BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22214_g1_i1 len=2165 path=[1:0-1506 1508:1507-1552 1554:1553-2164]

Length=2165
                                                                      Score     E

ref|XP_009779883.1|  PREDICTED: probable glycosyltransferase At5g...    733   0.0      
ref|XP_009617934.1|  PREDICTED: probable glycosyltransferase At5g...    731   0.0      
ref|XP_009617933.1|  PREDICTED: probable glycosyltransferase At5g...    728   0.0      
ref|XP_006366795.1|  PREDICTED: probable glycosyltransferase At5g...    717   0.0      
ref|XP_010325948.1|  PREDICTED: probable glycosyltransferase At5g...    704   0.0      
ref|XP_004246587.1|  PREDICTED: probable glycosyltransferase At5g...    701   0.0      
ref|XP_011094446.1|  PREDICTED: probable glycosyltransferase At5g...    679   0.0      
gb|EYU41561.1|  hypothetical protein MIMGU_mgv1a004154mg                652   0.0      
ref|XP_002528630.1|  catalytic, putative                                635   0.0      Ricinus communis
ref|XP_003553575.1|  PREDICTED: probable glycosyltransferase At5g...    620   0.0      
gb|KHN02275.1|  Putative glycosyltransferase                            620   0.0      
ref|XP_004494122.1|  PREDICTED: probable glycosyltransferase At5g...    617   0.0      
gb|KEH24081.1|  glycosyltransferase                                     608   0.0      
ref|XP_003521429.1|  PREDICTED: probable glycosyltransferase At5g...    613   0.0      
gb|KDP29231.1|  hypothetical protein JCGZ_16620                         607   0.0      
ref|XP_007162830.1|  hypothetical protein PHAVU_001G184500g             607   0.0      
gb|KHN18714.1|  Putative glycosyltransferase                            607   0.0      
ref|XP_002284018.2|  PREDICTED: probable glycosyltransferase At5g...    605   0.0      Vitis vinifera
ref|XP_010242926.1|  PREDICTED: probable glycosyltransferase At5g...    596   0.0      
ref|XP_010098868.1|  putative glycosyltransferase                       587   0.0      
gb|EPS64188.1|  hypothetical protein M569_10593                         583   0.0      
ref|XP_010248410.1|  PREDICTED: probable glycosyltransferase At5g...    593   0.0      
ref|XP_010039041.1|  PREDICTED: probable glycosyltransferase At5g...    588   0.0      
ref|XP_006381337.1|  hypothetical protein POPTR_0006s11930g             586   0.0      
ref|XP_003537031.2|  PREDICTED: probable glycosyltransferase At5g...    584   0.0      
ref|XP_010243080.1|  PREDICTED: probable glycosyltransferase At5g...    588   0.0      
ref|XP_011018855.1|  PREDICTED: probable glycosyltransferase At5g...    585   0.0      
ref|XP_010543482.1|  PREDICTED: probable glycosyltransferase At5g...    584   0.0      
ref|XP_010039055.1|  PREDICTED: probable glycosyltransferase At5g...    586   0.0      
ref|XP_004303053.1|  PREDICTED: probable glycosyltransferase At5g...    584   0.0      
ref|XP_010243073.1|  PREDICTED: probable glycosyltransferase At5g...    587   0.0      
ref|XP_008359607.1|  PREDICTED: probable glycosyltransferase At5g...    583   0.0      
ref|XP_003541440.1|  PREDICTED: probable glycosyltransferase At5g...    580   0.0      
ref|XP_004497579.1|  PREDICTED: probable glycosyltransferase At5g...    581   0.0      
ref|XP_010247793.1|  PREDICTED: probable glycosyltransferase At5g...    583   0.0      
ref|XP_009631064.1|  PREDICTED: probable glycosyltransferase At5g...    577   0.0      
ref|XP_009340969.1|  PREDICTED: probable glycosyltransferase At5g...    579   0.0      
ref|XP_009375632.1|  PREDICTED: probable glycosyltransferase At5g...    579   0.0      
ref|XP_007202112.1|  hypothetical protein PRUPE_ppa006842mg             572   0.0      
ref|XP_008392545.1|  PREDICTED: probable glycosyltransferase At5g...    578   0.0      
ref|XP_010683939.1|  PREDICTED: probable glycosyltransferase At5g...    578   0.0      
gb|KEH24082.1|  glycosyltransferase                                     572   0.0      
ref|XP_006481931.1|  PREDICTED: probable glycosyltransferase At5g...    577   0.0      
gb|AES60658.2|  exostosin family protein                                573   0.0      
gb|KDO60990.1|  hypothetical protein CISIN_1g048582mg                   576   0.0      
ref|XP_006430348.1|  hypothetical protein CICLE_v10011407mg             576   0.0      
ref|XP_003542567.1|  PREDICTED: probable glycosyltransferase At5g...    573   0.0      
ref|XP_003590407.1|  hypothetical protein MTR_1g061760                  573   0.0      
ref|XP_009774930.1|  PREDICTED: probable glycosyltransferase At5g...    568   0.0      
ref|XP_009774931.1|  PREDICTED: probable glycosyltransferase At5g...    568   0.0      
ref|XP_008241335.1|  PREDICTED: probable glycosyltransferase At5g...    571   0.0      
ref|XP_004156325.1|  PREDICTED: probable glycosyltransferase At5g...    569   0.0      
ref|XP_009122667.1|  PREDICTED: probable glycosyltransferase At5g...    568   0.0      
ref|XP_004143371.1|  PREDICTED: probable glycosyltransferase At5g...    568   0.0      
ref|XP_007027562.1|  Exostosin family protein                           570   0.0      
emb|CDP15333.1|  unnamed protein product                                563   0.0      
gb|KCW48746.1|  hypothetical protein EUGRSUZ_K02385                     560   0.0      
gb|KHG20191.1|  hypothetical protein F383_08256                         568   0.0      
emb|CDY42006.1|  BnaC04g00840D                                          565   0.0      
gb|KHG04052.1|  hypothetical protein F383_28592                         564   0.0      
ref|XP_004249828.2|  PREDICTED: probable glycosyltransferase At5g...    560   0.0      
ref|XP_009787886.1|  PREDICTED: probable glycosyltransferase At5g...    560   0.0      
ref|XP_008462519.1|  PREDICTED: probable glycosyltransferase At5g...    561   0.0      
ref|XP_009776098.1|  PREDICTED: probable glycosyltransferase At5g...    559   0.0      
ref|XP_010039048.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    555   0.0      
gb|KHN24379.1|  Putative glycosyltransferase                            558   0.0      
ref|XP_006339262.1|  PREDICTED: probable glycosyltransferase At5g...    556   0.0      
ref|XP_003535253.1|  PREDICTED: probable glycosyltransferase At5g...    556   0.0      
ref|XP_004249790.2|  PREDICTED: probable glycosyltransferase At5g...    555   0.0      
ref|XP_011101498.1|  PREDICTED: probable glycosyltransferase At5g...    553   0.0      
ref|XP_006339310.1|  PREDICTED: probable glycosyltransferase At5g...    550   0.0      
gb|EYU38594.1|  hypothetical protein MIMGU_mgv1a021350mg                552   0.0      
ref|XP_006398838.1|  hypothetical protein EUTSA_v10016080mg             553   0.0      
gb|KFK24839.1|  hypothetical protein AALP_AA8G031400                    551   0.0      
gb|KCW48767.1|  hypothetical protein EUGRSUZ_K02411                     544   0.0      
gb|KHN45704.1|  Putative glycosyltransferase                            543   0.0      
dbj|BAB08605.1|  unnamed protein product                                544   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490872.1|  PREDICTED: probable glycosyltransferase At5g...    548   0.0      
ref|XP_002873114.1|  hypothetical protein ARALYDRAFT_487158             548   0.0      
ref|XP_010423660.1|  PREDICTED: probable glycosyltransferase At5g...    546   0.0      
ref|NP_001031828.1|  Exostosin family protein                           546   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413449.1|  PREDICTED: probable glycosyltransferase At5g...    545   0.0      
