSSIREAARNGSLKSTHEDPDYVPQGPIYRNANA  77

Query  442   FHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPDSAHV  618
             FHRSY+EMEK  K+YVYE+G+PP+ H GPCKSIY+ EG FIH M+  S +RTTDPD A +
Sbjct  78    FHRSYLEMEKLFKIYVYEEGEPPMFHNGPCKSIYSTEGRFIHEMEKGSVYRTTDPDQALL  137

Query  619   FFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWG  798
             +FLPFSV ++ + +YV +SH+   +++T +DY+  I+  +PFWNR+LGADHFMLSCHDWG
Sbjct  138   YFLPFSVVMMVQYLYVPDSHEIHAIEKTVIDYINLISHNHPFWNRSLGADHFMLSCHDWG  197

Query  799   PEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVL  978
             P  S S+P L   +IR LCNANTSE FNP KDVS PEI+L  G   G +GG  P+ RP+L
Sbjct  198   PRASTSVPYLYNNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGEMSGPLGGLSPSRRPIL  257

Query  979   VFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPR  1158
              F+AG LHG +R +LL+ W++KD+D++++  LP  +SY  M++KS++CLCPSGYEVASPR
Sbjct  258   GFFAGRLHGHIRYLLLEQWKDKDKDLQVYDQLPNGLSYDSMLKKSRFCLCPSGYEVASPR  317

Query  1159  MVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQR  1338
             +VEA+Y  CVPVLI   YVPPF+DVLNW +FAV + V DI N+K+IL  I QTQY  + R
Sbjct  318   VVEAIYAECVPVLISDNYVPPFNDVLNWKSFAVQVQVRDIANIKRILMGISQTQYLRMYR  377

Query  1339  RGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             R  +V+RHF VN  P+RFDVFHM +HSIWLRRLNIR+ 
Sbjct  378   RVKQVQRHFMVNAAPQRFDVFHMTIHSIWLRRLNIRIQ  415



>ref|XP_009622709.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
tomentosiformis]
Length=524

 Score =   485 bits (1249),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 227/388 (59%), Positives = 287/388 (74%), Gaps = 7/388 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQ------LHSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y++LE +E+ LA+ARSSI    +       H D  Y+P G +Y NA+SFHRSY+EMEK
Sbjct  136   KMYSRLERVEAILAKARSSIREAARNGSMISSHQDPDYVPQGPMYHNANSFHRSYLEMEK  195

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQF-RTTDPDSAHVFFLPFSVTVL  648
               K YVYE+G+PP+ H GPC+SIY+ EG FIH M+   F RT DPD A V+FLPFSV V+
Sbjct  196   NFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTKDPDEAMVYFLPFSVVVM  255

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
                +YV  +HD   +  T  DYV+ I+ ++ FWNR+LGADHFMLSCHDWGP  +  +P L
Sbjct  256   VHYLYVPGAHDMHTIGTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPRSTSYVPHL  315

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KDVS+PEI+L  G   GLIGGP P+ R +L F+AGGLHG 
Sbjct  316   FNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLIGGPSPSTRSILAFFAGGLHGN  375

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R  LL+ W+ KDED+ ++  LP++ SY  M++KSK+CLCPSGYEVASPR+VEA+Y  C+
Sbjct  376   IRHHLLKQWKGKDEDVLVYEKLPRSKSYESMLKKSKFCLCPSGYEVASPRVVEAIYAECI  435

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPFSDVLNW +F+V + V+DIPN+KKIL  I Q+QY  + RR  +V+RHF 
Sbjct  436   PVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHFV  495

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             +N PPKRFD+FHM +HSIWLRRLNIRVH
Sbjct  496   INGPPKRFDLFHMTVHSIWLRRLNIRVH  523



>ref|XP_002524591.1| catalytic, putative [Ricinus communis]
 gb|EEF37799.1| catalytic, putative [Ricinus communis]
Length=507

 Score =   484 bits (1247),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 225/393 (57%), Positives = 288/393 (73%), Gaps = 7/393 (2%)
 Frame = +1

Query  307   AKSYTKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHRSYVEME  468
              K Y++LE LE+ LA+ RSSI    Q+      H D  Y+P G +Y NA++FHRSY+EME
Sbjct  115   VKRYSRLEKLEASLARVRSSIREAAQVRNLSSVHDDPDYVPQGPVYRNANAFHRSYLEME  174

Query  469   KTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTV  645
             K  K+YVYE+G PP+ H GPCKSIY+ EG FIH ++  + +RT DPD A V+FLPFSV +
Sbjct  175   KQFKIYVYEEGGPPMYHDGPCKSIYSSEGRFIHELEKGKLYRTLDPDEALVYFLPFSVVM  234

Query  646   LSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPD  825
             + + +YV +SH+ + + R  +DY+  I+ K+PFWNR+LGADHFMLSCHDWGP  S  +P 
Sbjct  235   MVEYLYVPDSHETNAIGRAIVDYIHVISNKHPFWNRSLGADHFMLSCHDWGPRASSYVPH  294

Query  826   LQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHG  1005
             L   +IR LCNANTSE FNP KD S PEI+L  G   GL+GG  P+ R +L F+AG LHG
Sbjct  295   LFNSSIRVLCNANTSEGFNPSKDASFPEIHLKTGEISGLLGGVSPSRRSILAFFAGRLHG  354

Query  1006  PVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGC  1185
              +R ILL+ W+NKDED++++  +P  VSY  M++ S++CLCPSGYEVASPR+VEA+Y  C
Sbjct  355   HIRQILLEQWKNKDEDVQVYDQMPNGVSYESMLKTSRFCLCPSGYEVASPRIVEAIYTEC  414

Query  1186  VPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHF  1365
             VPVLI   YVPPFSDVLNW AF+V I V DIP +K+IL  I Q QY  +QRR  +V+RHF
Sbjct  415   VPVLISDNYVPPFSDVLNWKAFSVQIQVRDIPKIKEILMGISQRQYLRMQRRLKQVQRHF  474

Query  1366  EVNWPPKRFDVFHMILHSIWLRRLNIRVHHLNN  1464
              VN PPKRFD+FHM +HSIWLRRLNI +  L+N
Sbjct  475   VVNGPPKRFDMFHMTIHSIWLRRLNIHIQDLSN  507



>ref|XP_002264076.2| PREDICTED: probable glycosyltransferase At5g03795 [Vitis vinifera]
Length=484

 Score =   482 bits (1241),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 230/402 (57%), Positives = 296/402 (74%), Gaps = 7/402 (2%)
 Frame = +1

Query  268   FTFPYLKTLAVYGAKSYTKLEILESGLAQARSSI---LRGNQL---HSDEHYIPSGSIYW  429
             F  P  K    +  K Y+KLE LE+GLA+ARSSI    R   L   H D  Y+P G IY 
Sbjct  82    FQPPLEKKQETWKDKRYSKLERLEAGLARARSSIREAARNGSLKSTHEDPDYVPQGPIYR  141

Query  430   NASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPD  606
             NA++FHRSY+EMEK  K+YVYE+G+PP+ H GPCKSIY+ EG FIH M+  S +RTTDPD
Sbjct  142   NANAFHRSYLEMEKLFKIYVYEEGEPPMFHNGPCKSIYSTEGRFIHEMEKGSVYRTTDPD  201

Query  607   SAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSC  786
              A ++FLPFSV ++ + +YV +SH+   +++T +DY+  I+  +PFWNR+LGADHFMLSC
Sbjct  202   QALLYFLPFSVVMMVQYLYVPDSHEIHAIEKTVIDYINLISHNHPFWNRSLGADHFMLSC  261

Query  787   HDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTE  966
             HDWGP  S S+P L   +IR LCNANTSE FNP KDVS PEI+L  G   G +GG  P+ 
Sbjct  262   HDWGPRASTSVPYLYNNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGEMSGPLGGLSPSR  321

Query  967   RPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEV  1146
             RP+L F+AG LHG +R +LL+ W++KD+D++++  LP  +SY  M++KS++CLCPSGYEV
Sbjct  322   RPILGFFAGRLHGHIRYLLLEQWKDKDKDLQVYDQLPNGLSYDSMLKKSRFCLCPSGYEV  381

Query  1147  ASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYE  1326
             ASPR+VEA+Y  CVPVLI   YVPPF+DVLNW +FAV + V DI N+K+IL  I QTQY 
Sbjct  382   ASPRVVEAIYAECVPVLISDNYVPPFNDVLNWKSFAVQVQVRDIANIKRILMGISQTQYL  441

Query  1327  ILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
              + RR  +V+RHF VN  P+RFDVFHM +HSIWLRRLNIR+ 
Sbjct  442   RMYRRVKQVQRHFMVNAAPQRFDVFHMTIHSIWLRRLNIRIQ  483



>ref|XP_010252860.1| PREDICTED: probable glycosyltransferase At3g07620 [Nelumbo nucifera]
Length=517

 Score =   483 bits (1242),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 229/393 (58%), Positives = 294/393 (75%), Gaps = 11/393 (3%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRG-----NQL--HSDEH--YIPSGSIYWNASSFHRSY  456
             G K Y+KL  LE+GLA+AR+SI        NQ   H D+   Y+P G IY NA  FHRSY
Sbjct  123   GVKRYSKLMRLEAGLARARASIRMASAQSRNQTSTHDDDDPDYVPRGPIYRNAFVFHRSY  182

Query  457   VEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS--QFRTTDPDSAHVFFLP  630
             +EMEK  K++VYE+G PP+ H GPC+SIY+ EG FI+ M+ +   +RT DPD AHV+FLP
Sbjct  183   LEMEKIFKIFVYEEGDPPLFHNGPCRSIYSTEGRFINEMEKAGNHYRTRDPDEAHVYFLP  242

Query  631   FSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEIS  810
             FSV ++ + +YV +SH+   + RT +DY+  ++ KYP+WNR+LGADHFMLSCHDWGP  S
Sbjct  243   FSVVMMVQFLYVPDSHEIDSIGRTVVDYINILSAKYPYWNRSLGADHFMLSCHDWGPRTS  302

Query  811   GSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYA  990
               + +L   +IR LCNANTSE FNP KD S PEI+L  G   GL+GG  P+ RP+L F+A
Sbjct  303   AYVRELFDNSIRVLCNANTSEGFNPLKDASFPEIHLRTGEITGLLGGLSPSRRPLLAFFA  362

Query  991   GGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             G LHG +R +LLQ W+++D+D++++  LP  +SY+ M++KSKYCLCPSGYEVASPR+VEA
Sbjct  363   GRLHGNIRLLLLQEWKDRDKDVQVYDELPDGMSYNEMLKKSKYCLCPSGYEVASPRIVEA  422

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
             +Y  CVPVLI   YVPPFSDVLNW++F+V I V DIPN+K IL+ I QTQY  +QRR  +
Sbjct  423   IYAECVPVLISDHYVPPFSDVLNWNSFSVQIAVSDIPNIKTILSSISQTQYIRMQRRVKQ  482

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             V+RHF VN PP+RFDVFHMILHSIWLRRLNI +
Sbjct  483   VQRHFVVNGPPQRFDVFHMILHSIWLRRLNIHI  515



>ref|XP_009782027.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X4 
[Nicotiana sylvestris]
Length=523

 Score =   483 bits (1242),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 225/388 (58%), Positives = 288/388 (74%), Gaps = 7/388 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI---LRGNQL---HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y++LE +E+ LA++RSSI    R   +   H D  Y+P G +Y NA+SFHRSY+EMEK
Sbjct  135   KMYSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNANSFHRSYLEMEK  194

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQF-RTTDPDSAHVFFLPFSVTVL  648
             + K YVYE+G+PP+ H GPC+SIY+ EG FIH M+   F RT DPD A V+FLPFSV V+
Sbjct  195   SFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAMVYFLPFSVVVM  254

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
                +YV  +HD   +  T  DYV+ I+ ++ FWNR+LGADHFMLSCHDWGP  +  +P L
Sbjct  255   VHYLYVPGAHDMHTIGTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPHSTSYVPHL  314

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KDVS+PEI+L  G   GL+GGP P+ R +L F+AGGLHG 
Sbjct  315   FNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPSTRSILAFFAGGLHGN  374

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R  LL+ W+ KDE++ ++  LP+  SY  M++ SK+CLCPSGYEVASPR+VEA+Y  C+
Sbjct  375   IRHHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEVASPRIVEAIYAECI  434

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPFSDVLNW +F+V + V+DIPN+KKIL  I Q+QY  + RR  +V+RHF 
Sbjct  435   PVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHFM  494

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             +N PPKRFD+FHMI+HSIWLRRLNIRVH
Sbjct  495   INGPPKRFDLFHMIVHSIWLRRLNIRVH  522



>gb|EMT30821.1| Exostosin-2 [Aegilops tauschii]
Length=537

 Score =   483 bits (1243),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 232/385 (60%), Positives = 285/385 (74%), Gaps = 7/385 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSI---LRGNQLH---SDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
              KLE +E GLA+AR  I   +R        +D  Y+P G +Y NA +FHRSY+EMEK  K
Sbjct  150   VKLERVELGLAKARLVIREAIRNKDKRPPLTDRDYVPVGPVYRNAYAFHRSYLEMEKLFK  209

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             VYVYE+G+PPV H GPC+SIY+ EG FI AM+  ++ RT DP+ AHVFFLPFSV  + KM
Sbjct  210   VYVYEEGEPPVFHDGPCRSIYSSEGRFIFAMEMENRMRTRDPELAHVFFLPFSVVKMVKM  269

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             IY  NSHD  P++RT  DY+  ++ KYP+WNR+LGADHFMLSCHDWGP +S +   L   
Sbjct  270   IYEPNSHDMEPLRRTLSDYIDVLSTKYPYWNRSLGADHFMLSCHDWGPYVSSADGHLFSN  329

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE FNP KDVS+PEI L     D  +GGP  + RP+L F+AGG HGPVRP
Sbjct  330   SIRVLCNANTSEGFNPSKDVSLPEITLRTDIVDNQVGGPSASRRPILAFFAGGDHGPVRP  389

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             +LL+HW+ KD D+++  YLP+ VSY  +MR+SK+CLCPSGYEVASPR+VEA+Y+ CVPV+
Sbjct  390   LLLRHWKGKDADVQVSEYLPRGVSYINVMRRSKFCLCPSGYEVASPRVVEAIYLECVPVV  449

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I   YV PFSDVLNW AF+V + V DIPNLK IL  +   QY  +QR    VRRHF VN 
Sbjct  450   IGDDYVLPFSDVLNWPAFSVRVAVADIPNLKTILAAVSPRQYIRMQRGVRPVRRHFMVNG  509

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVH  1452
             PP+RFDVFHMILHSIWLRRLN+R+H
Sbjct  510   PPRRFDVFHMILHSIWLRRLNVRLH  534



>ref|XP_006354423.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=511

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 227/387 (59%), Positives = 290/387 (75%), Gaps = 7/387 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI---LRGNQL---HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y+KLE LE+ LA++RSSI    R   +   H D  Y+P G +Y NA++FHRSY+EMEK
Sbjct  123   KMYSKLERLEAILAKSRSSIREAARNGSMISNHHDPDYVPQGPMYHNANAFHRSYLEMEK  182

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPDSAHVFFLPFSVTVL  648
               KVYVYE+G+PP+ H GPC+SIY+ EG FIH M+  S +RT +PD A V+FLPFSV V+
Sbjct  183   NFKVYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMERGSLYRTKNPDEALVYFLPFSVVVM  242

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + ++V  +HD   + RT  DYV+ I+ ++ FWNR+ GADHFMLSCHDWGP ++  +P L
Sbjct  243   VQYLFVPGAHDMHVIGRTVADYVKVISERHSFWNRSRGADHFMLSCHDWGPHLTSYVPHL  302

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KDVS+PEINL  G   GLIGGP P+ R +L F+AGGLHG 
Sbjct  303   FNTSIRVLCNANTSEGFNPLKDVSLPEINLKTGDIKGLIGGPSPSRRSILAFFAGGLHGN  362

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R  LL+ W+ KDED+ ++  LP + SY  M++ S++CLCPSGYEVASPR+VEA+Y  C+
Sbjct  363   IRHHLLEQWKGKDEDVLVYDKLPNDKSYETMLKNSRFCLCPSGYEVASPRIVEAIYAECI  422

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPFSDVLNW+AF+V I V+DIPN+KKIL  I Q+QY  + RR  +V+RHF 
Sbjct  423   PVLISDSYVPPFSDVLNWNAFSVTIGVKDIPNIKKILISISQSQYLRMHRRVKQVQRHFV  482

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             +N  PKRFD+FHMI+HSIWLRRLNIRV
Sbjct  483   INGSPKRFDLFHMIVHSIWLRRLNIRV  509



>ref|XP_002320538.2| hypothetical protein POPTR_0014s16920g [Populus trichocarpa]
 gb|EEE98853.2| hypothetical protein POPTR_0014s16920g [Populus trichocarpa]
Length=452

 Score =   479 bits (1233),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 222/388 (57%), Positives = 285/388 (73%), Gaps = 7/388 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRG------NQLHSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K ++KLE +E+ LA+ RSSI           ++ D  Y+P G IY NA++FHRSY+EMEK
Sbjct  64    KRHSKLEKMEANLAKIRSSIREAARVRNLTSIYEDPDYVPKGPIYRNANAFHRSYLEMEK  123

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVL  648
               K+Y+Y++G PP+ H GPCKSIY+ EG FIH ++  + F TTDPD A V+FLPFSV +L
Sbjct  124   LFKIYIYKEGDPPMFHDGPCKSIYSSEGRFIHELEKGKSFTTTDPDEALVYFLPFSVVML  183

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +YV  SH+   +  T +DY+  IA KYPFWNR+LGADHF+LSCHDWGP  S  +P L
Sbjct  184   VQYLYVPGSHEIDAIGNTVVDYINVIADKYPFWNRSLGADHFILSCHDWGPRTSSYVPHL  243

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNPKKD S PEI+L  G   GL+GGP P+ R +L F+AG LHG 
Sbjct  244   FNNSIRVLCNANTSEGFNPKKDASFPEIHLRTGEITGLVGGPSPSRRSILAFFAGRLHGH  303

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R +LL+ W++KD+D+++H  L   +SY  M++ S++CLCPSGYEVASPR+VEA+Y  CV
Sbjct  304   IRRLLLEQWKDKDQDVQVHDQLRNGMSYDSMLKNSRFCLCPSGYEVASPRIVEAIYAECV  363

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI  GYVPPFSDVLNW AF++ + V+DIP +K IL  I Q QY  +QRR  +V+RHF 
Sbjct  364   PVLISDGYVPPFSDVLNWKAFSIQVQVKDIPKIKDILMGISQRQYLRMQRRVKQVQRHFV  423

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             VN  PKRFDVFHM +HSIWLRRLNIR+H
Sbjct  424   VNGIPKRFDVFHMTIHSIWLRRLNIRIH  451



>ref|XP_009782025.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana sylvestris]
Length=549

 Score =   482 bits (1241),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 225/388 (58%), Positives = 288/388 (74%), Gaps = 7/388 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI---LRGNQL---HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y++LE +E+ LA++RSSI    R   +   H D  Y+P G +Y NA+SFHRSY+EMEK
Sbjct  161   KMYSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNANSFHRSYLEMEK  220

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQF-RTTDPDSAHVFFLPFSVTVL  648
             + K YVYE+G+PP+ H GPC+SIY+ EG FIH M+   F RT DPD A V+FLPFSV V+
Sbjct  221   SFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAMVYFLPFSVVVM  280

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
                +YV  +HD   +  T  DYV+ I+ ++ FWNR+LGADHFMLSCHDWGP  +  +P L
Sbjct  281   VHYLYVPGAHDMHTIGTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPHSTSYVPHL  340

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KDVS+PEI+L  G   GL+GGP P+ R +L F+AGGLHG 
Sbjct  341   FNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPSTRSILAFFAGGLHGN  400

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R  LL+ W+ KDE++ ++  LP+  SY  M++ SK+CLCPSGYEVASPR+VEA+Y  C+
Sbjct  401   IRHHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEVASPRIVEAIYAECI  460

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPFSDVLNW +F+V + V+DIPN+KKIL  I Q+QY  + RR  +V+RHF 
Sbjct  461   PVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHFM  520

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             +N PPKRFD+FHMI+HSIWLRRLNIRVH
Sbjct  521   INGPPKRFDLFHMIVHSIWLRRLNIRVH  548



>ref|XP_009782026.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X3 
[Nicotiana sylvestris]
Length=524

 Score =   481 bits (1239),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 225/388 (58%), Positives = 288/388 (74%), Gaps = 7/388 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI---LRGNQL---HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y++LE +E+ LA++RSSI    R   +   H D  Y+P G +Y NA+SFHRSY+EMEK
Sbjct  136   KMYSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNANSFHRSYLEMEK  195

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQF-RTTDPDSAHVFFLPFSVTVL  648
             + K YVYE+G+PP+ H GPC+SIY+ EG FIH M+   F RT DPD A V+FLPFSV V+
Sbjct  196   SFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAMVYFLPFSVVVM  255

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
                +YV  +HD   +  T  DYV+ I+ ++ FWNR+LGADHFMLSCHDWGP  +  +P L
Sbjct  256   VHYLYVPGAHDMHTIGTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPHSTSYVPHL  315

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KDVS+PEI+L  G   GL+GGP P+ R +L F+AGGLHG 
Sbjct  316   FNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPSTRSILAFFAGGLHGN  375

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R  LL+ W+ KDE++ ++  LP+  SY  M++ SK+CLCPSGYEVASPR+VEA+Y  C+
Sbjct  376   IRHHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEVASPRIVEAIYAECI  435

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPFSDVLNW +F+V + V+DIPN+KKIL  I Q+QY  + RR  +V+RHF 
Sbjct  436   PVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHFM  495

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             +N PPKRFD+FHMI+HSIWLRRLNIRVH
Sbjct  496   INGPPKRFDLFHMIVHSIWLRRLNIRVH  523



>ref|XP_009782024.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana sylvestris]
Length=553

 Score =   482 bits (1241),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 225/388 (58%), Positives = 288/388 (74%), Gaps = 7/388 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI---LRGNQL---HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y++LE +E+ LA++RSSI    R   +   H D  Y+P G +Y NA+SFHRSY+EMEK
Sbjct  165   KMYSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNANSFHRSYLEMEK  224

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQF-RTTDPDSAHVFFLPFSVTVL  648
             + K YVYE+G+PP+ H GPC+SIY+ EG FIH M+   F RT DPD A V+FLPFSV V+
Sbjct  225   SFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAMVYFLPFSVVVM  284

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
                +YV  +HD   +  T  DYV+ I+ ++ FWNR+LGADHFMLSCHDWGP  +  +P L
Sbjct  285   VHYLYVPGAHDMHTIGTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPHSTSYVPHL  344

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KDVS+PEI+L  G   GL+GGP P+ R +L F+AGGLHG 
Sbjct  345   FNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPSTRSILAFFAGGLHGN  404

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R  LL+ W+ KDE++ ++  LP+  SY  M++ SK+CLCPSGYEVASPR+VEA+Y  C+
Sbjct  405   IRHHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEVASPRIVEAIYAECI  464

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPFSDVLNW +F+V + V+DIPN+KKIL  I Q+QY  + RR  +V+RHF 
Sbjct  465   PVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHFM  524

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             +N PPKRFD+FHMI+HSIWLRRLNIRVH
Sbjct  525   INGPPKRFDLFHMIVHSIWLRRLNIRVH  552



>ref|XP_006447859.1| hypothetical protein CICLE_v10017948mg [Citrus clementina]
 gb|ESR61099.1| hypothetical protein CICLE_v10017948mg [Citrus clementina]
Length=524

 Score =   480 bits (1236),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 224/389 (58%), Positives = 288/389 (74%), Gaps = 7/389 (2%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRG------NQLHSDEHYIPSGSIYWNASSFHRSYVEM  465
               K Y KLE +E+ L +ARSSI           +H D  Y+P G IY NA++FHRSY+ M
Sbjct  129   AVKKYNKLERVEASLVRARSSIREAALVRNLTSVHQDPDYVPRGPIYRNANAFHRSYLLM  188

Query  466   EKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVT  642
             EK  K+YVYE+G+PP+ H GPCKSIY+ EG FIH M+ S  ++T DP+ A V+FLPFSV 
Sbjct  189   EKLFKIYVYEEGEPPMFHDGPCKSIYSTEGRFIHEMERSNMYKTKDPEKALVYFLPFSVV  248

Query  643   VLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIP  822
             ++ + +YV  +H+ + + R+ +DY+  I+ KYPFWNR+LGADHFMLSCHDWGP  S  +P
Sbjct  249   MMVEHLYVPGAHEINAIGRSIVDYISIISHKYPFWNRSLGADHFMLSCHDWGPRSSSFVP  308

Query  823   DLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLH  1002
              L + +IR LCNANTSE FNP KD S+PEINL  G   GLIGGP P+ R +L F+AG LH
Sbjct  309   HLFRNSIRVLCNANTSEGFNPVKDASLPEINLLTGEVTGLIGGPSPSRRSILAFFAGRLH  368

Query  1003  GPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMG  1182
             G +R +LL +W+NKD+D++++  LP NVSY+ M+RKSK+CLCPSGYEVASPR+VEA+Y  
Sbjct  369   GHIRHLLLDNWKNKDQDVQVYDKLPNNVSYNSMLRKSKFCLCPSGYEVASPRVVEAIYSE  428

Query  1183  CVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRH  1362
             CVPVLI   +VPPFSDVLNW+AF+V I V+DIP +K+IL  I Q QY  +QRR  +V+RH
Sbjct  429   CVPVLISDSFVPPFSDVLNWNAFSVQIDVKDIPKIKEILKGISQRQYLRMQRRVKQVQRH  488

Query  1363  FEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             F  N   KRFDVFHM +HS+WLRRLNI +
Sbjct  489   FVANQSLKRFDVFHMTVHSVWLRRLNIHI  517



>ref|XP_006469477.1| PREDICTED: probable glycosyltransferase At5g03795-like [Citrus 
sinensis]
Length=524

 Score =   480 bits (1235),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 224/389 (58%), Positives = 287/389 (74%), Gaps = 7/389 (2%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRG------NQLHSDEHYIPSGSIYWNASSFHRSYVEM  465
               K Y KLE +E+ L +ARSSI           +H D  Y+P G IY NA++FHRSY+ M
Sbjct  129   AVKKYNKLERVEASLVRARSSIREAALVRNLTSVHQDPDYVPRGPIYRNANAFHRSYLLM  188

Query  466   EKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVT  642
             EK  K+YVYE+G+PP+ H GPCKSIY+ EG FIH M+ S  ++T DP+ A V+FLPFSV 
Sbjct  189   EKLFKIYVYEEGEPPMFHDGPCKSIYSTEGRFIHEMERSNMYKTKDPEKALVYFLPFSVV  248

Query  643   VLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIP  822
             ++   +YV  +H+ + + R+ +DY+  I+ KYPFWNR+LGADHFMLSCHDWGP  S  +P
Sbjct  249   MMVAHLYVPGAHEINAIGRSIVDYISIISHKYPFWNRSLGADHFMLSCHDWGPRSSSFVP  308

Query  823   DLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLH  1002
              L + +IR LCNANTSE FNP KD S+PEINL  G   GLIGGP P+ R +L F+AG LH
Sbjct  309   HLFRNSIRVLCNANTSEGFNPVKDASLPEINLLTGEVTGLIGGPSPSRRSILAFFAGRLH  368

Query  1003  GPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMG  1182
             G +R +LL +W+NKD+D++++  LP NVSY+ M+RKSK+CLCPSGYEVASPR+VEA+Y  
Sbjct  369   GHIRHLLLDNWKNKDQDVQVYDKLPNNVSYNSMLRKSKFCLCPSGYEVASPRVVEAIYSE  428

Query  1183  CVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRH  1362
             CVPVLI   +VPPFSDVLNW+AF+V I V+DIP +K+IL  I Q QY  +QRR  +V+RH
Sbjct  429   CVPVLISDSFVPPFSDVLNWNAFSVQIDVKDIPKIKEILKGISQRQYLRMQRRVKQVQRH  488

Query  1363  FEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             F  N   KRFDVFHM +HS+WLRRLNI +
Sbjct  489   FVANQSLKRFDVFHMTVHSVWLRRLNIHI  517



>ref|XP_008459522.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
Length=514

 Score =   479 bits (1233),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 225/395 (57%), Positives = 289/395 (73%), Gaps = 7/395 (2%)
 Frame = +1

Query  289   TLAVYGAKSYTKLEILESGLAQARSSILRGNQLHS------DEHYIPSGSIYWNASSFHR  450
             T  +   K Y+KL+ LE  L +AR++I + +QLH+      D  Y+P+G IY N ++FHR
Sbjct  119   TSGISKTKGYSKLKKLEEKLGRARAAIRKASQLHNLTSIHHDPDYVPTGPIYRNPNAFHR  178

Query  451   SYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTT-DPDSAHVFFL  627
             SY+EME+ LK+YVY++G+PP+ H GPCKSIY+ EG FIH M+     TT DPD A ++FL
Sbjct  179   SYLEMERLLKIYVYKEGEPPMFHGGPCKSIYSTEGRFIHEMEKGNLYTTNDPDQALLYFL  238

Query  628   PFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEI  807
             PFSV  L + +YV NSH+ + + R   DY+  I++K+PFW+R+LGADHFMLSCHDWGP  
Sbjct  239   PFSVVNLVQYLYVPNSHEVNAIGRAITDYINVISKKHPFWDRSLGADHFMLSCHDWGPRT  298

Query  808   SGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFY  987
             +  +P L   +IR LCNAN SE F P KD S PEI+L  G  DGLIGG  P+ R VL F+
Sbjct  299   TSYVPLLFNNSIRVLCNANVSEGFLPSKDASFPEIHLRTGEIDGLIGGLSPSRRSVLAFF  358

Query  988   AGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVE  1167
             AG LHG +R +LLQ W+ KDED+ ++  LP  +SY+ M++KS++CLCPSGYEVASPR+VE
Sbjct  359   AGRLHGHIRYLLLQEWKEKDEDVLVYEELPSGISYNSMLKKSRFCLCPSGYEVASPRVVE  418

Query  1168  ALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGV  1347
             A+Y  CVPVLI   YVPPFSDVLNW +F+V I V+DIPN+KKIL  I QTQY  +QRR  
Sbjct  419   AIYAECVPVLISESYVPPFSDVLNWKSFSVQIQVKDIPNIKKILKGISQTQYLRMQRRVK  478

Query  1348  EVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             +V+RHF +N  PKRFD FHMILHSIWLRRLNI + 
Sbjct  479   QVQRHFALNGTPKRFDAFHMILHSIWLRRLNIHIQ  513



>ref|XP_010068733.1| PREDICTED: probable glycosyltransferase At5g03795 [Eucalyptus 
grandis]
 gb|KCW89056.1| hypothetical protein EUGRSUZ_A01382 [Eucalyptus grandis]
Length=496

 Score =   478 bits (1230),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 226/393 (58%), Positives = 289/393 (74%), Gaps = 9/393 (2%)
 Frame = +1

Query  298   VYGAKSYTKLEILESGLAQARSSILRG------NQLHSDEHYIPSGSIYWNASSFHRSYV  459
             V   K Y++ E LE+ L++ARS+I           +H+D  YIP G IY NA++FHRSY+
Sbjct  100   VRAVKRYSRFERLEASLSRARSAIREAALVRNLTSVHADADYIPQGPIYRNANAFHRSYL  159

Query  460   EMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD--FSQFRTTDPDSAHVFFLPF  633
             EMEK  K+YVY++G+PP+ H GPCKSIY+ EG FIH M+   + +RTT PD A V+FLPF
Sbjct  160   EMEKLFKIYVYQEGEPPMFHDGPCKSIYSTEGRFIHEMERGHNMYRTTGPDEALVYFLPF  219

Query  634   SVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISG  813
             SV +L   +Y   SH+   + R  +DY+  IA K+PFWNR+LGADHFMLSCHDWGP  S 
Sbjct  220   SVVMLVHYLYEPGSHETHAIGRAVVDYIDVIAAKHPFWNRSLGADHFMLSCHDWGPRTSS  279

Query  814   SIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAG  993
              +P+L   +IR LCNANTSE F+P KD S+PEINL  G   GL+GGP P+ R  L F+AG
Sbjct  280   YVPNLFSKSIRVLCNANTSEGFDPFKDASLPEINLKTGEIFGLLGGPSPSRRGTLAFFAG  339

Query  994   GLHGPVRPILLQHWENK-DEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
              LHG +R +LLQ W++K D D++++  LP+ VSY  M+R+S+YCLCPSGYEVASPR+VEA
Sbjct  340   HLHGHIRYLLLQEWKDKEDPDVRVYDKLPRGVSYESMLRQSRYCLCPSGYEVASPRIVEA  399

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
             +Y  CVPVLI  GYVPPFSDVLNW AF+V + V+DIPN+KKIL  I  +QY  +QRR  +
Sbjct  400   IYAECVPVLISDGYVPPFSDVLNWKAFSVQVQVKDIPNIKKILMAISPSQYLRMQRRVKQ  459

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             V+RHF  N PP+R+DVFHM +HSIWLRRLNIR+
Sbjct  460   VQRHFVANGPPRRYDVFHMTVHSIWLRRLNIRI  492



>ref|XP_011009812.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Populus euphratica]
Length=510

 Score =   477 bits (1228),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 222/388 (57%), Positives = 285/388 (73%), Gaps = 7/388 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRG------NQLHSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K ++KLE +E+ LA+ RSSI           ++ D  Y+P G IY NA++FHRSY+EMEK
Sbjct  122   KRHSKLEKMEANLAKIRSSIREAARVRNLTSIYEDPDYVPKGPIYRNANAFHRSYLEMEK  181

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVL  648
               K+Y+Y++G PP+ H GPCKSIY+ EG FIH ++  + F TTDPD A V+FLPFSV +L
Sbjct  182   LFKIYIYKEGDPPMFHDGPCKSIYSSEGRFIHELEKGKSFTTTDPDKALVYFLPFSVVML  241

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +YV  SH+   +  T +DY++ IA KYPFWNR+LGADHF+LSCHDWGP  S  +P L
Sbjct  242   VQYLYVPGSHEIDAIGNTVVDYIKVIADKYPFWNRSLGADHFILSCHDWGPRTSSYVPHL  301

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNPKKD S PEI+L  G   GL+GGP P+ R +L F+AG LHG 
Sbjct  302   FNNSIRVLCNANTSEGFNPKKDASFPEIHLRTGEITGLVGGPSPSRRSILAFFAGRLHGH  361

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R +LL+ W++KD+D+++H  L   +SY  M++ S++CLCPSGYEVASPR+VEA+Y  CV
Sbjct  362   IRRLLLEQWKDKDQDMQVHDQLRNGMSYDSMLKNSRFCLCPSGYEVASPRIVEAIYAECV  421

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI  GYVPPFSDVLNW AF++ + V+DIP LK IL  I Q QY  +QRR  +V+RHF 
Sbjct  422   PVLISDGYVPPFSDVLNWKAFSIQVQVKDIPKLKDILMGISQRQYLRMQRRVKQVQRHFV  481

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             VN  PKRFD FHM +HSIWLRRLNIR+H
Sbjct  482   VNGLPKRFDEFHMTIHSIWLRRLNIRIH  509



>ref|XP_010048370.1| PREDICTED: probable glycosyltransferase At3g07620 [Eucalyptus 
grandis]
Length=521

 Score =   477 bits (1227),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/391 (57%), Positives = 288/391 (74%), Gaps = 9/391 (2%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRG------NQLHSDEHYIPSGSIYWNASSFHRSYVEM  465
               K Y++ E LE+ L+QARS+I           +H+D  Y+P G IY NA++FHRSY+EM
Sbjct  127   AVKRYSRFERLEASLSQARSAIREAALVRNLTSVHADADYVPRGPIYRNANAFHRSYLEM  186

Query  466   EKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD--FSQFRTTDPDSAHVFFLPFSV  639
             EK  K+YVY++G+PP+ H GPCKSIY+ EG FIH M+   + +RTTDPD A V+FLPFSV
Sbjct  187   EKLFKIYVYQEGEPPMFHDGPCKSIYSTEGRFIHEMERGHNMYRTTDPDEALVYFLPFSV  246

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
              +L + +Y   SH+   +    +DY+  IA K+PFWNR+LGADHFMLSCHDWGP  S  +
Sbjct  247   VMLVQYLYEPGSHETHAIGHAVVDYIDVIAAKHPFWNRSLGADHFMLSCHDWGPRTSSYV  306

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
             P+L   +IR LCNANTSE F+P KD S+PEINL  G   GL+GGP P+ R  L F+AG L
Sbjct  307   PNLFSKSIRVLCNANTSEGFDPFKDASLPEINLKTGEIFGLLGGPSPSRRGTLAFFAGRL  366

Query  1000  HGPVRPILLQHWENK-DEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALY  1176
             HG +R +LLQ W++K D D++++  LP+ VSY  M+R+S+YCLCPSGYEVASPR+VEA+Y
Sbjct  367   HGHIRHLLLQEWKDKEDPDVRVYDELPRGVSYESMLRQSRYCLCPSGYEVASPRIVEAIY  426

Query  1177  MGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVR  1356
               CVPVLI   YVPPFSDVLNW AF+V + V+DIPN+KK+L  I  +QY  +QRR  +V+
Sbjct  427   AECVPVLISDSYVPPFSDVLNWKAFSVQVQVKDIPNIKKLLMAISPSQYLRMQRRVKQVQ  486

Query  1357  RHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             RHF  N PP+R+DVFHM +HSIWLRRLNIR+
Sbjct  487   RHFVANGPPRRYDVFHMTVHSIWLRRLNIRI  517



>gb|KCW89058.1| hypothetical protein EUGRSUZ_A01384 [Eucalyptus grandis]
Length=559

 Score =   477 bits (1228),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 223/391 (57%), Positives = 288/391 (74%), Gaps = 9/391 (2%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRG------NQLHSDEHYIPSGSIYWNASSFHRSYVEM  465
               K Y++ E LE+ L+QARS+I           +H+D  Y+P G IY NA++FHRSY+EM
Sbjct  165   AVKRYSRFERLEASLSQARSAIREAALVRNLTSVHADADYVPRGPIYRNANAFHRSYLEM  224

Query  466   EKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD--FSQFRTTDPDSAHVFFLPFSV  639
             EK  K+YVY++G+PP+ H GPCKSIY+ EG FIH M+   + +RTTDPD A V+FLPFSV
Sbjct  225   EKLFKIYVYQEGEPPMFHDGPCKSIYSTEGRFIHEMERGHNMYRTTDPDEALVYFLPFSV  284

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
              +L + +Y   SH+   +    +DY+  IA K+PFWNR+LGADHFMLSCHDWGP  S  +
Sbjct  285   VMLVQYLYEPGSHETHAIGHAVVDYIDVIAAKHPFWNRSLGADHFMLSCHDWGPRTSSYV  344

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
             P+L   +IR LCNANTSE F+P KD S+PEINL  G   GL+GGP P+ R  L F+AG L
Sbjct  345   PNLFSKSIRVLCNANTSEGFDPFKDASLPEINLKTGEIFGLLGGPSPSRRGTLAFFAGRL  404

Query  1000  HGPVRPILLQHWENK-DEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALY  1176
             HG +R +LLQ W++K D D++++  LP+ VSY  M+R+S+YCLCPSGYEVASPR+VEA+Y
Sbjct  405   HGHIRHLLLQEWKDKEDPDVRVYDELPRGVSYESMLRQSRYCLCPSGYEVASPRIVEAIY  464

Query  1177  MGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVR  1356
               CVPVLI   YVPPFSDVLNW AF+V + V+DIPN+KK+L  I  +QY  +QRR  +V+
Sbjct  465   AECVPVLISDSYVPPFSDVLNWKAFSVQVQVKDIPNIKKLLMAISPSQYLRMQRRVKQVQ  524

Query  1357  RHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             RHF  N PP+R+DVFHM +HSIWLRRLNIR+
Sbjct  525   RHFVANGPPRRYDVFHMTVHSIWLRRLNIRI  555



>ref|XP_008794078.1| PREDICTED: probable glycosyltransferase At5g03795 [Phoenix dactylifera]
Length=552

 Score =   476 bits (1226),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 226/384 (59%), Positives = 286/384 (74%), Gaps = 8/384 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRG-----NQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             TKLE LE GLA+AR++I             D+ Y+P G +Y NA +FH+SY+EMEK  KV
Sbjct  168   TKLERLELGLARARAAIKEAVRNPNRTALVDKDYVPKGPVYRNAYAFHKSYLEMEKLFKV  227

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             YVY++G+PP+ H GPCKSIY+ EG FI++MD  S+ RT DPD AHVFFLPFSV  + + I
Sbjct  228   YVYQEGEPPIFHDGPCKSIYSTEGFFINSMDMESRLRTRDPDRAHVFFLPFSVVRMVQYI  287

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             Y  + HD  P++RT LDY+  I+ KYP+WNR+LGADHFMLSCHDWGP  SG  P L   +
Sbjct  288   YPRDHHDMKPLRRTVLDYINVISGKYPYWNRSLGADHFMLSCHDWGPYASGGHPQLFFNS  347

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNANTSE FN  +DV++PE+N+        +GGP  + RP+L F+AGG HGP+RP+
Sbjct  348   IRVLCNANTSEWFNASRDVTLPEMNVRSHVVK--VGGPSASGRPILAFFAGGNHGPIRPL  405

Query  1021  LLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLI  1200
             LL+HW++ D D+++H YLPK VSY  +M+KSK+CLCPSGYEVASPR++EA+Y  CVPV I
Sbjct  406   LLKHWKDIDGDVQVHEYLPKGVSYVDLMKKSKFCLCPSGYEVASPRIMEAIYYECVPVTI  465

Query  1201  KRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWP  1380
                YV PFSDVLNW AF+V + VEDIPNLK IL  I   QY  +QRR   V+RHF +N P
Sbjct  466   NAHYVLPFSDVLNWKAFSVQVSVEDIPNLKNILMSISPRQYIRMQRRVRTVQRHFMINGP  525

Query  1381  PKRFDVFHMILHSIWLRRLNIRVH  1452
             P+RFD++HM+LHSIWLRRLNIR+H
Sbjct  526   PRRFDLYHMLLHSIWLRRLNIRIH  549



>ref|XP_008237734.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=415

 Score =   471 bits (1213),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 221/397 (56%), Positives = 285/397 (72%), Gaps = 8/397 (2%)
 Frame = +1

Query  289   TLAVYGAKSYTKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHR  450
             T A    K Y++LE LE+ LA  R+SI    ++      H D  Y+P G IY NA++FHR
Sbjct  16    TSASTTIKRYSRLEKLEANLAGVRASIREAARVRNLTSTHEDPDYVPKGPIYRNANAFHR  75

Query  451   SYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ--FRTTDPDSAHVFF  624
             SY+EME+  K+YVYE+G PP+ H GPCKSIY+ EG FIH M+     +RT DPD A V+F
Sbjct  76    SYLEMERLFKIYVYEEGDPPIFHNGPCKSIYSTEGRFIHEMEMDNNIYRTRDPDEALVYF  135

Query  625   LPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPE  804
             LPFSV +L + +Y A+SH+   + R  +DYV  I+ K+PFWNR+LGADHFMLSCHDWGP 
Sbjct  136   LPFSVVMLVQYLYAADSHNTDSIGRAVIDYVNVISDKHPFWNRSLGADHFMLSCHDWGPR  195

Query  805   ISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVF  984
              S  +P L   +IR LCNANTSE FNP KD S PEI+L  G   GL+GG  P+ R +L F
Sbjct  196   TSSYVPHLYHKSIRVLCNANTSEGFNPSKDASFPEIHLRTGEIKGLLGGLSPSRRSILAF  255

Query  985   YAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMV  1164
             +AG LHG +R +LL  W+ KD+D++++  LP  VSY  M++KS++CLCPSGYEVA+PR+V
Sbjct  256   FAGRLHGHIRYLLLNEWKEKDQDVQVYDQLPHGVSYESMLKKSRFCLCPSGYEVANPRVV  315

Query  1165  EALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRG  1344
             EA+Y  C+PVLI   YVPPFSDVL+W +F+V I V+DIPN+K IL  I Q+QY  + RR 
Sbjct  316   EAIYAECIPVLISDSYVPPFSDVLDWKSFSVQIQVKDIPNIKTILMGISQSQYLRMHRRV  375

Query  1345  VEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVHH  1455
              +V+RHF VN P KRFDVF+MI+HSIWLRRLNI + +
Sbjct  376   KQVQRHFVVNGPSKRFDVFNMIVHSIWLRRLNIHIEN  412