ref|XP_006287392.1|  hypothetical protein CARUB_v10000598mg             546   0.0      
emb|CBI30213.3|  unnamed protein product                                534   0.0      
emb|CDX80888.1|  BnaC03g01420D                                          538   1e-180   
ref|XP_009130782.1|  PREDICTED: probable glycosyltransferase At5g...    537   2e-180   
emb|CDY11270.1|  BnaA03g01060D                                          531   4e-180   
ref|XP_011101497.1|  PREDICTED: probable glycosyltransferase At5g...    525   3e-176   
gb|EMT30821.1|  Exostosin-2                                             525   3e-175   
ref|XP_011094445.1|  PREDICTED: probable glycosyltransferase At5g...    523   3e-175   
ref|XP_007027565.1|  Exostosin family protein, putative                 524   8e-175   
ref|XP_008381668.1|  PREDICTED: probable glycosyltransferase At5g...    520   1e-173   
ref|XP_010252860.1|  PREDICTED: probable glycosyltransferase At3g...    518   6e-173   
ref|XP_009593673.1|  PREDICTED: probable glycosyltransferase At5g...    516   2e-172   
ref|XP_009593674.1|  PREDICTED: probable glycosyltransferase At5g...    512   3e-172   
ref|XP_008794078.1|  PREDICTED: probable glycosyltransferase At5g...    517   4e-172   
ref|XP_002320538.2|  hypothetical protein POPTR_0014s16920g             510   7e-171   Populus trichocarpa [western balsam poplar]
ref|XP_002524591.1|  catalytic, putative                                509   7e-170   Ricinus communis
ref|XP_004292405.1|  PREDICTED: probable glycosyltransferase At5g...    510   8e-170   
ref|XP_009782027.1|  PREDICTED: probable glycosyltransferase At5g...    510   1e-169   
ref|XP_009622709.1|  PREDICTED: probable glycosyltransferase At5g...    509   1e-169   
ref|XP_009782026.1|  PREDICTED: probable glycosyltransferase At5g...    509   2e-169   
ref|XP_006447859.1|  hypothetical protein CICLE_v10017948mg             509   2e-169   
ref|XP_006469477.1|  PREDICTED: probable glycosyltransferase At5g...    509   3e-169   
ref|XP_009782024.1|  PREDICTED: probable glycosyltransferase At5g...    509   3e-169   
ref|XP_009782025.1|  PREDICTED: probable glycosyltransferase At5g...    509   4e-169   
ref|XP_008237734.1|  PREDICTED: probable glycosyltransferase At5g...    504   6e-169   
ref|XP_007049438.1|  Catalytic, putative                                508   1e-168   
ref|XP_010923285.1|  PREDICTED: probable glycosyltransferase At5g...    506   2e-168   
ref|XP_011009812.1|  PREDICTED: probable glycosyltransferase At5g...    505   4e-168   
gb|EYU41560.1|  hypothetical protein MIMGU_mgv1a005355mg                504   6e-168   
ref|XP_011009813.1|  PREDICTED: probable glycosyltransferase At5g...    497   8e-167   
ref|XP_006845223.1|  hypothetical protein AMTR_s00005p00255230          497   9e-167   
emb|CBI28483.3|  unnamed protein product                                498   1e-166   
ref|XP_007145275.1|  hypothetical protein PHAVU_007G225300g             500   2e-166   
ref|XP_006357695.1|  PREDICTED: probable glycosyltransferase At5g...    499   3e-166   
ref|NP_001059081.1|  Os07g0188700                                       503   8e-166   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008796633.1|  PREDICTED: probable glycosyltransferase At5g...    499   8e-166   
ref|XP_002264076.2|  PREDICTED: probable glycosyltransferase At5g...    498   1e-165   Vitis vinifera
emb|CDP08577.1|  unnamed protein product                                498   2e-165   
ref|XP_004243882.1|  PREDICTED: probable glycosyltransferase At5g...    497   5e-165   
gb|EAZ03045.1|  hypothetical protein OsI_25187                          498   4e-164   Oryza sativa Indica Group [Indian rice]
ref|XP_010068733.1|  PREDICTED: probable glycosyltransferase At5g...    494   5e-164   
ref|XP_010048370.1|  PREDICTED: probable glycosyltransferase At3g...    494   9e-164   
ref|XP_008394205.1|  PREDICTED: probable glycosyltransferase At5g...    494   1e-163   
ref|XP_008227680.1|  PREDICTED: probable glycosyltransferase At5g...    493   3e-163   
gb|KCW89058.1|  hypothetical protein EUGRSUZ_A01384                     494   3e-163   
ref|XP_009379540.1|  PREDICTED: probable glycosyltransferase At5g...    494   3e-163   
ref|XP_009379539.1|  PREDICTED: probable glycosyltransferase At5g...    493   4e-163   
ref|XP_006354423.1|  PREDICTED: probable glycosyltransferase At5g...    492   6e-163   
ref|XP_004955715.1|  PREDICTED: probable glycosyltransferase At5g...    494   8e-163   
ref|XP_008459522.1|  PREDICTED: probable glycosyltransferase At5g...    491   1e-162   
ref|XP_010933454.1|  PREDICTED: probable glycosyltransferase At5g...    491   1e-162   
gb|AGZ15405.1|  limonene cyclase-like protein                           490   2e-162   
ref|XP_010657501.1|  PREDICTED: probable glycosyltransferase At3g...    486   3e-162   
gb|KDP22997.1|  hypothetical protein JCGZ_01719                         498   4e-162   
ref|XP_004239536.1|  PREDICTED: probable glycosyltransferase At5g...    490   5e-162   
ref|XP_008227726.1|  PREDICTED: probable glycosyltransferase At5g...    491   6e-162   
gb|AGV54221.1|  glycosyltransferase                                     488   8e-162   
ref|XP_002264111.3|  PREDICTED: probable glycosyltransferase At3g...    486   1e-161   Vitis vinifera
ref|XP_007137813.1|  hypothetical protein PHAVU_009G157700g             488   2e-161   
gb|KGN52623.1|  hypothetical protein Csa_5G647450                       488   3e-161   
gb|KEH35655.1|  exostosin family protein                                486   1e-160   
ref|XP_007216463.1|  hypothetical protein PRUPE_ppa024503mg             483   7e-160   
emb|CBI28482.3|  unnamed protein product                                488   8e-160   
ref|XP_011009816.1|  PREDICTED: probable glycosyltransferase At3g...    482   2e-159   
emb|CDP15733.1|  unnamed protein product                                482   2e-159   
ref|XP_002320537.2|  hypothetical protein POPTR_0014s16900g             481   2e-159   Populus trichocarpa [western balsam poplar]
ref|XP_004289488.1|  PREDICTED: probable glycosyltransferase At5g...    477   8e-159   
ref|XP_008229804.1|  PREDICTED: probable glycosyltransferase At3g...    479   1e-158   
ref|XP_010228257.1|  PREDICTED: probable glycosyltransferase At5g...    481   5e-158   
ref|XP_010228256.1|  PREDICTED: probable glycosyltransferase At5g...    481   5e-158   
ref|XP_009379541.1|  PREDICTED: probable glycosyltransferase At5g...    480   8e-158   
ref|XP_010246563.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    478   1e-157   
ref|XP_008342266.1|  PREDICTED: probable glycosyltransferase At3g...    476   5e-157   
ref|XP_008227724.1|  PREDICTED: probable glycosyltransferase At3g...    477   5e-157   
ref|XP_004503012.1|  PREDICTED: probable glycosyltransferase At5g...    473   9e-156   
ref|XP_009417384.1|  PREDICTED: probable glycosyltransferase At5g...    468   2e-155   
gb|KHN09672.1|  Putative glycosyltransferase                            468   2e-155   
ref|XP_011085648.1|  PREDICTED: probable glycosyltransferase At5g...    469   3e-155   
ref|XP_004305861.1|  PREDICTED: probable glycosyltransferase At3g...    468   2e-154   
ref|XP_010107365.1|  putative glycosyltransferase                       468   5e-154   
ref|XP_009361503.1|  PREDICTED: probable glycosyltransferase At3g...    468   1e-153   
ref|XP_011100587.1|  PREDICTED: probable glycosyltransferase At3g...    469   1e-153   
ref|XP_008337560.1|  PREDICTED: probable glycosyltransferase At5g...    462   3e-153   
ref|XP_003555678.1|  PREDICTED: probable glycosyltransferase At3g...    464   2e-152   
gb|KHN15414.1|  Putative glycosyltransferase                            464   3e-152   
ref|XP_006856555.1|  hypothetical protein AMTR_s00046p00174470          461   2e-150   
ref|XP_004502077.1|  PREDICTED: probable glycosyltransferase At3g...    457   3e-150   
ref|XP_007213348.1|  hypothetical protein PRUPE_ppa1027150mg            454   4e-150   
ref|XP_008652150.1|  PREDICTED: probable glycosyltransferase At5g...    461   6e-150   
ref|XP_002524592.1|  catalytic, putative                                453   1e-149   Ricinus communis
tpg|DAA59884.1|  TPA: hypothetical protein ZEAMMB73_690759              459   2e-149   
ref|XP_010096418.1|  T-complex protein 1 subunit beta                   473   3e-149   
gb|AES71688.2|  exostosin family protein                                454   4e-149   
ref|XP_003601437.1|  hypothetical protein MTR_3g080690                  454   8e-149   
gb|KEH35171.1|  exostosin family protein                                452   4e-148   
ref|XP_009759830.1|  PREDICTED: probable glycosyltransferase At3g...    452   8e-148   
emb|CDP15735.1|  unnamed protein product                                447   6e-147   
ref|XP_010905483.1|  PREDICTED: probable glycosyltransferase At5g...    449   1e-146   
ref|XP_010241628.1|  PREDICTED: probable glycosyltransferase At5g...    449   1e-146   
ref|XP_004288781.1|  PREDICTED: probable glycosyltransferase At5g...    448   2e-146   
ref|XP_002285237.2|  PREDICTED: probable glycosyltransferase At5g...    448   3e-146   Vitis vinifera
ref|XP_008794982.1|  PREDICTED: probable glycosyltransferase At5g...    448   3e-146   
ref|XP_007013571.1|  Exostosin family protein                           447   6e-146   
ref|XP_002459470.1|  hypothetical protein SORBIDRAFT_02g005180          451   8e-146   Sorghum bicolor [broomcorn]
ref|XP_006594253.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    447   1e-145   
gb|AAU04753.1|  EXO                                                     441   1e-145   Cucumis melo [Oriental melon]
gb|KHN47102.1|  Xylogalacturonan beta-1,3-xylosyltransferase            446   2e-145   
ref|XP_008242826.1|  PREDICTED: probable glycosyltransferase At5g...    446   2e-145   
ref|XP_006594254.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    446   2e-145   
ref|XP_007200373.1|  hypothetical protein PRUPE_ppa008342mg             441   2e-145   
gb|KHN47101.1|  Putative glycosyltransferase                            447   2e-145   
ref|XP_003542647.2|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    447   2e-145   
ref|XP_007202437.1|  hypothetical protein PRUPE_ppa014750mg             441   7e-145   
ref|XP_006600735.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    444   2e-144   
gb|KHG09514.1|  hypothetical protein F383_01906                         442   5e-144   
ref|XP_006400593.1|  hypothetical protein EUTSA_v10015371mg             441   6e-144   
ref|XP_009151056.1|  PREDICTED: probable glycosyltransferase At5g...    441   1e-143   
gb|EYU42789.1|  hypothetical protein MIMGU_mgv1a009597mg                436   1e-143   
ref|XP_009151057.1|  PREDICTED: probable glycosyltransferase At5g...    441   1e-143   
ref|XP_008457132.1|  PREDICTED: probable glycosyltransferase At3g...    440   1e-143   
ref|XP_007155060.1|  hypothetical protein PHAVU_003G169700g             441   3e-143   
ref|XP_008242868.1|  PREDICTED: probable glycosyltransferase At3g...    437   4e-143   
gb|KHN15048.1|  Xylogalacturonan beta-1,3-xylosyltransferase            444   6e-143   
ref|XP_007011817.1|  Exostosin family protein                           439   1e-142   
emb|CDX80499.1|  BnaC07g29450D                                          439   1e-142   
ref|XP_009393729.1|  PREDICTED: probable glycosyltransferase At5g...    437   2e-142   
ref|XP_008337219.1|  PREDICTED: probable glycosyltransferase At5g...    434   2e-142   
ref|XP_010683539.1|  PREDICTED: probable glycosyltransferase At3g...    438   2e-142   
ref|XP_010418150.1|  PREDICTED: probable glycosyltransferase At3g...    436   3e-142   
ref|XP_011020204.1|  PREDICTED: probable glycosyltransferase At5g...    437   4e-142   
ref|XP_007204886.1|  hypothetical protein PRUPE_ppa017740mg             434   6e-142   
ref|XP_007013568.1|  Exostosin family protein, putative isoform 1       437   6e-142   
ref|XP_006381108.1|  hypothetical protein POPTR_0006s06330g             437   8e-142   
ref|XP_009340668.1|  PREDICTED: probable glycosyltransferase At5g...    441   8e-142   
ref|XP_003550810.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    437   1e-141   
ref|XP_010489710.1|  PREDICTED: probable glycosyltransferase At3g...    435   1e-141   
ref|XP_007013570.1|  Exostosin family protein                           436   1e-141   
ref|XP_003550809.2|  PREDICTED: probable glycosyltransferase At3g...    434   2e-141   
gb|KCW74795.1|  hypothetical protein EUGRSUZ_E03530                     435   3e-141   
ref|XP_010519637.1|  PREDICTED: probable glycosyltransferase At5g...    434   4e-141   
ref|XP_010519636.1|  PREDICTED: probable glycosyltransferase At5g...    434   4e-141   
ref|XP_004501350.1|  PREDICTED: probable glycosyltransferase At5g...    434   6e-141   
gb|KGN60712.1|  hypothetical protein Csa_2G008045                       434   6e-141   
ref|XP_010250234.1|  PREDICTED: probable glycosyltransferase At5g...    434   7e-141   
ref|XP_006600734.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    434   7e-141   
ref|XP_010250233.1|  PREDICTED: probable glycosyltransferase At5g...    434   1e-140   
ref|XP_006299448.1|  hypothetical protein CARUB_v10015613mg             433   1e-140   
ref|NP_187419.1|  putative glycosyltransferase                          433   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006856564.1|  hypothetical protein AMTR_s00046p00183980          433   1e-140   
ref|XP_010454331.1|  PREDICTED: probable glycosyltransferase At5g...    432   1e-140   
gb|AHL38775.1|  glycosyltransferase                                     432   2e-140   
gb|KHN47103.1|  Putative glycosyltransferase                            433   2e-140   
ref|XP_006856554.1|  hypothetical protein AMTR_s00046p00173940          434   2e-140   
ref|XP_006453093.1|  hypothetical protein CICLE_v10010441mg             432   2e-140   
ref|XP_008242869.1|  PREDICTED: probable glycosyltransferase At3g...    430   3e-140   
ref|XP_006407816.1|  hypothetical protein EUTSA_v10020696mg             432   3e-140   
ref|XP_006289990.1|  hypothetical protein CARUB_v10003620mg             432   4e-140   
ref|XP_010464397.1|  PREDICTED: probable glycosyltransferase At3g...    432   4e-140   
ref|XP_002884661.1|  predicted protein                                  432   4e-140   
ref|XP_011085421.1|  PREDICTED: probable glycosyltransferase At3g...    429   4e-140   
ref|XP_011081538.1|  PREDICTED: probable glycosyltransferase At5g...    432   4e-140   
ref|XP_008443936.1|  PREDICTED: probable glycosyltransferase At5g...    432   6e-140   
ref|XP_006394779.1|  hypothetical protein EUTSA_v10004121mg             431   7e-140   
ref|XP_006287596.1|  hypothetical protein CARUB_v10000808mg             432   8e-140   
ref|XP_010059401.1|  PREDICTED: probable glycosyltransferase At3g...    431   1e-139   