>ref|XP_004239536.1| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=535

 Score =   474 bits (1220),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 226/389 (58%), Positives = 289/389 (74%), Gaps = 8/389 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSI---LRGNQL---HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y +LE LE+ LA++RSSI    R   +   H D  Y+P G +Y NA+SFHRSY+EMEK
Sbjct  146   KMYRRLERLEAILAKSRSSIREAARNGSMISNHHDPDYVPQGPMYHNANSFHRSYLEMEK  205

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPDSAHVFFLPFSVTVL  648
               KVYVYE+G+PP+ H GPC+SIY+ EG FIH M+  S +RT +PD A V+FLPFSV V+
Sbjct  206   NFKVYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMERGSLYRTKNPDEALVYFLPFSVVVM  265

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + ++V  +HD   + RT  DYV+ I+ ++ FWNR+LGADHFMLSCHDWGP ++  +P L
Sbjct  266   VQYLFVPGAHDMHALGRTVADYVKVISERHSFWNRSLGADHFMLSCHDWGPHLTSYVPHL  325

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KDVS+PEINL  G   GLIGGP P+ R +L F+AGGLHG 
Sbjct  326   FNTSIRVLCNANTSEGFNPLKDVSLPEINLKTGDIKGLIGGPSPSRRSILAFFAGGLHGN  385

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R  LL+ W+ KDED+ ++  LP + SY  M++ S++CLCPSGYEVASPR+VEA+Y  C+
Sbjct  386   IRHHLLEQWKGKDEDMLVYEKLPNDKSYETMLKNSRFCLCPSGYEVASPRVVEAIYAECI  445

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPFSDVLNW+AF+V I V+DIPN+KKIL  I Q+QY  + RR  +V+RHF 
Sbjct  446   PVLISDNYVPPFSDVLNWNAFSVTIGVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHFV  505

Query  1369  VN-WPPKRFDVFHMILHSIWLRRLNIRVH  1452
             +N   PKRFD+ +MI+HSIWLRRLNIRV 
Sbjct  506   INDGSPKRFDLLNMIVHSIWLRRLNIRVQ  534



>ref|XP_010923285.1| PREDICTED: probable glycosyltransferase At5g03795 [Elaeis guineensis]
Length=522

 Score =   474 bits (1219),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 226/383 (59%), Positives = 287/383 (75%), Gaps = 8/383 (2%)
 Frame = +1

Query  322   KLEILESGLAQARSSILRGNQLH-----SDEHYIPSGSIYWNASSFHRSYVEMEKTLKVY  486
             KLE LE GLA+AR++I    Q       +D+ Y+P G  Y NA +FHRSY+EMEK LKVY
Sbjct  139   KLERLELGLARARAAIREDVQNSNRPALADKDYVPIGPAYRNAYAFHRSYLEMEKLLKVY  198

Query  487   VYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIY  663
             VY +G+PP+ H GPC SIY+ EG FI++MD  ++ RT DPD AHVFFLPFSV  + + IY
Sbjct  199   VYGEGEPPIFHDGPCLSIYSTEGLFINSMDMENRLRTRDPDRAHVFFLPFSVVRMVQHIY  258

Query  664   VANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAI  843
               +  D SP++RT  DY+  I+RKYP+WNR+LGADHFMLSCHDWGP  SG    L   +I
Sbjct  259   QRDRRDMSPLRRTVRDYIDVISRKYPYWNRSLGADHFMLSCHDWGPYASGGHSHLFFNSI  318

Query  844   RALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPIL  1023
             R LCNANTSE FNP KDVS+PE+N+     +  +GGP  + RP+L F+AGG HGPVRP+L
Sbjct  319   RVLCNANTSEGFNPLKDVSLPEMNMRSAVVN--VGGPSASGRPILAFFAGGNHGPVRPVL  376

Query  1024  LQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIK  1203
             ++HW++KD+DI++H YLP+ VSY  +M+KSK+CLCPSGYEVASPR++EA+Y+ CVPV I 
Sbjct  377   IKHWKDKDKDIQVHEYLPQGVSYIDLMKKSKFCLCPSGYEVASPRIMEAIYLECVPVTIN  436

Query  1204  RGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPP  1383
               YV P SDVLNW AF+V + VEDIPNLK IL  I   QY  +QRR   V+RHF +N PP
Sbjct  437   DHYVLPLSDVLNWKAFSVQVSVEDIPNLKNILMSISPRQYIRMQRRVKIVQRHFMLNSPP  496

Query  1384  KRFDVFHMILHSIWLRRLNIRVH  1452
             KRFD++HM+LHS+WLRRLN+ +H
Sbjct  497   KRFDLYHMLLHSVWLRRLNVHIH  519



>ref|XP_011009813.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Populus euphratica]
Length=381

 Score =   468 bits (1204),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 218/380 (57%), Positives = 279/380 (73%), Gaps = 7/380 (2%)
 Frame = +1

Query  334   LESGLAQARSSILRG------NQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYE  495
             +E+ LA+ RSSI           ++ D  Y+P G IY NA++FHRSY+EMEK  K+Y+Y+
Sbjct  1     MEANLAKIRSSIREAARVRNLTSIYEDPDYVPKGPIYRNANAFHRSYLEMEKLFKIYIYK  60

Query  496   DGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSKMIYVAN  672
             +G PP+ H GPCKSIY+ EG FIH ++  + F TTDPD A V+FLPFSV +L + +YV  
Sbjct  61    EGDPPMFHDGPCKSIYSSEGRFIHELEKGKSFTTTDPDKALVYFLPFSVVMLVQYLYVPG  120

Query  673   SHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRAL  852
             SH+   +  T +DY++ IA KYPFWNR+LGADHF+LSCHDWGP  S  +P L   +IR L
Sbjct  121   SHEIDAIGNTVVDYIKVIADKYPFWNRSLGADHFILSCHDWGPRTSSYVPHLFNNSIRVL  180

Query  853   CNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQH  1032
             CNANTSE FNPKKD S PEI+L  G   GL+GGP P+ R +L F+AG LHG +R +LL+ 
Sbjct  181   CNANTSEGFNPKKDASFPEIHLRTGEITGLVGGPSPSRRSILAFFAGRLHGHIRRLLLEQ  240

Query  1033  WENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGY  1212
             W++KD+D+++H  L   +SY  M++ S++CLCPSGYEVASPR+VEA+Y  CVPVLI  GY
Sbjct  241   WKDKDQDMQVHDQLRNGMSYDSMLKNSRFCLCPSGYEVASPRIVEAIYAECVPVLISDGY  300

Query  1213  VPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRF  1392
             VPPFSDVLNW AF++ + V+DIP LK IL  I Q QY  +QRR  +V+RHF VN  PKRF
Sbjct  301   VPPFSDVLNWKAFSIQVQVKDIPKLKDILMGISQRQYLRMQRRVKQVQRHFVVNGLPKRF  360

Query  1393  DVFHMILHSIWLRRLNIRVH  1452
             D FHM +HSIWLRRLNIR+H
Sbjct  361   DEFHMTIHSIWLRRLNIRIH  380



>gb|KGN52623.1| hypothetical protein Csa_5G647450 [Cucumis sativus]
Length=510

 Score =   473 bits (1216),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 223/395 (56%), Positives = 286/395 (72%), Gaps = 7/395 (2%)
 Frame = +1

Query  289   TLAVYGAKSYTKLEILESGLAQARSSILRGNQLHS------DEHYIPSGSIYWNASSFHR  450
             T  +   + Y+KL+ LE  L +AR++I   +Q+H+      D  Y+P+G IY N ++FHR
Sbjct  115   TPGISKTERYSKLKKLEEKLGRARAAIREASQIHNLTSIHHDPDYVPTGPIYRNPNAFHR  174

Query  451   SYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTT-DPDSAHVFFL  627
             SY+EMEK LK+YVY++G+PP+ H GPCKSIY+ EG FIH M+     TT DPD A ++FL
Sbjct  175   SYIEMEKLLKIYVYKEGEPPMFHGGPCKSIYSTEGRFIHEMEKGNLYTTNDPDQALLYFL  234

Query  628   PFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEI  807
             PFSV  L + +YV NSH+ + +     DY+  I+ K+PFW+R+LGADHFMLSCHDWGP  
Sbjct  235   PFSVVNLVQYLYVPNSHEVNAIGTAITDYINVISNKHPFWDRSLGADHFMLSCHDWGPRT  294

Query  808   SGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFY  987
             +  +P L   +IR LCNAN SE F P KD S PEI+L  G  DGL+GG  P+ R VL F+
Sbjct  295   TSFVPLLFNNSIRVLCNANVSEGFRPSKDASFPEIHLRTGEIDGLLGGLSPSRRSVLAFF  354

Query  988   AGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVE  1167
             AG LHG +R +LLQ W+ KDED+ ++  LP  +SY  M++KS++CLCPSGYEVASPR+VE
Sbjct  355   AGRLHGHIRYLLLQEWKEKDEDVLVYDELPSGISYDSMLKKSRFCLCPSGYEVASPRVVE  414

Query  1168  ALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGV  1347
             A+Y  CVPVLI   YVPPFSDVLNW++FAV I V+DIPN+KKIL  I QTQY  +QRR  
Sbjct  415   AIYAECVPVLISESYVPPFSDVLNWNSFAVQIQVKDIPNIKKILNGISQTQYLRMQRRVK  474

Query  1348  EVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             +V+RHF +N  PKRFD FHMILHSIWLRRLNI + 
Sbjct  475   QVQRHFVLNGTPKRFDAFHMILHSIWLRRLNIHIQ  509



>ref|XP_004955715.1| PREDICTED: probable glycosyltransferase At5g03795-like [Setaria 
italica]
Length=567

 Score =   474 bits (1219),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 227/386 (59%), Positives = 286/386 (74%), Gaps = 10/386 (3%)
 Frame = +1

Query  322   KLEILESGLAQARSSILRG--NQLH----SDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             KLE LE GLA+ARS+I+ G  N+ +    +D+ Y+P G IY NA +FH+SY+EMEK  KV
Sbjct  178   KLERLELGLAKARSAIMEGIRNKDNRPPLADKDYVPMGPIYRNAYAFHKSYLEMEKLFKV  237

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             YVYE+G+PPV H GPC+SIY+ EG FI++M+  S+ RT DPD AH FFLPFSV  + KMI
Sbjct  238   YVYEEGEPPVFHDGPCRSIYSTEGRFIYSMEMESRLRTRDPDLAHAFFLPFSVVKMVKMI  297

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             Y  NSHD  P+KRT  DY+  ++ KYP+WNR+LGADHFMLSCHDWGP +S +   L   +
Sbjct  298   YEPNSHDMGPLKRTVSDYIGVLSTKYPYWNRSLGADHFMLSCHDWGPYVSSANGHLFGNS  357

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNANTSE FNP KDVS+PEINL     D  +GGP  + RP+L F+AGG HGPVRP 
Sbjct  358   IRVLCNANTSEGFNPSKDVSLPEINLRSDVVDRQVGGPSASRRPILAFFAGGNHGPVRPA  417

Query  1021  LLQHWENK-DEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             LL HW+ K D D+++  YLP+ VSY  MMR+S++CLCP GYEVASPR+ EA+Y+ CVPV+
Sbjct  418   LLAHWKGKGDPDVQVSEYLPRGVSYTDMMRRSRFCLCPGGYEVASPRLAEAIYLECVPVV  477

Query  1198  IKRG-YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV-  1371
             I  G Y  PF+DVLNW AFAV +P  DIP L+++L+ +   QY  +QRR   VRRHF V 
Sbjct  478   IDDGEYALPFADVLNWDAFAVRLPTADIPRLREVLSAVSPRQYIRMQRRVRAVRRHFMVH  537

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRV  1449
                P+R+D FHMILHS+WLRRLN+R+
Sbjct  538   GGAPRRYDAFHMILHSVWLRRLNVRI  563



>ref|XP_004292405.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=526

 Score =   472 bits (1215),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 221/387 (57%), Positives = 280/387 (72%), Gaps = 7/387 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y++LE LE+ LA  R+SI    ++      H D  Y+P G IY NA++FHRSY+EME+
Sbjct  135   KRYSRLEKLEASLAGVRASIREAARVRNLTSTHEDPDYVPQGPIYRNANAFHRSYLEMER  194

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVL  648
               K+YVY++G PP+ H GPCKSIY+ EG FIH M+    +RT +PD A V+FLPFSV +L
Sbjct  195   LFKIYVYQEGDPPIFHNGPCKSIYSTEGMFIHEMEMDNTYRTKNPDDALVYFLPFSVVML  254

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +Y A SH    + R  +DYV  I+ K+PFWNR+LGADHFMLSCHDWGP  S  +P L
Sbjct  255   VQYLYEAESHSTESIGRAVVDYVNVISDKHPFWNRSLGADHFMLSCHDWGPRTSSYVPQL  314

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KDVS PEI+L  G T GL+GG  P+ R VL F+AG LHG 
Sbjct  315   YHKSIRVLCNANTSEGFNPSKDVSFPEIHLRTGETKGLLGGLSPSRRSVLAFFAGRLHGH  374

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R +LL  W+ KD+D++++  LP  VSY  M+++SK+CLCPSGYEVASPR+VEA+Y  CV
Sbjct  375   IRCLLLNEWKEKDQDVQVYDQLPNGVSYESMLKQSKFCLCPSGYEVASPRIVEAIYAECV  434

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPFSDVL W  F+V + V+DIPN+K IL  I Q+QY  + RR   V+RHF 
Sbjct  435   PVLISDNYVPPFSDVLEWKTFSVQVQVKDIPNIKTILMGISQSQYLRMHRRVKLVQRHFV  494

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             VN P KR+DVF+MI+HSIWLRRLNIR+
Sbjct  495   VNGPSKRYDVFNMIVHSIWLRRLNIRI  521



>ref|XP_008796633.1| PREDICTED: probable glycosyltransferase At5g03795 [Phoenix dactylifera]
Length=499

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 231/384 (60%), Positives = 287/384 (75%), Gaps = 8/384 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLH-----SDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             TKLE LE GLA+AR++I    Q       +D+ Y+P G  Y N+ +FHRSY+EMEK LKV
Sbjct  115   TKLERLELGLARARAAIREAVQNSNRPALADKDYVPKGPAYRNSYAFHRSYLEMEKLLKV  174

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             YVYE+G+PP+ H GPC SIY+ EG FI+ MD  S+ RT DPD AHVFFLPFSV  + + I
Sbjct  175   YVYEEGEPPIFHDGPCLSIYSTEGLFINDMDMESRLRTRDPDRAHVFFLPFSVVRMVQHI  234

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             Y  +  D SP++RT L Y+  I+ KYP+WNR+LGADHFMLSCHDWGP  SG    L   +
Sbjct  235   YQRDRRDMSPLRRTVLAYINDISGKYPYWNRSLGADHFMLSCHDWGPYASGGHSHLFLNS  294

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNAN SE FNP KDVS+PE+N+     D  +GGP  + RP+L F+AGG HGPVRP+
Sbjct  295   IRVLCNANMSEGFNPLKDVSLPEMNMRSAVVD--VGGPSASGRPILAFFAGGNHGPVRPV  352

Query  1021  LLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLI  1200
             LL+HW++KD+D+++H YLPK VSY  +MRKSK+CLCPSGYEVASPR++EA+Y+ CVPV I
Sbjct  353   LLKHWKDKDKDMQVHEYLPKGVSYVDLMRKSKFCLCPSGYEVASPRIMEAIYLECVPVTI  412

Query  1201  KRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWP  1380
                YV P SDVLNW AF+V + VEDIPNLK IL  I   QY  +QRR   V+RHF +N P
Sbjct  413   NDHYVLPLSDVLNWKAFSVQVSVEDIPNLKNILMSISPRQYIRMQRRVKIVQRHFMLNGP  472

Query  1381  PKRFDVFHMILHSIWLRRLNIRVH  1452
             PKRFD++HM+LHSIWLRRLN+R+H
Sbjct  473   PKRFDLYHMLLHSIWLRRLNVRIH  496



>ref|NP_001059081.1| Os07g0188700 [Oryza sativa Japonica Group]
 dbj|BAC83913.1| putative pectin-glucuronyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAD31848.1| putative pectin-glucuronyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF20995.1| Os07g0188700 [Oryza sativa Japonica Group]
 gb|EAZ38963.1| hypothetical protein OsJ_23384 [Oryza sativa Japonica Group]
 dbj|BAG93622.1| unnamed protein product [Oryza sativa Japonica Group]
Length=606

 Score =   474 bits (1219),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 228/388 (59%), Positives = 288/388 (74%), Gaps = 11/388 (3%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLH------SDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
              KLE+LE GLA+AR++I    Q        +D+ Y+P G +Y NA +FHRSY+EMEK  K
Sbjct  214   VKLELLELGLAKARATIREAIQNKDNKPPLTDKDYVPVGPVYRNAYAFHRSYLEMEKVFK  273

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             V+VYE+G+PPV H GPC+SIY+ EG FI+AM+  ++ RT DPD AHVFFLPFSV  + KM
Sbjct  274   VFVYEEGEPPVFHDGPCRSIYSTEGRFIYAMEMENRMRTRDPDQAHVFFLPFSVVKMVKM  333

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             IY  NSHD  P++RT  DY+  ++ KYP WNR+LGADHFMLSCHDWGP +S +   L   
Sbjct  334   IYEPNSHDMDPLRRTISDYINVVSTKYPHWNRSLGADHFMLSCHDWGPYVSSANGHLFSN  393

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE F+P +DVS+PEINL     D  +GGP  + RP+L F+AGG HGPVRP
Sbjct  394   SIRVLCNANTSEGFDPSRDVSLPEINLRSDVVDRQVGGPSASHRPILAFFAGGDHGPVRP  453

Query  1018  ILLQHW-ENKDEDIKIHSYLPK--NVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +LLQHW + +D DI++  YLP+   +SY  MMR+S++CLCPSGYEVASPR+VEA+Y+ CV
Sbjct  454   LLLQHWGKGQDADIQVSEYLPRRHGMSYTDMMRRSRFCLCPSGYEVASPRVVEAIYLECV  513

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PV+I   Y  PF+DVLNW+AF+V + V DIP LK+IL  +   QY  +QRR   VRRHF 
Sbjct  514   PVVIGDDYTLPFADVLNWAAFSVRVAVGDIPRLKEILAAVSPRQYIRMQRRVRAVRRHFM  573

Query  1369  V-NWPPKRFDVFHMILHSIWLRRLNIRV  1449
             V +  P+RFDVFHMILHSIWLRRLN+RV
Sbjct  574   VSDGAPRRFDVFHMILHSIWLRRLNVRV  601



>ref|XP_006357695.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=492

 Score =   469 bits (1206),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 224/389 (58%), Positives = 286/389 (74%), Gaps = 8/389 (2%)
 Frame = +1

Query  307   AKSYTKLEILESGLAQARSSI---LRGNQL---HSDEHYIPSGSIYWNASSFHRSYVEME  468
              K Y +LE LE+ LA+ARSSI    R   +   H D  Y+P G IY N ++FHRSY+EME
Sbjct  104   VKRYNRLERLEAILAKARSSIREAARNGSMISNHQDPDYVPQGPIYRNTNAFHRSYLEME  163

Query  469   KTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPDSAHVFFLPFSVTV  645
             K  K+YVYE+G+ P+ H GPC+SIY+ EG FI+ M+  + +RT DP+ A V+FLPFSV V
Sbjct  164   KKFKIYVYEEGELPIFHNGPCRSIYSTEGRFIYEMEKGNMYRTKDPEEALVYFLPFSVVV  223

Query  646   LSKMIYVANSHDWS-PMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIP  822
             + + +YV+   D    + RT  DY+  I+ ++ FWN +LGADHFMLSCHDWGP  +  +P
Sbjct  224   MVRYLYVSGGPDSRHVIGRTVADYIHVISSRHSFWNTSLGADHFMLSCHDWGPHTTSYVP  283

Query  823   DLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLH  1002
              L   +IR LCNANT+E FNP+KDVS+PEINL    T G+IGGP P+ R  L F+AGGLH
Sbjct  284   HLFNNSIRVLCNANTTEGFNPQKDVSLPEINLKTDDTIGIIGGPSPSRRSTLAFFAGGLH  343

Query  1003  GPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMG  1182
             G +R  L+Q W+ KD+D+ ++  LP   SY  M++ SK+CLCPSGYEVASPR+VEA+Y  
Sbjct  344   GAIRNNLMQQWKGKDQDVLVYEELPPGKSYETMLKNSKFCLCPSGYEVASPRVVEAIYAE  403

Query  1183  CVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRH  1362
             CVPVLI  GYVPPFSDVLNW+AF+V + VEDIPN+KKIL  I QTQY  +Q+R  +V+RH
Sbjct  404   CVPVLISDGYVPPFSDVLNWNAFSVKVAVEDIPNIKKILMSISQTQYLRMQKRVKQVQRH  463

Query  1363  FEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             F +N PPKRFD+FHMI+HSIWLRRLNIRV
Sbjct  464   FVMNGPPKRFDLFHMIVHSIWLRRLNIRV  492



>ref|XP_011085648.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=438

 Score =   466 bits (1200),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 222/390 (57%), Positives = 281/390 (72%), Gaps = 14/390 (4%)
 Frame = +1

Query  322   KLEILESGLAQARSSILRG------NQLHSDEH-------YIPSGSIYWNASSFHRSYVE  462
             +L+  E+ LA+AR SI         N     EH       YIP G +Y N ++F RSY E
Sbjct  46    RLKKAEAVLAKARFSIRDVAQSKLVNSTSDQEHDDDDDDDYIPQGPVYRNPTAFLRSYQE  105

Query  463   MEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQF-RTTDPDSAHVFFLPFSV  639
             MEK  K+YVYE+G+ P+ H+GPC+SIY+ EG+FI+ ++   F RT DP  AHVFFLPFSV
Sbjct  106   MEKVFKIYVYEEGERPIFHHGPCRSIYSTEGNFIYELERGSFYRTNDPREAHVFFLPFSV  165

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
               L + +Y A S D   +     DYVQ+I+ +YPFWN +LGADHFMLSCHDWGP  + S+
Sbjct  166   VGLVQYLYEAGSRDRKAIAGVVADYVQTISFRYPFWNSSLGADHFMLSCHDWGPYSTKSV  225

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
             P L   +IR LCNANTSE FNP KDVS+PEINL  G   GL+GG PP++RP+L F+AG L
Sbjct  226   PKLFSNSIRVLCNANTSEGFNPLKDVSLPEINLNTGDMSGLLGGSPPSQRPILAFFAGRL  285

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HG +R ILL+ W+ KD D++++  LP+N+SY  M+R SK+CLCPSGYEVASPR+VEA+Y 
Sbjct  286   HGHIRRILLKQWKGKDHDVQVYDELPRNISYESMLRNSKFCLCPSGYEVASPRVVEAIYA  345

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
              CVPVLI +GYVPP SDVL W  FAV +  EDIPN+KKIL  IP+ +Y  + +R  EV+R
Sbjct  346   ECVPVLISKGYVPPLSDVLKWEEFAVAVAEEDIPNVKKILMGIPKEKYLRMHKRLREVQR  405

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             HF +N PPKRFD+FHMILHSIWLRRLN+R+
Sbjct  406   HFVMNGPPKRFDLFHMILHSIWLRRLNVRI  435



>ref|XP_004243882.1| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=508

 Score =   468 bits (1205),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 223/389 (57%), Positives = 286/389 (74%), Gaps = 8/389 (2%)
 Frame = +1

Query  307   AKSYTKLEILESGLAQARSSI---LRGNQL---HSDEHYIPSGSIYWNASSFHRSYVEME  468
              K Y +LE +E+ LA+ARSSI    R   +   H D  Y+P G IY N ++FHRSY+EME
Sbjct  120   VKRYNRLERVEAILAKARSSIREAARNGSMISNHEDPDYVPQGPIYRNTNAFHRSYLEME  179

Query  469   KTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPDSAHVFFLPFSVTV  645
             K  K+YVYE+G+ P+ H GPC+SIY+ EG FI+ M+  + +RT +PD A V+FLPFSV V
Sbjct  180   KKFKIYVYEEGELPIFHNGPCRSIYSTEGRFIYEMEKGNMYRTKNPDEALVYFLPFSVVV  239

Query  646   LSKMIYVANSHDWS-PMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIP  822
             + + +YV+   D    + RT  DY+  I+ ++ FWN +LGADHFMLSCHDWGP  +  +P
Sbjct  240   MVRYLYVSGGPDSRHVIGRTVADYIHVISSRHSFWNTSLGADHFMLSCHDWGPHTTSYVP  299

Query  823   DLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLH  1002
              L   +IR LCNANT+E FNP+KDVS+PEINL    T G+IGGP P+ R +L F+AGGLH
Sbjct  300   HLFNNSIRVLCNANTTEGFNPQKDVSLPEINLKTDDTIGIIGGPSPSRRSILAFFAGGLH  359

Query  1003  GPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMG  1182
             G +R  L+Q W+ KD+D+ ++  LP   SY  M++ SK+CLCPSGYEVASPR+VEA+Y  
Sbjct  360   GAIRNNLMQQWKGKDQDVLVYEELPSGESYESMLKNSKFCLCPSGYEVASPRVVEAIYAE  419

Query  1183  CVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRH  1362
             CVPVLI  GYVPPFSDVLNW+AF+V + VEDIPN+KKIL  I QTQY  +QRR  +V+RH
Sbjct  420   CVPVLISDGYVPPFSDVLNWNAFSVKVAVEDIPNIKKILMSISQTQYLRMQRRVKQVQRH  479

Query  1363  FEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             F +N P KRFD+FHMI+HSIWLRRLNIRV
Sbjct  480   FVMNGPSKRFDLFHMIVHSIWLRRLNIRV  508



>ref|XP_007145275.1| hypothetical protein PHAVU_007G225300g [Phaseolus vulgaris]
 gb|ESW17269.1| hypothetical protein PHAVU_007G225300g [Phaseolus vulgaris]
Length=490

 Score =   467 bits (1202),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 227/382 (59%), Positives = 279/382 (73%), Gaps = 9/382 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSI--LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVY  492
             T L+ +E GLAQAR++I   R      D  Y+P G +YWNA +FHRSY+EMEK  KV+ Y
Sbjct  108   TILDNIEIGLAQARAAIREARNGTGTPDSDYVPKGPMYWNAKAFHRSYLEMEKQFKVFSY  167

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
              +G+PPV H  PCKS Y++EG+F+HA++ +  FRT DP+ AHVFFLP          Y  
Sbjct  168   GEGEPPVFHNAPCKSKYSMEGNFMHAIEMNNHFRTKDPEEAHVFFLP-----RVGYGYEG  222

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
              S D SP+K+TA DYV  IA +YP+WNR+LGADHF L+CHD     S S+P   K +IR 
Sbjct  223   VSQDLSPVKKTATDYVSVIAARYPYWNRSLGADHFTLACHDMCRGTSLSLPTPHKNSIRV  282

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSE F P KDVS PEINL   +    IGG   ++R +L F+AGG+HGP+ P+LL+
Sbjct  283   LCNANTSEGFKPAKDVSFPEINLKISSIR-FIGGQSASKRSILTFFAGGVHGPIAPVLLK  341

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWENKDEDI+I  YLPK +SYH MMRKSK+CLCPSGYE ASPR+VEA+Y GCVPV I   
Sbjct  342   HWENKDEDIQILKYLPKGISYHEMMRKSKFCLCPSGYEGASPRVVEAIYTGCVPVFISEH  401

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
              VPPFSDVLNW +F+V + V+DIPNLK+IL  IP  QY  +QRR  ++ RHFEV+ PPKR
Sbjct  402   SVPPFSDVLNWKSFSVEVSVKDIPNLKEILMSIPPKQYIRMQRRVEQIGRHFEVHSPPKR  461

Query  1390  FDVFHMILHSIWLRRLNIRVHH  1455
             FDVFHMILHS+WLRRLN+ VHH
Sbjct  462   FDVFHMILHSVWLRRLNLEVHH  483



>ref|XP_002320537.2| hypothetical protein POPTR_0014s16900g [Populus trichocarpa]
 gb|EEE98852.2| hypothetical protein POPTR_0014s16900g [Populus trichocarpa]
Length=461

 Score =   466 bits (1199),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 219/389 (56%), Positives = 285/389 (73%), Gaps = 8/389 (2%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRGNQ-------LHSDEHYIPSGSIYWNASSFHRSYVE  462
             G +S  KLE +E+GLA AR+ I    +       LH D  YIP G IY NA +FHRSY+ 
Sbjct  70    GNRSDAKLERVEAGLAMARALIREAAEDNNCTSSLHDDLDYIPRGYIYRNACAFHRSYLL  129

Query  463   MEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSV  639
             MEK  K++VYE+G+PP+ HYG CK IY++EG F+  M+  ++FRT++PD AHV+FLPFSV
Sbjct  130   MEKLFKIFVYEEGEPPLFHYGTCKDIYSMEGVFLSLMETNTKFRTSNPDEAHVYFLPFSV  189

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
              ++ + ++     D + ++RT  DYV+ I+ KY +WNR+LGADHFMLSCHDWGP  +  +
Sbjct  190   VMIIEHLFHPIIRDKAVLERTVSDYVRIISHKYLYWNRSLGADHFMLSCHDWGPRATWYV  249

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
               L   +IR LCNANTSE FNPKKD S PEINL  G   GL GG PP+ R VL F+AG +
Sbjct  250   RQLYYNSIRVLCNANTSEYFNPKKDASFPEINLKTGEITGLTGGLPPSNRTVLAFFAGKM  309

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HG +RP LLQHW  KD+D++++  LP+ +SYH MM+KSKYC+CPSG+EVASPR+ EA+Y 
Sbjct  310   HGKLRPALLQHWMGKDKDVQVYETLPQGISYHEMMKKSKYCICPSGHEVASPRIAEAIYA  369

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
              CVPVLI + Y+ PFSDVLNW +F + +PV +IPNLK IL  IP+ QY  +Q R  +V+R
Sbjct  370   ECVPVLISQHYIFPFSDVLNWDSFTIQVPVTEIPNLKNILEGIPEDQYLRMQERVRQVQR  429

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIR  1446
             HF VN PP+R+DVFHMI+HSIWLRRLN+R
Sbjct  430   HFVVNNPPRRYDVFHMIIHSIWLRRLNVR  458



>ref|XP_011009816.1| PREDICTED: probable glycosyltransferase At3g07620 [Populus euphratica]
Length=480

 Score =   466 bits (1200),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 219/389 (56%), Positives = 284/389 (73%), Gaps = 8/389 (2%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRGNQ-------LHSDEHYIPSGSIYWNASSFHRSYVE  462
             G +S  KLE +E+GLA AR+ I    +       LH D  YIP G IY NA +FHRSY+ 
Sbjct  89    GNRSDAKLERVEAGLAMARALIREAAEDSNCTSSLHDDLDYIPRGYIYRNACAFHRSYLL  148

Query  463   MEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSV  639
             MEK  K++VYE+G+PP+ HYG CK IY++EG F+  M+  ++FRT++PD AHV+FLPFSV
Sbjct  149   MEKLFKIFVYEEGEPPLFHYGTCKDIYSMEGVFLSLMETNTKFRTSNPDEAHVYFLPFSV  208

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
              ++ + ++     D + ++RT  DYV+ I+ KY +WNR+LGADHFMLSCHDWGP  +  +
Sbjct  209   VMIIEHLFHPIIRDKAVLERTVSDYVRIISHKYLYWNRSLGADHFMLSCHDWGPRATWYV  268

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
               L   +IR LCNANTSE FNPKKD S PEINL  G   GL GG PP+ R VL F+AG +
Sbjct  269   RQLYYNSIRVLCNANTSEYFNPKKDASFPEINLKTGEITGLTGGLPPSNRTVLAFFAGKM  328

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HG +RP LLQHW  KD+D++++  LP+ +SYH MM KSKYC+CPSG+EVASPR+ EA+Y 
Sbjct  329   HGKLRPALLQHWMGKDKDVQVYETLPQGISYHEMMTKSKYCICPSGHEVASPRIAEAIYA  388

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
              CVPVLI + Y+ PFSDVLNW +F + +PV +IPNLK IL  IP+ QY  +Q R  +V+R
Sbjct  389   ECVPVLISQHYIFPFSDVLNWDSFTIQVPVTEIPNLKNILEGIPEDQYLRMQERVKQVQR  448

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIR  1446
             HF VN PP+R+DVFHMI+HSIWLRRLN+R
Sbjct  449   HFVVNNPPRRYDVFHMIIHSIWLRRLNVR  477



>ref|XP_007216463.1| hypothetical protein PRUPE_ppa024503mg [Prunus persica]
 gb|EMJ17662.1| hypothetical protein PRUPE_ppa024503mg [Prunus persica]
Length=482

 Score =   466 bits (1200),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 219/387 (57%), Positives = 285/387 (74%), Gaps = 6/387 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRG----NQLH-SDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             K    LE LE+GLA AR+ I       NQ    D  Y+P G IY NA +FHRS++ ME  
Sbjct  95    KGDVNLERLEAGLATARALIREATSKFNQTALEDADYVPQGDIYRNAYAFHRSHLLMESL  154

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLS  651
              K+YVYE+G+PP+ H GPCK+IY++EG F+  M+  ++FRT DPD AHV+FLPFSV ++ 
Sbjct  155   FKIYVYEEGEPPIFHNGPCKNIYSMEGLFLSFMETDTKFRTLDPDKAHVYFLPFSVVMII  214

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + ++     D + ++RT +DYV+ ++ KYPFWNR+LGADH MLSCHDWGP  +  +  L 
Sbjct  215   EYLFHPIIRDKAVLERTVVDYVRVVSNKYPFWNRSLGADHVMLSCHDWGPRATWYVKQLY  274

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
               AIR LCNANTSE FNPKKD S PEINL  G   GL+GG PP+ER  L F+AG +HG +
Sbjct  275   FVAIRVLCNANTSEHFNPKKDASFPEINLETGDITGLVGGLPPSERTTLAFFAGRMHGRI  334

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             RP+L QHW+ KD+D+ ++  LP+ VSYH M++KSKYC+CPSG+EVASPR+ EA+Y  CVP
Sbjct  335   RPLLFQHWKEKDKDLLVYETLPEGVSYHDMLKKSKYCICPSGHEVASPRIAEAIYAECVP  394

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI + YV PFSDVLNW  F+V + V +IP+LK+IL  IP+ QY  +Q+R  +V+RHF V
Sbjct  395   VLISQHYVLPFSDVLNWEFFSVQVSVSEIPHLKEILMGIPEEQYRRMQKRVKQVQRHFVV  454

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             N PPKRFDVFHMI+HSIWLRRLN+R++
Sbjct  455   NSPPKRFDVFHMIIHSIWLRRLNVRIY  481



>ref|XP_004289488.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=399

 Score =   462 bits (1189),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 226/397 (57%), Positives = 282/397 (71%), Gaps = 21/397 (5%)
 Frame = +1

Query  322   KLEILESGLAQARSSILRG--------NQLHS-----------DEHYIPSGSIYWNASSF  444
             KL+ LE  L++ARSSI           N+++S           D  Y+P G IY NA +F
Sbjct  2     KLDKLEESLSKARSSIREAAATSLALKNKINSTSKSVQLVHDQDPDYVPHGRIYRNAQAF  61

Query  445   HRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVF  621
             HRSY+ MEK  K+YVYE+G+ P+ H GPCKSIY+ EG FIH M+  + +RT DPD A V+
Sbjct  62    HRSYLLMEKLFKIYVYEEGEVPLFHAGPCKSIYSSEGRFIHEMEKGKLYRTKDPDEADVY  121

Query  622   FLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGP  801
             F+P SVT L + +YV  + D  P+KR  +DY++ IA ++PFWNR+LGADHFMLSCHDWGP
Sbjct  122   FIPVSVTNLVEYLYVHGTPDRDPIKRAFIDYIKVIADRHPFWNRSLGADHFMLSCHDWGP  181

Query  802   EISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLV  981
               S S+PD    +IR LCNANTSE FNP KD S PEINL  G    L GGPPP+ R VL 
Sbjct  182   VTSSSVPDFFHNSIRVLCNANTSEGFNPSKDASFPEINLLTGEISSL-GGPPPSTRTVLA  240

Query  982   FYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRM  1161
             F+AG LHG +R +LL  W+ KDED++++  LPK VSY   ++ SK+CLCPSGYEVASPR+
Sbjct  241   FFAGRLHGHIRYLLLNEWKGKDEDVQVYEVLPKKVSYENKLKSSKFCLCPSGYEVASPRV  300

Query  1162  VEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRR  1341
             VEA+Y  CVPVLI   YVPPFSDVLNW +F+V IPV++I ++K IL  I   QY  +QR 
Sbjct  301   VEAIYAECVPVLISDAYVPPFSDVLNWRSFSVQIPVQNISDIKNILMGISHRQYLRMQRN  360

Query  1342  GVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
               +V+RHF VN PPKR+DVFHMI+HSIWLRRLNIRVH
Sbjct  361   VKQVQRHFVVNGPPKRYDVFHMIVHSIWLRRLNIRVH  397



>emb|CDP08577.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   466 bits (1199),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 219/387 (57%), Positives = 280/387 (72%), Gaps = 7/387 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQ------LHSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y KLE LE+ L++AR SI    +       H D  Y+P G +Y NA+ FHRSY+EMEK
Sbjct  121   KRYNKLERLETMLSKARYSIREAAKNGSMISTHEDADYVPHGPMYINANGFHRSYLEMEK  180

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQF-RTTDPDSAHVFFLPFSVTVL  648
             + KVYVY++G+PP+ H G CKSIY+ EG FIH M+   F RT +PD A V+FLPFSV  +
Sbjct  181   SFKVYVYQEGEPPMFHDGLCKSIYSTEGRFIHEMEKGNFYRTKNPDDALVYFLPFSVVAM  240

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +Y    HD   +  T  DY+  I+ K+PFWNR+LGADHFMLSCHDWGP  +  +P L
Sbjct  241   VQYLYEPGGHDRQAIGHTLADYIGLISGKHPFWNRSLGADHFMLSCHDWGPYSTSYVPQL  300

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KDVS+PEI+L  G   GLIG P P+ RP+L F+AG LHG 
Sbjct  301   FNNSIRVLCNANTSEGFNPLKDVSLPEIHLRTGEITGLIGCPSPSRRPILAFFAGRLHGH  360

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R +LL+ W+ KD+ I+++  LP  VSY  M+RKSK+CLCPSGYEVASPR+VEA+Y  C+
Sbjct  361   IRYLLLEQWKEKDQGIQVYDSLPAGVSYESMLRKSKFCLCPSGYEVASPRVVEAIYAECI  420

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             P+LI   Y PPFSDVLNW +F+V + V+DI N+KKILT I QTQY  + RR  +V+RHF 
Sbjct  421   PILISDSYAPPFSDVLNWKSFSVEVAVKDILNIKKILTSISQTQYRRMHRRLKQVQRHFV  480

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             +N PPKRFD+FH I+HSIWL+RLNI++
Sbjct  481   INGPPKRFDLFHTIMHSIWLQRLNIQI  507



>ref|XP_010246563.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At5g03795 [Nelumbo nucifera]
Length=494

 Score =   464 bits (1193),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 221/408 (54%), Positives = 287/408 (70%), Gaps = 11/408 (3%)
 Frame = +1

Query  250   PNKSWVFTFPYLKTLAVYGAKSYTKLEILESGLAQARSSILRGNQ-----LHSDEHYIPS  414
             PNK+ +++     T+   G   ++KL+ LE+ LA+AR+ I + +Q     L S E YIP 
Sbjct  90    PNKTGLYSNQMSITVVKGG---HSKLQRLEANLARARALIRKASQNQTSPLQSGEDYIPQ  146

Query  415   GSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ--F  588
             G+IY NA  FHRSY+EMEK  K++VYEDG PP+ H GPCK IY+ EG FIH ++ ++   
Sbjct  147   GTIYHNAHEFHRSYLEMEKLFKIFVYEDGDPPLFHNGPCKGIYSTEGRFIHQIEINKQFL  206

Query  589   RTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGAD  768
             RT DP  A V+FLP S+    +++YV +S D  P+KR    YV +IA KYP+WNR+LGAD
Sbjct  207   RTRDPARALVYFLPISIARSVQLLYVPDSRDIGPIKRXC-HYVNAIAAKYPYWNRSLGAD  265

Query  769   HFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIG  948
             HF+ SCHDWGP IS  IP L + +IR LCNANTSE FNP +DVS PEINL  G     +G
Sbjct  266   HFLFSCHDWGPLISAYIPYLHQNSIRVLCNANTSEGFNPSRDVSFPEINLRRGDISAFLG  325

Query  949   GPPPTERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLC  1128
             G PP  R +L F+AG  HG VR +L +HW++KDE+++++ +LP+ +SY  MMR+S YCLC
Sbjct  326   GLPPQARQILAFFAGKQHGHVRLLLFEHWKDKDEELQVYEHLPRGISYREMMRRSNYCLC  385

Query  1129  PSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDI  1308
             PSGYEVASPR+ EA+Y  CVPVLI   YVPPFSDVLNW +F+V + V DIPNLK IL   
Sbjct  386   PSGYEVASPRVAEAIYAECVPVLISDHYVPPFSDVLNWKSFSVQVQVRDIPNLKSILMGT  445

Query  1309  PQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
              + QY  +Q R  +V++HF VN PP RFD FHM +HSIWLRRLN+ +H
Sbjct  446   SEAQYIRMQARVKQVQKHFIVNDPPTRFDAFHMTIHSIWLRRLNVHIH  493



>ref|XP_008394205.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=519

 Score =   464 bits (1194),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 220/389 (57%), Positives = 282/389 (72%), Gaps = 8/389 (2%)
 Frame = +1

Query  313   SYTKLEILESGLAQARSSILRG------NQLHSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             S ++L+ +E+ L +ARSSI            H D  Y+P G IY N ++FHRSY+EMEK 
Sbjct  130   SGSQLDKVEASLGRARSSIREAALVRNKTSTHQDPDYVPRGPIYRNPNAFHRSYLEMEKV  189

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLS  651
              K+YVYE+G+ P+ H GPC+SIY+ EG FIH M+  + +RT DP  A V+FLPFSV  + 
Sbjct  190   FKIYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGKMYRTKDPHKALVYFLPFSVVNMV  249

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + IY+  + D S MKR  +DY+  I+ K+PFWNR+LGADHFMLSCHDWGP  +  +PDL 
Sbjct  250   QYIYMPETFDRSGMKRAVVDYINLISHKHPFWNRSLGADHFMLSCHDWGPTTTSFVPDLF  309

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
               +IR LCNANTSE FNP KD S PEINL      G IGG PP++R  L F+AG LHG +
Sbjct  310   HNSIRVLCNANTSEGFNPLKDASFPEINLKTSEMPG-IGGRPPSKRSTLAFFAGRLHGHI  368

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             R +LL  W+ KD+D++++  LP+ VSY  M++ SK+CLCPSGYEVASPR+VEA+Y  CVP
Sbjct  369   RYLLLNEWKGKDQDVQVYDQLPRRVSYENMLKSSKFCLCPSGYEVASPRVVEAIYAECVP  428

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI  GYVPPFSDVLNW +F+V IPV++I ++K ILT I   QY  +QRR  +V+RHF V
Sbjct  429   VLISDGYVPPFSDVLNWKSFSVQIPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLV  488

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             N PPKR+DVFHMI+HSIWLRRLNIR+  +
Sbjct  489   NGPPKRYDVFHMIVHSIWLRRLNIRIQDV  517



>ref|XP_008229804.1| PREDICTED: probable glycosyltransferase At3g07620 [Prunus mume]
Length=482

 Score =   461 bits (1187),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 215/386 (56%), Positives = 281/386 (73%), Gaps = 6/386 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQLHS-----DEHYIPSGSIYWNASSFHRSYVEMEKT  474
             K    LE LE+GLA AR+ I       +     D  Y+P G IY NA +FHRS++ ME  
Sbjct  95    KGDVNLEKLEAGLATARALIREATSKFNHTALEDADYVPQGDIYRNAYAFHRSHLLMESL  154

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLS  651
              K+YVYE+G+PP+ H GPCK+IY++EG F+  M+  ++FRT DPD AHV+FLPFSV ++ 
Sbjct  155   FKIYVYEEGEPPIFHNGPCKNIYSMEGLFLSFMETDTKFRTLDPDKAHVYFLPFSVVMII  214

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + ++     D + ++RT +DYV+ ++ KYPFWNR+LGADH MLSCHDWGP  +  +  L 
Sbjct  215   EYLFHPIIRDKAVLERTVVDYVRVVSNKYPFWNRSLGADHVMLSCHDWGPRATWYVKQLY  274

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
               AIR LCNANTSE FNPKKD S PEINL  G   GL+GG  P+ER  L F+AG +HG +
Sbjct  275   FVAIRVLCNANTSEHFNPKKDASFPEINLETGDITGLVGGLSPSERTTLAFFAGRMHGRI  334