gb|EYU20246.1|  hypothetical protein MIMGU_mgv1a006806mg                429   1e-139   
gb|AES91622.2|  glycosyltransferase                                     436   1e-139   
ref|XP_010454330.1|  PREDICTED: probable glycosyltransferase At5g...    430   1e-139   
ref|XP_006474664.1|  PREDICTED: probable glycosyltransferase At5g...    427   2e-139   
ref|XP_004304808.1|  PREDICTED: probable glycosyltransferase At5g...    431   2e-139   
ref|XP_006483712.1|  PREDICTED: probable glycosyltransferase At5g...    430   2e-139   
ref|XP_006450385.1|  hypothetical protein CICLE_v10008151mg             430   3e-139   
ref|XP_003541484.1|  PREDICTED: probable glycosyltransferase At3g...    429   4e-139   
ref|XP_011036587.1|  PREDICTED: probable glycosyltransferase At5g...    430   4e-139   
ref|XP_009346171.1|  PREDICTED: probable glycosyltransferase At5g...    426   4e-139   
ref|XP_010533123.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    431   5e-139   
ref|XP_011020203.1|  PREDICTED: probable glycosyltransferase At5g...    430   5e-139   
ref|XP_010533124.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    431   8e-139   
ref|XP_009346174.1|  PREDICTED: probable glycosyltransferase At5g...    429   9e-139   
ref|XP_011085420.1|  PREDICTED: probable glycosyltransferase At3g...    430   1e-138   
ref|NP_197913.4|  Exostosin family protein                              428   1e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161196.1|  hypothetical protein PHAVU_001G050100g             428   1e-138   
ref|XP_006381109.1|  hypothetical protein POPTR_0006s06340g             429   1e-138   
ref|XP_010493134.1|  PREDICTED: probable glycosyltransferase At5g...    427   2e-138   
ref|XP_006389446.1|  hypothetical protein POPTR_0025s00770g             429   2e-138   
ref|XP_004292977.1|  PREDICTED: probable glycosyltransferase At5g...    428   3e-138   
ref|XP_008385236.1|  PREDICTED: probable glycosyltransferase At3g...    428   3e-138   
ref|XP_002515489.1|  catalytic, putative                                427   4e-138   Ricinus communis
ref|XP_010491808.1|  PREDICTED: probable glycosyltransferase At5g...    427   4e-138   
ref|XP_008394108.1|  PREDICTED: probable glycosyltransferase At5g...    427   5e-138   
ref|XP_009364050.1|  PREDICTED: probable glycosyltransferase At5g...    428   5e-138   
ref|XP_009124266.1|  PREDICTED: probable glycosyltransferase At3g...    426   5e-138   
gb|KHN15047.1|  Putative glycosyltransferase                            425   6e-138   
ref|XP_010099849.1|  putative glycosyltransferase                       426   6e-138   
ref|XP_006389444.1|  hypothetical protein POPTR_0025s00750g             435   9e-138   
ref|XP_010057604.1|  PREDICTED: probable glycosyltransferase At3g...    423   1e-137   
ref|XP_011017844.1|  PREDICTED: probable glycosyltransferase At5g...    427   1e-137   
ref|XP_009355772.1|  PREDICTED: probable glycosyltransferase At5g...    426   1e-137   
ref|XP_003549738.1|  PREDICTED: probable glycosyltransferase At3g...    425   2e-137   
ref|XP_010454855.1|  PREDICTED: probable glycosyltransferase At5g...    425   2e-137   
ref|XP_010050740.1|  PREDICTED: probable glycosyltransferase At5g...    422   2e-137   
ref|XP_009121991.1|  PREDICTED: probable glycosyltransferase At5g...    425   3e-137   
gb|KHN15049.1|  Putative glycosyltransferase                            421   3e-137   
gb|KCW74792.1|  hypothetical protein EUGRSUZ_E03525                     425   3e-137   
ref|XP_008389683.1|  PREDICTED: probable glycosyltransferase At5g...    421   3e-137   
ref|XP_006582516.1|  PREDICTED: probable glycosyltransferase At5g...    419   4e-137   
ref|XP_010026197.1|  PREDICTED: probable glycosyltransferase At5g...    423   4e-137   
gb|KGN65113.1|  hypothetical protein Csa_1G226410                       424   5e-137   
gb|KCW58739.1|  hypothetical protein EUGRSUZ_H01381                     421   6e-137   
ref|XP_008336982.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    421   7e-137   
ref|XP_011020197.1|  PREDICTED: probable glycosyltransferase At5g...    425   8e-137   
emb|CDX85728.1|  BnaA02g00850D                                          423   8e-137   
ref|XP_011017849.1|  PREDICTED: probable glycosyltransferase At5g...    423   1e-136   
ref|XP_006474663.1|  PREDICTED: probable glycosyltransferase At3g...    423   1e-136   
ref|XP_011016249.1|  PREDICTED: probable glycosyltransferase At5g...    423   1e-136   
ref|XP_009802043.1|  PREDICTED: probable glycosyltransferase At5g...    423   1e-136   
ref|XP_010042007.1|  PREDICTED: probable glycosyltransferase At3g...    420   1e-136   
ref|XP_009364051.1|  PREDICTED: probable glycosyltransferase At5g...    420   1e-136   
ref|XP_010421383.1|  PREDICTED: probable glycosyltransferase At5g...    424   1e-136   
emb|CDY51109.1|  BnaCnng20120D                                          422   1e-136   
ref|NP_196674.2|  exostosin family protein                              423   2e-136   
ref|XP_002308053.2|  hypothetical protein POPTR_0006s06350g             424   2e-136   
emb|CDY60376.1|  BnaCnng36170D                                          422   2e-136   
ref|XP_002515488.1|  catalytic, putative                                422   2e-136   
ref|XP_006389445.1|  hypothetical protein POPTR_0025s00760g             422   2e-136   
ref|XP_003550812.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    422   2e-136   
ref|NP_197526.5|  Exostosin family protein                              421   3e-136   
gb|EYU20247.1|  hypothetical protein MIMGU_mgv1a024162mg                419   3e-136   
ref|XP_011020198.1|  PREDICTED: probable glycosyltransferase At5g...    423   3e-136   
sp|Q3E9A4.3|GLYT5_ARATH  RecName: Full=Probable glycosyltransfera...    422   3e-136   
ref|XP_008218430.1|  PREDICTED: probable glycosyltransferase At5g...    422   4e-136   
ref|XP_009337990.1|  PREDICTED: probable glycosyltransferase At5g...    422   4e-136   
emb|CDX92476.1|  BnaA10g15150D                                          421   4e-136   
ref|XP_009125787.1|  PREDICTED: probable glycosyltransferase At5g...    421   5e-136   
ref|XP_010453152.1|  PREDICTED: probable glycosyltransferase At5g...    422   5e-136   
gb|AES91613.2|  exostosin family protein                                421   5e-136   
ref|XP_010419667.1|  PREDICTED: probable glycosyltransferase At5g...    422   5e-136   
emb|CDY35818.1|  BnaC09g37500D                                          420   7e-136   
ref|XP_009117358.1|  PREDICTED: probable glycosyltransferase At3g...    421   8e-136   
ref|XP_008352234.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    418   9e-136   
ref|XP_002877250.1|  exostosin family protein                           419   1e-135   
ref|XP_010552074.1|  PREDICTED: probable glycosyltransferase At3g...    420   1e-135   
ref|XP_008361205.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    417   1e-135   
ref|XP_010493785.1|  PREDICTED: probable glycosyltransferase At5g...    421   2e-135   
ref|XP_009120823.1|  PREDICTED: probable glycosyltransferase At5g...    419   2e-135   
emb|CDY35820.1|  BnaC09g37520D                                          419   3e-135   
ref|XP_003609423.1|  Xylogalacturonan beta-1,3-xylosyltransferase       416   3e-135   
ref|XP_003545455.1|  PREDICTED: probable glycosyltransferase At5g...    419   4e-135   
ref|XP_009131787.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    419   4e-135   
ref|XP_003603357.1|  hypothetical protein MTR_3g106690                  416   4e-135   
ref|XP_008337135.1|  PREDICTED: probable glycosyltransferase At5g...    418   6e-135   
ref|XP_010520570.1|  PREDICTED: probable glycosyltransferase At5g...    419   6e-135   
ref|XP_008336981.1|  PREDICTED: probable glycosyltransferase At3g...    416   6e-135   
ref|XP_006856553.1|  hypothetical protein AMTR_s00046p00173420          413   7e-135   
ref|XP_009337989.1|  PREDICTED: probable glycosyltransferase At5g...    419   9e-135   
ref|XP_007205109.1|  hypothetical protein PRUPE_ppa004757mg             419   1e-134   
ref|XP_007204648.1|  hypothetical protein PRUPE_ppa001571mg             429   1e-134   
ref|XP_004138850.1|  PREDICTED: probable glycosyltransferase At5g...    417   1e-134   
ref|XP_004139407.1|  PREDICTED: probable glycosyltransferase At3g...    417   1e-134   
emb|CBI21065.3|  unnamed protein product                                415   1e-134   
ref|XP_007155062.1|  hypothetical protein PHAVU_003G169900g             417   1e-134   
emb|CDX97082.1|  BnaC09g45430D                                          418   1e-134   
ref|XP_004508620.1|  PREDICTED: probable glycosyltransferase At3g...    417   2e-134   
ref|XP_008218534.1|  PREDICTED: probable glycosyltransferase At5g...    421   3e-134   
ref|XP_003549290.1|  PREDICTED: probable glycosyltransferase At5g...    417   4e-134   
ref|XP_010696519.1|  PREDICTED: probable glycosyltransferase At5g...    416   5e-134   
ref|XP_002285239.2|  PREDICTED: probable glycosyltransferase At5g...    416   6e-134   
gb|KCW44366.1|  hypothetical protein EUGRSUZ_L02165                     412   1e-133   
ref|XP_008445236.1|  PREDICTED: probable glycosyltransferase At5g...    415   1e-133   
ref|XP_010250231.1|  PREDICTED: probable glycosyltransferase At5g...    416   1e-133   
ref|XP_010250232.1|  PREDICTED: probable glycosyltransferase At5g...    415   1e-133   
ref|XP_006399613.1|  hypothetical protein EUTSA_v10013399mg             415   2e-133   
ref|XP_003609425.1|  Xylogalacturonan beta-1,3-xylosyltransferase       420   2e-133   
ref|XP_010520568.1|  PREDICTED: probable glycosyltransferase At3g...    415   2e-133   
ref|XP_004508619.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    414   2e-133   
ref|XP_002531945.1|  catalytic, putative                                414   2e-133   
emb|CDY13789.1|  BnaA09g42910D                                          411   3e-133   
ref|XP_006453094.1|  hypothetical protein CICLE_v10010628mg             424   3e-133   
ref|XP_011020199.1|  PREDICTED: probable glycosyltransferase At5g...    415   3e-133   
ref|XP_011015263.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    414   4e-133   
ref|XP_010041414.1|  PREDICTED: probable glycosyltransferase At5g...    414   8e-133   
ref|XP_007155059.1|  hypothetical protein PHAVU_003G169600g             412   9e-133   
ref|XP_010520569.1|  PREDICTED: probable glycosyltransferase At3g...    413   1e-132   
ref|XP_008352110.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    410   1e-132   
ref|XP_008370810.1|  PREDICTED: probable glycosyltransferase At5g...    412   1e-132   
ref|XP_009340649.1|  PREDICTED: probable glycosyltransferase At5g...    412   1e-132   
emb|CDX76960.1|  BnaC08g35460D                                          412   1e-132   
gb|EPS67004.1|  hypothetical protein M569_07774                         407   1e-132   
ref|XP_010050741.1|  PREDICTED: probable glycosyltransferase At5g...    412   2e-132   
ref|XP_008370808.1|  PREDICTED: probable glycosyltransferase At5g...    412   2e-132   
ref|XP_010314106.1|  PREDICTED: probable glycosyltransferase At3g...    411   3e-132   
ref|XP_007206344.1|  hypothetical protein PRUPE_ppa017605mg             411   3e-132   
ref|XP_007137001.1|  hypothetical protein PHAVU_009G091800g             411   4e-132   
ref|XP_009337993.1|  PREDICTED: probable glycosyltransferase At5g...    411   4e-132   
ref|XP_002324873.2|  hypothetical protein POPTR_0018s01950g             408   5e-132   
ref|XP_010541615.1|  PREDICTED: probable glycosyltransferase At5g...    411   5e-132   
ref|XP_009615070.1|  PREDICTED: probable glycosyltransferase At5g...    411   5e-132   
ref|XP_009337994.1|  PREDICTED: probable glycosyltransferase At3g...    409   6e-132   
ref|XP_008218431.1|  PREDICTED: probable glycosyltransferase At5g...    410   9e-132   
ref|XP_009407372.1|  PREDICTED: probable glycosyltransferase At5g...    411   9e-132   
ref|XP_009338023.1|  PREDICTED: probable glycosyltransferase At5g...    410   1e-131   
ref|XP_010491807.1|  PREDICTED: probable glycosyltransferase At5g...    411   2e-131   
emb|CDO99716.1|  unnamed protein product                                408   2e-131   
ref|XP_004498960.1|  PREDICTED: probable glycosyltransferase At5g...    409   3e-131   
ref|XP_009802047.1|  PREDICTED: probable glycosyltransferase At5g...    407   3e-131   
emb|CDP10462.1|  unnamed protein product                                404   3e-131   
emb|CDP13539.1|  unnamed protein product                                411   4e-131   
ref|XP_004302151.1|  PREDICTED: probable glycosyltransferase At5g...    408   7e-131   
ref|XP_002324871.2|  exostosin family protein                           403   9e-131   
ref|XP_006396181.1|  hypothetical protein EUTSA_v10002345mg             407   1e-130   
gb|KHN15046.1|  Xylogalacturonan beta-1,3-xylosyltransferase            405   1e-130   
ref|XP_007011816.1|  Exostosin family protein                           407   1e-130   
ref|XP_011036586.1|  PREDICTED: probable glycosyltransferase At5g...    407   2e-130   
ref|XP_010908761.1|  PREDICTED: probable glycosyltransferase At5g...    407   2e-130   
ref|XP_006483713.1|  PREDICTED: probable glycosyltransferase At5g...    406   3e-130   
ref|XP_008219689.1|  PREDICTED: probable glycosyltransferase At5g...    407   3e-130   
ref|XP_004508451.1|  PREDICTED: probable glycosyltransferase At5g...    403   3e-130   
ref|XP_006450384.1|  hypothetical protein CICLE_v10010549mg             403   3e-130   
ref|XP_006279358.1|  hypothetical protein CARUB_v10008022mg             406   4e-130   
ref|XP_010687902.1|  PREDICTED: probable glycosyltransferase At5g...    406   6e-130   
gb|ABA18105.1|  exostosin family protein                                403   1e-129   
ref|XP_006582483.1|  PREDICTED: probable glycosyltransferase At5g...    405   1e-129   
ref|XP_006345278.1|  PREDICTED: probable glycosyltransferase At5g...    402   1e-129   
gb|KCW80354.1|  hypothetical protein EUGRSUZ_C01719                     399   2e-129   
ref|XP_006286824.1|  hypothetical protein CARUB_v10003769mg             404   3e-129   
emb|CBI25537.3|  unnamed protein product                                404   3e-129   
ref|XP_010656546.1|  PREDICTED: probable glycosyltransferase At3g...    402   8e-129   
ref|XP_002264922.2|  PREDICTED: probable glycosyltransferase At5g...    402   1e-128   
ref|XP_002264880.2|  PREDICTED: probable glycosyltransferase At5g...    401   2e-128   
ref|XP_007155061.1|  hypothetical protein PHAVU_003G169800g             401   2e-128   
emb|CBI25529.3|  unnamed protein product                                398   3e-128   
ref|XP_004288780.1|  PREDICTED: probable glycosyltransferase At5g...    401   5e-128   
ref|XP_004287275.1|  PREDICTED: probable glycosyltransferase At5g...    401   6e-128   