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             RP+L QHW+ KD+D+ ++  LP+ VSYH M++KSKYC+CPSG+EVASPR+ EA+Y  CVP
Sbjct  335   RPLLFQHWKEKDKDLLVYETLPEGVSYHDMLKKSKYCICPSGHEVASPRIAEAIYAECVP  394

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI + YV PFSDVLNW +F+V + V +IP LK+IL  IP+ QY  +Q+R  +V+RHF V
Sbjct  395   VLISQHYVLPFSDVLNWESFSVQVSVTEIPQLKEILMGIPEEQYRRMQKRVKQVQRHFVV  454

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRV  1449
             N  PKRFDVFHMI+HSIWLRRLN+R+
Sbjct  455   NSSPKRFDVFHMIIHSIWLRRLNVRI  480



>ref|XP_007049438.1| Catalytic, putative [Theobroma cacao]
 gb|EOX93595.1| Catalytic, putative [Theobroma cacao]
Length=545

 Score =   464 bits (1193),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 219/393 (56%), Positives = 282/393 (72%), Gaps = 8/393 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRG------NQLHSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y+KLE LE+ LA+ARSSI           +H +  Y+P G IY N+++FHRSY+EMEK
Sbjct  152   KRYSKLERLEANLARARSSIKEAALVRNLTSIHQNHDYVPHGPIYRNSNAFHRSYLEMEK  211

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQF-RTTDPDSAHVFFLPFSVTVL  648
               K+YVY++G+PP+ H GPC+SIY+ EG FIH ++  +F RT DPD A V+FLPFSV +L
Sbjct  212   LFKIYVYQEGEPPIFHNGPCRSIYSSEGRFIHELEKGKFYRTQDPDEALVYFLPFSVVML  271

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
                +Y   + D   + R  +DY+  IA K+P+WNR+LGADH MLSCHDWGP  S  +P L
Sbjct  272   VHYLYDPETFDTDAIGRAVVDYIDVIASKHPYWNRSLGADHVMLSCHDWGPRASSYVPHL  331

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KD S PEINL  G  +GL+GGP P+ R +L F+AG LHG 
Sbjct  332   YHKSIRVLCNANTSEGFNPAKDASFPEINLLTGDVEGLLGGPSPSRRSILAFFAGRLHGY  391

Query  1009  VRPILLQHWENK-DEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGC  1185
             +R +LL  W++K D D+++   LPK VSY   ++ S++CLCPSGYEVASPR+VEA+Y  C
Sbjct  392   IRYLLLNEWKDKRDPDVQVFDQLPKGVSYMSKLKNSRFCLCPSGYEVASPRIVEAIYAEC  451

Query  1186  VPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHF  1365
             VPVLI   YVPPFSDVLNW++F+V +  +DIPN+KKIL  I Q +Y  +QRR  +V+RHF
Sbjct  452   VPVLISDSYVPPFSDVLNWNSFSVQVAAKDIPNIKKILMSISQRRYLRMQRRVKQVQRHF  511

Query  1366  EVNWPPKRFDVFHMILHSIWLRRLNIRVHHLNN  1464
              VN  PKR+DVFHMI HSIWLRRLNI V   ++
Sbjct  512   VVNATPKRYDVFHMITHSIWLRRLNIHVQDFDH  544



>ref|XP_004305861.1| PREDICTED: probable glycosyltransferase At3g07620-like [Fragaria 
vesca subsp. vesca]
Length=465

 Score =   460 bits (1183),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 212/389 (54%), Positives = 284/389 (73%), Gaps = 6/389 (2%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRGNQLHS-----DEHYIPSGSIYWNASSFHRSYVEME  468
               K    LE +E+GLA AR  I     L+      D  Y+P+G IY NA +FHRSY+ ME
Sbjct  76    NEKGDVNLERIEAGLATARELIREATTLNQTSPLEDADYVPNGDIYRNAYAFHRSYLLME  135

Query  469   KTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTV  645
                + +VYE+G+PP+ H GPCK+IY++EG F+  M+  ++FRT+DP+ AHV+FLPFSV +
Sbjct  136   SLFRTFVYEEGEPPIFHNGPCKNIYSMEGLFLSFMETDTKFRTSDPEEAHVYFLPFSVVM  195

Query  646   LSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPD  825
             + + ++     D + ++RT +DYV+ I+ KYPFWNR+LGADH MLSCHDWGP  +  +  
Sbjct  196   IIEYLFHPVIRDKAVLQRTVVDYVRVISNKYPFWNRSLGADHVMLSCHDWGPRATWYVRQ  255

Query  826   LQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHG  1005
             L   AIR LCNANTSE FNPKKD S PEINL  G   GLIGG PP++R VL F+AG +HG
Sbjct  256   LYFVAIRVLCNANTSEHFNPKKDASFPEINLVTGEITGLIGGLPPSKRSVLAFFAGRMHG  315

Query  1006  PVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGC  1185
              +RP+L QHW+ KDE++ ++  LPKN SY  M+++SKYC+CPSG+EVASPR+VEA+Y  C
Sbjct  316   RIRPLLFQHWKEKDENLLVYEKLPKNASYQDMLKQSKYCICPSGHEVASPRIVEAIYAEC  375

Query  1186  VPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHF  1365
             VPVLI + YV PFSDVL+W +F++ + V +IP LK+IL  IP+ +Y  +Q R  +V+ HF
Sbjct  376   VPVLISQHYVLPFSDVLDWESFSIQVSVSEIPQLKEILMRIPEEKYRRMQERVKQVQMHF  435

Query  1366  EVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
              VN PPKR+DVFHMI+HSIWLRRLN+R++
Sbjct  436   VVNNPPKRYDVFHMIIHSIWLRRLNVRIY  464



>ref|XP_010657501.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Vitis vinifera]
Length=410

 Score =   458 bits (1178),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 218/384 (57%), Positives = 284/384 (74%), Gaps = 7/384 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSD------EHYIPSGSIYWNASSFHRSYVEMEKTLK  480
              +LE +E+GLA+AR+ I  G    S         Y+P G IY NA++FHRSY+ MEK  K
Sbjct  27    AELERVEAGLARARALIREGTTNWSSISAPVGADYVPQGDIYRNATAFHRSYLLMEKLFK  86

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             +++Y++G+PP+ H GPCKSIY+IEG F   M+  + FRT DPD AHV+FLPFSV ++   
Sbjct  87    IFIYKEGEPPLFHNGPCKSIYSIEGVFFSLMEGDTHFRTQDPDEAHVYFLPFSVVMIIHH  146

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             ++     D   MK    DYV+ I++KY +WNR+LGADHFMLSCHDWGP  +  +P L   
Sbjct  147   LFDPIVRDKYVMKHVVSDYVKVISQKYRYWNRSLGADHFMLSCHDWGPRATWYVPQLYYN  206

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE FNP+KD SIPEINL DG T GL GG PP++R +L F+AGGLHG +RP
Sbjct  207   SIRLLCNANTSECFNPRKDASIPEINLIDGETIGLTGGLPPSKRTILAFFAGGLHGRIRP  266

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
              LLQHW+ KDE ++++  LP+ +SY  +M+KSKYC+CPSG+EVASPR+VEA+Y  CVPVL
Sbjct  267   ALLQHWKEKDEQVQVYETLPEGLSYPDLMKKSKYCICPSGHEVASPRIVEAIYAECVPVL  326

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I + YV PFSDVL+W +F++ + V +IPNLKKIL  IPQ +Y  +Q R  +V++HF VN 
Sbjct  327   ISQHYVLPFSDVLDWGSFSIQVSVNEIPNLKKILLGIPQDRYIRMQERVKQVQQHFVVNN  386

Query  1378  PPKRFDVFHMILHSIWLRRLNIRV  1449
             PPKRFDVFHMI+HSIWLRRLN+ +
Sbjct  387   PPKRFDVFHMIIHSIWLRRLNVAI  410



>ref|XP_009379539.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=521

 Score =   461 bits (1187),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 219/389 (56%), Positives = 281/389 (72%), Gaps = 8/389 (2%)
 Frame = +1

Query  313   SYTKLEILESGLAQARSSILRG------NQLHSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             S +KL+ +E+ L +ARSSI            H D  Y+P G IY N ++FHRSY+EMEK 
Sbjct  132   SSSKLDKVEASLGRARSSIREAALVRNKTSTHQDPDYVPRGPIYRNPNAFHRSYLEMEKV  191

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLS  651
              K+YVYE+G+ P+ H GPC+SIY+ EG FIH M+  Q +RT  P  A V+FLPFSV  + 
Sbjct  192   FKIYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGQLYRTKAPHKALVYFLPFSVVNMV  251

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + IY+  ++D S MK   +DY+  I+ K+PFWNR+LGADHFMLSCHDWGP  +  +PDL 
Sbjct  252   QYIYMPETYDRSGMKLAVVDYINLISHKHPFWNRSLGADHFMLSCHDWGPTTTSFVPDLF  311

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
               +IR LCNANTSE F+P KD S PEINL      GL GG PP++R  L F+AG LHG +
Sbjct  312   HNSIRVLCNANTSEGFDPSKDASFPEINLKTSEMPGL-GGQPPSKRYTLAFFAGRLHGHI  370

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             R +LL  W+ KD+D++++  LP+ VSY  M++ SK+CLCPSGYEVASPR+VEA+Y  CVP
Sbjct  371   RYLLLNEWKGKDQDVQVYDQLPQGVSYENMLKSSKFCLCPSGYEVASPRVVEAIYAECVP  430

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI  GYVPPFSDVLNW +F+V +PV++I ++K ILT I   QY  +QRR  +V+RHF V
Sbjct  431   VLISDGYVPPFSDVLNWKSFSVQVPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLV  490

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             N PPKRFDVFHMI+HSIWLRRLNIR+  +
Sbjct  491   NGPPKRFDVFHMIVHSIWLRRLNIRIQDV  519



>gb|EAZ03045.1| hypothetical protein OsI_25187 [Oryza sativa Indica Group]
Length=601

 Score =   464 bits (1193),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 285/388 (73%), Gaps = 11/388 (3%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLH------SDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
              KLE LE GLA+AR++I    Q        +D+ Y+P G +Y NA +FHRSY+EMEK  K
Sbjct  209   VKLERLELGLAKARATIREAIQNKDNKPPLTDKDYVPVGPVYRNAYAFHRSYLEMEKVFK  268

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             V+VYE+G+PPV H GPC SIY+ EG FI+AM+  ++ RT DP+ AHVFFLPFSV  + KM
Sbjct  269   VFVYEEGEPPVFHDGPCHSIYSTEGRFIYAMEMENRMRTRDPNQAHVFFLPFSVVKMVKM  328

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             IY  NSHD  P++RT  DY+  ++ KYP WNR+LGADHFMLSCHDWGP +S +   L   
Sbjct  329   IYEPNSHDMDPLRRTISDYINVVSTKYPHWNRSLGADHFMLSCHDWGPYVSSANGHLFSN  388

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE F+P +DVS+PEINL        +GGP  + RP+L F+AGG HGPVRP
Sbjct  389   SIRVLCNANTSEGFDPSRDVSLPEINLRSDVVARQVGGPSASHRPILAFFAGGDHGPVRP  448

Query  1018  ILLQHW-ENKDEDIKIHSYLPK--NVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +LLQHW + +D DI++  YLP+  ++SY  MMR+S++CLCPSGYEVASPR+VEA+Y+ CV
Sbjct  449   LLLQHWGKGQDADIQVSEYLPRRHSMSYTDMMRRSRFCLCPSGYEVASPRVVEAIYLECV  508

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PV+I   Y  PF+DVLNW+AF+V + V DIP LK+IL  +   QY  +QRR   VRRHF 
Sbjct  509   PVVIGDDYALPFADVLNWAAFSVRVAVGDIPRLKEILAAVSPRQYIRMQRRVRAVRRHFM  568

Query  1369  V-NWPPKRFDVFHMILHSIWLRRLNIRV  1449
             V +  P RFDVFHMILHSIWLRRLN+RV
Sbjct  569   VSDGAPWRFDVFHMILHSIWLRRLNVRV  596



>ref|XP_002264111.3| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Vitis vinifera]
Length=454

 Score =   458 bits (1179),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 218/384 (57%), Positives = 284/384 (74%), Gaps = 7/384 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSD------EHYIPSGSIYWNASSFHRSYVEMEKTLK  480
              +LE +E+GLA+AR+ I  G    S         Y+P G IY NA++FHRSY+ MEK  K
Sbjct  71    AELERVEAGLARARALIREGTTNWSSISAPVGADYVPQGDIYRNATAFHRSYLLMEKLFK  130

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             +++Y++G+PP+ H GPCKSIY+IEG F   M+  + FRT DPD AHV+FLPFSV ++   
Sbjct  131   IFIYKEGEPPLFHNGPCKSIYSIEGVFFSLMEGDTHFRTQDPDEAHVYFLPFSVVMIIHH  190

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             ++     D   MK    DYV+ I++KY +WNR+LGADHFMLSCHDWGP  +  +P L   
Sbjct  191   LFDPIVRDKYVMKHVVSDYVKVISQKYRYWNRSLGADHFMLSCHDWGPRATWYVPQLYYN  250

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE FNP+KD SIPEINL DG T GL GG PP++R +L F+AGGLHG +RP
Sbjct  251   SIRLLCNANTSECFNPRKDASIPEINLIDGETIGLTGGLPPSKRTILAFFAGGLHGRIRP  310

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
              LLQHW+ KDE ++++  LP+ +SY  +M+KSKYC+CPSG+EVASPR+VEA+Y  CVPVL
Sbjct  311   ALLQHWKEKDEQVQVYETLPEGLSYPDLMKKSKYCICPSGHEVASPRIVEAIYAECVPVL  370

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I + YV PFSDVL+W +F++ + V +IPNLKKIL  IPQ +Y  +Q R  +V++HF VN 
Sbjct  371   ISQHYVLPFSDVLDWGSFSIQVSVNEIPNLKKILLGIPQDRYIRMQERVKQVQQHFVVNN  430

Query  1378  PPKRFDVFHMILHSIWLRRLNIRV  1449
             PPKRFDVFHMI+HSIWLRRLN+ +
Sbjct  431   PPKRFDVFHMIIHSIWLRRLNVAI  454



>ref|XP_003555678.1| PREDICTED: probable glycosyltransferase At3g07620-like [Glycine 
max]
Length=493

 Score =   459 bits (1180),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 221/385 (57%), Positives = 282/385 (73%), Gaps = 9/385 (2%)
 Frame = +1

Query  322   KLEILESGLAQARSSI-----LRGNQ--LHSD-EHYIPSGSIYWNASSFHRSYVEMEKTL  477
             KLE +E+ LA+AR+ I     LR N   L  D   YIP G IY NA +FHRSY  MEK  
Sbjct  108   KLEKVEASLAKARALIKEALLLRTNATVLQDDTSDYIPEGDIYRNAVAFHRSYQLMEKVF  167

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSK  654
             K++VYE+G+PP+ HYGPCK+IY++EG FI++++  SQFRT +PD AHV+FLPFSV ++ +
Sbjct  168   KIFVYEEGEPPLFHYGPCKNIYSMEGIFINSLEINSQFRTQNPDEAHVYFLPFSVVMILE  227

Query  655   MIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
              ++     D + ++RT  DYV  I+ KY +WNR+ GADHFMLSCHDWGP  +  + +L  
Sbjct  228   HLFHPVIRDKAVLERTIGDYVHIISHKYKYWNRSYGADHFMLSCHDWGPRATWYVKELYF  287

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              AIR LCNAN SE FNPKKD S PEINL +G T GLIGG PP  R +L F+AG +HG +R
Sbjct  288   IAIRVLCNANISEHFNPKKDASFPEINLVNGETRGLIGGYPPCNRTILAFFAGQMHGRIR  347

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
             P+L QHWE KD+D+ ++  LP  V YH  M+KSKYC+CPSG+EVASPR+VEA+Y  CVPV
Sbjct  348   PVLFQHWEGKDKDVLVYEKLPDGVPYHETMKKSKYCICPSGFEVASPRIVEAIYAQCVPV  407

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             +I + YV PFSDVLNW +F+V I V D+P LK+IL  I + +Y  LQ    +V+RHF VN
Sbjct  408   IISQQYVLPFSDVLNWDSFSVQILVSDVPKLKEILLGISEDKYMRLQEGVKQVQRHFVVN  467

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRV  1449
              PPKR+DVFHMI+HSIWLRRLN+RV
Sbjct  468   NPPKRYDVFHMIIHSIWLRRLNVRV  492



>ref|XP_010933454.1| PREDICTED: probable glycosyltransferase At5g03795 [Elaeis guineensis]
Length=524

 Score =   459 bits (1182),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 225/384 (59%), Positives = 282/384 (73%), Gaps = 8/384 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILR-----GNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             TKLE LE GLA+AR++I             D+ Y+P G +Y NA +FH+SY+EMEK  KV
Sbjct  140   TKLERLEFGLARARAAIREAARNPNRTALVDKDYVPIGPVYRNAYAFHKSYLEMEKLFKV  199

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             +VYE+G+PP+ H GPC+SIY+ EG FI+ MD  S+ RT DPD AHVFFLPFSV  + + I
Sbjct  200   FVYEEGEPPIFHDGPCRSIYSTEGFFINNMDMESRLRTRDPDRAHVFFLPFSVVRMVQYI  259

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             Y  + HD  P+++T LDY+  I+ KYPFWNR+LGADHFMLSCHDWGP  SG    L   +
Sbjct  260   YPRDHHDMRPLRKTVLDYINLISGKYPFWNRSLGADHFMLSCHDWGPYASGGHHHLFVNS  319

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNANTSE FN  +DVS+PE+N+        +GGP  + RP+L F+AGG HGPVRP+
Sbjct  320   IRVLCNANTSEWFNASRDVSLPEMNVRSDVIK--VGGPSASGRPILAFFAGGNHGPVRPV  377

Query  1021  LLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLI  1200
             LL+HW+ KD D+++H YLPK VSY  +M+KSK+CLCPSGYEVASPR++EA+Y  CVPV I
Sbjct  378   LLKHWKGKDNDVQVHEYLPKGVSYVDLMKKSKFCLCPSGYEVASPRIMEAIYYECVPVTI  437

Query  1201  KRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWP  1380
                YV P SDVLNW AF+V + VEDIP LK IL  I   QY  +QRR   V+RHF +N P
Sbjct  438   NANYVLPLSDVLNWKAFSVQVSVEDIPKLKNILMSISPRQYIRMQRRVKTVQRHFMMNGP  497

Query  1381  PKRFDVFHMILHSIWLRRLNIRVH  1452
             P+RFD++HM+LHSIWLRRLNIR+H
Sbjct  498   PQRFDLYHMLLHSIWLRRLNIRIH  521



>ref|XP_008227726.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=542

 Score =   460 bits (1183),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 219/387 (57%), Positives = 277/387 (72%), Gaps = 8/387 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             ++LE LE+ L +ARSSI     +      H D  Y+P G IY N ++FHRSY+EME   K
Sbjct  155   SQLEKLEASLGRARSSIREAANVRNKISTHQDPDYVPRGPIYRNPNAFHRSYLEMENLFK  214

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPDSAHVFFLPFSVTVLSKM  657
             +YVYE+G+ P+ H GPC+SIY+ EG FIH M+  + +RT DPD A V+FLPFSV  + + 
Sbjct  215   IYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGNMYRTRDPDKALVYFLPFSVARMVRY  274

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +YV +S D   MK   +DYV  IA+K+PFWNR+LGADHFMLSCHDWGP  +  +P L   
Sbjct  275   MYVPDSKDRHGMKLAIIDYVNLIAQKHPFWNRSLGADHFMLSCHDWGPFTTSFVPLLFHN  334

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE FNP KD S PEINL      GL GG PP+ R  L F+AGGLHG +R 
Sbjct  335   SIRVLCNANTSEGFNPSKDSSFPEINLKTSEMSGL-GGQPPSSRSTLAFFAGGLHGHIRS  393

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             +LL  W+ KD D++++  LP+ VSY  M++ SK+CLCPSGYEVASPR+VEA+Y  C+PVL
Sbjct  394   LLLNEWKGKDRDVRVYEKLPRGVSYEKMLKGSKFCLCPSGYEVASPRVVEAIYAECIPVL  453

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I  GY+PPFSDVL+W  F+V +PV++I ++K IL  I   QY   QRR  EV+RHF VN 
Sbjct  454   ISDGYIPPFSDVLDWKTFSVQVPVKNISDIKNILMSISSRQYLRTQRRVKEVQRHFLVNG  513

Query  1378  PPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             PPKR+DVFHMI+HSIWLRRLNIR+  L
Sbjct  514   PPKRYDVFHMIVHSIWLRRLNIRIQDL  540



>gb|KHN15414.1| Putative glycosyltransferase [Glycine soja]
Length=493

 Score =   458 bits (1178),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 221/385 (57%), Positives = 282/385 (73%), Gaps = 9/385 (2%)
 Frame = +1

Query  322   KLEILESGLAQARSSI-----LRGNQ--LHSD-EHYIPSGSIYWNASSFHRSYVEMEKTL  477
             KLE +E+ LA+AR+ I     LR N   L  D   YIP G IY NA +FHRSY  MEK  
Sbjct  108   KLEKVEASLAKARALIKEALLLRTNATVLQDDTSDYIPEGDIYRNAVAFHRSYQLMEKVF  167

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSK  654
             K++VYE+G+PP+ HYGPCK+IY++EG FI++++  SQFRT +PD AHV+FLPFSV ++ +
Sbjct  168   KIFVYEEGEPPLFHYGPCKNIYSMEGIFINSLEINSQFRTQNPDEAHVYFLPFSVVMILE  227

Query  655   MIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
              ++     D + ++RT  DYV  I+ KY +WNR+ GADHFMLSCHDWGP  +  + +L  
Sbjct  228   HLFHPVIRDKAVLERTIGDYVHIISHKYKYWNRSYGADHFMLSCHDWGPRATWYVKELYF  287

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              AIR LCNAN SE FNPKKD S PEINL +G T GLIGG PP  R +L F+AG +HG +R
Sbjct  288   IAIRVLCNANISEHFNPKKDASFPEINLVNGETRGLIGGYPPCNRTILAFFAGQMHGRIR  347

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
             P+L QHWE KD+D+ ++  LP  V YH  M+KSKYC+CPSG+EVASPR+VEA+Y  CVPV
Sbjct  348   PVLFQHWEGKDKDVLVYEKLPDGVPYHETMKKSKYCICPSGFEVASPRIVEAIYAQCVPV  407

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             +I + YV PFSDVLNW +F+V I V D+P LK+IL  I + +Y  LQ    +V+RHF VN
Sbjct  408   IISQQYVLPFSDVLNWDSFSVQILVSDVPKLKEILLGISEDKYMRLQEGVKQVQRHFVVN  467

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRV  1449
              PPKR+DVFHMI+HSIWLRRLN+RV
Sbjct  468   NPPKRYDVFHMIIHSIWLRRLNVRV  492



>ref|XP_010228257.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Brachypodium distachyon]
Length=547

 Score =   460 bits (1183),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 218/386 (56%), Positives = 285/386 (74%), Gaps = 10/386 (3%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLH------SDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
              KL  LE GLA+ARS+I+  +         +D+ Y+P G +Y NA++FHRSY+EMEK  K
Sbjct  157   AKLHRLELGLAKARSTIMEASHNKDNRPPLTDKDYVPVGPVYRNANAFHRSYLEMEKLFK  216

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             +YVY++G+PP+ H GPC +IY+ EG FIHAM+  ++ RTTDP  AHVFFLPFS+  + K 
Sbjct  217   IYVYDEGEPPIYHDGPCHNIYSTEGRFIHAMEMENRMRTTDPGLAHVFFLPFSIAKMEKT  276

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             IYV  SH   P++RT  DY+  ++ K+P+WNR+ GADHFMLSCHDWGP +S    +L   
Sbjct  277   IYVPGSHTMEPLRRTVFDYIDVLSTKHPYWNRSQGADHFMLSCHDWGPYVSSVDGNLFSN  336

Query  838   AIRALCNANTSERFNPKKDVSIPEIN-LPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
             +IR LCNANTSE F P KDVS+PEIN L D   D  IGGP  + RP+L F+AGG HGPVR
Sbjct  337   SIRVLCNANTSEGFIPSKDVSLPEINHLNDFKKD--IGGPSASGRPILAFFAGGNHGPVR  394

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
             P+LL+HW+ KD D+++  YLP  VSY   MR+SK+CLCPSG+EVASPR+ EA+Y+ CVPV
Sbjct  395   PLLLKHWKGKDPDVQVSEYLPAGVSYVETMRRSKFCLCPSGFEVASPRVAEAIYVECVPV  454

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             +I   YV PFSDVL+W AF++ + V DIP++K+IL+ +   +Y  +QRR   VRRHF +N
Sbjct  455   VIADDYVLPFSDVLSWPAFSLRVAVRDIPDIKRILSAVSPRRYIRMQRRVRAVRRHFMLN  514

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRVH  1452
               P+R+DVFHMILHSIWLRRLN+R+H
Sbjct  515   GVPQRYDVFHMILHSIWLRRLNVRIH  540



>ref|XP_010228256.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Brachypodium distachyon]
Length=548

 Score =   460 bits (1183),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 218/386 (56%), Positives = 285/386 (74%), Gaps = 10/386 (3%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLH------SDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
              KL  LE GLA+ARS+I+  +         +D+ Y+P G +Y NA++FHRSY+EMEK  K
Sbjct  158   AKLHRLELGLAKARSTIMEASHNKDNRPPLTDKDYVPVGPVYRNANAFHRSYLEMEKLFK  217

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             +YVY++G+PP+ H GPC +IY+ EG FIHAM+  ++ RTTDP  AHVFFLPFS+  + K 
Sbjct  218   IYVYDEGEPPIYHDGPCHNIYSTEGRFIHAMEMENRMRTTDPGLAHVFFLPFSIAKMEKT  277

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             IYV  SH   P++RT  DY+  ++ K+P+WNR+ GADHFMLSCHDWGP +S    +L   
Sbjct  278   IYVPGSHTMEPLRRTVFDYIDVLSTKHPYWNRSQGADHFMLSCHDWGPYVSSVDGNLFSN  337

Query  838   AIRALCNANTSERFNPKKDVSIPEIN-LPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
             +IR LCNANTSE F P KDVS+PEIN L D   D  IGGP  + RP+L F+AGG HGPVR
Sbjct  338   SIRVLCNANTSEGFIPSKDVSLPEINHLNDFKKD--IGGPSASGRPILAFFAGGNHGPVR  395

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
             P+LL+HW+ KD D+++  YLP  VSY   MR+SK+CLCPSG+EVASPR+ EA+Y+ CVPV
Sbjct  396   PLLLKHWKGKDPDVQVSEYLPAGVSYVETMRRSKFCLCPSGFEVASPRVAEAIYVECVPV  455

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             +I   YV PFSDVL+W AF++ + V DIP++K+IL+ +   +Y  +QRR   VRRHF +N
Sbjct  456   VIADDYVLPFSDVLSWPAFSLRVAVRDIPDIKRILSAVSPRRYIRMQRRVRAVRRHFMLN  515

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRVH  1452
               P+R+DVFHMILHSIWLRRLN+R+H
Sbjct  516   GVPQRYDVFHMILHSIWLRRLNVRIH  541



>gb|AGV54221.1| glycosyltransferase [Phaseolus vulgaris]
Length=490

 Score =   456 bits (1174),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 222/382 (58%), Positives = 276/382 (72%), Gaps = 9/382 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSI--LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVY  492
             T L+ +E GLAQAR++I   R      D  Y+P G +YWNA +FHRSY+EMEK  KV+ Y
Sbjct  108   TILDNIEIGLAQARAAIREARNGTGTPDSDYVPKGPMYWNAKAFHRSYLEMEKQFKVFSY  167

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
              +G+PP  H  PCKS Y++EG+F+HA++ +  FRT DP+ AHVFFLP         +Y  
Sbjct  168   GEGEPPNFHNAPCKSKYSMEGNFMHAIEMNNHFRTKDPEEAHVFFLP-----KGGYVYEG  222

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
              S D+ P+K+TA DYV +IA +YP+ NR L A HF L+CHD     S S+P   K +IR 
Sbjct  223   ISQDFGPVKKTATDYVSAIAARYPYGNRNLEAKHFTLACHDMCRGTSLSLPTPHKNSIRV  282

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSE F P KDVS PEINL   +    IGG   ++R +L F+AGG+HGP+ P+LL+
Sbjct  283   LCNANTSEGFKPAKDVSFPEINLKISSIR-FIGGQSASKRSILTFFAGGVHGPIAPVLLK  341

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWENKDEDI+I  YLPK +SY+ MMRKSK+CLCPSGYE ASPR+VEA+Y GCVPV I   
Sbjct  342   HWENKDEDIQILKYLPKGISYYEMMRKSKFCLCPSGYEGASPRVVEAIYTGCVPVFISEH  401

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
              VPPFSDVLNW +F+V I V+DIPNLK+IL  IP  QY  +QRR  ++ RHFEV+ PPKR
Sbjct  402   SVPPFSDVLNWKSFSVEISVKDIPNLKEILMSIPPKQYIRMQRRVEQIGRHFEVHSPPKR  461

Query  1390  FDVFHMILHSIWLRRLNIRVHH  1455
             FDVFHMILHS+WLRRLN+ VHH
Sbjct  462   FDVFHMILHSVWLRRLNLEVHH  483



>ref|XP_009379540.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=540

 Score =   458 bits (1179),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 214/389 (55%), Positives = 282/389 (72%), Gaps = 8/389 (2%)
 Frame = +1

Query  313   SYTKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             S ++L+ +E+ L +ARS+I    ++      H D  Y+P G IY N ++FHRSY+EMEK 
Sbjct  151   SGSQLDKVEASLGRARSAIREAAKVRNKTSTHQDPDYVPRGPIYHNPNAFHRSYLEMEKV  210

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQF-RTTDPDSAHVFFLPFSVTVLS  651
              K+YVYE+G+ P+ H GPC+ IY+ EG FIH M+  +F RT DP  A V+FLPFSV  + 
Sbjct  211   FKIYVYEEGEVPIFHEGPCRGIYSSEGRFIHEMEKGKFYRTKDPHKALVYFLPFSVVTMV  270

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + IY+  + D + MK   +DY+  I+ K+PFWNR+ GADHFMLSCHDWGP  +  +PDL 
Sbjct  271   QYIYMPETFDRNGMKLAVVDYINLISYKHPFWNRSHGADHFMLSCHDWGPFTTSFVPDLF  330

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
               +IR +CNANTSE FNP KD S+PEINL      G IGG PP++R  L FYAGGLHG +
Sbjct  331   HNSIRVVCNANTSEGFNPSKDASLPEINLKTSEMSG-IGGQPPSKRSTLAFYAGGLHGHI  389

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             R +LL  W+ KD+D+ ++  LP+ +SY  M + SK+CLCPSGYEVASPR+VEA+Y  CVP
Sbjct  390   RYLLLNEWKGKDQDVLVYDKLPQGMSYENMFKSSKFCLCPSGYEVASPRVVEAIYAECVP  449

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI  GYVPPFSDVLNW++F+V +PV++I ++K ILT I   QY  +QRR  +V+RHF V
Sbjct  450   VLISDGYVPPFSDVLNWNSFSVQVPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLV  509

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             N PPKR+DVFHMI+HS+WLRRLNIR+  +
Sbjct  510   NGPPKRYDVFHMIVHSVWLRRLNIRIQDI  538



>emb|CDP15733.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   455 bits (1171),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 219/385 (57%), Positives = 273/385 (71%), Gaps = 24/385 (6%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQ------LHSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y KLE LE+ L++AR SI    +       H D  Y P G +Y NA+ FHRS++EMEK
Sbjct  121   KRYNKLERLETILSKARYSIREAAKNGSMISTHEDADYAPHGPMYINANGFHRSHLEMEK  180

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQF-RTTDPDSAHVFFLPFSVTVL  648
             + KVYVYE+G+PP+ H GPCKSIY+ EG FIH M+   F RT +PD A V+FLPFSV  +
Sbjct  181   SFKVYVYEEGEPPMFHDGPCKSIYSTEGRFIHEMEKGNFYRTKNPDDALVYFLPFSVVAM  240

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +Y    HD   +  T  DY+  I+ K+PFWN++ GADHFMLSCHDW           
Sbjct  241   VQYLYEPGGHDRQAIGHTLADYIGLISGKHPFWNQSFGADHFMLSCHDW-----------  289

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                    LCNANTSE FNP KDVS+PEI+L  G   GLIGGP P+ RP+L F+AG LHG 
Sbjct  290   ------ILCNANTSEGFNPLKDVSLPEIHLRTGEITGLIGGPSPSRRPILAFFAGRLHGH  343

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R +LL+ W+ KD+DI+++  LP  VSY  M+RKSK+CLCPSGYEVASPR+VEA+Y  C+
Sbjct  344   IRYLLLEQWKEKDQDIQVYDNLPAGVSYESMLRKSKFCLCPSGYEVASPRVVEAIYAECI  403

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             P+LI   YVPPFSDVLNW +F+V + V+DIPN+KKILT I QTQY  + RR  +V+RHF 
Sbjct  404   PILISDSYVPPFSDVLNWKSFSVEVAVKDIPNIKKILTSISQTQYIRMHRRLKQVQRHFV  463

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNI  1443
             +N PPKRFD+FHMILHSIWLRRLNI
Sbjct  464   INGPPKRFDLFHMILHSIWLRRLNI  488



>emb|CBI28482.3| unnamed protein product [Vitis vinifera]
Length=634

 Score =   460 bits (1183),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 218/384 (57%), Positives = 284/384 (74%), Gaps = 7/384 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSD------EHYIPSGSIYWNASSFHRSYVEMEKTLK  480
              +LE +E+GLA+AR+ I  G    S         Y+P G IY NA++FHRSY+ MEK  K
Sbjct  251   AELERVEAGLARARALIREGTTNWSSISAPVGADYVPQGDIYRNATAFHRSYLLMEKLFK  310

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             +++Y++G+PP+ H GPCKSIY+IEG F   M+  + FRT DPD AHV+FLPFSV ++   
Sbjct  311   IFIYKEGEPPLFHNGPCKSIYSIEGVFFSLMEGDTHFRTQDPDEAHVYFLPFSVVMIIHH  370

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             ++     D   MK    DYV+ I++KY +WNR+LGADHFMLSCHDWGP  +  +P L   
Sbjct  371   LFDPIVRDKYVMKHVVSDYVKVISQKYRYWNRSLGADHFMLSCHDWGPRATWYVPQLYYN  430

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE FNP+KD SIPEINL DG T GL GG PP++R +L F+AGGLHG +RP
Sbjct  431   SIRLLCNANTSECFNPRKDASIPEINLIDGETIGLTGGLPPSKRTILAFFAGGLHGRIRP  490

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
              LLQHW+ KDE ++++  LP+ +SY  +M+KSKYC+CPSG+EVASPR+VEA+Y  CVPVL
Sbjct  491   ALLQHWKEKDEQVQVYETLPEGLSYPDLMKKSKYCICPSGHEVASPRIVEAIYAECVPVL  550

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I + YV PFSDVL+W +F++ + V +IPNLKKIL  IPQ +Y  +Q R  +V++HF VN 
Sbjct  551   ISQHYVLPFSDVLDWGSFSIQVSVNEIPNLKKILLGIPQDRYIRMQERVKQVQQHFVVNN  610

Query  1378  PPKRFDVFHMILHSIWLRRLNIRV  1449
             PPKRFDVFHMI+HSIWLRRLN+ +
Sbjct  611   PPKRFDVFHMIIHSIWLRRLNVAI  634



>ref|XP_004503012.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=488

 Score =   454 bits (1168),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 215/390 (55%), Positives = 281/390 (72%), Gaps = 7/390 (2%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHRSYVEM  465
             G   YT+LE +ES L +AR SI   +++      H D+ Y+P G IY NA +FHRSY+EM
Sbjct  96    GTNKYTQLERIESKLVKARYSIKEASKVRNLTSTHQDQDYVPHGPIYRNAKAFHRSYLEM  155

Query  466   EKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPDSAHVFFLPFSVT  642
             EK  K++VYE+G+PP+ H G  K+IY+ EG FI+ M+ +  +RT DPD A V+FLPFSV 
Sbjct  156   EKIFKIFVYEEGEPPMFHNGLSKNIYSTEGRFINEMEKWRYYRTNDPDEAFVYFLPFSVV  215

Query  643   VLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIP  822
             ++ + +YV  S+D S +  +  DY+  I+ KYPFWN++LG DHFMLSCHDWGP  S  + 
Sbjct  216   MMVEYLYVHGSNDRSSIGLSVQDYIHIISHKYPFWNQSLGHDHFMLSCHDWGPIASAYVD  275

Query  823   DLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLH  1002
             +L   +IR LCNAN SE F P KDVS PE+NL  G   GL+GG PP++R  L F+AG LH
Sbjct  276   NLFNNSIRVLCNANISEGFKPSKDVSFPEMNLKTGEVTGLVGGYPPSQRTTLAFFAGHLH  335

Query  1003  GPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMG  1182
             G +R +LL  W+NKD+D++++  LP   SY+  +R SK+CLCPSGYEVASPR+VEA++  
Sbjct  336   GHIRYLLLNTWKNKDQDVQVYDELPHEDSYNTKLRSSKFCLCPSGYEVASPRIVEAIFAE  395

Query  1183  CVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRH  1362
             CVPVLI   YVPPFSDVLNW +F+V I V++IPN+KKIL  I Q QY  +Q R  +V+RH
Sbjct  396   CVPVLISDNYVPPFSDVLNWKSFSVQIDVKEIPNIKKILMGISQRQYLKMQGRVKQVQRH  455

Query  1363  FEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             F  N PP+RFDVFHM +HSIWLRRLNIR+H
Sbjct  456   FVPNEPPERFDVFHMTIHSIWLRRLNIRIH  485



>ref|XP_006845223.1| hypothetical protein AMTR_s00005p00255230 [Amborella trichopoda]
 gb|ERN06898.1| hypothetical protein AMTR_s00005p00255230 [Amborella trichopoda]
Length=384

 Score =   450 bits (1158),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 209/381 (55%), Positives = 281/381 (74%), Gaps = 8/381 (2%)
 Frame = +1

Query  334   LESGLAQARSSILRGNQLHSD-------EHYIPSGSIYWNASSFHRSYVEMEKTLKVYVY  492
             LE+GL++AR++I      H +       + Y P G IY N+ +FHRSY+EMEK  K++VY
Sbjct  3     LEAGLSKARAAIREATLSHRNRTPIEDPDDYAPKGGIYRNSYAFHRSYLEMEKRFKIFVY  62

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
             E+G+PP+ H GPCKSIY+ EG FIH M   ++FRT   + AHV FLPFSV  + + +Y  
Sbjct  63    EEGEPPLVHNGPCKSIYSSEGIFIHEMVLGNRFRTRSQERAHVHFLPFSVVAMIQFVYTP  122

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
             +S D  P+K    DY+  I++KY +WN++LGADHFMLSCHDWGP  S + P L K +IR 
Sbjct  123   SSFDLYPVKNLVADYIDVISKKYHYWNQSLGADHFMLSCHDWGPHTSAANPLLNKNSIRV  182

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNAN+SE F P++DV +PEIN+P G+ +G++GG  P+ R +L F+AGG+HG +R ILLQ
Sbjct  183   LCNANSSEDFYPQRDVPLPEINIPSGSIEGMLGGLRPSARTILAFFAGGVHGWIRSILLQ  242

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HW+NKD DI+   YLP ++SY  M+RKSK+CLCPSGYEVASPR+VEA+Y  CVPV+I   
Sbjct  243   HWKNKDPDIQAFEYLPHDLSYWDMLRKSKFCLCPSGYEVASPRLVEAIYAECVPVIISDH  302

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YV PFSDVLNW++F+V + V +I  LK+IL  I   +Y  +QRR  +V+RHF VN PPKR
Sbjct  303   YVLPFSDVLNWASFSVEVKVGEIERLKEILEGISMEKYVRMQRRVKQVQRHFVVNEPPKR  362

Query  1390  FDVFHMILHSIWLRRLNIRVH  1452
             +DVFHM++HS+WLRRLN+++H
Sbjct  363   YDVFHMVIHSVWLRRLNLKLH  383



>ref|XP_002524592.1| catalytic, putative [Ricinus communis]
 gb|EEF37800.1| catalytic, putative [Ricinus communis]
Length=388

 Score =   449 bits (1154),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 208/384 (54%), Positives = 280/384 (73%), Gaps = 8/384 (2%)
 Frame = +1

Query  322   KLEILESGLAQARSSILRGNQL-------HSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             KLE LE+GLA AR+ I   + L       H D  Y+P G IY N+ +FHRSY+ MEK  K
Sbjct  3     KLERLEAGLAMARALIKEASSLDQNYTSLHKDIDYVPHGDIYRNSCAFHRSYLLMEKLFK  62

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             ++VYE+G+PP+ HYGPCK+IY++EG F+  M+  ++FRT +PD A VFFLPFSV ++ + 
Sbjct  63    IFVYEEGEPPLLHYGPCKNIYSMEGLFLSLMETDTKFRTLNPDEAQVFFLPFSVVMIIEH  122

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             ++     D + ++RT +DYV+ I+ KY +WNR+LGADHFMLSCHDWGP  +     L   
Sbjct  123   LFHPIIRDKAVLERTVVDYVRIISHKYTYWNRSLGADHFMLSCHDWGPRATWYERQLYFN  182

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             +IR LCNANTSE FNPKKD S PEINL  G    L GG PP+ R +L F++G +HG +RP
Sbjct  183   SIRVLCNANTSEYFNPKKDASFPEINLITGEIADLTGGLPPSNRTILAFFSGKMHGKLRP  242

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             +L QHW+ KD+D+ ++   P+ +SY  MM+KS+YC+CPSG+EVASPR+VEA+Y  CVPVL
Sbjct  243   LLFQHWKEKDKDVLVYETFPEGLSYQEMMKKSRYCICPSGHEVASPRIVEAIYAECVPVL  302

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I + YV PFSDVLNW +F++ + V DI NLK IL  IP+ QY  ++ R  +V++HF +N 
Sbjct  303   ISQNYVFPFSDVLNWESFSIQVSVSDISNLKNILLGIPEDQYLRMRERVKQVQQHFLINN  362

Query  1378  PPKRFDVFHMILHSIWLRRLNIRV  1449
             PPKR+DVFHMI+HSIWLRRLN+++
Sbjct  363   PPKRYDVFHMIIHSIWLRRLNVKL  386



>gb|KEH35655.1| exostosin family protein [Medicago truncatula]
Length=495

 Score =   452 bits (1164),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 214/386 (55%), Positives = 278/386 (72%), Gaps = 7/386 (2%)
 Frame = +1

Query  316   YTKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHRSYVEMEKTL  477
             Y+KLE +ES LA+AR SI   +++      H D+ Y+P G IY N ++FHRSY+EMEK  
Sbjct  107   YSKLEKIESKLAKARYSIKEASKVQNLTSTHQDQDYVPQGPIYRNPNAFHRSYLEMEKVF  166

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQF-RTTDPDSAHVFFLPFSVTVLSK  654
             K++VYE+G+PP+ H G  K IY+ EG FI+ M+  ++ RT DP+ A V+FLPFSV ++ +
Sbjct  167   KIFVYEEGEPPLFHNGLSKDIYSTEGIFINEMEKGRYYRTNDPNEAFVYFLPFSVVMMVE  226

Query  655   MIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
              +YV  S+D +P+  T  DY+  I+ KYPFWN++LG DHFMLSCHDWGP+ S    +L  
Sbjct  227   YLYVGGSNDKTPIGVTVKDYIHVISHKYPFWNQSLGHDHFMLSCHDWGPDASAYEDNLFN  286

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              +IR LCNANTSE F P KD S PE+ L  G    L+GG  P+ R +L F+AG LHG +R
Sbjct  287   NSIRVLCNANTSEGFKPAKDASFPEMFLKKGEITNLVGGYSPSRRTILAFFAGHLHGYIR  346

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
              +LL  W+NKD+D++++  LP   SYH  +R SK+CLCPSGYEVASPR+VEA++  CVPV
Sbjct  347   YLLLDTWKNKDQDVQVYEELPDEDSYHTKLRSSKFCLCPSGYEVASPRIVEAIFAECVPV  406

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             LI   YVPPFSDVLNW AF+V I V+DIPN+K IL  I Q QY  +QRR  +V+RHF  N
Sbjct  407   LISDSYVPPFSDVLNWKAFSVQIDVKDIPNIKNILMGISQRQYLKMQRRVKQVQRHFVPN  466