gb|ABG48476.1|  At3g42180                                               399   7e-128   
ref|XP_009355880.1|  PREDICTED: probable glycosyltransferase At5g...    397   9e-128   
ref|NP_189804.4|  Exostosin family protein                              400   9e-128   
ref|XP_008794981.1|  PREDICTED: probable glycosyltransferase At5g...    397   1e-127   
ref|XP_006345657.1|  PREDICTED: probable glycosyltransferase At5g...    400   1e-127   
ref|XP_006353139.1|  PREDICTED: probable glycosyltransferase At3g...    400   3e-127   
ref|XP_002871458.1|  exostosin family protein                           393   4e-127   
ref|XP_002872156.1|  exostosin family protein                           393   4e-127   
ref|XP_002989572.1|  xylosyltransferase-like protein                    393   4e-127   
ref|XP_004244985.2|  PREDICTED: probable glycosyltransferase At5g...    398   5e-127   
ref|XP_002266646.2|  PREDICTED: probable glycosyltransferase At5g...    398   6e-127   
ref|XP_010667144.1|  PREDICTED: probable glycosyltransferase At5g...    395   6e-127   
ref|XP_002873987.1|  hypothetical protein ARALYDRAFT_326421             404   7e-127   
ref|XP_010435386.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    399   1e-126   
ref|XP_004166098.1|  PREDICTED: probable glycosyltransferase At5g...    393   1e-126   
emb|CAB96648.1|  putative protein                                       392   1e-126   
gb|KFK27864.1|  hypothetical protein AALP_AA8G439100                    398   1e-126   
gb|AHL38607.1|  glycosyltransferase                                     392   1e-126   
ref|XP_010454857.1|  PREDICTED: probable glycosyltransferase At5g...    397   1e-126   
gb|KDP42268.1|  hypothetical protein JCGZ_01592                         394   1e-126   
ref|XP_002964241.1|  xylosyltransferase-like protein                    392   2e-126   
ref|XP_010514701.1|  PREDICTED: probable glycosyltransferase At3g...    397   2e-126   
ref|XP_008364067.1|  PREDICTED: probable glycosyltransferase At5g...    403   4e-126   
ref|XP_007013569.1|  Exostosin family protein isoform 2                 390   5e-126   
gb|KFK38224.1|  hypothetical protein AALP_AA3G084800                    393   1e-125   
ref|XP_010435387.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    396   1e-125   
ref|XP_008645924.1|  PREDICTED: probable glycosyltransferase At5g...    394   1e-125   
gb|KCW80353.1|  hypothetical protein EUGRSUZ_C01718                     389   1e-125   
emb|CDX88845.1|  BnaA03g08040D                                          403   1e-125   
ref|XP_002266490.3|  PREDICTED: probable glycosyltransferase At5g...    396   1e-125   
ref|XP_010425790.1|  PREDICTED: probable glycosyltransferase At3g...    394   2e-125   
emb|CBI25530.3|  unnamed protein product                                390   2e-125   
ref|XP_010449641.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    395   2e-125   
ref|XP_004292976.1|  PREDICTED: probable glycosyltransferase At5g...    391   2e-125   
ref|XP_009592269.1|  PREDICTED: probable glycosyltransferase At3g...    393   3e-125   
ref|XP_009362346.1|  PREDICTED: probable glycosyltransferase At5g...    395   3e-125   
emb|CDY22124.1|  BnaC01g39770D                                          398   3e-125   
ref|XP_010449642.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    394   7e-125   
gb|KHN31216.1|  Putative glycosyltransferase                            387   8e-125   
ref|XP_007226606.1|  hypothetical protein PRUPE_ppa023392mg             391   1e-124   
ref|XP_010096841.1|  putative glycosyltransferase                       387   1e-124   
ref|XP_006283529.1|  hypothetical protein CARUB_v10004583mg             393   1e-124   
ref|XP_010111057.1|  putative glycosyltransferase                       392   2e-124   
ref|XP_001767347.1|  predicted protein                                  386   2e-124   
ref|XP_006283528.1|  hypothetical protein CARUB_v10004583mg             393   2e-124   
gb|KHN33893.1|  Putative glycosyltransferase                            386   3e-124   
ref|XP_002308055.2|  hypothetical protein POPTR_0006s06360g             386   3e-124   
gb|KDP33570.1|  hypothetical protein JCGZ_07141                         391   4e-124   
gb|KDP30240.1|  hypothetical protein JCGZ_17022                         385   5e-124   
ref|XP_010687901.1|  PREDICTED: probable glycosyltransferase At5g...    387   5e-124   
gb|EPS58814.1|  hypothetical protein M569_15998                         385   7e-124   
ref|XP_010493786.1|  PREDICTED: probable glycosyltransferase At5g...    389   7e-124   
gb|EMT14849.1|  Exostosin-1c                                            389   1e-123   
gb|AHL38617.1|  glycosyltransferase                                     384   1e-123   
gb|KDO73474.1|  hypothetical protein CISIN_1g048345mg                   384   2e-123   
ref|XP_010440684.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    390   2e-123   
gb|KFK38225.1|  hypothetical protein AALP_AA3G084800                    387   3e-123   
ref|XP_002870405.1|  hypothetical protein ARALYDRAFT_493575             389   3e-123   
gb|KDO61791.1|  hypothetical protein CISIN_1g038832mg                   383   4e-123   
gb|AFW85605.1|  hypothetical protein ZEAMMB73_586394                    389   6e-123   
emb|CDY12392.1|  BnaC08g08130D                                          389   6e-123   
ref|XP_009108067.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    389   7e-123   
ref|XP_008219690.1|  PREDICTED: probable glycosyltransferase At5g...    386   1e-122   
ref|XP_010450333.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    388   1e-122   
ref|XP_011082204.1|  PREDICTED: probable glycosyltransferase At5g...    384   1e-122   
gb|KHN26915.1|  Putative glycosyltransferase                            381   2e-122   
gb|EAY86665.1|  hypothetical protein OsI_08049                          386   3e-122   
ref|NP_198314.2|  xylogalacturonan beta-1,3-xylosyltransferase          387   3e-122   
dbj|BAK03842.1|  predicted protein                                      384   7e-122   
ref|XP_009108068.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    387   7e-122   
gb|AES91621.2|  glycosyltransferase                                     380   8e-122   
ref|XP_007223103.1|  hypothetical protein PRUPE_ppa007120mg             381   9e-122   
ref|XP_003609416.1|  Xylogalacturonan beta-1,3-xylosyltransferase       381   1e-121   
ref|XP_003561022.1|  PREDICTED: probable glycosyltransferase At5g...    384   2e-121   
ref|NP_001052025.1|  Os04g0109900                                       382   2e-121   
emb|CDX69782.1|  BnaA10g21310D                                          390   2e-121   
emb|CAH67778.1|  H0201G08.5                                             382   3e-121   
emb|CBI25528.3|  unnamed protein product                                395   4e-121   
ref|XP_006395978.1|  hypothetical protein EUTSA_v10004530mg             378   5e-121   
gb|EYU23547.1|  hypothetical protein MIMGU_mgv1a009659mg                377   8e-121   
ref|XP_008660691.1|  PREDICTED: probable glycosyltransferase At5g...    390   3e-120   
ref|XP_009363968.1|  PREDICTED: probable glycosyltransferase At3g...    374   1e-119   
gb|KHG16877.1|  Xylogalacturonan beta-1,3-xylosyltransferase -lik...    374   1e-119   
ref|XP_002531944.1|  catalytic, putative                                373   5e-119   
ref|XP_010496528.1|  PREDICTED: probable glycosyltransferase At3g...    371   2e-118   



>ref|XP_009779883.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=550

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/432 (81%), Positives = 385/432 (89%), Gaps = 3/432 (1%)
 Frame = +1

Query  553   ESQEIQQPDIQKEENLNisssipsiisssNET-GTPLQVTIKRKFRNLERLEANLGKARA  729
             E+QEIQQP IQK E+ NIS  IP    S NET   P++  IKRKF NLERLEA L K+RA
Sbjct  119   EAQEIQQPVIQKNESFNISLDIPHEFPSLNETHALPIETRIKRKFSNLERLEAKLWKSRA  178

Query  730   AIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCK  909
             +I+ A    NQTDD DYVP+GP+YWNAN FHRSYLEMEKQFK+FVYEEG+ P+FHNGPCK
Sbjct  179   SIKEAAMSGNQTDDSDYVPSGPMYWNANAFHRSYLEMEKQFKVFVYEEGDQPIFHNGPCK  238

Query  910   SIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTV  1089
             SIYA EGNFIY MET+ FRTRDPEKAH+FFLPIS+TAIVHF+YDR+  ++EHW PMKQT+
Sbjct  239   SIYAMEGNFIYQMETTKFRTRDPEKAHIFFLPISVTAIVHFIYDRN--SREHWNPMKQTL  296

Query  1090  SDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKP  1269
              DYINLVAGKY YWNRSLGADHF+LACHDWGPEISKAVPELFKNSIRALCNANTSEGFKP
Sbjct  297   RDYINLVAGKYPYWNRSLGADHFILACHDWGPEISKAVPELFKNSIRALCNANTSEGFKP  356

Query  1270  SKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVH  1449
             SKDVS PEILLPGGTM GLIGGPSPSRRSILAFFAGGLHGPIRPILL+HWENKD+D+QVH
Sbjct  357   SKDVSFPEILLPGGTMDGLIGGPSPSRRSILAFFAGGLHGPIRPILLDHWENKDDDMQVH  416

Query  1450  RYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWK  1629
             RYLPKG+SYY MLRK+K+C+CPSGYEVASPRMVEALYTGCVPVL+KDHYV PFSDVLNWK
Sbjct  417   RYLPKGVSYYGMLRKSKYCLCPSGYEVASPRMVEALYTGCVPVLLKDHYVPPFSDVLNWK  476

Query  1630  SFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAW  1809
             SFSVEVPVE+IPNLK IL GIS R+YIRLQRRG   RRHFEVNLPPKRYDV HMILHS W
Sbjct  477   SFSVEVPVEEIPNLKNILAGISTRQYIRLQRRGKQVRRHFEVNLPPKRYDVFHMILHSIW  536

Query  1810  LRRLNVRLHGIE  1845
             LRRLN+RL G+E
Sbjct  537   LRRLNMRLRGVE  548



>ref|XP_009617934.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana tomentosiformis]
Length=549

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/433 (81%), Positives = 381/433 (88%), Gaps = 4/433 (1%)
 Frame = +1

Query  553   ESQEIQQPDIQKEENLNisssipsiis-ssNET-GTPLQVTIKRKFRNLERLEANLGKAR  726
             E QEIQQP IQK E+ NI S        S NET   P++  IKRKF NLERLEA LGK R
Sbjct  117   ELQEIQQPVIQKNESFNIISYDKPHEFPSLNETHALPIETRIKRKFSNLERLEAKLGKFR  176

Query  727   AAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPC  906
             AAI+ A    NQTDD DY+P+GP+YWNAN FHRSYLEMEKQFK+FVYEEG+ P+FHNGPC
Sbjct  177   AAIKEAATSGNQTDDADYIPSGPMYWNANAFHRSYLEMEKQFKVFVYEEGDQPIFHNGPC  236

Query  907   KSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQT  1086
             KSIYA EGNFIY MET+ FRTRDPEKAH+FFLPIS+TAIVHF+YDR+  +KEHW PMKQT
Sbjct  237   KSIYAMEGNFIYQMETTKFRTRDPEKAHIFFLPISVTAIVHFIYDRN--SKEHWNPMKQT  294

Query  1087  VSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFK  1266
             + DYINLVAGKY YWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFK
Sbjct  295   LRDYINLVAGKYPYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFK  354

Query  1267  PSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQV  1446
             PSKDVS PEILLPGGTM GLIGGPSPS RSILAFFAGGLHGPIRPILLEHWENKD+D+QV
Sbjct  355   PSKDVSFPEILLPGGTMDGLIGGPSPSHRSILAFFAGGLHGPIRPILLEHWENKDDDIQV  414

Query  1447  HRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNW  1626
             HRYLPKG+SYY MLRK+K+C+CPSGYEVASPRMVEALYTGCVPVLIKDHYV PFSDVLNW
Sbjct  415   HRYLPKGVSYYGMLRKSKYCLCPSGYEVASPRMVEALYTGCVPVLIKDHYVLPFSDVLNW  474

Query  1627  KSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSA  1806
             KSFSVEV VE+IPNLKKIL GIS R+YIRLQRRG   RRHFEVN+PPKRYDV HMILHS 
Sbjct  475   KSFSVEVLVEEIPNLKKILAGISTRQYIRLQRRGKQVRRHFEVNMPPKRYDVFHMILHSI  534

Query  1807  WLRRLNVRLHGIE  1845
             WLRRLN+R+ G+E
Sbjct  535   WLRRLNMRIRGVE  547



>ref|XP_009617933.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana tomentosiformis]
Length=550

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/434 (81%), Positives = 381/434 (88%), Gaps = 5/434 (1%)
 Frame = +1

Query  553   ESQEIQQPD-IQKEENLNisssipsiis-ssNET-GTPLQVTIKRKFRNLERLEANLGKA  723
             E QEIQQP  IQK E+ NI S        S NET   P++  IKRKF NLERLEA LGK 
Sbjct  117   ELQEIQQPQVIQKNESFNIISYDKPHEFPSLNETHALPIETRIKRKFSNLERLEAKLGKF  176

Query  724   RAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGP  903
             RAAI+ A    NQTDD DY+P+GP+YWNAN FHRSYLEMEKQFK+FVYEEG+ P+FHNGP
Sbjct  177   RAAIKEAATSGNQTDDADYIPSGPMYWNANAFHRSYLEMEKQFKVFVYEEGDQPIFHNGP  236

Query  904   CKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQ  1083
             CKSIYA EGNFIY MET+ FRTRDPEKAH+FFLPIS+TAIVHF+YDR+  +KEHW PMKQ
Sbjct  237   CKSIYAMEGNFIYQMETTKFRTRDPEKAHIFFLPISVTAIVHFIYDRN--SKEHWNPMKQ  294