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRVH  1452
              PPKRFDVFHM +HSIWLRRLN+R+H
Sbjct  467   EPPKRFDVFHMTIHSIWLRRLNVRIH  492



>ref|XP_008342266.1| PREDICTED: probable glycosyltransferase At3g07620 [Malus domestica]
Length=476

 Score =   451 bits (1161),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 213/387 (55%), Positives = 284/387 (73%), Gaps = 7/387 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRG--NQLHS----DEHYIPSGSIYWNASSFHRSYVEMEK  471
             K    L+ LE+GLA AR+ I     N  H+    D  YIP G IY NA +FHRSY+ MEK
Sbjct  90    KGDENLKKLEAGLAAARALIGEAIKNLNHTTPLKDADYIPKGDIYRNAYAFHRSYLLMEK  149

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVL  648
               K+YVYE+G+ P+ H GPCK+IY++EG F+  M+  ++FRT +P++AHV+FLPFSV ++
Sbjct  150   MFKIYVYEEGELPIFHNGPCKNIYSMEGLFLSFMETDTKFRTREPENAHVYFLPFSVVMI  209

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + ++     D + ++RT +DYV+ I+ +YP+WNR+LGADH MLSCHDWGP  +  +  L
Sbjct  210   VEYLFHPIIRDKAVLERTVVDYVRIISNRYPYWNRSLGADHVMLSCHDWGPRATWYVKQL  269

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                AIR LCNANTSE FNPKKD S PEINL  G   GLIGG  P++R +L F+AG +HG 
Sbjct  270   YFVAIRVLCNANTSEHFNPKKDASFPEINLETGEITGLIGGLHPSKRTILAFFAGRMHGR  329

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +RP L +HW+ KD D+ ++  LP+ +SYH M++KSKYC+CPSG+EVASPR+VEA+Y  CV
Sbjct  330   IRPFLFEHWKGKDRDLLVYEKLPEELSYHDMLKKSKYCICPSGHEVASPRIVEAIYADCV  389

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI + YV PFSDVLNW +F+V + V +IP LK+IL  IP+ QY  +Q R  +V+RHF 
Sbjct  390   PVLISQHYVLPFSDVLNWDSFSVQVSVSEIPKLKEILMGIPEEQYRRMQERVKQVQRHFV  449

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             VN PPKR+DVFHMI+HSIWLRRLN+++
Sbjct  450   VNNPPKRYDVFHMIIHSIWLRRLNVQI  476



>ref|XP_009417384.1| PREDICTED: probable glycosyltransferase At5g03795 [Musa acuminata 
subsp. malaccensis]
Length=378

 Score =   447 bits (1151),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 220/365 (60%), Positives = 272/365 (75%), Gaps = 7/365 (2%)
 Frame = +1

Query  352   QARSSILRGNQLHS------DEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPV  513
             +AR++I    + HS      D+ Y+P G  Y +A +FHRSY+EMEK  KVYVYE+G+PP+
Sbjct  2     RARAAIKEAFRNHSNVSPLFDKDYVPQGPSYRDAYAFHRSYLEMEKLFKVYVYEEGEPPL  61

Query  514   AHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSP  690
              H GPC+SIY+ EG FIH +D    FRT DPD AHVFFLPFSV  + K+IY   S D SP
Sbjct  62    FHDGPCRSIYSSEGRFIHGIDMDTWFRTRDPDLAHVFFLPFSVVKMVKLIYKPKSFDISP  121

Query  691   MKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTS  870
             + RT  DY+  IA +YP+WNR+LGADHFMLSCHDWGP  S +   L   +IR LCNANTS
Sbjct  122   ITRTIADYISVIAERYPYWNRSLGADHFMLSCHDWGPHASEAHSHLYGDSIRVLCNANTS  181

Query  871   ERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQHWENKDE  1050
             E F+P+KDVS+PEINL       ++GGP  + RPVL F+AGG HGPVRP+LLQ W+ +D 
Sbjct  182   EGFDPRKDVSLPEINLKTDVMADMMGGPSASRRPVLAFFAGGDHGPVRPLLLQAWKGRDP  241

Query  1051  DIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSD  1230
              +++H YLP+ VSY+ MMR+S++CLCPSGYEVASPR+VEA+Y+GCVPV I   YV PFSD
Sbjct  242   SVQVHEYLPRGVSYYAMMRRSRFCLCPSGYEVASPRVVEAIYLGCVPVTISHRYVLPFSD  301

Query  1231  VLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMI  1410
             VLNW AF+V +  EDIP+LK+ILT I   QY  +QRR   VRRHFEVN PP+RFDVFHMI
Sbjct  302   VLNWKAFSVQVSPEDIPDLKRILTAISPRQYIRMQRRVRMVRRHFEVNSPPRRFDVFHMI  361

Query  1411  LHSIW  1425
             LHS+W
Sbjct  362   LHSVW  366



>ref|XP_008227680.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=505

 Score =   452 bits (1163),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 215/389 (55%), Positives = 279/389 (72%), Gaps = 8/389 (2%)
 Frame = +1

Query  313   SYTKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             S ++L+ LE+ L +ARSSI    ++      H D  Y+P G IY N ++FHRSY+EMEK 
Sbjct  116   SSSQLDKLEASLGRARSSIREAAKVRNKTSTHQDPDYVPRGPIYRNPNAFHRSYLEMEKL  175

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPDSAHVFFLPFSVTVLS  651
              K+YVYE+G+ P+ H GPC+SIY+ EG FIH M+  + +RT DPD A V+FLPFSV  + 
Sbjct  176   FKIYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGNMYRTRDPDKALVYFLPFSVVRMV  235

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + +Y+ +S+D   MK   +DYV  IA+K+ FWNR+LGADHFMLSCHDW P  +  +P L 
Sbjct  236   QYMYMPDSNDRHGMKLAIIDYVNLIAQKHSFWNRSLGADHFMLSCHDWAPLTTSFVPLLF  295

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
               +IR LCNANTSE FNP KD S PEINL      GL GG  P+ R  L F+AG LHG +
Sbjct  296   HKSIRILCNANTSEGFNPSKDASFPEINLKTSEMSGL-GGQSPSTRSTLAFFAGRLHGHI  354

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             R +LL  W+ KD+D++++  LP  VSY  M++ SK+CLCPSGYEVASPR+VEA+Y  C+P
Sbjct  355   RSLLLNEWKGKDQDVQVYDKLPPGVSYEKMLKGSKFCLCPSGYEVASPRVVEAIYAECIP  414

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI  GY+PPFSDVL+W +F+V +PV++I N+K IL  I   QY  +QRR  +V+RHF V
Sbjct  415   VLISDGYIPPFSDVLDWKSFSVQVPVKNISNIKNILMSISSGQYLRMQRRVKQVQRHFLV  474

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             N PPKR+DVFHMI+HSIWLRRLNIR+  L
Sbjct  475   NGPPKRYDVFHMIVHSIWLRRLNIRIQDL  503



>ref|XP_009361503.1| PREDICTED: probable glycosyltransferase At3g07620 [Pyrus x bretschneideri]
Length=512

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 212/387 (55%), Positives = 284/387 (73%), Gaps = 7/387 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRG--NQLHS----DEHYIPSGSIYWNASSFHRSYVEMEK  471
             K    L+ LE+GLA AR+ I     N  H+    D  YIP G IY NA +FHRSY+ MEK
Sbjct  126   KGDENLKKLEAGLAAARALIGEAIKNPNHTTPLKDADYIPKGDIYRNAYAFHRSYLLMEK  185

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVL  648
               K+YVYE+G+ P+ H GPCK+IY+ EG F+  ++  ++FRT +P++AHV+FLPFSV ++
Sbjct  186   MFKIYVYEEGELPIFHNGPCKNIYSTEGLFLSFIETDTKFRTREPENAHVYFLPFSVVMI  245

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + ++     D + ++RT +DYV+ I+ +YP+WNR+LGADH MLSCHDWGP  +  +  L
Sbjct  246   VEYLFHPIIRDKAVLERTVVDYVRIISNRYPYWNRSLGADHVMLSCHDWGPRATWYVKQL  305

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                AIR LCNANTSE FNPKKD S PEINL  G   GLIGG  P++R +L F+AG +HG 
Sbjct  306   YFVAIRVLCNANTSEHFNPKKDASFPEINLETGEITGLIGGLHPSKRTILAFFAGRMHGR  365

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +RP L +HW+ KD D+ ++  LP+ +SYH M++KSKYC+CPSG+EVASPR+VEA+Y  CV
Sbjct  366   IRPFLFEHWKGKDRDLLVYEKLPEELSYHDMLKKSKYCICPSGHEVASPRIVEAIYAECV  425

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI + YV PFSDVLNW +F+V + V +IP LK+IL +IP+ QY  +Q R  +V+RHF 
Sbjct  426   PVLISQHYVLPFSDVLNWDSFSVQVSVSEIPKLKEILMEIPEEQYRRMQERVKQVQRHFV  485

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             VN PPKRFD+FHMI+HSIWLRRLN+++
Sbjct  486   VNNPPKRFDIFHMIIHSIWLRRLNVQI  512



>ref|XP_010107365.1| putative glycosyltransferase [Morus notabilis]
 gb|EXC15616.1| putative glycosyltransferase [Morus notabilis]
Length=468

 Score =   449 bits (1155),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 214/385 (56%), Positives = 272/385 (71%), Gaps = 9/385 (2%)
 Frame = +1

Query  322   KLEILESGLAQARSSILRG----NQLH----SDEHYIPSGSIYWNASSFHRSYVEMEKTL  477
             KL  LE+ LA AR+ I       NQ       D  Y+P G +Y NA +FH SY+ ME+  
Sbjct  82    KLAKLEADLATARALIREATKKVNQTKKSFLEDADYVPQGEVYKNAYAFHWSYLLMERVF  141

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-QFRTTDPDSAHVFFLPFSVTVLSK  654
             +++VYE+G+PP+ H GPCKSIY+ EG F+  M+    FRT DPD AHV+FLPFSV ++ K
Sbjct  142   RIFVYEEGEPPIFHNGPCKSIYSTEGMFLSFMETDIHFRTWDPDEAHVYFLPFSVVMMVK  201

Query  655   MIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
              ++     D + ++RT +DYVQ+I+ KYP WNR+LGADHFMLSCHDWGP  +  +P L  
Sbjct  202   YLFDPIIRDKAVLQRTVVDYVQTISHKYPHWNRSLGADHFMLSCHDWGPRATWYVPQLYY  261

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              +IR LCNANTSE FNPKKD S PEINL  G    L GG P ++R  L F+AG  HG +R
Sbjct  262   NSIRVLCNANTSEHFNPKKDASFPEINLKTGQISSLTGGSPLSDRKTLAFFAGQRHGRIR  321

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
              +L  HW+ KD D+K++  LPK +SY  M+R S++CLCPSG+EVASPR+VEA+Y  CVPV
Sbjct  322   QVLFHHWKEKDRDVKVYETLPKEISYEKMLRTSRFCLCPSGHEVASPRVVEAIYAECVPV  381

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             LI + YVPPFSDVLNW +FAV + VE+IP LK+IL  I   QYE L+R    V+RHF +N
Sbjct  382   LISQQYVPPFSDVLNWESFAVSVSVEEIPKLKEILLGISLVQYENLRRNVKLVQRHFVLN  441

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRV  1449
              PPK +DVFHMILHSIWLRRLN+R+
Sbjct  442   DPPKGYDVFHMILHSIWLRRLNVRI  466



>ref|XP_009379541.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=536

 Score =   450 bits (1158),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 210/389 (54%), Positives = 281/389 (72%), Gaps = 8/389 (2%)
 Frame = +1

Query  313   SYTKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             S ++L+ +E+ L++ARS+I    ++      H D  Y+P G IY N ++FHRSY+EME  
Sbjct  147   SGSQLDKVEASLSRARSAIREAAKVRNKTSTHQDPDYVPRGPIYHNPNAFHRSYLEMENV  206

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLS  651
              K+YVYE+G+ P+ H GPC+SIY+ EG FIH M+  + +RT DP  A V+FLPFSV  + 
Sbjct  207   FKIYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGKLYRTKDPHKALVYFLPFSVVNMV  266

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + IY+  + D S MK   +DY+  I+ K+PFWNR+ GADHFMLSCHDWGP  +  +PDL 
Sbjct  267   QYIYMPETFDLSGMKLAVVDYINLISHKHPFWNRSHGADHFMLSCHDWGPLTTSFVPDLF  326

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
               +IR +CNANTSE FNP KD S+PEINL      G IGG PP++R  L FYAGG HG +
Sbjct  327   HNSIRVMCNANTSEGFNPSKDASLPEINLKTSEMSG-IGGQPPSKRSTLAFYAGGQHGHI  385

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             R +LL  W+ K++D+ ++  LP+ +SY  M +  K+CLCPSGYEVASPR+VEA+Y  CVP
Sbjct  386   RYLLLNEWKGKEQDVLVYDKLPQGMSYENMFKSGKFCLCPSGYEVASPRVVEAIYAECVP  445

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI  GYVPPFSDVLNW++F+V +PV++I ++K ILT I   QY  +QRR  +V+RHF V
Sbjct  446   VLISDGYVPPFSDVLNWNSFSVQVPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLV  505

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             N PPKR+DVFHM+++SIWLRRLNIR+  +
Sbjct  506   NGPPKRYDVFHMLVYSIWLRRLNIRIQDI  534



>gb|AGZ15405.1| limonene cyclase-like protein [Phaseolus vulgaris]
Length=491

 Score =   448 bits (1152),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/382 (58%), Positives = 273/382 (71%), Gaps = 9/382 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSI--LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVY  492
             T L+ +E GLAQAR++I   R      D  Y+P G +YWNA +FHRSY+EMEK  KV+ Y
Sbjct  109   TILDNIEIGLAQARAAIREARNGTGTPDSDYVPKGPMYWNAKAFHRSYLEMEKQFKVFSY  168

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
              +G+PP  H  PCKS Y++EG+F+HA++ +  FRT DP+ AHVFFLP          Y  
Sbjct  169   GEGEPPNFHNAPCKSKYSMEGNFMHAIEMNNHFRTKDPEEAHVFFLP-----KGGYGYER  223

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
              S D SP+K+TA DYV  IA +Y +WNR+LGAD F L+CHD     S S+P   K + R 
Sbjct  224   VSQDLSPVKKTATDYVNVIAARYLYWNRSLGADPFTLACHDMCRGKSFSLPYPHKNSFRV  283

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILLQ  1029
             LCNANTSE F P KDVS PEINL   +    IGG    +R +L F+AGG+HGP+ P+L +
Sbjct  284   LCNANTSEGFKPAKDVSFPEINLKISSIR-FIGGQSAFKRSILTFFAGGVHGPIAPVLFK  342

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HWENKDEDI+I  YLPK +SY+ MMRKSK+CLCPSGYE ASPR+VEA+Y GCVPV I   
Sbjct  343   HWENKDEDIQILKYLPKGISYYEMMRKSKFCLCPSGYEGASPRVVEAIYTGCVPVFIFEH  402

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
              VPPFSDVLNW +F+V I V+DIPNLK+IL  IP  QY  +QRR  ++ RHFEV+ PPKR
Sbjct  403   SVPPFSDVLNWKSFSVEISVKDIPNLKEILMSIPPKQYIRMQRRVEQIGRHFEVHSPPKR  462

Query  1390  FDVFHMILHSIWLRRLNIRVHH  1455
             FDVFHMILHS+WLRRLN+ VHH
Sbjct  463   FDVFHMILHSVWLRRLNLEVHH  484



>ref|XP_010683539.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=496

 Score =   447 bits (1149),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 217/391 (55%), Positives = 290/391 (74%), Gaps = 10/391 (3%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQLHSDEH--------YIPSGSIYWNASSFHRSYVEM  465
             K   K+EI+E  L +ARS I    Q  +  +        Y+P G+IY NA +FHRSY+ M
Sbjct  104   KKDQKVEIIEVTLGRARSLIKEAIQSRNTSNLFVEDQVDYVPHGNIYKNAFAFHRSYLLM  163

Query  466   EKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPDSAHVFFLPFSVT  642
             EK  K+Y+YE+G+PP+ HYGPCK+IY++EG FI+ ++  +QFR  DPD A V+FLPFSV 
Sbjct  164   EKMFKIYIYEEGEPPLFHYGPCKNIYSMEGIFINLLEKNNQFRAKDPDEAQVYFLPFSVV  223

Query  643   VLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIP  822
             ++ + ++     D + ++RT LDYV  I+ KYP+WNR+LGADHFMLSCHDWGP  +   P
Sbjct  224   MILQHLFDPIIRDKAVLERTILDYVSVISHKYPYWNRSLGADHFMLSCHDWGPRATWYHP  283

Query  823   DLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLI-GGPPPTERPVLVFYAGGL  999
              L  ++IRALCNANTSE FNP+KD SIPEINL  G    L+ G  PP+ER +L F+AG +
Sbjct  284   LLYFHSIRALCNANTSENFNPRKDASIPEINLKTGEFAALLHGSLPPSERTILAFFAGRM  343

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HG +RP LL +W++KD+D++++  LPK +SY  MM++SKYCLCPSG+EVASPR+VEA+Y 
Sbjct  344   HGHIRPALLTYWKDKDKDLQVYEELPKEISYGEMMKRSKYCLCPSGFEVASPRIVEAIYA  403

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
              CVPVLI + Y+ PFSDVL+WS+F+V + V +IPNLKKIL +IP  +Y  +Q    +V+R
Sbjct  404   ECVPVLISQNYILPFSDVLDWSSFSVQVSVSEIPNLKKILMEIPYDKYLQMQEGVKQVQR  463

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             HF +N PPKRFDVFHMI+HSIWLRRLN+R+H
Sbjct  464   HFVMNDPPKRFDVFHMIIHSIWLRRLNVRIH  494



>ref|XP_008227724.1| PREDICTED: probable glycosyltransferase At3g07620 [Prunus mume]
Length=520

 Score =   447 bits (1149),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 213/389 (55%), Positives = 279/389 (72%), Gaps = 8/389 (2%)
 Frame = +1

Query  313   SYTKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             S + LE LE+ L +ARSSI    ++      H D  Y+P G IY N ++FHRSY+EMEK 
Sbjct  130   SSSHLEKLEASLGRARSSIREAAKVRNKTSTHQDPDYVPRGPIYRNPNAFHRSYLEMEKL  189

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLS  651
              K+YVYE+GQ P+ H GPC  +Y  EG FIH M+  + +RTTDP+ A V+FLPFSV  + 
Sbjct  190   FKIYVYEEGQVPIFHDGPCFHMYLTEGRFIHEMENGKLYRTTDPNQALVYFLPFSVVRMV  249

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + +Y+ +++D + +K   +DY+  IA K+PFWNR+LGADHFMLSCHDWGP  +  +P L 
Sbjct  250   QFLYLPDTYDRNGLKLAVIDYINLIAHKHPFWNRSLGADHFMLSCHDWGPFTTAFVPHLF  309

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
               +IR LCNANTSE FNP KD S+PEI L       L GG PP++R  L F+AGGLHG +
Sbjct  310   HKSIRVLCNANTSEGFNPSKDASLPEIKLLTPEIPRL-GGQPPSKRSTLAFFAGGLHGHI  368

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             R +LL  W+ KD+D+ ++  +P  VSY  MM+ SK+CLCPSGYEVASPR+VEA+Y  CVP
Sbjct  369   RYLLLNEWKGKDQDVLVYEKVPHGVSYEEMMKSSKFCLCPSGYEVASPRVVEAIYAECVP  428

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI  GY+PPFSDVL+W +F+V +PV++I ++K IL  I   QY  +QRR  +V+RHF +
Sbjct  429   VLISDGYIPPFSDVLDWKSFSVQVPVKNISDMKNILMSISNRQYLRMQRRLKQVQRHFLM  488

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             N PPKR+DVFHMI+HSIWLRRLNIR+  L
Sbjct  489   NGPPKRYDVFHMIVHSIWLRRLNIRIQDL  517



>gb|KHG09514.1| hypothetical protein F383_01906 [Gossypium arboreum]
Length=484

 Score =   445 bits (1145),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 217/398 (55%), Positives = 277/398 (70%), Gaps = 11/398 (3%)
 Frame = +1

Query  286   KTLAVYGAKSYTKLEILESGLAQARSSILRG-------NQLHSDEHYIPSGSIYWNASSF  444
              T  +   K  +K ++LE GLA+AR+SI               +++ +P G +Y N S+F
Sbjct  81    NTTLIKETKKLSKEQVLEQGLARARASIRSAAIARIVRTAFFMNDNDVPVGDVYRNPSTF  140

Query  445   HRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS--QFRTTDPDSAHV  618
             ++SYVEME+  KVYVY +G+ P+ H GPCK++Y IEG FIH M+    +FRT DP  AHV
Sbjct  141   YQSYVEMERRFKVYVYSEGELPIVHDGPCKNLYTIEGRFIHEMEHGAKRFRTNDPQRAHV  200

Query  619   FFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWG  798
             +F+PFSV  + K IY   S D +P+K    DYV+ I+ KYPFWNRT GADHFML+CHDWG
Sbjct  201   YFMPFSVAWMVKYIYTPLSFDITPLKHFVSDYVKVISIKYPFWNRTHGADHFMLACHDWG  260

Query  799   PEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDG-TTDGLIGGPPP-TERP  972
             P  S     L   +IR LCNAN SE FNP+KDVS+PEI+L  G  +  LI  PPP T RP
Sbjct  261   PHASQGNSLLYNNSIRVLCNANISEGFNPQKDVSLPEISLIGGYLSHKLIHPPPPNTSRP  320

Query  973   VLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVAS  1152
                F+AGGLHGP+RP LLQHW+ +D D++++ YLPKN  Y+  M +SK+CLCPSGYEVAS
Sbjct  321   YFAFFAGGLHGPIRPYLLQHWKGRDNDMQVYEYLPKNKDYYSYMLESKFCLCPSGYEVAS  380

Query  1153  PRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEIL  1332
             PR+VEA+Y GCVPV++   YV PFSDVL W AF+V +    IP LK+IL+ IP+ +Y  L
Sbjct  381   PRIVEAIYSGCVPVILSDNYVLPFSDVLQWEAFSVQVETTKIPRLKEILSAIPEEKYRKL  440

Query  1333  QRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIR  1446
             Q   + VRRHF +N PPKRFDVFHMILHSIW+RR+N R
Sbjct  441   QEGVIVVRRHFMLNRPPKRFDVFHMILHSIWVRRINAR  478



>ref|XP_004502077.1| PREDICTED: probable glycosyltransferase At3g07620-like [Cicer 
arietinum]
Length=465

 Score =   444 bits (1143),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 216/383 (56%), Positives = 277/383 (72%), Gaps = 8/383 (2%)
 Frame = +1

Query  325   LEILESGLAQARSSI----LRGNQ---LHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             LE +E+ LA+AR+SI    LR N    L     YIP G IY NA +FHRSY  MEK  K+
Sbjct  82    LEKVEASLAKARASIKQALLRINDTLPLEDSHDYIPQGDIYRNAFAFHRSYYLMEKLFKI  141

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             +VYE+G+PP+ HYGPCK+IY++EG FI+ ++  +QFRT +PD AHV+FLPFSV ++ + +
Sbjct  142   FVYEEGEPPLFHYGPCKNIYSMEGIFINLLESNTQFRTQNPDEAHVYFLPFSVVMILEHL  201

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             +     D + + RT  DYV  I+ KY +WNR+ GADHFMLSCHDWGP  +  + +L   A
Sbjct  202   FHPVIRDKAVLGRTIGDYVHIISHKYTYWNRSYGADHFMLSCHDWGPRATWYVKELYFIA  261

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNAN SE FNPKKD S PEINL  G T GLIGG P   R +L F+AG +HG +RP+
Sbjct  262   IRVLCNANISEHFNPKKDASFPEINLVTGETTGLIGGYPQWNRTILAFFAGQMHGRIRPM  321

Query  1021  LLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLI  1200
             L QHW+NKD+D+ ++  LP+NVSYH  M+ SKYC+CPSGYEVASPR+VEA+Y  CVPV+I
Sbjct  322   LFQHWKNKDKDMLVYEKLPENVSYHETMKMSKYCICPSGYEVASPRIVEAIYAECVPVII  381

Query  1201  KRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWP  1380
              + YV PFSDVL+W  F+V I V +IP LK+IL  I + +Y  L     +V+RHF +N P
Sbjct  382   SQNYVLPFSDVLDWDCFSVQIQVSEIPKLKEILLGISEEKYVRLYEGVKKVQRHFVMNNP  441

Query  1381  PKRFDVFHMILHSIWLRRLNIRV  1449
             PKR+DVFHMI+HSIWLRRLN+ V
Sbjct  442   PKRYDVFHMIVHSIWLRRLNVIV  464



>gb|KDP22997.1| hypothetical protein JCGZ_01719 [Jatropha curcas]
Length=742

 Score =   453 bits (1165),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 215/386 (56%), Positives = 274/386 (71%), Gaps = 7/386 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRG------NQLHSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y+KLE +E+ LA+ R SI           LH DE Y+P G IY NA++FHRSY+EMEK
Sbjct  335   KRYSKLEKMEANLARVRVSIREAARIRNLTSLHQDEDYVPQGPIYRNANAFHRSYLEMEK  394

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVL  648
               K+YVYE+G+ P+ H GPCKSIY+ EG FIH ++  + +RT DP+ A V+FLPFSV ++
Sbjct  395   LFKIYVYEEGETPLFHDGPCKSIYSSEGTFIHELEKGKSYRTRDPEEALVYFLPFSVVMM  454

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +YV NSH+   + R  +DY+  I+ KYPFWNR+LGADHFMLSCHDWGP  S  +  L
Sbjct  455   VEYLYVPNSHEIEAIGRVVVDYINVISNKYPFWNRSLGADHFMLSCHDWGPRTSSYVSQL  514

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
              K +IR LCNANTSE FNP KD S PEI+L  G   GLIGG  P+ R +L F+AG LHG 
Sbjct  515   FKNSIRVLCNANTSEGFNPSKDASFPEIHLKTGEITGLIGGSSPSRRSILAFFAGRLHGD  574

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R +LL+ W+NKD+D+++   LPKNVSY  M++KS++CLCPSGYEVASPR+VEA+Y  CV
Sbjct  575   IRRLLLEKWKNKDKDVQVFEQLPKNVSYESMLKKSRFCLCPSGYEVASPRVVEAIYSECV  634

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPFSDVLNW AF+V + V+DIP +K+IL  I Q QY  +QRR  +V+RHF 
Sbjct  635   PVLISDSYVPPFSDVLNWKAFSVQVEVKDIPKIKEILMGISQRQYLRMQRRVKQVQRHFV  694

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIR  1446
             VN PPKR +       +  L R N R
Sbjct  695   VNGPPKRTNQLTADRSTTELLRNNGR  720


 Score =   218 bits (554),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 155/239 (65%), Gaps = 5/239 (2%)
 Frame = +1

Query  322   KLEILESGLAQARSSI----LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYV  489
             ++E LE+ L+ AR+ I    L  N   S +     G+IY N  +FHRSY+ MEK  K++V
Sbjct  11    RVEKLEATLSIARALIREAALDHNCKSSRDGDGDDGNIYRNFCAFHRSYMLMEKLFKIFV  70

Query  490   YEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYV  666
             YE+G+PP+ HYGPCK+IY+ EG F+  M+  ++FRT +P  A  +FLPFSV ++ + ++ 
Sbjct  71    YEEGEPPLFHYGPCKNIYSTEGLFLSLMETNTKFRTFNPHEAVAYFLPFSVVMIIEHLFH  130

Query  667   ANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIR  846
                 D + ++RT +DYV+ I+  +PFWN + GADHFMLSCHDWGP  +     L   +IR
Sbjct  131   PVIRDKAVLERTIVDYVRIISHNHPFWNTSHGADHFMLSCHDWGPRATWYERQLYFNSIR  190

Query  847   ALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPIL  1023
              LCNANTSE FNPKKD S+P INL  G T GL+GG  P+ R +L F+A     P   +L
Sbjct  191   VLCNANTSEYFNPKKDASLPAINLITGETTGLVGGLSPSNRTILAFFAENYVLPFSDVL  249



>ref|XP_007137813.1| hypothetical protein PHAVU_009G157700g [Phaseolus vulgaris]
 gb|ESW09807.1| hypothetical protein PHAVU_009G157700g [Phaseolus vulgaris]
Length=501

 Score =   444 bits (1143),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 210/388 (54%), Positives = 282/388 (73%), Gaps = 8/388 (2%)
 Frame = +1

Query  316   YTKLEILESGLAQARSSILRGNQLHS------DEHYIPSGSIYWNASSFHRSYVEMEKTL  477
             ++KL  +E  LA+AR SI   +++ +      D  Y+P G IY NA++FHRSY+EMEK  
Sbjct  113   HSKLRRIEKNLAKARYSIREASKIRNLTSTLQDPDYVPQGPIYRNANAFHRSYLEMEKVF  172

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSK  654
             KV+VYE+G+PP+ H G  K IYA EG FI+ M+  + +RT DPD A VF+LPFSV +L +
Sbjct  173   KVFVYEEGEPPLFHNGLSKDIYATEGRFINEMEKGRHYRTYDPDEAFVFYLPFSVVMLVE  232

Query  655   MIYVANS-HDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
              +Y   S ++  P+     DY+Q+I+ K+PFWNR+LG DHFMLSCHDWGP +S  +  L 
Sbjct  233   YVYDRGSNYNLDPLGLVVKDYIQTISYKHPFWNRSLGHDHFMLSCHDWGPIVSSYVDLLY  292

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
               AIR LCNANTSE F P KDVS PEI L  G   GL+GG PP++R +L F+AG LHG +
Sbjct  293   NNAIRVLCNANTSEGFKPAKDVSFPEIKLMRGEVTGLVGGYPPSQRTILAFFAGHLHGYI  352

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             R +LL  W+NKD+D++++  +P+ +SY+  +R SK+CLCPSGYEVASPR+VEA++  CVP
Sbjct  353   RYLLLHTWKNKDQDVQVYEEIPEGISYYTKLRSSKFCLCPSGYEVASPRIVEAIFAECVP  412

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI   YVPPFSDVLNW++F+V + V++IPN+KKIL  I + QY  +QRR  +V+RHF  
Sbjct  413   VLISDSYVPPFSDVLNWNSFSVQVAVKEIPNIKKILMGISERQYLRMQRRVKQVQRHFMP  472

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVHH  1455
             N PP+R+D+FHM +HSIWLRRLNI + H
Sbjct  473   NEPPERYDMFHMTVHSIWLRRLNIHIQH  500



>ref|XP_011100587.1| PREDICTED: probable glycosyltransferase At3g07620 [Sesamum indicum]
Length=548

 Score =   445 bits (1145),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/379 (56%), Positives = 271/379 (72%), Gaps = 9/379 (2%)
 Frame = +1

Query  316   YTKLEILESGLAQARSSI---LRGNQ-----LHSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             Y + E +E+ LA+AR SI    R N        S   Y+P G IY+NA++F+RSY EMEK
Sbjct  158   YGRSEKVEAILAKARYSIREAARNNNRSFISSSSGSDYVPQGPIYFNANAFYRSYTEMEK  217

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVL  648
               K+YVYE+G+ P+ H GPC+SIY  EG FIH M+  + +RT D + AHV+F+PFSV  +
Sbjct  218   VFKIYVYEEGEAPIFHGGPCRSIYTTEGRFIHEMERGELYRTRDAEEAHVYFMPFSVVAM  277

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +Y   + D   M  T  DYV +IA  +PFWNR+LGADHFMLSCHDWGP  S  +P L
Sbjct  278   VQYLYEPGAVDMDAMGNTLADYVHTIAHNHPFWNRSLGADHFMLSCHDWGPYTSSYVPLL  337

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KD ++PEINL  G   GL+GGPPP+ER +L F+AGGLHG 
Sbjct  338   FNNSIRVLCNANTSEGFNPIKDATLPEINLKFGEITGLLGGPPPSERSILAFFAGGLHGD  397

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R ILL HW+ KD DI+++  LP NVSY  M++ SK+CLCPSGYEVASPR+VEA+Y  CV
Sbjct  398   IRHILLDHWKEKDPDIRVYEKLPPNVSYEAMLKNSKFCLCPSGYEVASPRIVEAIYSECV  457

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPFSDVLNW  F++++ VEDIPN+K IL  I + +Y  +Q R  +V+RHF 
Sbjct  458   PVLISDHYVPPFSDVLNWKKFSIVVGVEDIPNIKTILMGISRAKYLKMQMRVKQVQRHFV  517

Query  1369  VNWPPKRFDVFHMILHSIW  1425
             +N  PKRFD+FHMI+HS+W
Sbjct  518   LNGTPKRFDLFHMIVHSVW  536



>emb|CDP15735.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   438 bits (1127),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 208/397 (52%), Positives = 288/397 (73%), Gaps = 9/397 (2%)
 Frame = +1

Query  286   KTLAVYGAKSYTKLEILESGLAQARS----SILRGNQ---LHSDEHYIPSGSIYWNASSF  444
             ++L   G     K+E +E+ LA+AR+    +I+ G+Q   LH  + YIP G IY + S F
Sbjct  15    ESLKRRGKPRDEKMEKIEASLARARALIREAIVNGSQQLPLHEAD-YIPQGEIYRSPSVF  73

Query  445   HRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPDSAHVF  621
             HRSY  ME   +++VYEDG+PP+ HYGPC+ IY++EG F+  ++  ++FRT +PD AHV+
Sbjct  74    HRSYQLMESLFRIFVYEDGEPPLFHYGPCRDIYSLEGIFLGLIEKNTRFRTYNPDEAHVY  133

Query  622   FLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGP  801
             FLPFSV  + + ++   S D + ++R   DYV+ ++ KYP+WNR+LGADH MLSCHDWGP
Sbjct  134   FLPFSVVKILEHLFDPISRDKAVLERVIGDYVRIVSTKYPYWNRSLGADHLMLSCHDWGP  193

Query  802   EISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLV  981
               +  +  L   +IRALCNANTSE FNP+KDVS PEINL  G    + GG  P+ R +L 
Sbjct  194   RATWYVHQLYFTSIRALCNANTSEFFNPRKDVSFPEINLQTGDIAIVTGGLSPSNRTILA  253

Query  982   FYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRM  1161
             F+AGG HG +RP L QHW+NKD DI+++  LP N+SYH MM+KSKYCLCPSG+EVASPR+
Sbjct  254   FFAGGYHGRIRPALFQHWKNKDSDIQVYEKLPGNLSYHEMMKKSKYCLCPSGHEVASPRI  313

Query  1162  VEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRR  1341
             VEA+Y  CVPVLI + Y+ PFSDVL+W++F++ + V ++PNLKKIL  I + ++  L   
Sbjct  314   VEAIYAECVPVLISQDYILPFSDVLDWNSFSIQVSVSELPNLKKILMGISEGKHRKLHEA  373

Query  1342  GVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
               +V+RHF +N PPK++DVFHMI+HSIWLRRLN++++
Sbjct  374   VKQVQRHFMINDPPKKYDVFHMIIHSIWLRRLNVKIY  410



>gb|AAU04753.1| EXO [Cucumis melo]
Length=343

 Score =   436 bits (1120),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 202/336 (60%), Positives = 253/336 (75%), Gaps = 1/336 (0%)
 Frame = +1

Query  448   RSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQFRTT-DPDSAHVFF  624
             RSY+EME+ LK+YVY++G+PP+ H GPCKSIY+ EG FIH M+     TT DPD A ++F
Sbjct  7     RSYLEMERLLKIYVYKEGEPPMFHGGPCKSIYSTEGRFIHEMEKGNLYTTNDPDQALLYF  66

Query  625   LPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPE  804
             LPFSV  L + +YV NSH+ + + R   DY+  I++K+PFW+R+LGADHFMLSCHDWGP 
Sbjct  67    LPFSVVNLVQYLYVPNSHEVNAIGRAITDYINVISKKHPFWDRSLGADHFMLSCHDWGPR  126

Query  805   ISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVF  984
              +  +P L   +IR LCNAN SE F P KD S PEI+L  G  DGLIGG  P+ R VL F
Sbjct  127   TTSYVPLLFNNSIRVLCNANVSEGFLPSKDASFPEIHLRTGEIDGLIGGLSPSRRSVLAF  186

Query  985   YAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMV  1164
             +AG LHG +R +LLQ W+ KDED+ ++  LP  +SY+ M++KS++CLCPSGYEVASPR+V
Sbjct  187   FAGRLHGHIRYLLLQEWKEKDEDVLVYEELPSGISYNSMLKKSRFCLCPSGYEVASPRVV  246

Query  1165  EALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRG  1344
             EA+Y  CVPVLI   YVPPFSDVLNW +F+V I V+DIPN+KKIL  I QTQY  +QRR 
Sbjct  247   EAIYAECVPVLISESYVPPFSDVLNWKSFSVQIQVKDIPNIKKILKGISQTQYLRMQRRV  306

Query  1345  VEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
              +V+RHF +N  PKRFD FHMILHSIWLRRLNI + 
Sbjct  307   KQVQRHFALNGTPKRFDAFHMILHSIWLRRLNIHIQ  342



>gb|KHN09672.1| Putative glycosyltransferase, partial [Glycine soja]
Length=399

 Score =   437 bits (1125),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 212/387 (55%), Positives = 280/387 (72%), Gaps = 9/387 (2%)
 Frame = +1

Query  316   YTKLEILESGLAQARSSILRGNQLHS------DEHYIPSGSIYWNASSFHRSYVEMEKTL  477
             YTKL  +E+ LA+AR SI   +++ +      D  Y+P GSIY NA++FHRSY+EMEK  
Sbjct  12    YTKLGSIEARLAKARYSIREASKIPNFTPTLQDPDYVPQGSIYRNANAFHRSYLEMEKVF  71

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQF-RTTDPDSAHVFFLPFSVTVLSK  654
             K++VYE+G+PP+ H G  K IYA EG FIH M+  ++ RT DPD A V++LPFSV +L +
Sbjct  72    KIFVYEEGEPPLFHNGLSKDIYATEGRFIHEMEKGRYYRTYDPDEAFVYYLPFSVVMLVE  131

Query  655   MIYVANS-HDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
              +Y   S ++  P+     DY+Q IA K+PFWNR+LG DH MLSCHDWGP +S  +  L 
Sbjct  132   YVYDRGSNYNLDPLGLVVKDYIQIIAHKHPFWNRSLGHDHVMLSCHDWGPLVSSYVDHLY  191

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
               AIR LCNANTSE F P KDVS PEI L  G   GL GG PP++R +L F+AG LHG +
Sbjct  192   NNAIRVLCNANTSEGFKPAKDVSFPEIKLIKGEVKGL-GGYPPSQRTILAFFAGHLHGYI  250

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             R +LL  W+NKD+D++I+  LP+ +SY+  +R SK+CLCPSGYEVASPR+VEA++  CVP
Sbjct  251   RYLLLSTWKNKDQDMQIYEELPEGISYYTKLRSSKFCLCPSGYEVASPRVVEAIFAECVP  310

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             VLI   YVPPFSDVLNW++F+V + V+DIPN+K+IL +I + QY  + +R  +V+RHF  
Sbjct  311   VLISDSYVPPFSDVLNWNSFSVQVNVKDIPNIKRILMEISEKQYLRMHKRVKQVQRHFVP  370

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             N PPKR+D+FHM +HSIWLRRLNI + 
Sbjct  371   NEPPKRYDMFHMTVHSIWLRRLNINIQ  397



>ref|XP_006483712.1| PREDICTED: probable glycosyltransferase At5g25310-like [Citrus 
sinensis]
 gb|KDO61790.1| hypothetical protein CISIN_1g011702mg [Citrus sinensis]
Length=479

 Score =   440 bits (1132),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 207/393 (53%), Positives = 278/393 (71%), Gaps = 11/393 (3%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRGNQ-------LHSDEHYIPSGSIYWNASSFHRSYVE  462
              A+  +K E L+ GLA+AR+SI +          + +   ++PS +IY N  +F++SYVE
Sbjct  86    SARVLSKYEQLKQGLARARASIRKAASTRNVTSIIKNGVDFVPSAAIYRNPGAFYQSYVE  145

Query  463   MEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS--QFRTTDPDSAHVFFLPFS  636
             MEK  KVYVY +G+ P+ HYGPCK IY IEG F+  ++    +FRT+DP  AHV++LPFS
Sbjct  146   MEKRFKVYVYREGELPITHYGPCKDIYTIEGRFMSEIEHGAKRFRTSDPHRAHVYYLPFS  205

Query  637   VTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGS  816
             V  + K +Y   ++D +P+K+   DYV+ ++ KYPFWNRT GADHFML+CHDWGP +S  
Sbjct  206   VAWMVKYLYKPLTYDLTPLKQFVADYVKVVSSKYPFWNRTCGADHFMLACHDWGPHVSKG  265

Query  817   IPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPP--TERPVLVFYA  990
                L   +IR LCNANTSE FNP+KDV++PEI+L  G     +  PPP    RP L F+A
Sbjct  266   NSHLYNNSIRVLCNANTSEGFNPQKDVTLPEIHLYGGYVSPKLLSPPPFNAPRPYLAFFA  325

Query  991   GGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             GGLHG +R ILLQHW+  D+D+ +  YLPK+  Y+  M KSK+CLCPSGYEVASPR+VE+
Sbjct  326   GGLHGTIRSILLQHWKGHDKDLIVFEYLPKDQDYYSFMLKSKFCLCPSGYEVASPRIVES  385

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
             +Y  CVPV++ + YV PFSDVL W AF++ + V +IP LK++L  +P+ +Y+ L+     
Sbjct  386   IYAQCVPVILSQNYVLPFSDVLRWEAFSIQVDVSEIPRLKEVLMAVPEEKYKRLKENLKA  445

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             VRRHFE+N P KRFDVFHMILHSIWLRRLN+R+
Sbjct  446   VRRHFELNHPAKRFDVFHMILHSIWLRRLNMRL  478



>ref|XP_010250232.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X2 
[Nelumbo nucifera]
Length=473

 Score =   440 bits (1131),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 209/352 (59%), Positives = 255/352 (72%), Gaps = 4/352 (1%)
 Frame = +1

Query  406   IPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ  585
             IP G IY N S F++SYVEMEK  KVYVY+DG PP+ H GPCK IY IEG FI  M+F  
Sbjct  114   IPKGDIYRNPSEFYQSYVEMEKRFKVYVYQDGDPPMVHEGPCKDIYTIEGRFIEEMEFGM  173

Query  586   --FRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTL  759
               FRT D   AHV+FLPFSVT +   +Y   S+D SP++R    YV+SI+ KYPFWNRT 
Sbjct  174   NGFRTRDAQRAHVYFLPFSVTRMVAYLYQPLSYDISPLQRFVSGYVRSISSKYPFWNRTQ  233

Query  760   GADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDG  939
             GADHFMLSCHDWGP  +   P L   +IR LCNANTSE F P+KDVS+PEINL DG    
Sbjct  234   GADHFMLSCHDWGPHATKGNPFLYNTSIRVLCNANTSEGFVPRKDVSLPEINLYDGNISP  293

Query  940   LIGGPPPTE--RPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKS  1113
              +  PP  +  RP L F++GGLHGP+RPILLQHW+ +D DI+++ YLPK + Y+  M +S
Sbjct  294   KLLSPPSDDAPRPYLAFFSGGLHGPIRPILLQHWKGQDTDIRVYEYLPKELDYYSFMLQS  353

Query  1114  KYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKK  1293
             K+CLCPSGYEVASPR+VEA+Y  CVPV++   YV PFSDVL W AF+V + V DIP LKK
Sbjct  354   KFCLCPSGYEVASPRIVEAIYAECVPVILSNNYVLPFSDVLRWEAFSVSVRVSDIPRLKK  413

Query  1294  ILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             +L  + + +Y  L+     VRRHF +N P KRFDVFHMILHSIWLRRL+I++
Sbjct  414   VLRGVSEDEYRKLKAGVRAVRRHFVLNQPAKRFDVFHMILHSIWLRRLDIKI  465



>ref|XP_010250231.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Nelumbo nucifera]
Length=482

 Score =   440 bits (1131),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 221/389 (57%), Positives = 274/389 (70%), Gaps = 8/389 (2%)
 Frame = +1

Query  307   AKSYTKLEILESGLAQARSSILRG----NQLHSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             AK+  K   LE GLA+AR++I +     N   + +  IP G IY N S F++SYVEMEK 
Sbjct  86    AKTPNKAAQLEEGLARARAAIRKAASTRNVSRAIDADIPKGDIYRNPSEFYQSYVEMEKR  145

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ--FRTTDPDSAHVFFLPFSVTVL  648
              KVYVY+DG PP+ H GPCK IY IEG FI  M+F    FRT D   AHV+FLPFSVT +
Sbjct  146   FKVYVYQDGDPPMVHEGPCKDIYTIEGRFIEEMEFGMNGFRTRDAQRAHVYFLPFSVTRM  205

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
                +Y   S+D SP++R    YV+SI+ KYPFWNRT GADHFMLSCHDWGP  +   P L
Sbjct  206   VAYLYQPLSYDISPLQRFVSGYVRSISSKYPFWNRTQGADHFMLSCHDWGPHATKGNPFL  265

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTE--RPVLVFYAGGLH  1002
                +IR LCNANTSE F P+KDVS+PEINL DG     +  PP  +  RP L F++GGLH
Sbjct  266   YNTSIRVLCNANTSEGFVPRKDVSLPEINLYDGNISPKLLSPPSDDAPRPYLAFFSGGLH  325

Query  1003  GPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMG  1182
             GP+RPILLQHW+ +D DI+++ YLPK + Y+  M +SK+CLCPSGYEVASPR+VEA+Y  
Sbjct  326   GPIRPILLQHWKGQDTDIRVYEYLPKELDYYSFMLQSKFCLCPSGYEVASPRIVEAIYAE  385

Query  1183  CVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRH  1362
             CVPV++   YV PFSDVL W AF+V + V DIP LKK+L  + + +Y  L+     VRRH
Sbjct  386   CVPVILSNNYVLPFSDVLRWEAFSVSVRVSDIPRLKKVLRGVSEDEYRKLKAGVRAVRRH  445

Query  1363  FEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             F +N P KRFDVFHMILHSIWLRRL+I++
Sbjct  446   FVLNQPAKRFDVFHMILHSIWLRRLDIKI  474



>gb|EYU42789.1| hypothetical protein MIMGU_mgv1a009597mg [Erythranthe guttata]
Length=337

 Score =   434 bits (1116),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 197/334 (59%), Positives = 257/334 (77%), Gaps = 4/334 (1%)
 Frame = +1

Query  463   MEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD--FSQFRTTDPDSAHVFFLPFS  636
             MEK  K+YVY++G+ P+ H GPC+SIY+ EG FI+ M+   + +RT DPD AHV+F+PFS
Sbjct  1     MEKVFKIYVYKEGEAPIFHNGPCRSIYSSEGRFINEMEKHGNHYRTNDPDEAHVYFMPFS  60

Query  637   VTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGS  816
             V V+ + +Y   + D +P+  T  DYV++I+ K+PFWNR+LGADHFMLSCHDWGP  S  
Sbjct  61    VVVMVQYLYEPGALDMNPIGNTLADYVRTISHKHPFWNRSLGADHFMLSCHDWGPHTSSY  120

Query  817   IPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGG  996
             +P L K +IR LCNANTSE FNP KD ++PEINL  G   GL+GGPPP++R  L F+AGG
Sbjct  121   VPLLFKNSIRVLCNANTSEGFNPLKDATLPEINLKTGEITGLLGGPPPSQRKTLAFFAGG  180

Query  997   LHGPVRPILLQHW--ENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             LHG +R +LL HW  +N+D+DI+++  LP N+SY  M++ SK+CLCPSGYEVASPR+VEA
Sbjct  181   LHGHIRHLLLHHWRDQNQDKDIQVYEKLPSNMSYEKMLKTSKFCLCPSGYEVASPRVVEA  240

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
             +Y  CVPVLI   YVPPFSDVLNW  FAV++ VEDIPN+K IL  I + +Y  +Q+R  +
Sbjct  241   IYAECVPVLISDSYVPPFSDVLNWKKFAVVVAVEDIPNIKNILMGISEGRYLKMQKRVRQ  300

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             V+RHF VN  PKRFD+FHMI+HS+WLRRLN+R+H
Sbjct  301   VQRHFVVNGNPKRFDLFHMIVHSVWLRRLNLRLH  334



>ref|XP_006450385.1| hypothetical protein CICLE_v10008151mg [Citrus clementina]
 gb|ESR63625.1| hypothetical protein CICLE_v10008151mg [Citrus clementina]
Length=479

 Score =   439 bits (1130),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 207/393 (53%), Positives = 278/393 (71%), Gaps = 11/393 (3%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRGNQ-------LHSDEHYIPSGSIYWNASSFHRSYVE  462
              A+  +K E L+ GLA+AR+SI +          + +   ++PS +IY N  +F++SYVE
Sbjct  86    SARVLSKNEQLKQGLARARASIRKAASTRNVTSIIKNGVDFVPSAAIYRNPGAFYQSYVE  145

Query  463   MEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS--QFRTTDPDSAHVFFLPFS  636
             MEK  KVYVY +G+ P+ HYGPCK IY IEG F+  ++    +FRT+DP  AHV++LPFS
Sbjct  146   MEKRFKVYVYREGELPITHYGPCKDIYTIEGRFMSEIEHGAKRFRTSDPHRAHVYYLPFS  205

Query  637   VTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGS  816
             V  + K +Y   ++D +P+K+   DYV+ ++ KYPFWNRT GADHFML+CHDWGP +S  
Sbjct  206   VAWMVKYLYKPLTYDLTPLKQFVADYVKVVSSKYPFWNRTCGADHFMLACHDWGPHVSKG  265

Query  817   IPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPP--TERPVLVFYA  990
                L   +IR LCNANTSE FNP+KDV++PEI+L  G     +  PPP    RP L F+A
Sbjct  266   NSHLYNNSIRVLCNANTSEGFNPQKDVTLPEIHLYGGYVSPKLLSPPPFNAPRPYLAFFA  325

Query  991   GGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             GGLHG +R ILLQHW+  D+D+ +  YLPK+  Y+  M KSK+CLCPSGYEVASPR+VE+
Sbjct  326   GGLHGTIRSILLQHWKGHDKDLIVFEYLPKDQDYYSFMLKSKFCLCPSGYEVASPRIVES  385

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
             +Y  CVPV++ + YV PFSDVL W AF++ + V +IP LK++L  +P+ +Y+ L+     
Sbjct  386   IYAQCVPVILSQNYVLPFSDVLRWEAFSIQVDVSEIPRLKEVLMAVPEEKYKRLKENLKA  445

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             VRRHFE+N P KRFDVFHMILHSIWLRRLN+R+
Sbjct  446   VRRHFELNHPAKRFDVFHMILHSIWLRRLNMRL  478



>emb|CDP13539.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   439 bits (1130),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 215/382 (56%), Positives = 278/382 (73%), Gaps = 5/382 (1%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHYIP-SGSIYWNASSFHRSYVEMEKTLKVYVYE  495
             T+ EILE GLA+AR++I      H +      S  IY N ++F +SY EMEK  KVYVYE
Sbjct  158   TRQEILERGLAKARAAIREAAASHRNFSVTAFSAHIYRNPAAFFQSYAEMEKRFKVYVYE  217

Query  496   DGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVLSKMIYVA  669
             +G+ P+ HYGPCK+IYAIEG FIH M+   ++FRT DP S HV+F+PFSVT + K +Y  
Sbjct  218   EGELPIVHYGPCKNIYAIEGRFIHEMEHGGNRFRTRDPHSGHVYFMPFSVTWMVKYLYKP  277

Query  670   NSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRA  849
             N+++ SP+K+ A DYV++I+  +PFWNRT GADHFMLSCHDWGP  S   P L   +IR 
Sbjct  278   NTYNISPLKQFASDYVRAISTNHPFWNRTQGADHFMLSCHDWGPHASRGNPFLYNTSIRV  337

Query  850   LCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTER--PVLVFYAGGLHGPVRPIL  1023
             LCNAN+SE FNP+KDVS+PEI L DG     I  PPP  R  P L F+AGGLHGP+RPIL
Sbjct  338   LCNANSSEGFNPRKDVSLPEIQLYDGDVSSKIRNPPPANRSRPYLAFFAGGLHGPIRPIL  397

Query  1024  LQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIK  1203
             +QHW+ +D  I+++ YLPK + Y+  M KSK+CLCPSG+EVASPR+VEA+Y  CVPV++ 
Sbjct  398   VQHWKGRDAAIRVYEYLPKGLDYYTFMLKSKFCLCPSGHEVASPRIVEAIYAECVPVILS  457

Query  1204  RGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPP  1383
             + YV PFSDVL W AF++ + + +IP LK+IL  IP  +Y+ L+     VRRHF +N P 
Sbjct  458   KHYVLPFSDVLRWEAFSIKVEISEIPRLKEILMAIPDDEYKRLKEGLRAVRRHFVLNHPA  517

Query  1384  KRFDVFHMILHSIWLRRLNIRV  1449
             +RFD+FHMILHS+WLRRLN R+
Sbjct  518   QRFDMFHMILHSVWLRRLNFRL  539



>ref|XP_003601437.1| hypothetical protein MTR_3g080690 [Medicago truncatula]
Length=450

 Score =   436 bits (1120),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 208/385 (54%), Positives = 276/385 (72%), Gaps = 9/385 (2%)
 Frame = +1

Query  322   KLEILESGLAQARS----SILRGNQ----LHSDEHYIPSGSIYWNASSFHRSYVEMEKTL  477
              LE +E  LA+AR+    ++LR N     L     Y+P G IY NA +FHRSY  MEK  
Sbjct  65    NLEKVEGSLAKARALIKQALLRTNDTVVPLEDSHDYVPQGHIYRNAFAFHRSYQLMEKLF  124

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSK  654
             K++VYE+G+PP+ HYGPCK+IY++EG FI+ ++ +  FRT +P+ AHV+FLPFSV ++ +
Sbjct  125   KIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLENNTLFRTQNPNEAHVYFLPFSVVMILE  184

Query  655   MIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
              ++     D + + RT  DYV  I+ KY +WNR+ GADHFMLSCHDWGP  +  + +L  
Sbjct  185   HLFHPVIRDKAVLGRTIGDYVHIISHKYAYWNRSYGADHFMLSCHDWGPRATWYVKELYF  244

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              AIR LCNAN SE FNPKKD S PEINL  G T GL+GG P   R +L F+AG ++G +R
Sbjct  245   IAIRVLCNANISEHFNPKKDASFPEINLVSGETTGLLGGYPTWNRTILAFFAGQMNGRIR  304

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
             P+L QHW+NKD+D+ ++  LP+ +SYH  M+ SKYC+CPSG+EVASPR+VEA+Y  CVP+
Sbjct  305   PVLFQHWKNKDKDVLVYEKLPEKISYHETMKMSKYCICPSGWEVASPRIVEAIYAECVPI  364

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             LI + YV PFSDVLNW +F+V I V +IP LK+IL  I + +Y  LQ    +V+RHF VN
Sbjct  365   LISQQYVLPFSDVLNWDSFSVQIEVSEIPKLKEILLGISEEKYMRLQEGVKQVQRHFVVN  424

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRV  1449
              PPK++DVFHMI+HSIWLRRLN+ V
Sbjct  425   NPPKKYDVFHMIIHSIWLRRLNVLV  449



>gb|AES71688.2| exostosin family protein [Medicago truncatula]
Length=445

 Score =   435 bits (1119),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 208/384 (54%), Positives = 276/384 (72%), Gaps = 9/384 (2%)
 Frame = +1

Query  325   LEILESGLAQARS----SILRGNQ----LHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             LE +E  LA+AR+    ++LR N     L     Y+P G IY NA +FHRSY  MEK  K
Sbjct  61    LEKVEGSLAKARALIKQALLRTNDTVVPLEDSHDYVPQGHIYRNAFAFHRSYQLMEKLFK  120

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLSKM  657
             ++VYE+G+PP+ HYGPCK+IY++EG FI+ ++ +  FRT +P+ AHV+FLPFSV ++ + 
Sbjct  121   IFVYEEGEPPLFHYGPCKNIYSMEGIFINLLENNTLFRTQNPNEAHVYFLPFSVVMILEH  180

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             ++     D + + RT  DYV  I+ KY +WNR+ GADHFMLSCHDWGP  +  + +L   
Sbjct  181   LFHPVIRDKAVLGRTIGDYVHIISHKYAYWNRSYGADHFMLSCHDWGPRATWYVKELYFI  240

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRP  1017
             AIR LCNAN SE FNPKKD S PEINL  G T GL+GG P   R +L F+AG ++G +RP
Sbjct  241   AIRVLCNANISEHFNPKKDASFPEINLVSGETTGLLGGYPTWNRTILAFFAGQMNGRIRP  300

Query  1018  ILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVL  1197
             +L QHW+NKD+D+ ++  LP+ +SYH  M+ SKYC+CPSG+EVASPR+VEA+Y  CVP+L
Sbjct  301   VLFQHWKNKDKDVLVYEKLPEKISYHETMKMSKYCICPSGWEVASPRIVEAIYAECVPIL  360

Query  1198  IKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNW  1377
             I + YV PFSDVLNW +F+V I V +IP LK+IL  I + +Y  LQ    +V+RHF VN 
Sbjct  361   ISQQYVLPFSDVLNWDSFSVQIEVSEIPKLKEILLGISEEKYMRLQEGVKQVQRHFVVNN  420

Query  1378  PPKRFDVFHMILHSIWLRRLNIRV  1449
             PPK++DVFHMI+HSIWLRRLN+ V
Sbjct  421   PPKKYDVFHMIIHSIWLRRLNVLV  444



>ref|XP_004501350.1| PREDICTED: probable glycosyltransferase At5g25310-like [Cicer 
arietinum]
Length=476

 Score =   435 bits (1119),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 210/397 (53%), Positives = 279/397 (70%), Gaps = 17/397 (4%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRG------------NQLHSDEHYIPSGSIYWNASSFHRS  453
             K  +K E  E GLA+AR SI +                H+++ YIP+G++Y N   F++S
Sbjct  79    KVKSKEEKREEGLARARGSIRKAALGDDRSNLSLSKSPHNNDGYIPAGAVYHNPRLFYQS  138

Query  454   YVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD--FSQFRTTDPDSAHVFFL  627
             Y+EMEK  KVYVY DG  P+ H GPCK IY+IEG F+H M+    +FRT DP++AHV+FL
Sbjct  139   YLEMEKIFKVYVYPDGDLPIVHDGPCKDIYSIEGRFLHEMEHGVGRFRTNDPNAAHVYFL  198

Query  628   PFSVTVLSKMIYVANS-HDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPE  804
             PFSVT + K +Y  +S +D +P+K+   DYV+ ++ +YPFWN+T GADHFML+CHDWGP 
Sbjct  199   PFSVTWMVKYLYTPSSNYDITPLKQFVSDYVRMVSMRYPFWNKTRGADHFMLACHDWGPH  258

Query  805   ISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERP--VL  978
              S   P L   +IR LCNANTSE FNP KDV++PEI+L  G     +   PP   P   L
Sbjct  259   ASKGNPFLYNTSIRVLCNANTSEGFNPLKDVTLPEIHLYGGEVSPKLLSLPPENAPRRYL  318

Query  979   VFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPR  1158
              F+AGG+HGP+RPILL HW+N+D DI ++ YLPK + Y+ +M  SK+CLCPSG+EVASPR
Sbjct  319   AFFAGGMHGPIRPILLHHWKNRDSDINVYEYLPKGLDYYSLMLNSKFCLCPSGHEVASPR  378

Query  1159  MVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQR  1338
             +VE++Y  CVPV++   YV PFSDVL W AF+V + V +IP LK++L  IP+++Y  L++
Sbjct  379   IVESIYAECVPVILSNYYVLPFSDVLRWEAFSVQVDVSNIPRLKEVLNAIPESKYRKLKQ  438

Query  1339  RGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
                 VRRHF +N P KRFDVFHMILHSIWLRRLN+++
Sbjct  439   GVRAVRRHFTLNQPAKRFDVFHMILHSIWLRRLNMKL  475



>ref|XP_006856564.1| hypothetical protein AMTR_s00046p00183980 [Amborella trichopoda]
 gb|ERN18031.1| hypothetical protein AMTR_s00046p00183980 [Amborella trichopoda]
Length=462

 Score =   435 bits (1118),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 204/383 (53%), Positives = 275/383 (72%), Gaps = 9/383 (2%)
 Frame = +1

Query  328   EILESGLAQARSSILRG-----NQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVY  492
             +++E+GLA+AR +I        + L +D  + P   I+ N ++FHRSY+EME  LK++VY
Sbjct  79    QVIEAGLARARKAIKDAASNPNSSLINDPLFSPDPQIFRNPAAFHRSYLEMENRLKIFVY  138

Query  493   EDGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVLSKMIYV  666
             ++G+PP+ H GPCK+IY IEG FIH ++   S F T  P+ AH++FLP SVT +   +Y 
Sbjct  139   KEGEPPLVHDGPCKNIYTIEGRFIHELELGTSSFLTKKPEQAHLYFLPLSVTQMVTYLYK  198

Query  667   ANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIR  846
               S+D +P+KR   DYV  I+ ++PFWN +LGADHF LSCHDW P +S S  +L   +IR
Sbjct  199   PLSYDLTPLKRFVSDYVSLISSRHPFWNASLGADHFFLSCHDWAPHVSRSNHNLYNTSIR  258

Query  847   ALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGP--PPTERPVLVFYAGGLHGPVRPI  1020
              LCNANTSE FNP KD+S+PEINL  G     +  P  P   RP+L F+AGGLHGP+RP+
Sbjct  259   VLCNANTSEGFNPSKDISLPEINLRTGELPAQLLTPADPRHPRPILAFFAGGLHGPIRPL  318

Query  1021  LLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLI  1200
             LLQ W++KD DIK++ YLPK ++Y+ +M KSKYCLCPSGYEVASPR+VEA++ GCVPVLI
Sbjct  319   LLQQWQSKDPDIKVYQYLPKGLNYYDLMSKSKYCLCPSGYEVASPRVVEAIHSGCVPVLI  378

Query  1201  KRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWP  1380
                YV PFSDVL W AF V + + +IP +K+IL  IP+ +Y+ L+     VRRHF +N P
Sbjct  379   SNSYVLPFSDVLRWEAFTVSLSLSEIPRVKEILEGIPEGEYQRLRENLGRVRRHFVLNQP  438

Query  1381  PKRFDVFHMILHSIWLRRLNIRV  1449
              +R DVFHM++HS+WLRRLN+R+
Sbjct  439   AQRLDVFHMVMHSLWLRRLNLRM  461



>ref|XP_009759830.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
sylvestris]
Length=483

 Score =   434 bits (1116),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 201/390 (52%), Positives = 282/390 (72%), Gaps = 10/390 (3%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQL--------HSDEHYIPSGSIYWNASSFHRSYVEM  465
             K    +E +E+GL+ AR+ ++R   L        + D  Y+P G+IY N  +FHRSY+ M
Sbjct  94    KKDENMEKIEAGLSSARA-LIRETLLINGTNESPYEDADYVPQGNIYRNPHAFHRSYLLM  152

Query  466   EKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVT  642
             EK  K++VY++G+PP+ HYGPCK+IY++EG FI+ M+ +  F+T +PD AHV+FLPFSV 
Sbjct  153   EKLFKIFVYKEGEPPLFHYGPCKNIYSMEGMFINLMEANNHFQTLNPDKAHVYFLPFSVV  212

Query  643   VLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIP  822
             ++ + ++     D + ++R   DYV++++ KYP+WNR+LGADHFMLS HDWGP  +  + 
Sbjct  213   MILEHLFDPIIRDKAVLERILRDYVRTVSTKYPYWNRSLGADHFMLSSHDWGPRATWYVH  272

Query  823   DLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLH  1002
              +   +IR LCNANTSE FNP+KDV +PEINL  G  +GL+   P + + +L F+AG  H
Sbjct  273   QMYFTSIRVLCNANTSEFFNPRKDVPLPEINLLTGNINGLVEALPKSNKTILGFFAGRSH  332

Query  1003  GPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMG  1182
             G +RPIL +HWE KDEDI+++S +P  +SY  MM+ SK+CLCPSGYEVASPR+VEA+Y  
Sbjct  333   GRIRPILFRHWEEKDEDIRVYSKIPPELSYDEMMKSSKFCLCPSGYEVASPRIVEAIYAN  392

Query  1183  CVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRH  1362
             CVPVLI + YV PFSDVL+W  F++ + V ++PNLK IL  I + +YE +     +V+RH
Sbjct  393   CVPVLISQNYVLPFSDVLDWDKFSIQVSVSELPNLKNILLGISEERYEKMVEGVRQVQRH  452

Query  1363  FEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             F +N PPKR+DVFHMI+HSIWLRRLN+R+H
Sbjct  453   FVINDPPKRYDVFHMIIHSIWLRRLNVRIH  482



>ref|XP_007200373.1| hypothetical protein PRUPE_ppa008342mg [Prunus persica]
 gb|EMJ01572.1| hypothetical protein PRUPE_ppa008342mg [Prunus persica]
Length=336

 Score =   428 bits (1101),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 196/331 (59%), Positives = 248/331 (75%), Gaps = 2/331 (1%)
 Frame = +1

Query  463   MEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ--FRTTDPDSAHVFFLPFS  636
             ME+  K+YVYE+G PP+ H GPCKSIY+ EG FIH M+     ++TTDPD A V+FLPFS
Sbjct  1     MERLFKIYVYEEGDPPIFHNGPCKSIYSTEGRFIHEMEMDNNIYKTTDPDEALVYFLPFS  60

Query  637   VTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGS  816
             V +L + +Y A+SH+   + R  +DYV  I+ K+PFWNR+LGADHFMLSCHDWGP  S  
Sbjct  61    VVMLVQYLYAADSHNTDSIGRAVIDYVNVISDKHPFWNRSLGADHFMLSCHDWGPRTSSY  120

Query  817   IPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGG  996
             +P L   +IR LCNANTSE FNP KD S PEI+L  G   GL+GG  P+ R +L F+AG 
Sbjct  121   VPHLYHKSIRVLCNANTSEGFNPSKDASFPEIHLRTGEIKGLVGGLSPSRRSILAFFAGR  180

Query  997   LHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALY  1176
             LHG +R +LL  W+ KD+D++++  LP  VSY  M++KS++CLCPSGYEVASPR+VEA+Y
Sbjct  181   LHGHIRYLLLNEWKEKDQDVQVYDQLPHGVSYELMLKKSRFCLCPSGYEVASPRVVEAIY  240

Query  1177  MGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVR  1356
               C+PVLI   YVPPFSDVL+W +F+V I VEDIPN+K IL  I Q+QY  + RR  +V+
Sbjct  241   AECIPVLISDSYVPPFSDVLDWKSFSVQIQVEDIPNIKTILMGISQSQYLRMHRRVKQVQ  300

Query  1357  RHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             RHF VN P KRFDVF+MI+HSIWLRRLNIR+
Sbjct  301   RHFVVNGPSKRFDVFNMIVHSIWLRRLNIRI  331



>gb|KEH35171.1| exostosin family protein [Medicago truncatula]
Length=447

 Score =   432 bits (1110),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 206/386 (53%), Positives = 274/386 (71%), Gaps = 11/386 (3%)
 Frame = +1

Query  325   LEILESGLAQARS----SILRGNQ------LHSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             LE +E  LA+AR+    ++LR N       L     ++P G IY NA +FHRSY  MEK 
Sbjct  61    LEKVEGSLAKARALIKQALLRTNDTVLALPLEDSHDFVPQGDIYRNAFAFHRSYHLMEKL  120

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVLS  651
              K++VYE+G+PP+ HYGPCK+IY++EG FI+ ++ +  FRT +P+ AH +FLPFSV ++ 
Sbjct  121   FKIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLENNTLFRTRNPNEAHAYFLPFSVVMIL  180

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + ++     D + + RT  DYV  I+ KY +WNR+ GADHFMLSCHDWGP  +  + +L 
Sbjct  181   EHLFHPVIRDKAVLGRTIGDYVHIISHKYAYWNRSYGADHFMLSCHDWGPRATWYVKELY  240

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
               AIR LCNAN SE FNPKKD S PEINL  G T GL+GG P   R +L F+AG +HG +
Sbjct  241   FIAIRVLCNANISEHFNPKKDASFPEINLVTGETAGLLGGYPTWNRTILAFFAGKMHGKI  300

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             RP+L QHW+NKD+D+ ++  LP+ +SYH  M+ SKYC+CPSG+EVASPR+VEA+Y  CVP
Sbjct  301   RPVLFQHWKNKDKDVLVYEKLPEKISYHETMKMSKYCICPSGWEVASPRIVEAIYAECVP  360

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             ++I + YV PFSDVL+W +F+V I V +IP LK IL  I + +Y  LQ    +V+RHF V
Sbjct  361   IIISQQYVLPFSDVLDWDSFSVKIEVSEIPKLKDILLGISEEKYMKLQEGVKQVQRHFVV  420

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRV  1449
             N PPKR+DVFHMI+HSIWLRRLN+ V
Sbjct  421   NNPPKRYDVFHMIIHSIWLRRLNVVV  446



>ref|XP_002459470.1| hypothetical protein SORBIDRAFT_02g005180 [Sorghum bicolor]
 gb|EER95991.1| hypothetical protein SORBIDRAFT_02g005180 [Sorghum bicolor]
Length=584

 Score =   436 bits (1122),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 224/401 (56%), Positives = 282/401 (70%), Gaps = 22/401 (5%)
 Frame = +1

Query  313   SYTKLEILESGLAQARSSIL---RGNQLHS---DEHYIPSGSIYWNASSFHRSYVEMEKT  474
             S  KLE LE GLA+ARS+I+   R     S   D+ Y+P G IY NA +FHRSY+EMEK 
Sbjct  178   SDIKLERLELGLAKARSAIMEAIRNKDKRSPLPDKDYVPMGPIYRNAHAFHRSYLEMEKQ  237

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPDSAHVFFLPFSVTVLS  651
             LKVYVYE+G+PPV H GPC+SIY+ EG FIHAM+  ++ RT+DP  AHVFFLPFSV  + 
Sbjct  238   LKVYVYEEGEPPVFHDGPCRSIYSTEGRFIHAMETATRLRTSDPSQAHVFFLPFSVVKMV  297

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             K IY   SHD +P+KRT  DY++ I+ KYPFWNR+ GADHFMLSCHDWGP +S +  +L 
Sbjct  298   KTIYEPGSHDMAPLKRTVADYLRVISDKYPFWNRSAGADHFMLSCHDWGPYVSSANAELF  357

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPV  1011
               +IR LCNANTSE F+  KDVS+PEINL     +  +GGP  + RP L F+AGG HGPV
Sbjct  358   GNSIRVLCNANTSEGFDLAKDVSLPEINLRSDAVERQVGGPSASRRPFLAFFAGGNHGPV  417

Query  1012  RPILLQHW-----ENKDEDIKIHSYLPK--------NVSYHGMMRKSKYCLCPSGYEVAS  1152
             RP LL HW        D D+++  YLP           +Y  MMR+S++CLCP GYEVAS
Sbjct  418   RPALLAHWGPGSGREDDPDVRVSEYLPTRGGRAGASAAAYTDMMRRSRFCLCPGGYEVAS  477

Query  1153  PRMVEALYMGCVPVLIKRG-YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEI  1329
             PR+ EA+Y+ CVPV++  G Y  PF+DVLNW AFAV + V D+P +K+IL+ +   QY  
Sbjct  478   PRLAEAVYLECVPVVVDDGEYALPFADVLNWDAFAVRVRVADVPRIKEILSAVSPRQYIR  537

Query  1330  LQRRGVEVRRHFEVN-WPPKRFDVFHMILHSIWLRRLNIRV  1449
             +QRR   VRRHF V+  PP+R+D FHMILHS+WLRRLN+R+
Sbjct  538   MQRRVRMVRRHFMVHGGPPRRYDAFHMILHSVWLRRLNVRI  578



>ref|XP_010905483.1| PREDICTED: probable glycosyltransferase At5g20260 [Elaeis guineensis]
Length=461

 Score =   431 bits (1109),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 204/385 (53%), Positives = 272/385 (71%), Gaps = 8/385 (2%)
 Frame = +1

Query  319   TKLEILESGLAQAR-----SSILRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
              K+ I+E GLA+AR     ++I R       E +IP G++Y NA +FH+SY+EMEK  KV
Sbjct  75    VKVGIIEEGLARARNAIRHAAIARNYSSEKVEKFIPRGAVYRNAYAFHQSYIEMEKRFKV  134

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ--FRTTDPDSAHVFFLPFSVTVLSKM  657
             + Y++G+PP+ H GP  SIYAIEGHFI  ++  +  FR   PD AHVFFLPFSV  + + 
Sbjct  135   WTYKEGEPPIIHEGPGASIYAIEGHFISEIEDEKNPFRAHHPDEAHVFFLPFSVVNIVQY  194

Query  658   IYVANSHD-WSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
             +Y  N  D W P+KR   DY+  I+ KYP+WNR+LG DHFM+SCHDW P +S +   L +
Sbjct  195   VYKPNVSDYWKPLKRLIADYIGVISEKYPYWNRSLGVDHFMVSCHDWAPHLSDANLQLYR  254

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              +IR +CNANTSE F   KDV++PE++LPDG     +      ER +L F++GG HG +R
Sbjct  255   NSIRVICNANTSEGFKLGKDVTLPEVHLPDGLLSQPVRHRSLAERTILAFFSGGSHGYIR  314

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
              ILL HW+ KD +I  + YLPK ++Y  +MRK+K+CLCPSGYEVASPR+VE+++MGCVPV
Sbjct  315   EILLHHWKGKDHEILAYEYLPKGLNYAELMRKTKFCLCPSGYEVASPRIVESIFMGCVPV  374

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             +I   Y PPF DVL+WS F+V IPVE IP +K +L  I + +Y ILQ R ++V+RHF +N
Sbjct  375   IISVNYPPPFGDVLDWSKFSVQIPVEKIPEIKTLLKGISERRYRILQSRVLQVQRHFVLN  434

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRV  1449
              P KRFDV HM+LHSIWLRRLN+R+
Sbjct  435   RPAKRFDVIHMVLHSIWLRRLNVRL  459



>ref|XP_008337560.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=390

 Score =   428 bits (1100),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 199/362 (55%), Positives = 260/362 (72%), Gaps = 7/362 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             K Y++LE LE+ LA  R SI    ++      H D  Y+P G IY NA++FHRSY+EMEK
Sbjct  25    KRYSRLEKLEANLAGVRXSIREAARVRNLTSTHEDPDYVPHGPIYRNANAFHRSYLEMEK  84

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVFFLPFSVTVL  648
               K++VY +G+PP+ H GPCKSIY+ EG  IH M+    +RT DPD A V+FLPFSV +L
Sbjct  85    HFKIFVYGEGEPPIFHNGPCKSIYSTEGRSIHEMEMENVYRTRDPDEALVYFLPFSVVML  144

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +YVA+SHD  P+ R  +DYV  I+ K+PFWNR+LGADHFM SCH WGP  S  +P+L
Sbjct  145   VQYLYVADSHDTZPIGRAVIDYVNVISDKHPFWNRSLGADHFMJSCHHWGPSTSAYVPNL  204

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KDVS PEI+L  G T+GL+GG  P+ R +L F+AG L G 
Sbjct  205   YHNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGETEGLLGGLSPSXRSILAFFAGRLSGH  264

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R +LL  W+ KD+D++++   P  VSY  M++K+++CLCPSGYEVASPR+VEA+Y  CV
Sbjct  265   IRYLLLNEWKEKDQDVQVYDQFPNGVSYESMLKKNRFCLCPSGYEVASPRVVEAIYAECV  324

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI   YVPPFSDVL W +F+V + V+DIPN+K+IL  I Q+QY  +QR   +V+RHF 
Sbjct  325   PVLISDSYVPPFSDVLEWKSFSVQVKVKDIPNIKRILKGISQSQYLRMQRXVKQVQRHFV  384

Query  1369  VN  1374
             VN
Sbjct  385   VN  386



>ref|XP_002515489.1| catalytic, putative [Ricinus communis]
 gb|EEF46938.1| catalytic, putative [Ricinus communis]
Length=481

 Score =   431 bits (1109),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 205/396 (52%), Positives = 279/396 (70%), Gaps = 6/396 (2%)
 Frame = +1

Query  280   YLKTLAVYGAKSYTKLEILESGLAQARSSILRGNQLHSDEHY--IPSGSIYWNASSFHRS  453
             +  T  +      ++ E LE GLA+AR+SI +     SD +   +    IY N ++F++S
Sbjct  85    FRNTTVIRKISKLSREEELEQGLARARASIRKAVTFGSDVNRSDVVRNVIYRNPAAFYQS  144

Query  454   YVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS--QFRTTDPDSAHVFFL  627
             Y+EME+  KVYVY +G PP+ H GPCK IY IEG FIH M+    ++RT DP  AHV+F+
Sbjct  145   YMEMERRFKVYVYSEGDPPIVHDGPCKDIYTIEGRFIHEMEHGARRYRTRDPKRAHVYFM  204

Query  628   PFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEI  807
             PFSVT + K +Y   ++D SP+++   DYV+ ++ KYPFWNRT GADHFML+CHDWGP  
Sbjct  205   PFSVTWMVKYLYKPLTYDHSPLRQFVADYVRVLSTKYPFWNRTHGADHFMLACHDWGPHA  264

Query  808   SGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPP--TERPVLV  981
             S     L   +IR LCNANTSE FNP+KDVS+PEI+L  G     +  PPP  T RP L 
Sbjct  265   SRGDHLLYNTSIRVLCNANTSEGFNPRKDVSLPEIHLYGGNVPPQLLSPPPANTTRPHLA  324

Query  982   FYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRM  1161
             F+AGGLHGP+RP+LL+HW++++ D+++  YLPK++ Y+  M +SK+CLCPSG+EVASPR+
Sbjct  325   FFAGGLHGPIRPLLLKHWKDRESDLRVFEYLPKHLDYYSFMLRSKFCLCPSGHEVASPRI  384

Query  1162  VEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRR  1341
             VE++Y  CVPV++   YV PFSDVL W AF++ + V +IP L+++L  +P+ +YE L+  
Sbjct  385   VESIYAECVPVILSDHYVLPFSDVLRWDAFSIQLNVSEIPRLEEVLRSVPEEKYERLKEG  444

Query  1342  GVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
                VR HF +N P KRFDVFHMILHSIWLRRLN+R+
Sbjct  445   LRTVRTHFMLNQPAKRFDVFHMILHSIWLRRLNLRL  480



>ref|XP_010519637.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X2 
[Tarenaya hassleriana]
Length=465

 Score =   430 bits (1106),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 205/386 (53%), Positives = 274/386 (71%), Gaps = 9/386 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQLHSD---EHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             +  TK E LE GLA+AR+SILR     +    E ++P+  +Y N ++F+RSYVEMEK  +
Sbjct  78    RKLTKEEELERGLAKARASILRAASDRNTTEYESHLPNAEVYHNPAAFYRSYVEMEKRFR  137

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVLSK  654
             VYVYE+G  P+ H GPCK +YA+EG FIH ++   ++FRT DP  AHV+F+PFSVT L K
Sbjct  138   VYVYEEGVLPLVHDGPCKDVYAVEGRFIHEIERGKTRFRTRDPLKAHVYFMPFSVTFLVK  197

Query  655   MIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
              +Y  +  D  P+KR   DYV +I+ KYPFWNR+ GADHFML+CHDWGP +S S P L  
Sbjct  198   YLYQGHG-DAKPLKRFVSDYVTTISSKYPFWNRSSGADHFMLACHDWGPLVSKSNPHLFN  256

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTD---GLIGGPPPTERPVLVFYAGGLHG  1005
              +IR LCNAN+SE FNPKKD S+PEI L     +    L      ++RP L F+AGGLHG
Sbjct  257   TSIRVLCNANSSEGFNPKKDASLPEIKLYGSEINPKLTLSKTGDYSQRPYLAFFAGGLHG  316

Query  1006  PVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGC  1185
             P+RPILL+HW+++D D+ +H YLPKN++++  M +SK+CLCPSGYEVASPR++E++Y  C
Sbjct  317   PIRPILLEHWKHRDPDMPVHEYLPKNLNFYDFMLQSKFCLCPSGYEVASPRVIESIYAEC  376

Query  1186  VPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHF  1365
             VPV++ + +V P SDVL W  F+V + V +IP LK+IL  + + +Y  L+R    VRRHF
Sbjct  377   VPVILSKNFVLPLSDVLRWETFSVQVDVSEIPRLKEILMSVSEEKYRWLRRNLQYVRRHF  436

Query  1366  EVNWPPKRFDVFHMILHSIWLRRLNI  1443
              +N PP+RFD FH  LHSIWLRR+N 
Sbjct  437   VLNQPPERFDAFHTTLHSIWLRRINF  462



>ref|XP_010519636.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Tarenaya hassleriana]
Length=469

 Score =   430 bits (1105),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 205/386 (53%), Positives = 274/386 (71%), Gaps = 9/386 (2%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQLHSD---EHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             +  TK E LE GLA+AR+SILR     +    E ++P+  +Y N ++F+RSYVEMEK  +
Sbjct  82    RKLTKEEELERGLAKARASILRAASDRNTTEYESHLPNAEVYHNPAAFYRSYVEMEKRFR  141

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVLSK  654
             VYVYE+G  P+ H GPCK +YA+EG FIH ++   ++FRT DP  AHV+F+PFSVT L K
Sbjct  142   VYVYEEGVLPLVHDGPCKDVYAVEGRFIHEIERGKTRFRTRDPLKAHVYFMPFSVTFLVK  201

Query  655   MIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
              +Y  +  D  P+KR   DYV +I+ KYPFWNR+ GADHFML+CHDWGP +S S P L  
Sbjct  202   YLYQGHG-DAKPLKRFVSDYVTTISSKYPFWNRSSGADHFMLACHDWGPLVSKSNPHLFN  260

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTD---GLIGGPPPTERPVLVFYAGGLHG  1005
              +IR LCNAN+SE FNPKKD S+PEI L     +    L      ++RP L F+AGGLHG
Sbjct  261   TSIRVLCNANSSEGFNPKKDASLPEIKLYGSEINPKLTLSKTGDYSQRPYLAFFAGGLHG  320

Query  1006  PVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGC  1185
             P+RPILL+HW+++D D+ +H YLPKN++++  M +SK+CLCPSGYEVASPR++E++Y  C
Sbjct  321   PIRPILLEHWKHRDPDMPVHEYLPKNLNFYDFMLQSKFCLCPSGYEVASPRVIESIYAEC  380

Query  1186  VPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHF  1365
             VPV++ + +V P SDVL W  F+V + V +IP LK+IL  + + +Y  L+R    VRRHF
Sbjct  381   VPVILSKNFVLPLSDVLRWETFSVQVDVSEIPRLKEILMSVSEEKYRWLRRNLQYVRRHF  440

Query  1366  EVNWPPKRFDVFHMILHSIWLRRLNI  1443
              +N PP+RFD FH  LHSIWLRR+N 
Sbjct  441   VLNQPPERFDAFHTTLHSIWLRRINF  466



>ref|XP_006856555.1| hypothetical protein AMTR_s00046p00174470 [Amborella trichopoda]
 gb|ERN18022.1| hypothetical protein AMTR_s00046p00174470 [Amborella trichopoda]
Length=543

 Score =   432 bits (1110),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/373 (54%), Positives = 272/373 (73%), Gaps = 6/373 (2%)
 Frame = +1

Query  325   LEILESGLAQARSSILRGNQLHSD-----EHYIPSGSIYWNASSFHRSYVEMEKTLKVYV  489
             L+ L++ LA+ARSSI R  +  +D     + ++P G+ Y N  +F++SY+EMEKTLKV++
Sbjct  161   LQRLDAQLARARSSIKRAARFCNDSCYGGDSFVPKGAAYRNPYAFYQSYLEMEKTLKVWI  220

Query  490   YEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYV  666
             Y++G+PP+ H GPCKSIY++EG FIH  D  ++F  + P+ AH+ F+P S+T L   +Y 
Sbjct  221   YKEGEPPLVHDGPCKSIYSMEGQFIHEFDSGNRFVASSPEHAHLHFIPLSITKLVHHLYP  280

Query  667   ANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIR  846
               ++   P+ R   DY+  I+RKYPFWNRT G+DHF LSCHDW P+ S + P+L + +IR
Sbjct  281   PKTYGRGPLHRVVSDYISIISRKYPFWNRTQGSDHFYLSCHDWAPDASEANPELNRNSIR  340

Query  847   ALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILL  1026
              LCNANTSE F+P+KDVS+PEI+L  G  DGLIGGP P+ R +L F+AG  HG +R +LL
Sbjct  341   VLCNANTSEGFDPRKDVSMPEIHLKTGRLDGLIGGPSPSRRSILAFFAGAQHGYIRSLLL  400

Query  1027  QHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKR  1206
             + W++KD  +++H YLPK  SY   M+++K+CLCPSGYEVASPR+VEA+Y GCVPV+I  
Sbjct  401   RQWKDKDSQVQVHEYLPKGQSYSKQMQRAKFCLCPSGYEVASPRVVEAIYSGCVPVIISS  460

Query  1207  GYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPK  1386
              YV PFSDVL+W  F+V IPV  IP++K IL  I Q +Y  L RR ++V+RHF VN P K
Sbjct  461   SYVLPFSDVLDWRKFSVHIPVSKIPDIKTILERISQRRYLQLYRRVLQVQRHFVVNRPAK  520

Query  1387  RFDVFHMILHSIW  1425
             RFDV HMILHSIW
Sbjct  521   RFDVIHMILHSIW  533



>ref|XP_007011817.1| Exostosin family protein [Theobroma cacao]
 gb|EOY29436.1| Exostosin family protein [Theobroma cacao]
Length=479

 Score =   429 bits (1104),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/390 (54%), Positives = 271/390 (69%), Gaps = 10/390 (3%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQLHS------DEHYIPSGSIYWNASSFHRSYVEMEK  471
             K  ++ ++LE GLA+AR+SI       +      ++  +P G +Y N S+F+ SYVEME+
Sbjct  89    KKPSREQVLEQGLARARASIRSAATARNVTVTFENDDDVPVGDVYRNPSAFYDSYVEMER  148

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS--QFRTTDPDSAHVFFLPFSVTV  645
               KVYVY +G+ P+ H GPCK IY IEG FIH M+    +FRT DP  AHV+F+PFSVT 
Sbjct  149   RFKVYVYTEGELPIVHDGPCKEIYTIEGRFIHEMEHGAKRFRTNDPGHAHVYFMPFSVTW  208

Query  646   LSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPD  825
             + K IY   S++ SP+K+   DYV+ ++ KYPFWNRT GADHFML+CHDWGP  S     
Sbjct  209   MVKYIYKPLSYNVSPLKQFVSDYVKVVSTKYPFWNRTHGADHFMLACHDWGPHASQGNSH  268

Query  826   LQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPP--PTERPVLVFYAGGL  999
             L   +IR LCNANTSE FNP+KDVS+PEI+L  G     +  PP     RP L F+AGGL
Sbjct  269   LYTNSIRVLCNANTSEGFNPQKDVSLPEIHLNGGFLSPKLLHPPLPNVSRPHLSFFAGGL  328

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HGP+RP LLQHW+ +D+++++  YLPK+  Y+  M +SK+CLCPSGYEVASPR+VEA+Y 
Sbjct  329   HGPIRPFLLQHWKGRDDEMQVFEYLPKDKDYYSYMLQSKFCLCPSGYEVASPRIVEAIYS  388

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
              CVPV++   YV PFSDVL W AF+V +    IP LK+IL  IP+ +Y  LQ     VRR
Sbjct  389   ECVPVILSEHYVLPFSDVLRWEAFSVQVETTAIPRLKEILLGIPEEKYRKLQEGVRAVRR  448

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             HF +N P KRFD+FHMILHSIWLRR+N R+
Sbjct  449   HFMLNQPSKRFDMFHMILHSIWLRRINARL  478



>ref|XP_008794982.1| PREDICTED: probable glycosyltransferase At5g20260 [Phoenix dactylifera]
Length=498

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 203/385 (53%), Positives = 271/385 (70%), Gaps = 8/385 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSI-----LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
              K+ I+E GLA+AR+SI      R       E +IP G++Y NA +FH+SY+EMEK  KV
Sbjct  112   VKVGIIEEGLARARNSIRHAALARNYTTSKVEDFIPRGAVYRNAHAFHQSYIEMEKRFKV  171

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ--FRTTDPDSAHVFFLPFSVTVLSKM  657
             + Y++G+PP+ H GP  SI AIEGHFI  ++  +  FR   PD AHVFFLPFSV  + + 
Sbjct  172   WTYKEGEPPIIHGGPGASINAIEGHFISEIEDKKNPFRARHPDEAHVFFLPFSVVNIVQY  231

Query  658   IYVANSHD-WSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
             +Y     D W P+KR   DY+  ++ K+P+WNR+LGADHFM+SCHDW P +S +   L +
Sbjct  232   VYKPKVSDYWGPLKRLIADYIGVVSEKHPYWNRSLGADHFMVSCHDWAPHLSDANLQLYE  291

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              +IR +CNANTSE F   KDV++PE++LPDG     +     T+R +L F+AGG HG +R
Sbjct  292   NSIRVICNANTSEGFKLGKDVTLPEVHLPDGLLSQPVRHRSLTDRTILAFFAGGSHGYIR  351

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
              IL  HW  KD++I +H YLPK ++Y  +M K+K+CLCPSGYEVASPR+VE+++MGCVPV
Sbjct  352   EILFHHWRGKDQEILVHEYLPKGLNYAALMSKTKFCLCPSGYEVASPRIVESIFMGCVPV  411

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
             +I   Y PPF DVL+WS F+V IPVE IP +K IL  I + +Y ILQ R ++V+RHF +N
Sbjct  412   IISVNYPPPFGDVLDWSKFSVQIPVEKIPEIKTILRGISERRYRILQMRVLQVQRHFVLN  471

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRV  1449
              P KRFDV HM+LHSIWLRRLN+R+
Sbjct  472   RPAKRFDVIHMVLHSIWLRRLNLRL  496



>ref|XP_007161196.1| hypothetical protein PHAVU_001G050100g [Phaseolus vulgaris]
 gb|ESW33190.1| hypothetical protein PHAVU_001G050100g [Phaseolus vulgaris]
Length=479

 Score =   429 bits (1103),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/370 (55%), Positives = 265/370 (72%), Gaps = 6/370 (2%)
 Frame = +1

Query  358   RSSILRGNQLH--SDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPC  531
             RS++     +H   D +Y+P+G+IY NA  FHRSY+EMEK  KVYVY DG+ P+AH GPC
Sbjct  109   RSNLTVATTVHDGGDRNYVPAGAIYRNARLFHRSYLEMEKIFKVYVYPDGELPIAHDGPC  168

Query  532   KSIYAIEGHFIHAMDFS--QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTA  705
             K IY+IEG F+H M+    +FRT DP++AHV+FLPFSVT + K +Y   S++ +P+K   
Sbjct  169   KDIYSIEGRFLHEMEHGAGRFRTNDPNAAHVYFLPFSVTWMVKYLYTPLSYNVTPLKHFV  228

Query  706   LDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNP  885
              DYV+ I+ ++PFWNRT GADHFML+CHDW P  S     L   +IR +CNANTSE FNP
Sbjct  229   SDYVKVISTRHPFWNRTHGADHFMLACHDWAPHASQGNHFLYNTSIRVMCNANTSEGFNP  288

Query  886   KKDVSIPEINLPDGTTDGLIGGPPPTE--RPVLVFYAGGLHGPVRPILLQHWENKDEDIK  1059
             +KDVS+PEI+L  G     +  P      R  L F++GGLHGP+RPILL HW+N+D DI+
Sbjct  289   RKDVSLPEIHLYGGEVSPKLLSPQSNNITRRYLAFFSGGLHGPIRPILLHHWKNQDGDIR  348

Query  1060  IHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLN  1239
             +  YLPK++ Y+  M  SK+CLCPSG+EVASPR+VEA+Y  CVPV++ + YV PFSDVL 
Sbjct  349   VFEYLPKDLDYYSFMLNSKFCLCPSGHEVASPRIVEAIYAECVPVILSKYYVLPFSDVLQ  408

Query  1240  WSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHS  1419
             W AF+V + V DIP LK IL+ I + +Y  L+     VR+HF +N P KRFDVFHMILHS
Sbjct  409   WEAFSVQVDVSDIPRLKDILSAISEDEYRKLKEGVKAVRKHFTLNRPSKRFDVFHMILHS  468

Query  1420  IWLRRLNIRV  1449
             IWLRRLNI +
Sbjct  469   IWLRRLNIEL  478



>ref|XP_011036587.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Populus euphratica]
Length=490

 Score =   429 bits (1104),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/387 (53%), Positives = 276/387 (71%), Gaps = 14/387 (4%)
 Frame = +1

Query  328   EILESGLAQARSSILRGNQL---------HSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
             E +E GLA+AR++I +   L           DE+ + +G+IY NA +F++SY+EMEK  K
Sbjct  104   EEMEHGLARARATIRKAASLTGNISRIVADGDENDV-AGAIYLNARAFYQSYMEMEKRFK  162

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS--QFRTTDPDSAHVFFLPFSVTVLSK  654
             V+VY +G+ P+ H GPCK IY IEG FIH M+    +F+T DP  AHV+F+PFSV  + K
Sbjct  163   VHVYSEGELPIVHDGPCKDIYTIEGRFIHEMEHGAKRFKTRDPLRAHVYFMPFSVAWMVK  222

Query  655   MIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
              +Y   ++D + MK+   DYV+ ++ KYPFWNRT GADHFMLSCHDWGP  S   P L  
Sbjct  223   YLYKPLTYDHTAMKQFVADYVRVVSSKYPFWNRTQGADHFMLSCHDWGPHASHGNPFLYN  282

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPP--TERPVLVFYAGGLHGP  1008
              +IR LCNAN+SE F+P+KDVS+PEI+L  G     +  PPP  + RP L F++GGLHGP
Sbjct  283   TSIRVLCNANSSEGFSPRKDVSLPEIHLYGGNVPPKLISPPPATSPRPYLAFFSGGLHGP  342

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +RPILL HW+ +D D+++H YLPK++ Y+  M +SK+CLCPSG+EVASPR+VEA+Y  CV
Sbjct  343   IRPILLDHWKGRDPDLQVHEYLPKDLDYYSFMLRSKFCLCPSGHEVASPRIVEAIYAECV  402

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PV++   YV PFSDVL W AFA+ + V +IP LK++L  +P+ +Y  L+     +R+HF 
Sbjct  403   PVILSDHYVLPFSDVLRWEAFAIQVNVSEIPRLKEVLISVPEEKYRRLKEGLRAIRKHFV  462

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             +N P KRFDVFHMILHSIWLRRLN+R+
Sbjct  463   LNQPAKRFDVFHMILHSIWLRRLNLRL  489



>ref|XP_007213348.1| hypothetical protein PRUPE_ppa1027150mg, partial [Prunus persica]
 gb|EMJ14547.1| hypothetical protein PRUPE_ppa1027150mg, partial [Prunus persica]
Length=389

 Score =   424 bits (1091),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 206/390 (53%), Positives = 269/390 (69%), Gaps = 24/390 (6%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQL------HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
             +S  +L+ LE+ L +ARSSI    ++      H D  Y+P G IY N ++FHRSY+EMEK
Sbjct  15    RSSGQLDRLEASLGRARSSIREAAKVRNKTSTHQDADYVPRGPIYRNPNAFHRSYLEMEK  74

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD-FSQFRTTDPDSAHVFFLPFSVTVL  648
               K+YVYE+G                +G FIH M+  + +RT DP+ A V+FLPFSV  +
Sbjct  75    LFKIYVYEEG----------------DGRFIHEMEKGNMYRTRDPNKALVYFLPFSVVRM  118

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +Y+ NS+D   MK   +DYV  IA+K+PFWNR+LGADHFMLSCHDW P  +  +P L
Sbjct  119   VQYLYMPNSNDRHGMKLAIIDYVNLIAQKHPFWNRSLGADHFMLSCHDWAPFTTSFVPLL  178

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGP  1008
                +IR LCNANTSE FNP KD S PEINL      GL GG  P+ R  L F+AG LHG 
Sbjct  179   FHKSIRVLCNANTSEGFNPSKDASFPEINLKTSEMSGL-GGQSPSTRSTLAFFAGRLHGH  237

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             +R +LL  W+ KD+D++++  LP+ VSY  M++ SK+CLCPSGYEVASPR+VEA+Y  C+
Sbjct  238   IRSLLLNEWKGKDQDVQVYDQLPRGVSYEKMLKGSKFCLCPSGYEVASPRVVEAIYAECI  297

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PVLI  GY+PPFSDVL+W +F+V +PV++I ++K IL  I   QY  +QRR  +V+RHF 
Sbjct  298   PVLISDGYIPPFSDVLDWKSFSVQVPVKNISDIKNILMSISSRQYLRMQRRVKQVQRHFL  357

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRVHHL  1458
             VN PPKR+DVFHMI+HSIWLRRLNIR+  L
Sbjct  358   VNGPPKRYDVFHMIVHSIWLRRLNIRIQDL  387



>ref|XP_004292977.1| PREDICTED: probable glycosyltransferase At5g25310-like [Fragaria 
vesca subsp. vesca]
Length=497

 Score =   428 bits (1100),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 203/386 (53%), Positives = 265/386 (69%), Gaps = 14/386 (4%)
 Frame = +1

Query  334   LESGLAQARSSILRGNQLHSD--------EHYIPSGSIYWNASSFHRSYVEMEKTLKVYV  489
             +E GLA+ARSSI        D           +  G +Y N  +FH+SY+EME+  KVYV
Sbjct  111   MEEGLARARSSIRTAAAASGDPNRSSPPQNDVVSHGVVYRNPRAFHQSYLEMERKFKVYV  170

Query  490   YEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS----QFRTTDPDSAHVFFLPFSVTVLSKM  657
             Y +G  P+ H GPCK IY+IEG FIH M+      +FRT +P  AHV+F+PFSVT + K 
Sbjct  171   YSEGDLPITHDGPCKDIYSIEGRFIHEMETGAKAGRFRTKNPKEAHVYFMPFSVTWMVKY  230

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +Y   S+D  P++    DYV+ ++ KYPFWNRT GADHFML+CHDW P  S   P L   
Sbjct  231   LYKPLSYDLRPLREYVSDYVRLVSEKYPFWNRTSGADHFMLACHDWAPHASAGNPFLYNT  290

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTE--RPVLVFYAGGLHGPV  1011
             +IR LCNANTSE F P+KDVS+PEI+L  G     +  PPPT   RP L F+AGGLHGP+
Sbjct  291   SIRVLCNANTSEGFRPQKDVSLPEIHLYGGYVSSKLISPPPTNTPRPYLAFFAGGLHGPI  350

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             RPILL +W+ +DE +++  YLPK + Y+ MM +SK+CLCPSG+EVASPR+VEA+Y  CVP
Sbjct  351   RPILLDYWKGRDESLRVFEYLPKTLDYNSMMLESKFCLCPSGHEVASPRIVEAIYAECVP  410

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             V+I   Y  PFSDVL W AF++ + V +I  LK+IL  +P+ +Y  L++    VR+HFE+
Sbjct  411   VIISEHYALPFSDVLRWEAFSIKVEVSEIKRLKEILEAVPEEKYRWLKKNLKVVRKHFEL  470

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRV  1449
             N P KRFDVFHMI+HS+WLRR+N+RV
Sbjct  471   NHPAKRFDVFHMIMHSVWLRRINLRV  496



>ref|XP_008394108.1| PREDICTED: probable glycosyltransferase At5g25310 [Malus domestica]
Length=492

 Score =   427 bits (1097),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/359 (56%), Positives = 260/359 (72%), Gaps = 7/359 (2%)
 Frame = +1

Query  394   DEHYIPSGSI-YWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHA  570
             D+   P GS+ Y N  +F++SY EMEK  KVYVY +G PP+ H GPCK IY+IEG FIH 
Sbjct  133   DDVLFPGGSVVYRNPGAFYQSYTEMEKKFKVYVYSEGDPPMTHDGPCKDIYSIEGRFIHE  192

Query  571   MDFS----QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKY  738
             M+      +F+T +P  AHV+F+PFSVT + K +Y   ++D +P++    DYV+ ++ ++
Sbjct  193   MENGAAGRRFKTENPQRAHVYFMPFSVTWMVKYLYKPLTYDLTPLRNFVSDYVRMVSVRH  252

Query  739   PFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINL  918
             PFWNRTLGADHFML+CHDW P  S   P L   +IR LCNANTSE FNP+KDVS+PEI+L
Sbjct  253   PFWNRTLGADHFMLACHDWAPRASEGNPLLFNTSIRVLCNANTSEGFNPQKDVSLPEIHL  312

Query  919   PDGTTDGLIGGPPP--TERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSY  1092
               GT    +  PPP  T RP L F+AGGLHGP+RPILL HW+N+D+D++IH YLPK + Y
Sbjct  313   YGGTVSSKLISPPPPNTLRPYLAFFAGGLHGPIRPILLAHWKNRDKDLQIHEYLPKGLDY  372

Query  1093  HGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVE  1272
               M+ KSK+CLCPSGYEVASPR+VEA+Y  CVPV++   Y  PFSDVL W AF+V + V 
Sbjct  373   DSMVLKSKFCLCPSGYEVASPRIVEAIYAECVPVILSEHYALPFSDVLRWEAFSVKVEVS  432

Query  1273  DIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             +I  LK++L  +P+ +Y  L      VR+HFE+N P KRFDVFHMILHSIWLRR+N+R+
Sbjct  433   EISRLKEVLMGVPEEKYRRLVENLRVVRKHFELNQPAKRFDVFHMILHSIWLRRINLRI  491



>ref|XP_011085421.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Sesamum indicum]
Length=410

 Score =   423 bits (1088),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 204/400 (51%), Positives = 278/400 (70%), Gaps = 12/400 (3%)
 Frame = +1

Query  283   LKTLAVYGAKSYTKLEILESGLAQARS----SILRGNQ---LHSDEHYIPSGSIYWNASS  441
             L   ++   +   K+E +E+GL++AR+    +IL+      L  D  Y+P G IY NA  
Sbjct  12    LNQKSIISRRDDKKMERIEAGLSKARAFIKDAILKSRYSPPLAQDTDYVPRGDIYRNAYV  71

Query  442   FHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHV  618
             F RSY+ MEK  K+YVYE+G+ P+ HYGP K IY+ EG F+  ++  +QFRT D D AHV
Sbjct  72    FQRSYMLMEKMFKIYVYEEGEAPLFHYGPSKDIYSTEGIFLGLIESNTQFRTYDADEAHV  131

Query  619   FFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWG  798
             +FLPFSV ++ + ++   + D   ++R   DYV  ++ KYP+WNR+LGADHFMLSCHDWG
Sbjct  132   YFLPFSVVMILQHLFDPVTRDKGVLERVVGDYVHIVSTKYPYWNRSLGADHFMLSCHDWG  191

Query  799   PEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVL  978
             P  +     L   ++R LCNANTSE FNP+KD+S PEINL  G   GL  G   + R +L
Sbjct  192   PRATWYEHHLYFTSMRVLCNANTSEFFNPRKDISFPEINLRTGDLTGLTSGS--SNRTIL  249

Query  979   VFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKN--VSYHGMMRKSKYCLCPSGYEVAS  1152
              F+AG LHG +RP+L QHW++KD D+K++  LP+N  +SY  MM +SKYCLCPSGYEVAS
Sbjct  250   AFFAGRLHGRIRPVLFQHWKDKDSDVKVYERLPENSPLSYKEMMERSKYCLCPSGYEVAS  309

Query  1153  PRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEIL  1332
             PR+VEA+Y  CVPVLI   YV PFSDVL+W  F++ + V ++P LK+IL  I + +Y+ L
Sbjct  310   PRIVEAIYAECVPVLISENYVLPFSDVLDWDKFSIKVSVRELPELKRILMGIGEDEYKAL  369

Query  1333  QRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
              R   +V+RHF VN PPKR+DVFHM++HS+WLRRLN+R++
Sbjct  370   HRGVRQVQRHFVVNDPPKRYDVFHMMIHSLWLRRLNLRIN  409



>ref|XP_009346174.1| PREDICTED: probable glycosyltransferase At5g25310 [Pyrus x bretschneideri]
Length=492

 Score =   426 bits (1096),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 201/359 (56%), Positives = 260/359 (72%), Gaps = 7/359 (2%)
 Frame = +1

Query  394   DEHYIPSGSI-YWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHA  570
             D+   P GS+ Y N  +F++SY EMEK  KVYVY +G PP+ H GPCK IY+IEG FIH 
Sbjct  133   DDVLFPGGSVVYRNPGAFYQSYTEMEKKFKVYVYSEGDPPMTHDGPCKDIYSIEGRFIHE  192

Query  571   MDFS----QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKY  738
             M+      +F+T +P  AHV+F+PFSVT + K +Y   ++D +P++    DYV+ ++ ++
Sbjct  193   MENGAAGRRFKTENPQRAHVYFMPFSVTWMVKYVYKPLTYDLTPLRNFVSDYVRMVSVRH  252

Query  739   PFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINL  918
             PFWNRTLGADHFML+CHDW P  S   P L   +IR LCNANTSE FNP+KDVS+PEI+L
Sbjct  253   PFWNRTLGADHFMLACHDWAPRASEGNPLLFNTSIRVLCNANTSEGFNPQKDVSLPEIHL  312

Query  919   PDGTTDGLIGGPPP--TERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSY  1092
               GT    +  PPP  T RP L F+AGGLHGP+RPILL HW+N+D+D++IH YLPK + Y
Sbjct  313   YGGTVSSKLISPPPPNTLRPYLAFFAGGLHGPIRPILLAHWKNRDKDLQIHEYLPKGLDY  372

Query  1093  HGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVE  1272
               M+ KSK+CLCPSGYEVASPR+VEA+Y  CVPV++   Y  PFSDVL W AF+V + V 
Sbjct  373   DSMVLKSKFCLCPSGYEVASPRIVEAIYAECVPVILSEHYALPFSDVLRWEAFSVKVEVS  432

Query  1273  DIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             +I  LK++L  IP+ +Y  L      VR+HFE+N P KRFDVFHMILHS+WLRR+N+R+
Sbjct  433   EISRLKEVLMGIPEEKYGRLVENLRVVRKHFELNQPAKRFDVFHMILHSVWLRRINLRI  491



>ref|XP_002285237.2| PREDICTED: probable glycosyltransferase At5g25310 [Vitis vinifera]
 emb|CBI21064.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   426 bits (1094),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 209/392 (53%), Positives = 281/392 (72%), Gaps = 12/392 (3%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRG-NQLH-------SDEHYIPSGSIYWNASSFHRSYVEM  465
             K  T+ +  E GLA+AR+SI +  + L+        D + +P+G +Y NA +F++SYVEM
Sbjct  86    KKRTRYQGQEEGLARARASIRKAFSNLNRSSEIGGEDNNEVPTGDVYRNAGAFYQSYVEM  145

Query  466   EKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS--QFRTTDPDSAHVFFLPFSV  639
             EK LKVYVYE+G+ P+ H GPCK IY IEG FIH ++    +FRT D + AHV+F+PFSV
Sbjct  146   EKRLKVYVYEEGEVPMIHDGPCKDIYTIEGRFIHEIEHGDGKFRTRDAERAHVYFMPFSV  205

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
             T + K +Y   +++ +P+++   DYV  I+ KYPFWN T GADHFML+CHDWGP  S   
Sbjct  206   TWMVKYLYKPLTYNLTPLRQFVSDYVSVISTKYPFWNTTQGADHFMLACHDWGPHASRGH  265

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDG--LIGGPPPTERPVLVFYAG  993
             P L   +IR LCNANTSE FNP+KDVS+PEI+L  G  +   L   PP + RP L F+AG
Sbjct  266   PVLYNTSIRVLCNANTSEGFNPQKDVSLPEIHLYGGNVNPKLLSPPPPNSPRPFLAFFAG  325

Query  994   GLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEAL  1173
             GLHGP+RPIL+QHW  +D D++++ YLPK++ Y+ +M +SKYCLCPSG+EVASPR+VEA+
Sbjct  326   GLHGPIRPILIQHWMGRDTDLRVYEYLPKDMDYYSLMLQSKYCLCPSGHEVASPRIVEAI  385

Query  1174  YMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEV  1353
             Y  CVPV++   YV PFSDVL W AF+V +   +IP LK++L  I + +Y  L+     V
Sbjct  386   YSECVPVILSDHYVLPFSDVLRWEAFSVKVEASEIPRLKEVLQAISEEKYTRLKEGVRAV  445

Query  1354  RRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             RRHFE+N P KRFDVFHMILHS+WLRR+N+++
Sbjct  446   RRHFELNQPAKRFDVFHMILHSVWLRRINLKL  477



>ref|XP_006394779.1| hypothetical protein EUTSA_v10004121mg [Eutrema salsugineum]
 gb|ESQ32065.1| hypothetical protein EUTSA_v10004121mg [Eutrema salsugineum]
Length=477

 Score =   425 bits (1093),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 205/392 (52%), Positives = 275/392 (70%), Gaps = 17/392 (4%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQLHSDEHY---IPSGSIYWNASSFHRSYVEMEKTLK  480
             K  ++ +++E GL +AR+SIL          +   +P+  +Y N S+ +RSY+EMEK  K
Sbjct  90    KKLSRRKMVEQGLGKARASILEAASNRDATLFNIDLPNPQVYRNPSALYRSYLEMEKRFK  149

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVLSK  654
             VYVYE+G+ P+AH GPCKS+YA+EG FI  M+   ++FRT DPD AHV+FLPFSVT L +
Sbjct  150   VYVYEEGERPLAHDGPCKSVYAVEGRFITEMEKRKTKFRTYDPDQAHVYFLPFSVTWLVR  209

Query  655   MIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
              +Y  N HD  P++  A DY++ I+  +PFWNRT GADHFML+CHDWGP  S +  DL  
Sbjct  210   YLYEGN-HDAKPLRTFASDYIRLISINHPFWNRTSGADHFMLACHDWGPLTSKANKDLFN  268

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGT-------TDGLIGGPPPTERPVLVFYAG  993
              +IR LCNAN+SE FNP KDV++PE++L  G        +  L+  P    RP L F+AG
Sbjct  269   KSIRVLCNANSSEGFNPTKDVTLPEVSLHGGEVHPQLRFSKTLMASP----RPHLAFFAG  324

Query  994   GLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEAL  1173
             G+HGPVRPILL+HW+ +D D+ +  YLPK+++Y+  MR SK+C CPSGYEVASPR+ EA+
Sbjct  325   GVHGPVRPILLKHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRVTEAI  384

Query  1174  YMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEV  1353
             +  C+PV++   +V PFSDVL W  F+V + V +IP LK+IL  I   +YE L+R    V
Sbjct  385   FSECIPVILSVNFVLPFSDVLRWDTFSVQVDVSEIPRLKEILMSISDEKYEWLKRNLRYV  444

Query  1354  RRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             RRHFE+N PPKRFD FHM LHSIWLRRLN+++
Sbjct  445   RRHFELNDPPKRFDAFHMTLHSIWLRRLNLKL  476



>ref|XP_009355772.1| PREDICTED: probable glycosyltransferase At5g25310 [Pyrus x bretschneideri]
Length=492

 Score =   425 bits (1093),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 203/359 (57%), Positives = 261/359 (73%), Gaps = 7/359 (2%)
 Frame = +1

Query  394   DEHYIPSGSI-YWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHA  570
             D+   P GS+ Y N  +F++SY EMEK  KVYVY +G PP+ H GPCK IY+IEG FIH 
Sbjct  133   DDVLFPGGSVVYRNPGAFYQSYTEMEKKFKVYVYSEGDPPMTHDGPCKDIYSIEGRFIHE  192

Query  571   MDFS----QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKY  738
             M+      +F+T +P  AHV+F+PFSVT + K +Y   ++D +P++    DYV+ ++ ++
Sbjct  193   MENGAAGRRFKTENPQRAHVYFMPFSVTWMVKYLYKPLTYDLTPLRNFVSDYVRMVSVRH  252

Query  739   PFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINL  918
             PFWNRTLGADHFML+CHDW P  S   P L   +IR LCNANTSE FNP+KDVS+PEI+L
Sbjct  253   PFWNRTLGADHFMLACHDWAPRASEGNPLLFNTSIRVLCNANTSEGFNPQKDVSLPEIHL  312

Query  919   PDGTTD-GLIGGPPP-TERPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSY  1092
               GT    LI  PPP T RP L F+AGGLHGP+RPILL HW+N+D+D++IH YLPK + Y
Sbjct  313   YGGTVSPKLISPPPPNTLRPYLAFFAGGLHGPIRPILLAHWKNRDKDLQIHEYLPKGLDY  372

Query  1093  HGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVE  1272
               M+ KSK+CLCPSGYEVASPR+VEA+Y  CVPV++   Y  PFSDVL W AF+V + V 
Sbjct  373   DSMVLKSKFCLCPSGYEVASPRIVEAIYAECVPVILSEHYALPFSDVLRWEAFSVKVEVS  432

Query  1273  DIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             +I  LK++L  +P+ +Y  L      VR+HFE+N P KRFDVFHMILHSIWLRR+N+R+
Sbjct  433   EISRLKEVLMGVPEEKYGRLVENLRVVRKHFELNQPAKRFDVFHMILHSIWLRRINLRI  491



>ref|XP_003549290.1| PREDICTED: probable glycosyltransferase At5g25310-like [Glycine 
max]
Length=482

 Score =   424 bits (1091),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/377 (55%), Positives = 267/377 (71%), Gaps = 6/377 (2%)
 Frame = +1

Query  337   ESGLAQARSSILRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVA  516
             ES   ++  S+    +  S   Y+P+G+IY NA  F+RSY+EMEK  KVYVY DG  P+A
Sbjct  105   ESEGERSNLSVATTARDDSYHRYVPAGAIYRNARLFYRSYLEMEKIFKVYVYPDGDLPIA  164

Query  517   HYGPCKSIYAIEGHFIHAMDFS--QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSP  690
             H GPCK IY+IEG F+H M+    +FRT DP++AHVFFLPFSVT + K +Y   S + +P
Sbjct  165   HDGPCKDIYSIEGRFLHEMEHGAGRFRTNDPNAAHVFFLPFSVTWMVKYLYTPLSFNVTP  224

Query  691   MKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTS  870
             +K+   DYV+ ++ ++PFWN T GADHFML+CHDWGP  S   P L   +IR LCNANTS
Sbjct  225   LKKFVSDYVRVVSTRHPFWNITHGADHFMLACHDWGPHASQGNPFLYNTSIRVLCNANTS  284

Query  871   ERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERP--VLVFYAGGLHGPVRPILLQHWENK  1044
             E FNP+KDVS+PEI+L  G     +  PPP   P   L F++GGLHGP+RP LL HW+N 
Sbjct  285   EGFNPRKDVSLPEIHLYGGEVSPKLLSPPPDTAPRRYLAFFSGGLHGPIRPALLGHWKNH  344

Query  1045  DED--IKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVP  1218
             DE+  I+++ YLPK++ Y+  M  SK+CLCPSG+EVASPR+VEA+Y  CVPV++   YV 
Sbjct  345   DENDVIRVYEYLPKDLDYYSFMLTSKFCLCPSGHEVASPRIVEAIYAECVPVILSEYYVL  404

Query  1219  PFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDV  1398
             PFSDVL W AF+V + V DIP LK+IL+ I + +Y  L+     VRRHF +N P KRFDV
Sbjct  405   PFSDVLQWEAFSVQVDVSDIPRLKEILSAISEDKYRKLKEGVKAVRRHFTLNRPAKRFDV  464

Query  1399  FHMILHSIWLRRLNIRV  1449
             FHMILHSIWLRRLNI +
Sbjct  465   FHMILHSIWLRRLNIEL  481



>ref|XP_003603357.1| hypothetical protein MTR_3g106690 [Medicago truncatula]
 gb|AES73608.1| glycosyltransferase [Medicago truncatula]
Length=393

 Score =   421 bits (1082),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 197/342 (58%), Positives = 255/342 (75%), Gaps = 4/342 (1%)
 Frame = +1

Query  436   SSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD--FSQFRTTDPDS  609
             S ++RSY+EMEK  KVYVY DG  P+ H GPCK IY+ EG F+H M+    +FRT DP++
Sbjct  50    SYYYRSYLEMEKIFKVYVYPDGDLPIVHDGPCKDIYSTEGRFLHEMERGVGKFRTNDPNA  109

Query  610   AHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCH  789
             AHV+FLPFSVT + K +Y  +S+D +P+ +   DYV+ ++ +YPFWNRT GADHFML+CH
Sbjct  110   AHVYFLPFSVTWMVKYLYTPSSYDITPLTQFVSDYVRVVSMRYPFWNRTHGADHFMLACH  169

Query  790   DWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTER  969
             DWGP  S   P L   +IR LCNANTSE FNP KDVS+PEI+L  G     +   PP   
Sbjct  170   DWGPHASKGNPFLYNTSIRVLCNANTSEGFNPLKDVSLPEIHLYGGEVSPKLLSLPPENA  229

Query  970   P--VLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYE  1143
             P   L F+AGG+HGP+RPILLQHW+N+D+DI ++ YLPK + Y+ +M  SK+CLCPSG+E
Sbjct  230   PRRYLAFFAGGMHGPIRPILLQHWKNRDKDILVNEYLPKGIDYYSIMLSSKFCLCPSGFE  289

Query  1144  VASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQY  1323
             VASPR+VE++Y  CVPV++   YV PFSDVL W AF+V + V DIP LK+IL+ IP+++Y
Sbjct  290   VASPRIVESIYAECVPVILSNYYVLPFSDVLQWEAFSVQVDVSDIPRLKEILSAIPESKY  349

Query  1324  EILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             + L++    VRRHF +N P KRFDVFHMILHSIWLRRLNI++
Sbjct  350   KKLKQGVRAVRRHFTLNQPAKRFDVFHMILHSIWLRRLNIKL  391



>ref|XP_006287596.1| hypothetical protein CARUB_v10000808mg [Capsella rubella]
 gb|EOA20494.1| hypothetical protein CARUB_v10000808mg [Capsella rubella]
Length=493

 Score =   424 bits (1091),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 202/390 (52%), Positives = 273/390 (70%), Gaps = 14/390 (4%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHY--------IPSGSIYWNASSFHRSYVEMEKT  474
              ++  +E GLA+AR+SIL  +      H         +P+  IY N S+ HRSY+EMEK 
Sbjct  104   NRINSVERGLAKARASILEASSSSPSSHRNTTLFSIDLPNPEIYRNPSALHRSYLEMEKR  163

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVL  648
              KVYVYE+G+PP+ H GPCKS+YA+EG FI+ M+   ++FRT DP+ A+V+FLPFSVT L
Sbjct  164   FKVYVYEEGEPPLVHDGPCKSVYAVEGRFIYEMERRKARFRTYDPNQAYVYFLPFSVTWL  223

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +Y  NS D  P++    DYV+ ++  +PFWNRT GADHFML+CHDWGP  S +   L
Sbjct  224   VRYLYEGNS-DAKPLRTFVSDYVRLVSTNHPFWNRTNGADHFMLACHDWGPLTSRANKHL  282

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTD---GLIGGPPPTERPVLVFYAGGL  999
                +IR LCNAN+SE FNP KDV++PEI L  G  D    L      + RP L F+AGG+
Sbjct  283   FNTSIRVLCNANSSEGFNPTKDVTLPEIKLVGGEVDPKLRLSATLSASPRPYLAFFAGGV  342

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HGPVRPILL+HW+ +D D+ +  YLPK+++Y+  MR SK+C CPSGYEVASPR++E++Y 
Sbjct  343   HGPVRPILLKHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRVIESIYS  402

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
              C+PV++   +V PF+DVL W  F+V++ V +IP LK+IL  I   +YE L+R    VRR
Sbjct  403   ECIPVILSVNFVLPFTDVLRWETFSVLVDVSEIPRLKEILMSISDEKYEWLKRNLRSVRR  462

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             HFE+N PPKR+D FH+ LHSIWLRRLN+++
Sbjct  463   HFELNDPPKRYDAFHLTLHSIWLRRLNLKL  492



>ref|XP_006856554.1| hypothetical protein AMTR_s00046p00173940 [Amborella trichopoda]
 gb|ERN18021.1| hypothetical protein AMTR_s00046p00173940 [Amborella trichopoda]
Length=505

 Score =   424 bits (1091),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 200/373 (54%), Positives = 271/373 (73%), Gaps = 6/373 (2%)
 Frame = +1

Query  325   LEILESGLAQARSSILRGNQLHSDEHY-----IPSGSIYWNASSFHRSYVEMEKTLKVYV  489
              E +E+ L +AR+SI R  +  +D  Y     +P G++Y N  +F++SY++MEKTLK+++
Sbjct  123   FERVEAQLVRARASIKRAAKFCNDSCYGDDPLVPKGAVYRNPHAFYQSYIDMEKTLKIWI  182

Query  490   YEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSVTVLSKMIYV  666
             Y++G+PP+AHYGP K IY+IEG FIH  +  +QF T+DP+ AH+ F+P SVT + + +Y 
Sbjct  183   YKEGEPPLAHYGPLKYIYSIEGQFIHEFESRNQFITSDPEIAHLHFIPLSVTKMVQTLYP  242

Query  667   ANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIR  846
              N +   P+ RT  DYV+ I+ KYPFWNRT GADHF+LSCHDW P+      DLQ  +IR
Sbjct  243   PNGYGSGPLHRTVSDYVKVISCKYPFWNRTRGADHFILSCHDWAPDALKGNRDLQHNSIR  302

Query  847   ALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPILL  1026
               CNANTSE F+ ++DVS+PEI+L     D LIGGP P+ R VL F+AGG HG +R +LL
Sbjct  303   VFCNANTSEGFDRRRDVSMPEIHLKGWEIDDLIGGPSPSRRTVLAFFAGGEHGYIRSVLL  362

Query  1027  QHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKR  1206
             +HW++KD ++++H YLPK  SY  +M+++K+CLCPSG+EVASPR+VEA+Y GCVPV I  
Sbjct  363   EHWKDKDSEVRVHEYLPKGKSYSKLMKQAKFCLCPSGWEVASPRIVEAIYSGCVPVTISA  422

Query  1207  GYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPK  1386
              Y+ PFSDVL+WS F+V IPV  IP +K IL  I Q +Y  LQRR ++V+ HF +N P K
Sbjct  423   SYILPFSDVLDWSKFSVNIPVSRIPEIKTILKGISQRRYLQLQRRVLQVQHHFVLNRPAK  482

Query  1387  RFDVFHMILHSIW  1425
             RFDV HMILHSIW
Sbjct  483   RFDVIHMILHSIW  495



>ref|XP_003545455.1| PREDICTED: probable glycosyltransferase At5g25310-like [Glycine 
max]
Length=483

 Score =   423 bits (1088),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/358 (57%), Positives = 261/358 (73%), Gaps = 5/358 (1%)
 Frame = +1

Query  391   SDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHA  570
              D  Y+P+G+IY NA  F+RSY+EMEK  KVYVY DG  P+AH GPCK IY+IEG F+H 
Sbjct  125   GDHRYVPAGAIYRNARLFYRSYLEMEKIFKVYVYPDGDLPIAHDGPCKDIYSIEGRFLHE  184

Query  571   MDFS--QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPF  744
             M+    +FRT DP++AHV+FLPFSVT + K +Y   S + +P+K+   DYV+ I+ ++PF
Sbjct  185   MEHGAGRFRTNDPNAAHVYFLPFSVTWMVKYLYTPLSFNVTPLKQFVSDYVRVISTRHPF  244

Query  745   WNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPD  924
             WN T GADHFML+CHDWGP  S   P L   +IR LCNANTSE FNP+KDVS+PEI+L  
Sbjct  245   WNITHGADHFMLACHDWGPHASQGNPFLYNTSIRVLCNANTSEGFNPRKDVSLPEIHLYG  304

Query  925   GTTDGLIGGPPPTERP--VLVFYAGGLHGPVRPILLQHWEN-KDEDIKIHSYLPKNVSYH  1095
             G     +  PPP   P   L F++GGLHGP+RP LL+HW+N  D+DI+++ YLPK++ Y+
Sbjct  305   GEVSPKLLSPPPDTAPRRYLAFFSGGLHGPIRPALLRHWKNDNDDDIRVYEYLPKDLDYY  364

Query  1096  GMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVED  1275
               M  SK+CLCPSG+EVASPR+VEA+Y  CVPV++   YV PFSDVL W AF+V + V D
Sbjct  365   SFMLNSKFCLCPSGHEVASPRIVEAIYAECVPVILSEYYVLPFSDVLQWEAFSVQVDVSD  424

Query  1276  IPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             IP LK+IL+ I + +Y  L+     VR HF +N P KRFDVFHMILHSIWLRRLNI++
Sbjct  425   IPRLKEILSAISEDKYRKLKEGVKAVRGHFTLNRPAKRFDVFHMILHSIWLRRLNIKL  482



>ref|NP_197913.4| Exostosin family protein [Arabidopsis thaliana]
 sp|Q3E7Q9.2|GLYT6_ARATH RecName: Full=Probable glycosyltransferase At5g25310 [Arabidopsis 
thaliana]
 gb|AED93425.1| Exostosin family protein [Arabidopsis thaliana]
Length=480

 Score =   423 bits (1087),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 274/388 (71%), Gaps = 15/388 (4%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQ------LHSDEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
              +  ++E GLA+AR+SIL  +         SD   +P+  IY N S+ +RSY+EMEK  K
Sbjct  96    NRRNLVEQGLAKARASILEASSNVNTTLFKSD---LPNSEIYRNPSALYRSYLEMEKRFK  152

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD--FSQFRTTDPDSAHVFFLPFSVTVLSK  654
             VYVYE+G+PP+ H GPCKS+YA+EG FI  M+   ++FRT DP+ A+V+FLPFSVT L +
Sbjct  153   VYVYEEGEPPLVHDGPCKSVYAVEGRFITEMEKRRTKFRTYDPNQAYVYFLPFSVTWLVR  212

Query  655   MIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
              +Y  NS D  P+K    DY++ ++  +PFWNRT GADHFML+CHDWGP  S +  DL  
Sbjct  213   YLYEGNS-DAKPLKTFVSDYIRLVSTNHPFWNRTNGADHFMLTCHDWGPLTSQANRDLFN  271

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTD---GLIGGPPPTERPVLVFYAGGLHG  1005
              +IR +CNAN+SE FNP KDV++PEI L  G  D    L      + RP L F+AGG+HG
Sbjct  272   TSIRVMCNANSSEGFNPTKDVTLPEIKLYGGEVDHKLRLSKTLSASPRPYLGFFAGGVHG  331

Query  1006  PVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGC  1185
             PVRPILL+HW+ +D D+ ++ YLPK+++Y+  MR SK+C CPSGYEVASPR++EA+Y  C
Sbjct  332   PVRPILLKHWKQRDLDMPVYEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRVIEAIYSEC  391

Query  1186  VPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHF  1365
             +PV++   +V PF+DVL W  F+V++ V +IP LK+IL  I   +YE L+     VRRHF
Sbjct  392   IPVILSVNFVLPFTDVLRWETFSVLVDVSEIPRLKEILMSISNEKYEWLKSNLRYVRRHF  451

Query  1366  EVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             E+N PP+RFD FH+ LHSIWLRRLN+++
Sbjct  452   ELNDPPQRFDAFHLTLHSIWLRRLNLKL  479



>ref|XP_010493785.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Camelina sativa]
Length=487

 Score =   422 bits (1086),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 201/387 (52%), Positives = 273/387 (71%), Gaps = 11/387 (3%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHYI-----PSGSIYWNASSFHRSYVEMEKTLKV  483
              +  ++E GLA+AR+SIL  +    ++  +     P+  IY N S+ HRSY+EMEK  KV
Sbjct  101   NRRNLVEEGLAKARASILEASSSTRNDTTLFKIDLPNPEIYRNPSALHRSYLEMEKRFKV  160

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             YVYE+G+PP+ H GPCKS+YA+EG FI  ++   ++FRT DP  A+V+FLPFSVT L + 
Sbjct  161   YVYEEGEPPLVHDGPCKSVYAVEGRFILELEKRKTRFRTYDPSQAYVYFLPFSVTWLVRY  220

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +Y  NS +  P++    DY++ ++  +PFWNRT GADHFML+CHDWGP  S +  DL   
Sbjct  221   LYEGNS-NAEPLRTFVSDYIRLVSTNHPFWNRTNGADHFMLACHDWGPLTSHANKDLFNT  279

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTD---GLIGGPPPTERPVLVFYAGGLHGP  1008
             +IR +CNAN+SE FNP KDV++PEI L  G  D    L      + RP L F+AGG+HGP
Sbjct  280   SIRVMCNANSSEGFNPAKDVTLPEIKLYGGEVDPKLRLSKTLSASPRPYLGFFAGGVHGP  339

Query  1009  VRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCV  1188
             VRPILL+HW+ +D D+ ++ YLPK+++Y+  MR SK+C CPSGYEVASPR+ EA+Y  C+
Sbjct  340   VRPILLKHWKQRDPDMPVYEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRVTEAIYSECI  399

Query  1189  PVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFE  1368
             PV++   +V PF+DVL W  F+V++ V +IP LK+IL  I   +YE L+R    VRRHFE
Sbjct  400   PVILSVNFVLPFTDVLRWETFSVLVDVSEIPRLKEILMSISDEKYEWLKRNLRSVRRHFE  459

Query  1369  VNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             +N PPKRFD FH+ LHSIWLRRLN+R+
Sbjct  460   LNDPPKRFDAFHLTLHSIWLRRLNLRL  486



>ref|XP_004288781.1| PREDICTED: probable glycosyltransferase At5g20260-like [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   422 bits (1085),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 201/388 (52%), Positives = 272/388 (70%), Gaps = 11/388 (3%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHS-----DEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
             T LE +E  LA+AR+SIL   Q  +     +E +IP GSIY N  +FH+S++EM K  K+
Sbjct  93    TSLERIEEDLAKARASILEAIQSKNYSSEKEESFIPRGSIYKNPYAFHQSHLEMMKRFKM  152

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             + YE+G+ P+ H+GP  +IY IEGHFI  ++   S FR T PD AH+FFLPFSV  + + 
Sbjct  153   WSYEEGEQPLVHFGPMNNIYGIEGHFIDEIEREGSPFRATHPDEAHMFFLPFSVANIVQY  212

Query  658   IY--VANSHDW--SPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPD  825
             +Y  +    D+    +++ A+DY+  +A KYP+WNR+ GADHFM SCHDW PEIS   P+
Sbjct  213   VYLPITKKQDYHRDRLQQIAMDYIGVVAHKYPYWNRSKGADHFMASCHDWAPEISVGKPE  272

Query  826   LQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHG  1005
             L +  IR LCNANTSE F PK+DV +PEI +P G       G  P  R +L F+AG +HG
Sbjct  273   LFRNFIRVLCNANTSEGFQPKRDVPLPEIFVPTGKLGPPNLGQAPNNRQILAFFAGRVHG  332

Query  1006  PVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGC  1185
             P+RPILL+HW++KD ++++H  LPK ++Y  +M +SK+CLCPSG+EVASPR+VEALY GC
Sbjct  333   PIRPILLEHWKDKDNEVRVHEKLPKGMNYTKLMGQSKFCLCPSGFEVASPRVVEALYAGC  392

Query  1186  VPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHF  1365
             VPVLI   Y  PFSDVL+WS F++ +PV  IP +K IL  IP  +Y  +QRR ++V+RHF
Sbjct  393   VPVLISDNYSLPFSDVLDWSQFSIQVPVAKIPEIKTILQAIPNEEYLKMQRRVLKVQRHF  452

Query  1366  EVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
              +N P K FDV HM+LHS+WLRRLN ++
Sbjct  453   VLNKPAKPFDVIHMVLHSVWLRRLNFKI  480



>ref|XP_010421383.1| PREDICTED: probable glycosyltransferase At5g25310 [Camelina sativa]
Length=493

 Score =   422 bits (1086),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 202/389 (52%), Positives = 273/389 (70%), Gaps = 13/389 (3%)
 Frame = +1

Query  319   TKLEILESGLAQARSSIL-------RGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTL  477
              +  ++E GLA+AR+SIL       R N     +  +P+  IY N S+ HRSY+EMEK  
Sbjct  105   NRRNLVEEGLAKARASILEASSSSNRNNTTTLFKIDLPNPEIYRNPSALHRSYLEMEKRF  164

Query  478   KVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVLS  651
             KVYVYE+G+PP+ H GPCKS+YA+EG FI  ++   ++FRT DP  A+V+FLPFSVT L 
Sbjct  165   KVYVYEEGEPPLVHDGPCKSVYAVEGRFITELENRKTRFRTYDPSQAYVYFLPFSVTWLV  224

Query  652   KMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQ  831
             + +Y  NS +  P++    DY++ ++  +PFWNRT GADHFML+CHDWGP  S +  DL 
Sbjct  225   RYLYEGNS-NAEPLRTFVSDYIRLVSTNHPFWNRTSGADHFMLACHDWGPLTSHANKDLF  283

Query  832   KYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPP---PTERPVLVFYAGGLH  1002
               +IR +CNANTSE FNP KDV++PEI L  G  D  +        + RP L F+AGG+H
Sbjct  284   NTSIRVMCNANTSEGFNPAKDVTLPEIKLYGGEVDPKLRSSKTLSASPRPYLGFFAGGVH  343

Query  1003  GPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMG  1182
             GPVRPILL+HW+ +D ++ ++ YLPK+++Y+  MR SK+C CPSGYEVASPR+ EA+Y  
Sbjct  344   GPVRPILLKHWKQRDPEMPVYEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRVTEAIYSE  403

Query  1183  CVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRH  1362
             C+PV++   +V PF+DVL W  F+V++ V +IP LK+IL  I   +YE L+R    VRRH
Sbjct  404   CIPVILSVNFVLPFTDVLRWETFSVLVDVSEIPRLKEILMSISDEKYEWLKRNLRSVRRH  463

Query  1363  FEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             FE+N PPKRFD FH+ LHSIWLRRLN+R+
Sbjct  464   FELNDPPKRFDAFHLTLHSIWLRRLNLRL  492



>ref|XP_008652150.1| PREDICTED: probable glycosyltransferase At5g03795 [Zea mays]
Length=579

 Score =   425 bits (1093),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 217/400 (54%), Positives = 279/400 (70%), Gaps = 23/400 (6%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHS------DEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
              KLE LE GLA+ARS+I+   +         D+ Y+P G +Y NA  FHRSY+EME+ LK
Sbjct  176   VKLERLELGLARARSAIMEAIRKKDKVSPLPDKDYVPMGPVYRNAHVFHRSYLEMERQLK  235

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-------QFRTTDPDSAHVFFLPFSV  639
             VYVYE+G+PPV H GPC+SIY+ EG FIH+M+         + RT DP  AHVFFLPFSV
Sbjct  236   VYVYEEGEPPVFHDGPCRSIYSTEGRFIHSMETETEAEEGRRLRTRDPARAHVFFLPFSV  295

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
               + + IY   S D +P+KRT  DYV+ ++ KYP+WNR+LGADHFMLSCHDWGP +S + 
Sbjct  296   VKMVQTIYEPGSRDMAPLKRTVADYVRVLSSKYPYWNRSLGADHFMLSCHDWGPYVSSAN  355

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
               L   +IR LCNANTSE F+P +DVS+P++NL     +  +GGP  + RPVL F+AGG 
Sbjct  356   AQLFGNSIRVLCNANTSEGFDPARDVSLPQVNLRSDAVERQVGGPSASRRPVLAFFAGGN  415

Query  1000  HGPVRPILLQHW-----ENKDEDIKIHSYLPKNV---SYHGMMRKSKYCLCPSGYEVASP  1155
             HGPVRP LL HW        D D+++  YLP+     SY  MMR+S++CLCP GYEVASP
Sbjct  416   HGPVRPALLAHWGPGGRRGGDPDVRVSEYLPRGGGAPSYADMMRRSRFCLCPGGYEVASP  475

Query  1156  RMVEALYMGCVPVLIKRG-YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEIL  1332
             R+ EALY+GCVPV++  G Y  PF+DVL+W AFA+ + V DIP LK+IL  +   QY  +
Sbjct  476   RLAEALYLGCVPVVVDDGEYALPFADVLDWDAFALRLRVADIPRLKEILAAVSPRQYIRM  535

Query  1333  QRRGVEVRRHFEVN-WPPKRFDVFHMILHSIWLRRLNIRV  1449
             QRR   VRRHF ++  PP+R+D FHMILHS+WLRRLN+R+
Sbjct  536   QRRVRMVRRHFMLHGGPPRRYDAFHMILHSVWLRRLNVRI  575



>ref|XP_010454855.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Camelina sativa]
 ref|XP_010454856.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Camelina sativa]
Length=484

 Score =   422 bits (1084),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 200/388 (52%), Positives = 272/388 (70%), Gaps = 14/388 (4%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHY--------IPSGSIYWNASSFHRSYVEMEKT  474
              + +++E GLA+AR+SIL  +   +  +         +P+  IY N S+ HRSY+EMEK 
Sbjct  95    NRRDLVEEGLAKARASILEASSSSNRNNTTTTLFKIDLPNPDIYRNPSALHRSYLEMEKR  154

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVL  648
              KVYVYE+G+PP+ H GPCKS+YA+EG FI  ++   ++FRT DP  A+V+FLPFSV+ L
Sbjct  155   FKVYVYEEGEPPLVHDGPCKSVYAVEGRFITELEKRKTRFRTYDPSQAYVYFLPFSVSWL  214

Query  649   SKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDL  828
              + +Y  NS +  P++    DY++ ++  +PFWNRT GADHFML+CHDWGP  S +  DL
Sbjct  215   VRYLYEGNS-NAEPLRTFVSDYIRLVSTNHPFWNRTNGADHFMLACHDWGPLTSKANKDL  273

Query  829   QKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTD---GLIGGPPPTERPVLVFYAGGL  999
                +IR +CNAN+SE FNP KDV++PEI L  G  D    L      + RP L F+AGG+
Sbjct  274   FNTSIRVMCNANSSEGFNPAKDVTLPEIKLYGGVVDPKLRLSKTLSASPRPYLGFFAGGV  333

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HGPVRPILL+HW+ +D D+ ++ YLPK+++Y+  MR SK+C CPSGYEVASPR+ EA+Y 
Sbjct  334   HGPVRPILLKHWKQRDPDMPVYEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRVTEAIYS  393

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
              C+PV++   +V PF+DVL W  F+V++ V DIP LK+IL  I   +YE L+R    VRR
Sbjct  394   ECIPVILSVNFVLPFTDVLRWETFSVLVDVSDIPRLKEILMSISDEKYEWLKRNLRSVRR  453

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNI  1443
             HFE+N PPKRFD FH+ LHSIWLRRLN+
Sbjct  454   HFELNDPPKRFDAFHLTLHSIWLRRLNL  481



>ref|XP_011081538.1| PREDICTED: probable glycosyltransferase At5g25310 [Sesamum indicum]
Length=485

 Score =   422 bits (1084),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/381 (53%), Positives = 274/381 (72%), Gaps = 9/381 (2%)
 Frame = +1

Query  334   LESGLAQARSSILRGNQLHS-----DEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYED  498
             LE GLA+AR++IL      +       + I S +IYWN S+F++SY EME+  KVYVY++
Sbjct  104   LEQGLARARAAILDAASATNPSIIIKNNNILSPAIYWNPSAFYQSYKEMERRFKVYVYQE  163

Query  499   GQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVLSKMIYVAN  672
             G+ P+ H GPCK IY+ EG FIH M+   ++F+T++  +AHV+F+PFSVT + K +Y  N
Sbjct  164   GELPIVHDGPCKDIYSSEGRFIHEMEHGNNRFKTSNAQAAHVYFMPFSVTWMVKYLYKPN  223

Query  673   SHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRAL  852
             +++ +P+K    DYV+ I+ K+PFWNRT GADHFMLSCHDWGP+ S     L   +IR L
Sbjct  224   TYNVTPLKAFVSDYVKLISTKHPFWNRTQGADHFMLSCHDWGPKASQGNGLLYNTSIRVL  283

Query  853   CNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTE--RPVLVFYAGGLHGPVRPILL  1026
             CNAN+SE F+P KDVS+PEI+L  G  +  +  PPP+   RP L F+AGG+HGP+RPILL
Sbjct  284   CNANSSEGFDPTKDVSLPEIHLYGGIVNPKLISPPPSNISRPDLAFFAGGIHGPIRPILL  343

Query  1027  QHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKR  1206
             +HW  KD D+ ++ YLPK+  Y+  M +SK+CLCPSGYEVASPR+VEA+Y  C+PV++  
Sbjct  344   KHWRGKDTDLHVYEYLPKDQDYYDSMLRSKFCLCPSGYEVASPRIVEAIYAECIPVILSD  403

Query  1207  GYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPK  1386
              YV PFSDVL W AF++ + + +IP LK+IL  + + +Y  L+     VRRHF +N P K
Sbjct  404   HYVLPFSDVLRWEAFSIQVDISEIPRLKEILVAVSEDEYLRLKEGLRAVRRHFLLNQPVK  463

Query  1387  RFDVFHMILHSIWLRRLNIRV  1449
             RFD+FHMILHS+WLRRLN+RV
Sbjct  464   RFDMFHMILHSVWLRRLNLRV  484



>ref|XP_010050741.1| PREDICTED: probable glycosyltransferase At5g25310 [Eucalyptus 
grandis]
Length=470

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 210/400 (53%), Positives = 285/400 (71%), Gaps = 7/400 (2%)
 Frame = +1

Query  271   TFPYLKTLAVYGAKSYTKLEILESGLAQARSSILRGNQLHSDEHYIPSGSIYWNASSFHR  450
             +F      +V   +   ++  LE GLAQAR++I +  +L +      S ++Y N  +F +
Sbjct  70    SFASATEYSVRKTEKAREVRKLELGLAQARAAIRKAAKLGARPSNGASTAVYRNRRAFIQ  129

Query  451   SYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF----SQFRTTDPDSAHV  618
             SY+EME+  KVYVY +G+PP+ H GPCK IY +EG FIH M+     ++F T DP  AHV
Sbjct  130   SYMEMERRFKVYVYSEGEPPIVHDGPCKDIYTVEGRFIHEMEHGSAAARFGTRDPRRAHV  189

Query  619   FFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWG  798
             +F+PFSVT +   +Y   ++D +P++R   DYVQ+++ KYPFWNRT GADHFM++CHDWG
Sbjct  190   YFMPFSVTRMVTYLYKPPTYDVTPLRRFVADYVQAVSAKYPFWNRTRGADHFMVACHDWG  249

Query  799   PEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGT-TDGLIGGPPP-TERP  972
             P  S     L K +IRALCNAN SE FNP+KDVS+PEI L DG  +  L+  PPP   RP
Sbjct  250   PHASLGDAHLYKNSIRALCNANASEGFNPQKDVSLPEIYLLDGNISPKLLSLPPPHVPRP  309

Query  973   VLVFYAGGLHGPVRPILLQHWENK-DEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVA  1149
             +L F+AGGLHGP+RPILL HW++K D D++++ YLPK++ Y+ ++ +SK+CLCPSG+EVA
Sbjct  310   LLTFFAGGLHGPIRPILLHHWKDKGDPDVRVYGYLPKHLDYYTLILQSKFCLCPSGHEVA  369

Query  1150  SPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEI  1329
             SPR+VEA+Y  CVPV+I   YV PFSDVLNW AF+V + V +IP LK+IL  +P+ +Y  
Sbjct  370   SPRIVEAIYAECVPVIISEHYVLPFSDVLNWDAFSVKVEVSEIPRLKEILKAVPEDEYRR  429

Query  1330  LQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             L++    VRRHF +N P KRFDVFHM+LHSIWLRRLN+ +
Sbjct  430   LRQGLKAVRRHFVLNQPAKRFDVFHMVLHSIWLRRLNLNL  469



>ref|XP_011085420.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Sesamum indicum]
Length=513

 Score =   422 bits (1086),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/400 (51%), Positives = 278/400 (70%), Gaps = 12/400 (3%)
 Frame = +1

Query  283   LKTLAVYGAKSYTKLEILESGLAQARS----SILRGNQ---LHSDEHYIPSGSIYWNASS  441
             L   ++   +   K+E +E+GL++AR+    +IL+      L  D  Y+P G IY NA  
Sbjct  115   LNQKSIISRRDDKKMERIEAGLSKARAFIKDAILKSRYSPPLAQDTDYVPRGDIYRNAYV  174

Query  442   FHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHV  618
             F RSY+ MEK  K+YVYE+G+ P+ HYGP K IY+ EG F+  ++  +QFRT D D AHV
Sbjct  175   FQRSYMLMEKMFKIYVYEEGEAPLFHYGPSKDIYSTEGIFLGLIESNTQFRTYDADEAHV  234

Query  619   FFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWG  798
             +FLPFSV ++ + ++   + D   ++R   DYV  ++ KYP+WNR+LGADHFMLSCHDWG
Sbjct  235   YFLPFSVVMILQHLFDPVTRDKGVLERVVGDYVHIVSTKYPYWNRSLGADHFMLSCHDWG  294

Query  799   PEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVL  978
             P  +     L   ++R LCNANTSE FNP+KD+S PEINL  G   GL  G   + R +L
Sbjct  295   PRATWYEHHLYFTSMRVLCNANTSEFFNPRKDISFPEINLRTGDLTGLTSGS--SNRTIL  352

Query  979   VFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKN--VSYHGMMRKSKYCLCPSGYEVAS  1152
              F+AG LHG +RP+L QHW++KD D+K++  LP+N  +SY  MM +SKYCLCPSGYEVAS
Sbjct  353   AFFAGRLHGRIRPVLFQHWKDKDSDVKVYERLPENSPLSYKEMMERSKYCLCPSGYEVAS  412

Query  1153  PRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEIL  1332
             PR+VEA+Y  CVPVLI   YV PFSDVL+W  F++ + V ++P LK+IL  I + +Y+ L
Sbjct  413   PRIVEAIYAECVPVLISENYVLPFSDVLDWDKFSIKVSVRELPELKRILMGIGEDEYKAL  472

Query  1333  QRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
              R   +V+RHF VN PPKR+DVFHM++HS+WLRRLN+R++
Sbjct  473   HRGVRQVQRHFVVNDPPKRYDVFHMMIHSLWLRRLNLRIN  512



>tpg|DAA59884.1| TPA: hypothetical protein ZEAMMB73_690759, partial [Zea mays]
Length=577

 Score =   425 bits (1092),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 217/400 (54%), Positives = 279/400 (70%), Gaps = 23/400 (6%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHS------DEHYIPSGSIYWNASSFHRSYVEMEKTLK  480
              KLE LE GLA+ARS+I+   +         D+ Y+P G +Y NA  FHRSY+EME+ LK
Sbjct  176   VKLERLELGLARARSAIMEAIRKKDKVSPLPDKDYVPMGPVYRNAHVFHRSYLEMERQLK  235

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS-------QFRTTDPDSAHVFFLPFSV  639
             VYVYE+G+PPV H GPC+SIY+ EG FIH+M+         + RT DP  AHVFFLPFSV
Sbjct  236   VYVYEEGEPPVFHDGPCRSIYSTEGRFIHSMETETEAEEGRRLRTRDPARAHVFFLPFSV  295

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
               + + IY   S D +P+KRT  DYV+ ++ KYP+WNR+LGADHFMLSCHDWGP +S + 
Sbjct  296   VKMVQTIYEPGSRDMAPLKRTVADYVRVLSSKYPYWNRSLGADHFMLSCHDWGPYVSSAN  355

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
               L   +IR LCNANTSE F+P +DVS+P++NL     +  +GGP  + RPVL F+AGG 
Sbjct  356   AQLFGNSIRVLCNANTSEGFDPARDVSLPQVNLRSDAVERQVGGPSASRRPVLAFFAGGN  415

Query  1000  HGPVRPILLQHW-----ENKDEDIKIHSYLPKNV---SYHGMMRKSKYCLCPSGYEVASP  1155
             HGPVRP LL HW        D D+++  YLP+     SY  MMR+S++CLCP GYEVASP
Sbjct  416   HGPVRPALLAHWGPGGRRGGDPDVRVSEYLPRGGGAPSYADMMRRSRFCLCPGGYEVASP  475

Query  1156  RMVEALYMGCVPVLIKRG-YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEIL  1332
             R+ EALY+GCVPV++  G Y  PF+DVL+W AFA+ + V DIP LK+IL  +   QY  +
Sbjct  476   RLAEALYLGCVPVVVDDGEYALPFADVLDWDAFALRLRVADIPRLKEILAAVSPRQYIRM  535

Query  1333  QRRGVEVRRHFEVN-WPPKRFDVFHMILHSIWLRRLNIRV  1449
             QRR   VRRHF ++  PP+R+D FHMILHS+WLRRLN+R+
Sbjct  536   QRRVRMVRRHFMLHGGPPRRYDAFHMILHSVWLRRLNVRI  575



>ref|XP_009151056.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Brassica rapa]
 emb|CDX88169.1| BnaA06g27600D [Brassica napus]
Length=480

 Score =   421 bits (1082),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 204/390 (52%), Positives = 271/390 (69%), Gaps = 18/390 (5%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHY----IPSGSIYWNASSFHRSYVEMEKTLKVY  486
              +   +E GL++AR+SI      + +       +P+  +Y N S+  +SY+EMEK  KVY
Sbjct  95    NRRRTVEVGLSKARASIREAASSNRNATLFSVDLPNAQVYRNPSALSQSYLEMEKRFKVY  154

Query  487   VYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS--QFRTTDPDSAHVFFLPFSVTVLSKMI  660
             VYE+G+PP+ H GPCKS+YA+EG FI  M+ S  +FRT DPD AHV+FLPFSVT L   +
Sbjct  155   VYEEGEPPLVHDGPCKSVYAVEGRFIMEMEKSRTKFRTYDPDQAHVYFLPFSVTWLVTYL  214

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             Y  N +D  P++  A DYV+ I+ K+PFWNRT GADHFML+CHDWGP  S +  DL   +
Sbjct  215   YQYN-YDAEPLRTFASDYVRLISSKHPFWNRTSGADHFMLACHDWGPLTSKANEDLFHKS  273

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGT-------TDGLIGGPPPTERPVLVFYAGGL  999
             IR +CNAN+SE FNP KD ++PEI L  G        +  L+  P    RP L F+AGG+
Sbjct  274   IRVMCNANSSEGFNPAKDATLPEIKLYGGEVHPQLRLSKILMTSP----RPHLAFFAGGV  329

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HGPVRPILL HW+ +D D+ +  YLPK+++Y+  MR SK+C CPSGYEVASPR++EA+Y 
Sbjct  330   HGPVRPILLDHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRLIEAIYS  389

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
              C+PV++   +V PFSD+L W  F+V + V +IP LK+ILT I   +Y+ L+R    VRR
Sbjct  390   ECIPVILSVNFVLPFSDILRWETFSVQVDVSEIPRLKEILTSISDEKYQSLKRNLRYVRR  449

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             HFE+N PPKR+D FHMILHSIWLRRLN+R+
Sbjct  450   HFELNDPPKRYDAFHMILHSIWLRRLNLRL  479



>ref|XP_009151057.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X2 
[Brassica rapa]
Length=478

 Score =   421 bits (1081),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 204/390 (52%), Positives = 271/390 (69%), Gaps = 18/390 (5%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHY----IPSGSIYWNASSFHRSYVEMEKTLKVY  486
              +   +E GL++AR+SI      + +       +P+  +Y N S+  +SY+EMEK  KVY
Sbjct  93    NRRRTVEVGLSKARASIREAASSNRNATLFSVDLPNAQVYRNPSALSQSYLEMEKRFKVY  152

Query  487   VYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS--QFRTTDPDSAHVFFLPFSVTVLSKMI  660
             VYE+G+PP+ H GPCKS+YA+EG FI  M+ S  +FRT DPD AHV+FLPFSVT L   +
Sbjct  153   VYEEGEPPLVHDGPCKSVYAVEGRFIMEMEKSRTKFRTYDPDQAHVYFLPFSVTWLVTYL  212

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             Y  N +D  P++  A DYV+ I+ K+PFWNRT GADHFML+CHDWGP  S +  DL   +
Sbjct  213   YQYN-YDAEPLRTFASDYVRLISSKHPFWNRTSGADHFMLACHDWGPLTSKANEDLFHKS  271

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGT-------TDGLIGGPPPTERPVLVFYAGGL  999
             IR +CNAN+SE FNP KD ++PEI L  G        +  L+  P    RP L F+AGG+
Sbjct  272   IRVMCNANSSEGFNPAKDATLPEIKLYGGEVHPQLRLSKILMTSP----RPHLAFFAGGV  327

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HGPVRPILL HW+ +D D+ +  YLPK+++Y+  MR SK+C CPSGYEVASPR++EA+Y 
Sbjct  328   HGPVRPILLDHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRLIEAIYS  387

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
              C+PV++   +V PFSD+L W  F+V + V +IP LK+ILT I   +Y+ L+R    VRR
Sbjct  388   ECIPVILSVNFVLPFSDILRWETFSVQVDVSEIPRLKEILTSISDEKYQSLKRNLRYVRR  447

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             HFE+N PPKR+D FHMILHSIWLRRLN+R+
Sbjct  448   HFELNDPPKRYDAFHMILHSIWLRRLNLRL  477



>ref|XP_010096418.1| T-complex protein 1 subunit beta [Morus notabilis]
 gb|EXB64089.1| T-complex protein 1 subunit beta [Morus notabilis]
Length=1028

 Score =   437 bits (1124),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 210/379 (55%), Positives = 265/379 (70%), Gaps = 13/379 (3%)
 Frame = +1

Query  298   VYGAKSYTKLEILESGLAQARSSILRGNQLH-----------SDEHYIPSGSIYWNASSF  444
             V   K  + L  LE+ L + R+SI     +            SD  + P G IY N ++F
Sbjct  126   VAKIKLSSSLHKLEARLVEVRASIREAALVARNFTPNSHDSLSDPDFTPKGHIYRNPNAF  185

Query  445   HRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ-FRTTDPDSAHVF  621
             HRSY+EMEK +K+YVYE+G+PPV H GPC+SIY+ EG FIH ++    FRT DP+ A V+
Sbjct  186   HRSYLEMEKLMKIYVYEEGEPPVFHDGPCRSIYSSEGRFIHEIEKGGLFRTRDPNKALVY  245

Query  622   FLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGP  801
             FLPFSV  + + +YV +SHD  PM+R  +DY+  IA K+PFWNR+LGADHFMLSCHDWGP
Sbjct  246   FLPFSVVNMVRYLYVPDSHDTKPMRRVVVDYMNLIAHKHPFWNRSLGADHFMLSCHDWGP  305

Query  802   EISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLV  981
               S  +P L   +IRALCNANTSE F P KDVS PEINL  G   GL GGP P++R +L 
Sbjct  306   STSSFVPHLYHRSIRALCNANTSEGFRPSKDVSFPEINLLTGEVRGL-GGPSPSKRTILA  364

Query  982   FYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRM  1161
             F+AG LHG +R +LL  W+NKD+D++++  LP+ VSY  MM+KSK+CLCPSGYEVASPR+
Sbjct  365   FFAGRLHGYIRYLLLNQWKNKDQDVQVYDQLPRRVSYQDMMKKSKFCLCPSGYEVASPRV  424

Query  1162  VEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRR  1341
             VEA+Y GCVPVLI  GYVPPF+DVLNW +F+V I V DIP +K+IL  I    Y  LQR 
Sbjct  425   VEAIYAGCVPVLISDGYVPPFNDVLNWKSFSVQIKVNDIPKIKEILMGISTRHYSRLQRT  484

Query  1342  GVEVRRHFEVNWPPKRFDV  1398
                V+RHF VN  PKR+D+
Sbjct  485   LKLVQRHFLVNATPKRYDI  503



>ref|XP_006856553.1| hypothetical protein AMTR_s00046p00173420 [Amborella trichopoda]
 gb|ERN18020.1| hypothetical protein AMTR_s00046p00173420 [Amborella trichopoda]
Length=332

 Score =   415 bits (1066),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 190/332 (57%), Positives = 252/332 (76%), Gaps = 1/332 (0%)
 Frame = +1

Query  463   MEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF-SQFRTTDPDSAHVFFLPFSV  639
             MEK LK+++Y++G+PP+AHYGP K IY++EG FIH +D  ++F T DP+ AH+ F+P SV
Sbjct  1     MEKILKIWIYKEGEPPLAHYGPLKYIYSMEGQFIHELDSGNRFITLDPEHAHLHFIPLSV  60

Query  640   TVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSI  819
             T++ + +Y  N +   P+ R   DYV+ I+RKYPFWNRT+G+DHF+LSCHDW P+ S   
Sbjct  61    TMMVQNLYPPNGYGNGPLHRVVSDYVKVISRKYPFWNRTMGSDHFILSCHDWAPDASIGN  120

Query  820   PDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGL  999
              DLQ  +IR  CNANTSE F+P++DVS+PEI+L     DGLIGGP P+ R VL F+AGG 
Sbjct  121   RDLQHNSIRVFCNANTSEGFDPRRDVSMPEIHLKGWEIDGLIGGPSPSRRSVLAFFAGGK  180

Query  1000  HGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYM  1179
             HG +R +LL+HW++KD ++++H YLPK  SY  +M+++K+CLCPSG+EVASPR++EA+Y 
Sbjct  181   HGYIRSVLLEHWKDKDSEVRVHEYLPKGQSYSKLMKQAKFCLCPSGWEVASPRIIEAIYT  240

Query  1180  GCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRR  1359
             GCVPV I   YV PFSDVL+WS F+V IPV  IP ++ IL  I Q +Y  LQRR + V+R
Sbjct  241   GCVPVTISTSYVLPFSDVLDWSKFSVNIPVSRIPEIRTILEGISQRRYLQLQRRVLRVQR  300

Query  1360  HFEVNWPPKRFDVFHMILHSIWLRRLNIRVHH  1455
             HF +N P KRFDV HMILHSIWLRRLN+R  H
Sbjct  301   HFVLNRPAKRFDVIHMILHSIWLRRLNLRHLH  332



>ref|XP_010696519.1| PREDICTED: probable glycosyltransferase At5g25310 [Beta vulgaris 
subsp. vulgaris]
Length=475

 Score =   419 bits (1078),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 258/351 (74%), Gaps = 4/351 (1%)
 Frame = +1

Query  409   PSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF--S  582
             PS  IY N  +F++SY+EME+ LKVYVYE+G  P+ H GPCK IY IEG FIH ++   +
Sbjct  124   PSTFIYRNPRAFYQSYLEMERRLKVYVYEEGDLPIVHDGPCKDIYTIEGRFIHEVEHGAA  183

Query  583   QFRTTDPDSAHVFFLPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLG  762
             +FRT DP+ AH++F+PFSVT + K +Y   S++ +P++    DYV  I+ KY FWNRT G
Sbjct  184   RFRTRDPNHAHIYFMPFSVTWMVKYLYKPMSYNVTPLRHFVSDYVNVISTKYAFWNRTQG  243

Query  763   ADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTD-G  939
             ADHFML+CHDWGP  S   P+L   +IR LCNAN+SE FNP+KDVS+PEI+L DG     
Sbjct  244   ADHFMLACHDWGPHASSGNPNLYNNSIRVLCNANSSEGFNPQKDVSLPEIHLYDGNISPK  303

Query  940   LIGGPPPTE-RPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSK  1116
             L+  PP T  RP L F+AGGLHGP+RPILL  W+ +D D+++H YLPK++ Y+ MM +SK
Sbjct  304   LLSIPPQTSPRPYLAFFAGGLHGPIRPILLNQWKGRDPDLQVHEYLPKDLDYYTMMLQSK  363

Query  1117  YCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKI  1296
             +CLCPSG+EVASPR+VEA+Y  CVPV++ + YV PFSDVL W AF++ + V +IP LK+I
Sbjct  364   FCLCPSGHEVASPRLVEAIYAECVPVILSKNYVLPFSDVLKWEAFSIEVDVSEIPRLKEI  423

Query  1297  LTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             L  +P  +Y  L      VR HF +N P KRFDVFHMILHS+WLRRLN+++
Sbjct  424   LRAVPDEKYRRLIEGIRAVREHFVLNRPAKRFDVFHMILHSVWLRRLNLKL  474



>ref|XP_010418150.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=423

 Score =   415 bits (1067),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 203/393 (52%), Positives = 270/393 (69%), Gaps = 12/393 (3%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRGNQLHS---------DEHYIPSGSIYWNASSFHRSY  456
             G  S+ +   +E+ LA AR+ ++R  QL+S         D+ YIP G IY N  +FHRSY
Sbjct  31    GHGSWKRDVKVEAELATARA-LIREAQLNSNATSSSPLGDKDYIPHGDIYRNPYAFHRSY  89

Query  457   VEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAM--DFSQFRTTDPDSAHVFFLP  630
             + MEK  K+YVYE+G PP+ HYG CK IY++EG F++ M  D  ++RT DPD AHV+FLP
Sbjct  90    LLMEKIFKIYVYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLP  149

Query  631   FSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEIS  810
             FSV ++   ++     D + ++R   DY+Q I++KYP+WN + G DHFMLSCHDWG   +
Sbjct  150   FSVVMILHHLFDPVVRDKAVLERVIADYIQIISKKYPYWNTSDGFDHFMLSCHDWGHRAT  209

Query  811   GSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYA  990
               +  L   +IR LCNAN SE FNP+KD   PEINL  G  + L GG  PT R  L F+A
Sbjct  210   WYVKKLFFNSIRVLCNANISEYFNPEKDAPFPEINLLTGEINNLTGGLDPTSRTTLAFFA  269

Query  991   GGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             G  HG +RP+LL HW+ KD+DI ++  LP  + Y  MMRKS++C+CPSG+EVASPR+ EA
Sbjct  270   GKSHGKIRPVLLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEA  329

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
             +Y GCVPVLI   YV PFSDVLNW  F+V + V++IP LK+IL DIP+ +Y  L     +
Sbjct  330   IYSGCVPVLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYMRLYEGVKK  389

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             V+RH  VN PPKR+DVF+MI+HSIWLRRLN+++
Sbjct  390   VKRHILVNDPPKRYDVFNMIIHSIWLRRLNVKL  422



>ref|XP_010489710.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=459

 Score =   416 bits (1070),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 205/393 (52%), Positives = 268/393 (68%), Gaps = 12/393 (3%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRGNQLHS---------DEHYIPSGSIYWNASSFHRSY  456
             G  S+ +   +E+ LA AR+ ++R  QL+S         DE YIP G IY N  +FHRSY
Sbjct  67    GHGSWKRDGRVEAELATARA-LIREAQLNSNSTSSSPLGDEEYIPHGDIYRNPYAFHRSY  125

Query  457   VEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAM--DFSQFRTTDPDSAHVFFLP  630
             + MEK  K+YVYE+G PP+ HYG CK IY++EG F++ M  D  ++RT DPD AHVFFLP
Sbjct  126   LLMEKIFKIYVYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVFFLP  185

Query  631   FSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEIS  810
             FSV ++   ++     D + ++R   DYVQ I++KYP+WN + G DHFMLSCHDWG   +
Sbjct  186   FSVVMILHHLFDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRAT  245

Query  811   GSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYA  990
               +  L   +IR LCNAN SE FNP+KD   PEINL  G    L GG  P  R  L F+A
Sbjct  246   WYVKKLFFNSIRVLCNANISEYFNPEKDAPFPEINLLTGEIKNLTGGLDPISRTTLAFFA  305

Query  991   GGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             G  HG +RP+LL HW+ KD+DI ++  LP  + Y  MMRKS++C+CPSG+EVASPR+ EA
Sbjct  306   GKSHGKIRPVLLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEA  365

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
             +Y GCVPVLI   YV PFSDVLNW  F+V + V++IP LK+IL DIP+ +Y  L     +
Sbjct  366   IYSGCVPVLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYLRLYEGVKK  425

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             V+RH  VN PPKR+DVF+MI+HSIWLRRLN+++
Sbjct  426   VKRHILVNDPPKRYDVFNMIIHSIWLRRLNVKL  458



>ref|XP_008443936.1| PREDICTED: probable glycosyltransferase At5g20260 [Cucumis melo]
Length=480

 Score =   417 bits (1071),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/394 (51%), Positives = 273/394 (69%), Gaps = 9/394 (2%)
 Frame = +1

Query  301   YGAKSYTKLEILESGLAQARSSI-----LRGNQLHSDEHYIPSGSIYWNASSFHRSYVEM  465
             Y +    K E++E GLA+AR++I      R      +E +IP G +Y NA +FH+S++EM
Sbjct  87    YSSTRKKKSEMIEEGLAEARAAIRQAIVTRNYTSEKEESFIPRGRVYRNAYAFHQSHIEM  146

Query  466   EKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSV  639
             +K LK++ Y++G+ P+ H GP K IY+IEGHFI  MD   S F   DP+ AHVFFLP S+
Sbjct  147   KKRLKIWTYKEGEQPLVHDGPMKHIYSIEGHFIDEMDSGKSPFSAHDPEEAHVFFLPISI  206

Query  640   TVLSKMIYV-ANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGS  816
               +   IY    ++    + R   DYV+ +A KYP+WNRT GADHFM+SCHDW PE++  
Sbjct  207   VYIVDYIYKPITTYARDRLVRIFTDYVRVVANKYPYWNRTRGADHFMVSCHDWAPEVTKE  266

Query  817   IPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGL-IGGPPPTERPVLVFYAG  993
              P+L KY IR LCNANTSE FNP +D S+PEINLP      L   G PP  R +L F+AG
Sbjct  267   DPNLFKYFIRVLCNANTSEGFNPMRDASLPEINLPPTFHLNLPRSGQPPQNRSILAFFAG  326

Query  994   GLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEAL  1173
             G HG +R +L+QHW++KD++I++H YLP   +Y  ++ +SK+CLCPSGYEVASPR+VEA+
Sbjct  327   GAHGFIRHVLMQHWKDKDDEIQVHEYLPPAKNYTELIDRSKFCLCPSGYEVASPRLVEAI  386

Query  1174  YMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEV  1353
             + GCVPV+I   Y  PF DVL+WS F++ IP E IP +KKIL  +   +Y  LQR  ++V
Sbjct  387   HGGCVPVIISDYYSLPFDDVLDWSKFSMRIPSERIPEIKKILRGVSMKKYLKLQRGVMKV  446

Query  1354  RRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVHH  1455
             +RHFE++ P K FD+FHM+LHS+WLRRLN+++ H
Sbjct  447   QRHFEIHRPAKAFDMFHMVLHSVWLRRLNVKLTH  480



>ref|XP_010464397.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=474

 Score =   417 bits (1071),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/393 (52%), Positives = 269/393 (68%), Gaps = 12/393 (3%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRGNQLHS---------DEHYIPSGSIYWNASSFHRSY  456
             G  S+ +   +E+ LA AR+ ++R  QL+S         DE YIP G IY N  +FHRSY
Sbjct  82    GHGSWKRDGKVEAELATARA-LIREAQLNSHATSSSPLGDEDYIPHGDIYRNPYAFHRSY  140

Query  457   VEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAM--DFSQFRTTDPDSAHVFFLP  630
             + MEK  K+YVYE+G PP+ HYG CK IY++EG F++ M  D  ++RT DPD AHV+FLP
Sbjct  141   LLMEKIFKIYVYEEGDPPIFHYGICKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLP  200

Query  631   FSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEIS  810
             FSV ++   ++     D + ++R   DYVQ I++KYP+WN + G DHFMLSCHDWG   +
Sbjct  201   FSVVMILHHLFDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRAT  260

Query  811   GSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYA  990
               +  L   +IR LCNAN SE FNP+KD   PEINL  G  + L GG  P  R  L F+A
Sbjct  261   WYVKKLFFNSIRVLCNANISEYFNPEKDAPFPEINLMTGEINNLTGGLDPISRTTLAFFA  320

Query  991   GGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             G  HG +RP+LL HW+ KD+DI ++  LP  + Y  MMRKS++C+CPSG+EVASPR+ EA
Sbjct  321   GKSHGKIRPVLLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEA  380

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
             +Y GCVPVLI   YV PFSDVLNW  F+V + V++IP LK+IL DIP+ +Y  L     +
Sbjct  381   IYSGCVPVLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYMRLYEGVKK  440

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             V+RH  VN PPKR+DVF+MI+HSIWLRRLN+++
Sbjct  441   VKRHILVNDPPKRYDVFNMIIHSIWLRRLNVKL  473



>emb|CDX80499.1| BnaC07g29450D [Brassica napus]
Length=482

 Score =   417 bits (1071),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/392 (52%), Positives = 272/392 (69%), Gaps = 21/392 (5%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRGNQLHSDEHY------IPSGSIYWNASSFHRSYVEMEKTLK  480
              +  ++E GL++AR+SI R     S+ +       +P+  +Y N S+ H+SY+EMEK  K
Sbjct  96    NRRRMVEVGLSKARASI-REAGASSNRNATLFNVDLPNAQVYRNPSALHQSYLEMEKRFK  154

Query  481   VYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFS--QFRTTDPDSAHVFFLPFSVTVLSK  654
             VYVYE+G+PP+ H GPCKS+YA+EG FI  M+ S  +FRT DPD AHV+FLPFSVT L  
Sbjct  155   VYVYEEGEPPLVHDGPCKSVYAVEGRFIMEMEKSRTKFRTHDPDKAHVYFLPFSVTWLVT  214

Query  655   MIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
              +Y  N+ D  P++  A DYV+ I+ K+PFWNRT GADHFML+CHDWGP  S +  DL  
Sbjct  215   NLY-DNNFDVEPLRTFASDYVRLISSKHPFWNRTSGADHFMLACHDWGPLTSKANEDLFS  273

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGT-------TDGLIGGPPPTERPVLVFYAG  993
              +IR +CNAN+SE FNP KD ++PEI L  G        +  L+  P    RP L F+AG
Sbjct  274   KSIRVMCNANSSEGFNPAKDATLPEIKLYGGEVHPQLRLSKTLMTSP----RPHLAFFAG  329

Query  994   GLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEAL  1173
             G+HGPVRPILL HW+ +D D+ +  YLPK+++Y+  MR SK+C CPSGYEVASPR++EA+
Sbjct  330   GVHGPVRPILLDHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRLIEAI  389

Query  1174  YMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEV  1353
             Y  C+PV++   +V PFSD+L    F+V + V +IP LK+IL  I   +Y+ L+R    V
Sbjct  390   YSECIPVILSVNFVLPFSDILRLETFSVQVDVSEIPRLKEILMSISDEKYQSLKRNLRYV  449

Query  1354  RRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             RRHFE+N PPKR+D FHM LHSIWLRRLN+R+
Sbjct  450   RRHFELNDPPKRYDAFHMTLHSIWLRRLNLRL  481



>ref|XP_003550809.2| PREDICTED: probable glycosyltransferase At3g42180-like [Glycine 
max]
Length=460

 Score =   416 bits (1068),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/394 (52%), Positives = 267/394 (68%), Gaps = 13/394 (3%)
 Frame = +1

Query  307   AKSYTKLEILESGLAQARSSI----LRGNQLHS--DEHYIPSGSIYWNASSFHRSYVEME  468
             +K  T  +++E GLA+AR+SI    L  N  +S   EH+IP GSIY N  +FH+S++EM 
Sbjct  63    SKKRTSFDVVEEGLAKARASIREAILYRNHSNSGKQEHFIPKGSIYRNPHAFHQSHMEMV  122

Query  469   KTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ---FRTTDPDSAHVFFLPFSV  639
             K  KV+VYE+G+ P+ HYGP   IYAIEG FI  +D S+   F+  +PD AH FFLP SV
Sbjct  123   KRFKVWVYEEGEQPLVHYGPVNDIYAIEGQFIDEIDNSKRSPFKARNPDEAHAFFLPLSV  182

Query  640   TVLSKMIY----VANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEI  807
               +   +Y      N +    ++R   DY+  +A KYP+WNR+ GADHF+LSCHDW PEI
Sbjct  183   VNVVHYVYKPYMSQNDYSRDRLQRLVEDYIGVVADKYPYWNRSNGADHFLLSCHDWAPEI  242

Query  808   SGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFY  987
             S + PDL K  IR LCNAN SE F PK+DVSIPE+ LP G       G  P  R +L F+
Sbjct  243   SHANPDLFKNFIRVLCNANNSEGFQPKRDVSIPEVYLPVGKLGPPNLGQHPMNRTILAFF  302

Query  988   AGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVE  1167
             +GG HG +R +LL+HW++KD  +++H YLPK  +Y  +M  SK+CLCPSGYEVASPR+VE
Sbjct  303   SGGAHGDIRKLLLKHWKDKDNHVQVHEYLPKGQNYTELMGLSKFCLCPSGYEVASPRVVE  362

Query  1168  ALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGV  1347
             A+  GCVPV+I   Y  PFSDVLNWS F++ I VE+I ++K IL ++ Q +Y+ L R   
Sbjct  363   AINAGCVPVIISENYSLPFSDVLNWSQFSIQISVENISDIKTILQNVTQKKYKKLHRNVR  422

Query  1348  EVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
              V+RHF +N P K FD+ HMILHSIWLRRLN RV
Sbjct  423   RVQRHFVMNRPAKPFDLMHMILHSIWLRRLNFRV  456



>ref|XP_004138850.1| PREDICTED: probable glycosyltransferase At5g25310-like [Cucumis 
sativus]
 ref|XP_004172108.1| PREDICTED: probable glycosyltransferase At5g25310-like [Cucumis 
sativus]
 gb|KGN62965.1| hypothetical protein Csa_2G382390 [Cucumis sativus]
Length=465

 Score =   416 bits (1068),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/386 (53%), Positives = 269/386 (70%), Gaps = 9/386 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRG----NQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVY  486
             ++ E LE GLAQAR+SI +     N   S   YIPS S+Y N  +F++SYVEMEK  KVY
Sbjct  79    SREEKLELGLAQARASIRKAANDSNLSTSSIDYIPSSSVYHNPRAFYQSYVEMEKRFKVY  138

Query  487   VYEDGQPPVAHYGPCKSIYAIEGHFIHAMD--FSQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             VY +G+ P+ H GPCK+IY IEG FIH M+   + FRT DP  AHV F+PFSV  + K +
Sbjct  139   VYPEGELPITHAGPCKNIYTIEGRFIHEMEDGGNGFRTVDPSRAHVLFMPFSVAWMVKYL  198

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             Y   S+D +P++    DYV+ +++KYPFWN+T GADHF+L+CHDWGP  +     L   +
Sbjct  199   YKDGSYDQTPLRMFVSDYVEVVSKKYPFWNKTNGADHFILACHDWGPIATEGNRFLYNTS  258

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDG--LIGGPPPTERPVLVFYAGGLHGPVR  1014
             IR LCNAN+SE FNP+KDVS+PEI+L DG      L        RP L F+AGGLHGP+R
Sbjct  259   IRVLCNANSSEGFNPQKDVSLPEIHLYDGEISPKLLSASNSHHHRPHLAFFAGGLHGPIR  318

Query  1015  PILLQHWENKDE-DIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             PILL HW+N+   +I ++ YLPK + Y+  M +S++CLCPSGYEVASPR+VEA+Y  CVP
Sbjct  319   PILLNHWKNRTHTNIHVYEYLPKQLDYYDEMLQSRFCLCPSGYEVASPRIVEAIYAECVP  378

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             V+I   YV PFSDVL W  F++ + V +IP L++IL  + + +YE L +    VR+HF +
Sbjct  379   VIISERYVLPFSDVLRWEGFSIEVSVSEIPRLEEILMGVSEERYEKLIQGLRTVRKHFVL  438

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRV  1449
             N P KRFD FHMILHS+WLRRLN+++
Sbjct  439   NRPAKRFDAFHMILHSVWLRRLNVKL  464



>ref|XP_008242869.1| PREDICTED: probable glycosyltransferase At3g42180 [Prunus mume]
Length=407

 Score =   413 bits (1061),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 201/393 (51%), Positives = 268/393 (68%), Gaps = 11/393 (3%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSIL-----RGNQLHSDEHYIPSGSIYWNASSFHRSYVEME  468
             G K+ T LE +E  LAQAR++I      R  +    E +IP GSIY N  +FH+S++EM 
Sbjct  7     GHKNKTSLERIEEDLAQARAAIREAIQSRNYKSERTETFIPRGSIYKNPYAFHQSHIEMR  66

Query  469   KTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ--FRTTDPDSAHVFFLPFSVT  642
             K  KV+ Y++G+ P+ H GP  +IY IEGHFI  ++  +  FR T PD AH FFLP SV 
Sbjct  67    KMFKVWSYKEGELPLVHIGPMTNIYGIEGHFIDEIEREESPFRATHPDQAHTFFLPVSVA  126

Query  643   VLSKMIY--VANSHDW--SPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEIS  810
              + + +Y  +    D+    ++R  +DY+  +ARKYP+WNR+ GADHFM SCHDWGPEIS
Sbjct  127   NIVEYVYLPITRKQDYYRDRLQRIVVDYIGVVARKYPYWNRSHGADHFMASCHDWGPEIS  186

Query  811   GSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYA  990
                P+L K  IR LCNANTSE F P++DV +PEI +P         G PP  RP+L F+A
Sbjct  187   VGQPELFKNFIRVLCNANTSEGFQPRRDVPLPEIYVPSRKLGPPYFGQPPNNRPILAFFA  246

Query  991   GGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             G +HG +RPILL +W++KD+++++H  LP + +Y  +M KSKYCLCPSG+EVASPR+VEA
Sbjct  247   GRVHGSIRPILLDNWKDKDDEVQVHEKLPLDQNYTKLMGKSKYCLCPSGFEVASPRVVEA  306

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
              Y GCVPVLI   Y  PFSDVLNWS F++ IPV  IP +K IL  IP  +Y  +Q+R  +
Sbjct  307   FYAGCVPVLISDNYTLPFSDVLNWSQFSIQIPVAKIPEIKTILQGIPYEKYLRMQKRVSK  366

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             V+RHF +N P + FDV HM+LHS+WLRRLN ++
Sbjct  367   VKRHFVLNRPSQPFDVIHMVLHSVWLRRLNSKL  399



>ref|XP_003542647.2| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
[Glycine max]
Length=525

 Score =   417 bits (1072),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 208/392 (53%), Positives = 263/392 (67%), Gaps = 12/392 (3%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQL-----HSDEHYIPSGSIYWNASSFHRSYVEMEKT  474
             K Y  L+ +E GLA+AR+SI    +       + E  +P  SIYWNA +FH+S  EM K 
Sbjct  130   KKYPSLDKIEEGLARARASIRESARFINYTSPTREKIVPKRSIYWNARAFHQSQKEMLKR  189

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD----FSQFRTTDPDSAHVFFLPFSVT  642
              KV+VYE+G+ P+ HYGP  +IY+IEG FI  MD    +S FR  +P+ AHVF +PFS+ 
Sbjct  190   FKVWVYEEGEQPLVHYGPVNNIYSIEGQFIDEMDNYHKWSHFRARNPNQAHVFLIPFSIV  249

Query  643   VLSKMIYVANSHDWSPMKRTAL--DYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGS  816
              + + +Y  N           L  DY++ IA KYP+WNRT GADHF+LSCHDWGP IS +
Sbjct  250   NIVQYVYNRNLRQPGSQSIQLLVEDYIRVIAHKYPYWNRTEGADHFLLSCHDWGPTISYA  309

Query  817   IPDLQKYAIRALCNANTSERFNPKKDVSIPEINL-PDGTTDGLIGGPPPTERPVLVFYAG  993
              P L K  IR LCNANTSE F P KDVSIPE+NL P GT      G  P +R +L F+AG
Sbjct  310   NPKLFKNFIRVLCNANTSEGFRPNKDVSIPEVNLLPRGTLGSPNRGQHPNDRTILAFFAG  369

Query  994   GLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEAL  1173
               HG +R ILL HW++KD D++I+  LPK   Y  +M +SK+CLCPSGYEVASPR+VEA+
Sbjct  370   REHGAIRTILLNHWKDKDNDVQIYESLPKGKVYTKLMGQSKFCLCPSGYEVASPRVVEAI  429

Query  1174  YMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEV  1353
             Y GCVPVLI   Y PPF+DVLNWS F+V IPVE IP +K IL  +   +Y  LQ   + V
Sbjct  430   YAGCVPVLISSSYSPPFTDVLNWSQFSVEIPVEKIPEIKTILQSVSPKKYLKLQMNVLRV  489

Query  1354  RRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             +RHF +N P K FD+ HMILHSIWLRRLN+++
Sbjct  490   QRHFTINRPAKPFDLMHMILHSIWLRRLNLKL  521



>ref|XP_009802043.1| PREDICTED: probable glycosyltransferase At5g25310 [Nicotiana 
sylvestris]
Length=484

 Score =   416 bits (1068),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 202/380 (53%), Positives = 265/380 (70%), Gaps = 5/380 (1%)
 Frame = +1

Query  322   KLEILESGLAQARSSILRGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDG  501
             K++  E GLA+AR +I +   +  ++  I +G IY N  +F++SY EME+  K YVYEDG
Sbjct  106   KVDKKEEGLARARGAIRKAAGVR-NQSIINTGGIYRNPGAFYQSYKEMERRFKAYVYEDG  164

Query  502   QPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVLSKMIYVANS  675
                + H GPCK IYA EG FI  M+   S+FRT DP SAHV+F+PFSVT + K +Y   S
Sbjct  165   DFIIVHNGPCKDIYASEGRFISEMEHGNSKFRTRDPHSAHVYFMPFSVTWMVKFLYKPLS  224

Query  676   HDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALC  855
             ++ +P+K    DYV+ I+ KYPFWN+T GADHFMLSCHDW P  S     L   +IR LC
Sbjct  225   YNVTPLKEFVSDYVRLISTKYPFWNQTHGADHFMLSCHDWAPLASKGNDFLYNTSIRVLC  284

Query  856   NANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTE--RPVLVFYAGGLHGPVRPILLQ  1029
             NAN+SE FNP+KDVS+PEI L +G     +  PPP    RP L F+AGGLHG +R  L +
Sbjct  285   NANSSEGFNPQKDVSLPEIYLYNGGVSPKLQSPPPANISRPYLGFFAGGLHGDIRKNLFE  344

Query  1030  HWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRG  1209
             HW+ KD D++++ YLPK++ Y   + +SK+CLCPSGYEVASPR VEA+Y  CVPV++   
Sbjct  345   HWKGKDSDLRVYEYLPKDMDYPSELLRSKFCLCPSGYEVASPRAVEAIYAECVPVMLSDH  404

Query  1210  YVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKR  1389
             YV PFSDVLNW AF++ + + DIP LK+IL  +P+ +Y  L+     VR+HFE+N P  +
Sbjct  405   YVFPFSDVLNWDAFSIQVNISDIPRLKEILLAVPEDKYMKLKEGLRAVRKHFELNRPALK  464

Query  1390  FDVFHMILHSIWLRRLNIRV  1449
             FDVFHMILHSIWLRRLN+R+
Sbjct  465   FDVFHMILHSIWLRRLNLRL  484



>gb|KHN47101.1| Putative glycosyltransferase [Glycine soja]
Length=525

 Score =   416 bits (1070),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 208/392 (53%), Positives = 263/392 (67%), Gaps = 12/392 (3%)
 Frame = +1

Query  310   KSYTKLEILESGLAQARSSILRGNQLHS-----DEHYIPSGSIYWNASSFHRSYVEMEKT  474
             K Y  L+ +E GLA+AR+SI    +  +      E  +P  SIYWNA +FH+S  EM K 
Sbjct  130   KKYPSLDKIEEGLARARASIRESARFINYTSPMREKIVPKRSIYWNARAFHQSQKEMLKR  189

Query  475   LKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD----FSQFRTTDPDSAHVFFLPFSVT  642
              KV+VYE+G+ P+ HYGP  +IY+IEG FI  MD    +S FR  +P+ AHVF +PFS+ 
Sbjct  190   FKVWVYEEGEQPLVHYGPVNNIYSIEGQFIDEMDNYHKWSHFRARNPNQAHVFLIPFSIV  249

Query  643   VLSKMIYVANSHDWSPMKRTAL--DYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGS  816
              + + +Y  N           L  DY++ IA KYP+WNRT GADHF+LSCHDWGP IS +
Sbjct  250   NIVQYVYNRNLRQPGSQSIQLLVEDYIRVIAHKYPYWNRTEGADHFLLSCHDWGPTISYA  309

Query  817   IPDLQKYAIRALCNANTSERFNPKKDVSIPEINL-PDGTTDGLIGGPPPTERPVLVFYAG  993
              P L K  IR LCNANTSE F P KDVSIPE+NL P GT      G  P +R +L F+AG
Sbjct  310   NPKLFKNFIRVLCNANTSEGFRPNKDVSIPEVNLLPRGTLGSPNRGQHPNDRTILAFFAG  369

Query  994   GLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEAL  1173
               HG +R ILL HW++KD D++I+  LPK   Y  +M +SK+CLCPSGYEVASPR+VEA+
Sbjct  370   REHGAIRTILLNHWKDKDNDVQIYESLPKGKVYTKLMGQSKFCLCPSGYEVASPRVVEAI  429

Query  1174  YMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEV  1353
             Y GCVPVLI   Y PPF+DVLNWS F+V IPVE IP +K IL  +   +Y  LQ   + V
Sbjct  430   YAGCVPVLISSSYSPPFTDVLNWSQFSVEIPVEKIPEIKTILQSVSPKKYLKLQMNVLRV  489

Query  1354  RRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             +RHF +N P K FD+ HMILHSIWLRRLN+++
Sbjct  490   QRHFTINRPAKPFDLMHMILHSIWLRRLNLKL  521



>ref|XP_008336982.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At3g42180 [Malus domestica]
Length=404

 Score =   412 bits (1059),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 200/394 (51%), Positives = 267/394 (68%), Gaps = 11/394 (3%)
 Frame = +1

Query  307   AKSYTKLEILESGLAQARSSILRGNQL-----HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
              K  T L+ +E GLA+AR++IL   Q        +E +IP G+IY N  +FH+S+VEM K
Sbjct  11    TKGKTSLDTIEEGLAKARAAILEAIQFKKYASQKNETFIPRGTIYKNPYAFHQSHVEMMK  70

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ--FRTTDPDSAHVFFLPFSVTV  645
               KV+ Y++G+ P+ H+GP   IY IEG FI  ++  +  FR T PD AH FFLPFSV  
Sbjct  71    RFKVWSYKEGEHPLIHFGPVNDIYGIEGQFIDEIEREESPFRATHPDEAHTFFLPFSVAN  130

Query  646   LSKMIY--VANSHDW--SPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISG  813
             + + ++  +    D+    ++R   DY+  +A KYP+WNR+ GADHFM SCHDW PE+S 
Sbjct  131   VVRYVHMPITRKQDYHRDRLQRVVTDYISVVADKYPYWNRSNGADHFMASCHDWAPEVSI  190

Query  814   SIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAG  993
               P+L K  IR LCNANTSE F  K+DVS+P I LP G  D    G  P  RP+L F+AG
Sbjct  191   ENPELFKNFIRVLCNANTSEGFXLKRDVSLPXIYLPKGNLDPPNLGQAPKSRPILAFFAG  250

Query  994   GLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEAL  1173
              +HGPVRPILL HW++KD++++++  LPK ++Y   M +SK+CLCPSG+EVASPR+VEA+
Sbjct  251   RVHGPVRPILLDHWKDKDDEVQVYEKLPKGLNYTKFMGQSKFCLCPSGFEVASPRIVEAI  310

Query  1174  YMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEV  1353
             Y GCVPVLI   Y   FSDVL+WS F+V IPV+ IP +K IL  IP  +Y  +Q+R   V
Sbjct  311   YAGCVPVLISDNYTLLFSDVLDWSKFSVQIPVDKIPEIKTILQAIPFDKYLKMQKRVYRV  370

Query  1354  RRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVHH  1455
             RRHF +N P K FDV HM+LHS+WLRRLN ++ +
Sbjct  371   RRHFVLNXPSKPFDVIHMVLHSVWLRRLNFKLEN  404



>ref|XP_009124266.1| PREDICTED: probable glycosyltransferase At3g07620 [Brassica rapa]
Length=460

 Score =   414 bits (1064),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 201/393 (51%), Positives = 269/393 (68%), Gaps = 12/393 (3%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRGNQLH---------SDEHYIPSGSIYWNASSFHRSY  456
             G+ S+ + + +E+ LA AR+ ++R  QL+          DE Y+P G IY N  +FHRSY
Sbjct  68    GSLSWKRDKKVEAELATARA-LIREAQLNPNSTTSSPLRDEDYVPHGEIYRNPYAFHRSY  126

Query  457   VEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAM--DFSQFRTTDPDSAHVFFLP  630
             + MEK  K+YVYE+G PP+ HYG CK IY++EG  ++ M  D   +RT DPD AHV+FLP
Sbjct  127   LLMEKMFKIYVYEEGDPPIFHYGLCKDIYSMEGLLLNFMENDVLTYRTRDPDKAHVYFLP  186

Query  631   FSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEIS  810
             FSV ++   ++     D + ++R  +DYVQ I+ KYP+WN + G DHFMLSCHDWG   +
Sbjct  187   FSVVMILHHLFDPVVRDKAVLERVIVDYVQIISEKYPYWNTSDGFDHFMLSCHDWGHRAT  246

Query  811   GSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYA  990
               +  L   +IR LCNAN SE FNP+KD   PEINL  G  + L GG  P  R  L F+A
Sbjct  247   WYVKKLFFNSIRVLCNANISEYFNPEKDAPFPEINLQTGEINNLTGGLDPMSRTTLAFFA  306

Query  991   GGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             G  HG +RP+LL HW+ KD+DI ++  LP  + Y  MMRKS++C+CPSG+EVASPR+ EA
Sbjct  307   GQSHGKIRPVLLNHWKEKDKDILVYEDLPGELDYKEMMRKSRFCICPSGHEVASPRVPEA  366

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
             +Y GCVPVLI   YV PFSDVLNW  F+V + V++IP LK+IL DIP+ +Y+ L     +
Sbjct  367   IYSGCVPVLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYKKLYEGVKQ  426

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             V+RH  VN PPKR+DVF+MI+HSIWLRRLN+++
Sbjct  427   VQRHILVNDPPKRYDVFNMIIHSIWLRRLNVKL  459



>ref|XP_008445236.1| PREDICTED: probable glycosyltransferase At5g25310 [Cucumis melo]
Length=464

 Score =   413 bits (1062),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/386 (53%), Positives = 270/386 (70%), Gaps = 9/386 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSILRG----NQLHSDEHYIPSGS-IYWNASSFHRSYVEMEKTLKV  483
             ++ E LE GLAQAR+SI +     N   S   Y+PS S +Y N  +F++SYVEMEK  KV
Sbjct  78    SREEKLELGLAQARASIRKAANDSNLSSSSVDYVPSSSSVYHNPRAFYQSYVEMEKRFKV  137

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMD--FSQFRTTDPDSAHVFFLPFSVTVLSKM  657
             YVY +G+ P+ H GPCK+IY IEG FIH M+   + FRT DP  AHV F+PFSV  + K 
Sbjct  138   YVYPEGELPITHDGPCKNIYTIEGRFIHEMEDGGNGFRTVDPGRAHVLFMPFSVAWMVKY  197

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +Y A S+D +P++    DYV+ +++KYPFWN+T GADHF+L+CHDWGP  +     L   
Sbjct  198   LYKAGSYDQTPLRMFVSDYVEVVSKKYPFWNKTNGADHFILACHDWGPIATEGNRFLYNT  257

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGT-TDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
             +IR LCNAN+SE FNP+KDVS+PEI+L DG  +  L+       RP L F+AGGLHGP+R
Sbjct  258   SIRVLCNANSSEGFNPQKDVSLPEIHLYDGDISPKLLSSNSHHHRPHLAFFAGGLHGPIR  317

Query  1015  PILLQHWENKDE-DIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             PILL HW+N+   +I ++ YLP  + Y+  M +S++CLCPSGYEVASPR+VEA+Y  CVP
Sbjct  318   PILLNHWKNRTHTNIHVYEYLPTQLDYYDQMLQSRFCLCPSGYEVASPRIVEAIYAECVP  377

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             V+I   YV PFSDVL W  F++ +   +IP LK+IL  +   +YE L++    VR+HF +
Sbjct  378   VIISERYVLPFSDVLRWKGFSIEVSASEIPRLKEILMGVSDEKYEKLKQGLRTVRKHFVL  437

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRV  1449
             N P KRFD FHMILHS+WLRRLN+++
Sbjct  438   NRPAKRFDAFHMILHSVWLRRLNVKL  463



>ref|XP_009393729.1| PREDICTED: probable glycosyltransferase At5g20260 [Musa acuminata 
subsp. malaccensis]
Length=464

 Score =   413 bits (1062),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/385 (52%), Positives = 271/385 (70%), Gaps = 8/385 (2%)
 Frame = +1

Query  319   TKLEILESGLAQARSSIL-----RGNQLHSDEHYIPSGSIYWNASSFHRSYVEMEKTLKV  483
              KL  +E GLA+AR++I      R       + +IP G++Y NA +FH+SY+EMEK  KV
Sbjct  78    VKLGTVEEGLAKARAAIKRAAISRNRTFSEAQDWIPRGAVYRNAYAFHQSYIEMEKRFKV  137

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ--FRTTDPDSAHVFFLPFSVTVLSKM  657
             ++Y++G+PP+AH GP K+IYAIEGHFI  M+  +  F    P  AHVFFLPFSV  +   
Sbjct  138   WIYKEGEPPIAHDGPSKNIYAIEGHFIIEMERERNPFVARHPADAHVFFLPFSVVNIVHF  197

Query  658   IYVANSHDW-SPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQK  834
             +Y  N  D+  P+KR   DYV  +A +YP+WNR+LGADHFM+SCHDW P +S +  DL +
Sbjct  198   LYKPNVTDYRGPLKRLIADYVAVVADRYPYWNRSLGADHFMVSCHDWAPHLSDANSDLYE  257

Query  835   YAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVR  1014
              +IR +CNANTSE F   KDV++PE++LP G            E+ +L F+AGG HG +R
Sbjct  258   NSIRVICNANTSEGFKLGKDVTLPEVHLPGGELSQPAANQLHNEKTILAFFAGGSHGYIR  317

Query  1015  PILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPV  1194
              +LL HWE KDE++ +H YLP+ V+Y  +M KSK+CLCPSGYEVASPR+VE++++GCVPV
Sbjct  318   EMLLHHWEGKDEEVVVHEYLPEGVNYDELMSKSKFCLCPSGYEVASPRIVESIFVGCVPV  377

Query  1195  LIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVN  1374
              I   Y  PFSDVL+W  F+V IPVE I  +K IL  IP+++Y+ LQ+R  +V+RHF VN
Sbjct  378   TISVDYPLPFSDVLDWRKFSVQIPVEKIAEIKAILRAIPESRYKKLQKRVTQVQRHFVVN  437

Query  1375  WPPKRFDVFHMILHSIWLRRLNIRV  1449
              P KR+D+ HM+LHSIWLRRLN+R+
Sbjct  438   QPAKRYDMIHMVLHSIWLRRLNVRL  462



>ref|XP_007013570.1| Exostosin family protein [Theobroma cacao]
 gb|EOY31189.1| Exostosin family protein [Theobroma cacao]
Length=470

 Score =   413 bits (1061),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 195/394 (49%), Positives = 270/394 (69%), Gaps = 8/394 (2%)
 Frame = +1

Query  295   AVYGAKSYTKLEILESGLAQARSSI-----LRGNQLHSDEHYIPSGSIYWNASSFHRSYV  459
             AV   +   + E +E+ LA AR++I      R    + +E +IP G +Y N  +FH+S++
Sbjct  76    AVSCIRKKGRSERVEADLASARAAIREAIRTRNYTSYKEEKFIPRGCMYRNEYAFHQSHI  135

Query  460   EMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPF  633
             EM +  K++ Y++G+ P+ H GP K IYAIEG FI  ++   S F+   PD AHVFFLP 
Sbjct  136   EMVERFKIWTYKEGERPLVHTGPMKHIYAIEGQFIEEIEGGKSPFKAQHPDEAHVFFLPV  195

Query  634   SVTVLSKMIYV-ANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEIS  810
             SV  +   IY+   ++    + R   DY++ +A+KYP+W+RT GADHFM+SCHDW PE++
Sbjct  196   SVAYIVNYIYLPITTYSRDRLVRIFTDYIKVVAKKYPYWSRTKGADHFMVSCHDWAPEVA  255

Query  811   GSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYA  990
             G  P+L K  IR LCNAN+SE F+PK+DV++PE+NLP           PP +R +L F+A
Sbjct  256   GQDPELYKNLIRVLCNANSSEGFHPKRDVALPELNLPPRGFSPRRFAQPPDKRTILAFFA  315

Query  991   GGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             GG HG +R ILL HW++KD ++++H YL K   Y  +M +SK+CLCPSG+EVASPR+VE+
Sbjct  316   GGAHGNIRKILLHHWKDKDNEVQVHEYLSKGQDYSKLMGRSKFCLCPSGFEVASPRVVES  375

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
              Y GCVPV+I   YV PFSDVL+WS F+V IPVE IP +K IL  IP  +Y  +QRR ++
Sbjct  376   FYAGCVPVIISDNYVLPFSDVLDWSKFSVQIPVEKIPQIKTILQSIPGNKYLEMQRRVLK  435

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVH  1452
             +RRHFE+N P K FD+ HM+LHSIWLRRLN+R+ 
Sbjct  436   LRRHFELNRPAKPFDIIHMVLHSIWLRRLNLRLQ  469



>gb|AHL38775.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=459

 Score =   412 bits (1058),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 200/383 (52%), Positives = 263/383 (69%), Gaps = 12/383 (3%)
 Frame = +1

Query  334   LESGLAQARSSILRGNQLH---------SDEHYIPSGSIYWNASSFHRSYVEMEKTLKVY  486
             +E+ LA AR  ++R  QL+          DE Y+P G IY N  +FHRSY+ MEK  K+Y
Sbjct  77    VEAELATARV-LIREAQLNYSSTTSSPLGDEDYVPHGDIYRNPYAFHRSYLLMEKMFKIY  135

Query  487   VYEDGQPPVAHYGPCKSIYAIEGHFIHAM--DFSQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             VYE+G PP+ HYG CK IY++EG F++ M  D  ++RT DPD AHV+FLPFSV ++   +
Sbjct  136   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  195

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             +     D + ++R   DYVQ I++KYP+WN + G DHFMLSCHDWG   +  +  L   +
Sbjct  196   FDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  255

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNAN SE FNP+KD   PEINL  G  + L GG  P  R  L F+AG  HG +RP+
Sbjct  256   IRVLCNANISEYFNPEKDAPFPEINLLTGDINNLTGGLDPISRTTLAFFAGKSHGKIRPV  315

Query  1021  LLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLI  1200
             LL HW+ KD+DI ++  LP  + Y  MMRKS++C+CPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  316   LLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRVPEAIYSGCVPVLI  375

Query  1201  KRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWP  1380
                YV PFSDVLNW  F+V + V++IP LK+IL DIP+ +Y  L     +V+RH  VN P
Sbjct  376   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEERYMRLYEGVKKVKRHILVNDP  435

Query  1381  PKRFDVFHMILHSIWLRRLNIRV  1449
             PKR+DVF+MI+HSIWLRRLN+++
Sbjct  436   PKRYDVFNMIIHSIWLRRLNVKL  458



>ref|NP_187419.1| putative glycosyltransferase [Arabidopsis thaliana]
 sp|Q9SSE8.1|GLYT1_ARATH RecName: Full=Probable glycosyltransferase At3g07620 [Arabidopsis 
thaliana]
 gb|AAF13080.1|AC009176_7 hypothetical protein [Arabidopsis thaliana]
 gb|AEE74576.1| putative glycosyltransferase [Arabidopsis thaliana]
Length=470

 Score =   412 bits (1059),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 200/383 (52%), Positives = 263/383 (69%), Gaps = 12/383 (3%)
 Frame = +1

Query  334   LESGLAQARSSILRGNQLH---------SDEHYIPSGSIYWNASSFHRSYVEMEKTLKVY  486
             +E+ LA AR  ++R  QL+          DE Y+P G IY N  +FHRSY+ MEK  K+Y
Sbjct  88    VEAELATARV-LIREAQLNYSSTTSSPLGDEDYVPHGDIYRNPYAFHRSYLLMEKMFKIY  146

Query  487   VYEDGQPPVAHYGPCKSIYAIEGHFIHAM--DFSQFRTTDPDSAHVFFLPFSVTVLSKMI  660
             VYE+G PP+ HYG CK IY++EG F++ M  D  ++RT DPD AHV+FLPFSV ++   +
Sbjct  147   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  206

Query  661   YVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYA  840
             +     D + ++R   DYVQ I++KYP+WN + G DHFMLSCHDWG   +  +  L   +
Sbjct  207   FDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  266

Query  841   IRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAGGLHGPVRPI  1020
             IR LCNAN SE FNP+KD   PEINL  G  + L GG  P  R  L F+AG  HG +RP+
Sbjct  267   IRVLCNANISEYFNPEKDAPFPEINLLTGDINNLTGGLDPISRTTLAFFAGKSHGKIRPV  326

Query  1021  LLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLI  1200
             LL HW+ KD+DI ++  LP  + Y  MMRKS++C+CPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  327   LLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRVPEAIYSGCVPVLI  386

Query  1201  KRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWP  1380
                YV PFSDVLNW  F+V + V++IP LK+IL DIP+ +Y  L     +V+RH  VN P
Sbjct  387   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEERYMRLYEGVKKVKRHILVNDP  446

Query  1381  PKRFDVFHMILHSIWLRRLNIRV  1449
             PKR+DVF+MI+HSIWLRRLN+++
Sbjct  447   PKRYDVFNMIIHSIWLRRLNVKL  469



>ref|XP_006407816.1| hypothetical protein EUTSA_v10020696mg [Eutrema salsugineum]
 gb|ESQ49269.1| hypothetical protein EUTSA_v10020696mg [Eutrema salsugineum]
Length=459

 Score =   411 bits (1057),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 199/393 (51%), Positives = 268/393 (68%), Gaps = 12/393 (3%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRGNQLH---------SDEHYIPSGSIYWNASSFHRSY  456
             G+ S+ +   +E+ LA AR+ ++R  QL+          DE Y+P G IY N  +FHRSY
Sbjct  67    GSVSWKRDGKVEAELATARA-LIREAQLNPNSTTSSPLRDEDYVPHGDIYRNPYAFHRSY  125

Query  457   VEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAM--DFSQFRTTDPDSAHVFFLP  630
             + MEK  K+YVYE+G PP+ HYG CK IY++EG F++ M  D   +RT DPD AHV+FLP
Sbjct  126   LLMEKMFKIYVYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDILNYRTRDPDRAHVYFLP  185

Query  631   FSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEIS  810
             FSV ++   ++     D + ++R  +DYV+ I+ KYP+WN + G DHFMLSCHDWG   +
Sbjct  186   FSVVMILHHLFDPVVRDKAVLERVIVDYVRIISNKYPYWNTSDGFDHFMLSCHDWGHRAT  245

Query  811   GSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYA  990
               +  L   +IR LCNAN SE FNP+KD   PEINLP G  + L GG  P  R  L F+A
Sbjct  246   WYVKKLFFNSIRVLCNANISEYFNPEKDAPFPEINLPTGEINNLTGGLDPISRTTLAFFA  305

Query  991   GGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             G  HG +RP+LL HW+ KD+DI ++  LP  + Y  +MR+S++C+CPSG+EVASPR+ EA
Sbjct  306   GKSHGKIRPVLLNHWKEKDKDILVYENLPDGLDYKDLMRRSRFCICPSGHEVASPRIPEA  365

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
             +Y  CVPVLI   YV PFSDVLNW  F+V + V++IP LK+IL DIP+ +Y  L     +
Sbjct  366   IYSECVPVLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYIRLHEGVKK  425

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             V+RH  VN PPKR+DVF+MI+HSIWLRRLN+++
Sbjct  426   VKRHILVNDPPKRYDVFNMIIHSIWLRRLNVKL  458



>ref|XP_006299448.1| hypothetical protein CARUB_v10015613mg [Capsella rubella]
 gb|EOA32346.1| hypothetical protein CARUB_v10015613mg [Capsella rubella]
Length=462

 Score =   411 bits (1057),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 200/393 (51%), Positives = 270/393 (69%), Gaps = 12/393 (3%)
 Frame = +1

Query  304   GAKSYTKLEILESGLAQARSSILRGNQLHS---------DEHYIPSGSIYWNASSFHRSY  456
             G  S+ +   +E+ LA AR+ ++R  Q++S         DE Y+P G IY N  +FHRSY
Sbjct  70    GHGSWKRDGKVEAELAMARA-LIREAQVNSNSTSSSPLGDEDYVPHGDIYRNPYAFHRSY  128

Query  457   VEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAM--DFSQFRTTDPDSAHVFFLP  630
             + MEK  K+YVYE+G PP+ HYG CK IY++EG F++ M  D  ++RT DPD AHV+FLP
Sbjct  129   LLMEKIFKIYVYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLP  188

Query  631   FSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEIS  810
             FSV ++   ++     D + ++R   DYVQ I++KYP+WN + G DHFMLSCHDWG   +
Sbjct  189   FSVVMILHHLFDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRAT  248

Query  811   GSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYA  990
               +  L   +IR LCNAN SE FNP+KD   PEINL  G  + L GG  PT R  L F+A
Sbjct  249   WYVKKLFFNSIRVLCNANISEYFNPEKDAPFPEINLVTGEINNLTGGLDPTSRTTLAFFA  308

Query  991   GGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEA  1170
             G  HG +RP+LL +W+ KD+DI ++  LP  + Y  MMRKS++C+CPSG+EVASPR+ EA
Sbjct  309   GKSHGKIRPVLLNNWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEA  368

Query  1171  LYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVE  1350
             +Y GCVPVLI   YV PFSDVLNW  F+V + V++IP +K+IL +IP+ +Y  L     +
Sbjct  369   IYSGCVPVLISENYVLPFSDVLNWEKFSVSVSVKEIPEMKRILMNIPEDRYMRLYEGVKK  428

Query  1351  VRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             V+RH  VN PPKR+DVF+MI+HSIWLRRLN+++
Sbjct  429   VKRHILVNDPPKRYDVFNMIIHSIWLRRLNVKL  461



>ref|XP_008352234.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At3g42180 [Malus domestica]
Length=404

 Score =   409 bits (1051),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/394 (51%), Positives = 266/394 (68%), Gaps = 11/394 (3%)
 Frame = +1

Query  307   AKSYTKLEILESGLAQARSSILRGNQL-----HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
              K  T L+ +E GLA+AR++IL   Q        +E +IP G+IY N  +FH+S+VEM K
Sbjct  11    TKGKTSLDTIEEGLAKARAAILEAIQFKKYASQKNETFIPRGTIYKNPYAFHQSHVEMMK  70

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ--FRTTDPDSAHVFFLPFSVTV  645
               KV+ Y++G+ P+ H+GP   IY IEG FI  ++  +  FR T PD AH FFLPFSV  
Sbjct  71    RFKVWSYKEGEHPLIHFGPVNDIYGIEGQFIDEIEREESPFRATHPDEAHTFFLPFSVAN  130

Query  646   LSKMIY--VANSHDW--SPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISG  813
             + + +   +    D+    ++R   D +  +A KYP+WNR+ GADHFM SCHDW PE+S 
Sbjct  131   VVRYVXMPITRKQDYHRDRLQRVVTDXISVVADKYPYWNRSNGADHFMASCHDWAPEVSI  190

Query  814   SIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAG  993
               P+L K  IR LCNANTSE F  K+DVS+P+I LP G  D    G  P  RP+L F+AG
Sbjct  191   ENPELFKNFIRVLCNANTSEGFXLKRDVSLPKIYLPKGNLDPPNLGQAPKSRPILAFFAG  250

Query  994   GLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEAL  1173
              +HGPVRPILL HW++KD++++++  LPK ++Y   M +SK+CLCPSG+EVASPR+VEA+
Sbjct  251   RVHGPVRPILLDHWKDKDDEVQVYEKLPKGLNYTKFMGQSKFCLCPSGFEVASPRIVEAI  310

Query  1174  YMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEV  1353
             Y GCVPVLI   Y   FSDVL+WS F+V IPV+ IP +K IL  IP  +Y  +Q+R   V
Sbjct  311   YAGCVPVLISDNYTLLFSDVLDWSKFSVQIPVDKIPEIKTILQAIPFDKYLKMQKRVYRV  370

Query  1354  RRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVHH  1455
             RRHF +N P K FDV HM+LHS+WLRRLN ++ +
Sbjct  371   RRHFVLNRPSKPFDVIHMVLHSVWLRRLNFKLEN  404



>ref|XP_008242868.1| PREDICTED: probable glycosyltransferase At3g42180 [Prunus mume]
Length=404

 Score =   409 bits (1051),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/401 (49%), Positives = 264/401 (66%), Gaps = 11/401 (3%)
 Frame = +1

Query  280   YLKTLAVYGAKSYTKLEILESGLAQARSSILRGNQLHS-----DEHYIPSGSIYWNASSF  444
             Y +       K  T LE +E  LA+AR++IL   +  +      E ++P G+IY N  +F
Sbjct  2     YQRRHKASATKGRTSLEKIEEDLAKARAAILEAIRFKNYTSEKTETFVPRGTIYKNPYAF  61

Query  445   HRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ--FRTTDPDSAHV  618
             H+S++EM K  KV+ Y++G+ P+ H+GP  +IY IEG FI  ++  +  FR T PD AH 
Sbjct  62    HQSHIEMVKRFKVWSYKEGEQPLVHFGPVNNIYGIEGQFIDEIEREESPFRATHPDEAHT  121

Query  619   FFLPFSVTVLSKMIY--VANSHDW--SPMKRTALDYVQSIARKYPFWNRTLGADHFMLSC  786
             FFLP SV  +   +Y  +    D+    ++R  +DY+  +A KYP+WNR+ GADHFM SC
Sbjct  122   FFLPVSVANIVHYVYMPITRKQDYYRDRLQRVVMDYIGVVANKYPYWNRSNGADHFMASC  181

Query  787   HDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTE  966
             HDW PE+S   P+L    IR LCNANTSE F PK+DVS+PEI LP G       G  P  
Sbjct  182   HDWAPEVSVGKPELFTNFIRVLCNANTSEGFQPKRDVSLPEIYLPYGRLGPPSLGQAPNN  241

Query  967   RPVLVFYAGGLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEV  1146
             RP+L F+AG +HGP+RP+LL +W+ KD+++++H  LPK ++Y  +M +SKYCLCPSG+EV
Sbjct  242   RPILAFFAGRVHGPIRPMLLDYWKGKDDEVQVHEKLPKGLNYTKLMGQSKYCLCPSGFEV  301

Query  1147  ASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYE  1326
             ASPR+VEA Y GCVPVLI   Y  PF DVLNWS F+V IPV  IP +K IL  IP  +Y 
Sbjct  302   ASPRVVEAFYAGCVPVLISDNYALPFGDVLNWSQFSVQIPVARIPEIKTILESIPYEKYL  361

Query  1327  ILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
              +Q+R   V RHF +N P K FDV HM+LHS+WLRRLN ++
Sbjct  362   KMQKRVSRVHRHFVLNRPSKSFDVIHMVLHSVWLRRLNFKL  402



>ref|XP_008361205.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At3g42180 [Malus domestica]
Length=404

 Score =   409 bits (1050),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/394 (51%), Positives = 265/394 (67%), Gaps = 11/394 (3%)
 Frame = +1

Query  307   AKSYTKLEILESGLAQARSSILRGNQL-----HSDEHYIPSGSIYWNASSFHRSYVEMEK  471
              K  T L+ +E GLA+AR++IL   Q        +E +IP G+IY N  +FH+S+VEM K
Sbjct  11    TKGKTSLDTIEEGLAKARAAILEAIQFKKYASQKNETFIPRGTIYKNPYAFHQSHVEMMK  70

Query  472   TLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDFSQ--FRTTDPDSAHVFFLPFSVTV  645
               KV+ Y++G+ P+ H+GP   IY IEG FI  ++  +  FR T PD AH FFLPFSV  
Sbjct  71    RFKVWSYKEGEHPLIHFGPVNDIYGIEGQFIDEIEREESPFRATHPDEAHTFFLPFSVAN  130

Query  646   LSKMIY--VANSHDW--SPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISG  813
             + + +   +    D+    ++R   D +  +A KYP+WNR+ GADHFM SCHDW PE+S 
Sbjct  131   VVRYVXMPITRKQDYHRDRLQRVVTDXISVVADKYPYWNRSNGADHFMASCHDWAPEVSI  190

Query  814   SIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTERPVLVFYAG  993
               P+L K  IR LCNANTSE F  K+DVS+P I LP G  D    G  P  RP+L F+AG
Sbjct  191   ENPELFKNFIRVLCNANTSEGFXLKRDVSLPXIYLPKGNLDPPNLGQAPKSRPILAFFAG  250

Query  994   GLHGPVRPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEAL  1173
              +HGPVRPILL HW++KD++++++  LPK ++Y   M +SK+CLCPSG+EVASPR+VEA+
Sbjct  251   RVHGPVRPILLDHWKDKDDEVQVYEKLPKGLNYTKFMGQSKFCLCPSGFEVASPRIVEAI  310

Query  1174  YMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEV  1353
             Y GCVPVLI   Y   FSDVL+WS F+V IPV+ IP +K IL  IP  +Y  +Q+R   V
Sbjct  311   YAGCVPVLISDNYTLLFSDVLDWSKFSVQIPVDKIPEIKTILQAIPFDKYLKMQKRVYRV  370

Query  1354  RRHFEVNWPPKRFDVFHMILHSIWLRRLNIRVHH  1455
             RRHF +N P K FDV HM+LHS+WLRRLN ++ +
Sbjct  371   RRHFVLNXPSKPFDVIHMVLHSVWLRRLNFKLEN  404



>gb|EYU20247.1| hypothetical protein MIMGU_mgv1a024162mg [Erythranthe guttata]
Length=398

 Score =   408 bits (1049),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 269/386 (70%), Gaps = 15/386 (4%)
 Frame = +1

Query  337   ESGLAQARSSILRGNQLHSDEHYIPS-----------GSIYWNASSFHRSYVEMEKTLKV  483
             E GLA++R++I +     +    I +            +IY N ++F +SY EMEK  KV
Sbjct  12    EQGLAKSRAAIRKAASNRNLSSAIININSNGSSILSSSTIYRNPTAFFQSYKEMEKRFKV  71

Query  484   YVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF--SQFRTTDPDSAHVFFLPFSVTVLSKM  657
             YVYE+G+ P+ H GPCK IY  EG FIH M+   ++FRT +P +AHV+F+PFSVT + K 
Sbjct  72    YVYEEGELPIVHDGPCKDIYTSEGRFIHEMEHGNNRFRTNNPRAAHVYFMPFSVTWMVKY  131

Query  658   IYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKY  837
             +Y  ++++ +P+K+   DYV+ I+ K+PFWN T GADHFMLSCHDW P  S     L   
Sbjct  132   LYTPDTYNLTPLKQFVSDYVKLISVKHPFWNTTQGADHFMLSCHDWAPHASRGNSFLYNT  191

Query  838   AIRALCNANTSERFNPKKDVSIPEINLPDGTTDGLIGGPPPTE--RPVLVFYAGGLHGPV  1011
             +IR LCNAN+SE FNP+KDVS+PEI+L  G  +  +  PPP+   RP L F+AGGLHGP+
Sbjct  192   SIRVLCNANSSEGFNPQKDVSLPEIHLYGGNVNPKLISPPPSNLSRPFLAFFAGGLHGPI  251

Query  1012  RPILLQHWENKDEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVP  1191
             R ILLQHW+ +D D++I+ YLPK+  Y+  M  SK+CLCPSGYEVASPR+VEA+Y  C+P
Sbjct  252   RSILLQHWKGRDSDLRIYEYLPKDQDYYDSMLWSKFCLCPSGYEVASPRIVEAVYAECIP  311

Query  1192  VLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEV  1371
             V++   YV PFSDVL W AF++ + + +IP LK+IL  + + +Y +L+     VR+HF +
Sbjct  312   VILSDHYVLPFSDVLKWEAFSIQVDISEIPRLKEILLGVSEDKYLMLKEGLRAVRKHFVL  371

Query  1372  NWPPKRFDVFHMILHSIWLRRLNIRV  1449
             N P K+FDVFHMILHS+WLRRLN+RV
Sbjct  372   NQPVKKFDVFHMILHSVWLRRLNLRV  397



>ref|XP_006582483.1| PREDICTED: probable glycosyltransferase At5g25310-like [Glycine 
max]
Length=474

 Score =   411 bits (1056),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/366 (55%), Positives = 260/366 (71%), Gaps = 8/366 (2%)
 Frame = +1

Query  370   LRGNQLHS-DEHYIPSGSIYWNASSFHRSYVEMEKTLKVYVYEDGQPPVAHYGPCKSIYA  546
             L G  L + D   I +G++Y N   FH+SY+EMEK  KVYVY DG  P+ H  PCK IY+
Sbjct  106   LTGTNLTTHDNDDILAGTVYRNPRLFHQSYLEMEKLFKVYVYPDGDLPIVHDAPCKDIYS  165

Query  547   IEGHFIHAMD--FSQFRTTDPDSAHVFFLPFSVTVLSKMIY-VANSHDWSPMKRTALDYV  717
             IEG F+H M+    +FRT DP +AHV+FLPFSVT + K  Y   +S+D +P+K    DYV
Sbjct  166   IEGRFLHEMEHGVGRFRTNDPTAAHVYFLPFSVTWMVKYFYSTPHSYDVTPLKNFVSDYV  225

Query  718   QSIARKYPFWNRTLGADHFMLSCHDWGPEISGSIPDLQKYAIRALCNANTSERFNPKKDV  897
             + I+ KYPFWN+T GADHFM++CHDWGP  S   P L   +IR LCNANTSE FNP+KDV
Sbjct  226   RVISTKYPFWNKTHGADHFMVACHDWGPYASEGNPFLYNTSIRVLCNANTSEGFNPQKDV  285

Query  898   SIPEINLPDGTTDGLIGGPPP--TERPVLVFYAGGLHGPVRPILLQHWENKD--EDIKIH  1065
              +PEI+L  G     +  PPP    R  L F+AGG+HGP+RPILL HW N+D  +D++++
Sbjct  286   PLPEIHLYGGEVSPKLLSPPPGNATRRYLAFFAGGMHGPIRPILLHHWNNRDINDDMRVY  345

Query  1066  SYLPKNVSYHGMMRKSKYCLCPSGYEVASPRMVEALYMGCVPVLIKRGYVPPFSDVLNWS  1245
              YLPK++ Y+  M  SK+CLCPSGYEVASPR+VE++Y  CVPV++ + Y  PFSDVL W 
Sbjct  346   EYLPKDLDYYSFMLNSKFCLCPSGYEVASPRIVESIYAECVPVILSKNYTLPFSDVLRWE  405

Query  1246  AFAVIIPVEDIPNLKKILTDIPQTQYEILQRRGVEVRRHFEVNWPPKRFDVFHMILHSIW  1425
             +F+V + V DIP LK++L+ IP+++Y+ L+     VRRHF +N P KR DVFHMILHSIW
Sbjct  406   SFSVQVDVSDIPRLKEVLSAIPESEYQKLKHGVRAVRRHFTLNQPAKRLDVFHMILHSIW  465

Query  1426  LRRLNI  1443
             LRRL+I
Sbjct  466   LRRLDI  471



>gb|KCW80354.1| hypothetical protein EUGRSUZ_C01719 [Eucalyptus grandis]
Length=339

 Score =   405 bits (1042),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 192/338 (57%), Positives = 253/338 (75%), Gaps = 7/338 (2%)
 Frame = +1

Query  457   VEMEKTLKVYVYEDGQPPVAHYGPCKSIYAIEGHFIHAMDF----SQFRTTDPDSAHVFF  624
             +EME+  KVYVY +G+PP+ H GPCK IY +EG FIH M+     ++F T DP  AHV+F
Sbjct  1     MEMERRFKVYVYSEGEPPIVHDGPCKDIYTVEGRFIHEMEHGSAAARFGTRDPRRAHVYF  60

Query  625   LPFSVTVLSKMIYVANSHDWSPMKRTALDYVQSIARKYPFWNRTLGADHFMLSCHDWGPE  804
             +PFSVT +   +Y   ++D +P++R   DYVQ+++ KYPFWNRT GADHFM++CHDWGP 
Sbjct  61    MPFSVTRMVTYLYKPPTYDVTPLRRFVADYVQAVSAKYPFWNRTRGADHFMVACHDWGPH  120

Query  805   ISGSIPDLQKYAIRALCNANTSERFNPKKDVSIPEINLPDGT-TDGLIGGPPP-TERPVL  978
              S     L K +IRALCNAN SE FNP+KDVS+PEI L DG  +  L+  PPP   RP+L
Sbjct  121   ASLGDAHLYKNSIRALCNANASEGFNPQKDVSLPEIYLLDGNISPKLLSLPPPHVPRPLL  180

Query  979   VFYAGGLHGPVRPILLQHWENK-DEDIKIHSYLPKNVSYHGMMRKSKYCLCPSGYEVASP  1155
              F+AGGLHGP+RPILL HW++K D D++++ YLPK++ Y+ ++ +SK+CLCPSG+EVASP
Sbjct  181   TFFAGGLHGPIRPILLHHWKDKGDPDVRVYGYLPKHLDYYTLILQSKFCLCPSGHEVASP  240

Query  1156  RMVEALYMGCVPVLIKRGYVPPFSDVLNWSAFAVIIPVEDIPNLKKILTDIPQTQYEILQ  1335
             R+VEA+Y  CVPV+I   YV PFSDVLNW AF+V + V +IP LK+IL  +P+ +Y  L+
Sbjct  241   RIVEAIYAECVPVIISEHYVLPFSDVLNWDAFSVKVEVSEIPRLKEILKAVPEDEYRRLR  300

Query  1336  RRGVEVRRHFEVNWPPKRFDVFHMILHSIWLRRLNIRV  1449
             +    VRRHF +N P KRFDVFHM+LHSIWLRRLN+ +
Sbjct  301   QGLKAVRRHFVLNQPAKRFDVFHMVLHSIWLRRLNLNL  338



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4625486112216