Query  1084  TVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGF  1263
             T+ DYINLVAGKY YWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGF
Sbjct  295   TLRDYINLVAGKYPYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGF  354

Query  1264  KPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQ  1443
             KPSKDVS PEILLPGGTM GLIGGPSPS RSILAFFAGGLHGPIRPILLEHWENKD+D+Q
Sbjct  355   KPSKDVSFPEILLPGGTMDGLIGGPSPSHRSILAFFAGGLHGPIRPILLEHWENKDDDIQ  414

Query  1444  VHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLN  1623
             VHRYLPKG+SYY MLRK+K+C+CPSGYEVASPRMVEALYTGCVPVLIKDHYV PFSDVLN
Sbjct  415   VHRYLPKGVSYYGMLRKSKYCLCPSGYEVASPRMVEALYTGCVPVLIKDHYVLPFSDVLN  474

Query  1624  WKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHS  1803
             WKSFSVEV VE+IPNLKKIL GIS R+YIRLQRRG   RRHFEVN+PPKRYDV HMILHS
Sbjct  475   WKSFSVEVLVEEIPNLKKILAGISTRQYIRLQRRGKQVRRHFEVNMPPKRYDVFHMILHS  534

Query  1804  AWLRRLNVRLHGIE  1845
              WLRRLN+R+ G+E
Sbjct  535   IWLRRLNMRIRGVE  548



>ref|XP_006366795.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=519

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/433 (80%), Positives = 382/433 (88%), Gaps = 4/433 (1%)
 Frame = +1

Query  553   ESQEIQQPDI-QKEENLNisssipsiisssNET-GTPLQVTIKRKFRNLERLEANLGKAR  726
             E QE Q+P I QK E  NIS   P  + S NET   P+++ IK+KF NLE+LE  LGKAR
Sbjct  87    EFQENQKPVITQKNETFNISLEKPHELPSLNETHALPIELKIKKKFTNLEKLEVKLGKAR  146

Query  727   AAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPC  906
             AAI+ A    NQTDD DYVP+GP+YWN   FHRSYLEMEK+FK+FVYEEGE P+FHNGPC
Sbjct  147   AAIKEAAVSGNQTDDSDYVPSGPMYWNPKAFHRSYLEMEKEFKVFVYEEGEQPIFHNGPC  206

Query  907   KSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQT  1086
             KSIYA EGNFIY METS FRTRDPEKAHVFFLPIS+T+IVHF+YDR+  ++EHW PMKQT
Sbjct  207   KSIYAMEGNFIYQMETSKFRTRDPEKAHVFFLPISVTSIVHFIYDRN--SREHWNPMKQT  264

Query  1087  VSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFK  1266
             ++DYINLV+GKY YWNRSLGADHFMLACHDWGPE+SKAVPELFKNSIRALCNANTSEGFK
Sbjct  265   LTDYINLVSGKYPYWNRSLGADHFMLACHDWGPELSKAVPELFKNSIRALCNANTSEGFK  324

Query  1267  PSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQV  1446
             PSKDVS PEILLPGGTM+GLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKD+D+QV
Sbjct  325   PSKDVSFPEILLPGGTMNGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDDDIQV  384

Query  1447  HRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNW  1626
             HRYLPKG+SYY MLR +KFC+CPSGYEVASPRMVEALYTGCVPVL+KDHYV PFSDVLNW
Sbjct  385   HRYLPKGVSYYGMLRNSKFCLCPSGYEVASPRMVEALYTGCVPVLLKDHYVPPFSDVLNW  444

Query  1627  KSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSA  1806
             KSFSVEVPV+ IP+LKKIL GIS R+YIRLQRRG   RRHFEVN+ P+RYDV HMILHS 
Sbjct  445   KSFSVEVPVDRIPDLKKILAGISTRQYIRLQRRGKQVRRHFEVNMIPQRYDVFHMILHSV  504

Query  1807  WLRRLNVRLHGIE  1845
             WLRRLN+RLHG+E
Sbjct  505   WLRRLNMRLHGLE  517



>ref|XP_010325948.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Solanum lycopersicum]
Length=535

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/430 (79%), Positives = 375/430 (87%), Gaps = 3/430 (1%)
 Frame = +1

Query  559   QEIQQPDIQKEENLNisssipsiisssNET-GTPLQVTIKRKFRNLERLEANLGKARAAI  735
             QE QQ   QK    NIS   P  +SS NET    ++  IK+KF NLE+LE  LGKARAAI
Sbjct  106   QENQQVITQKNVTFNISLEKPHELSSLNETHALQIEPKIKKKFTNLEKLEVKLGKARAAI  165

Query  736   RAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSI  915
             + A    NQTDD DYVP+GP+YWNA  FHRSYLEMEK+ K+FVYEEGE P+FHNGPCKSI
Sbjct  166   KEAATFGNQTDDSDYVPSGPMYWNAKAFHRSYLEMEKELKVFVYEEGEQPIFHNGPCKSI  225

Query  916   YASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSD  1095
             YA EGNFIY METS FRTRDPEKAHVFFLPIS+T+IVHF+YDR  +++ HW PM+QTV D
Sbjct  226   YAMEGNFIYQMETSKFRTRDPEKAHVFFLPISVTSIVHFIYDR--NSRGHWDPMRQTVMD  283

Query  1096  YINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSK  1275
             YINLV+GKY YWNRSLGADHFMLACHDWGPE+SK+VPELFKNSIRALCNANTSEGFKPSK
Sbjct  284   YINLVSGKYPYWNRSLGADHFMLACHDWGPELSKSVPELFKNSIRALCNANTSEGFKPSK  343

Query  1276  DVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRY  1455
             DVS PEILLPGGTM+GL+GGPSPSRRSILAFFAGGLHGPIRPILLEHWENKD+D+QVH+Y
Sbjct  344   DVSFPEILLPGGTMNGLLGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDDDIQVHKY  403

Query  1456  LPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSF  1635
             LPKG+SYY MLR +KFC+CPSGYEVASPRMVEALYTGCVPVL+KDHYV PFSDVLNWKSF
Sbjct  404   LPKGVSYYGMLRNSKFCLCPSGYEVASPRMVEALYTGCVPVLLKDHYVPPFSDVLNWKSF  463

Query  1636  SVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLR  1815
             SVEVPV+ IP+LKKIL+GIS R+YIRLQRRG   RRHFEVN+  KRYDV HMILHS WLR
Sbjct  464   SVEVPVDRIPDLKKILSGISTRQYIRLQRRGKQVRRHFEVNMFAKRYDVFHMILHSVWLR  523

Query  1816  RLNVRLHGIE  1845
             RLN+RLHG+E
Sbjct  524   RLNMRLHGLE  533



>ref|XP_004246587.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Solanum lycopersicum]
Length=534

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/435 (78%), Positives = 377/435 (87%), Gaps = 6/435 (1%)
 Frame = +1

Query  553   ESQEIQQPD---IQKEENLNisssipsiisssNET-GTPLQVTIKRKFRNLERLEANLGK  720
             ESQE  Q +    QK    NIS   P  +SS NET    ++  IK+KF NLE+LE  LGK
Sbjct  100   ESQEQFQENQVITQKNVTFNISLEKPHELSSLNETHALQIEPKIKKKFTNLEKLEVKLGK  159

Query  721   ARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNG  900
             ARAAI+ A    NQTDD DYVP+GP+YWNA  FHRSYLEMEK+ K+FVYEEGE P+FHNG
Sbjct  160   ARAAIKEAATFGNQTDDSDYVPSGPMYWNAKAFHRSYLEMEKELKVFVYEEGEQPIFHNG  219

Query  901   PCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMK  1080
             PCKSIYA EGNFIY METS FRTRDPEKAHVFFLPIS+T+IVHF+YDR  +++ HW PM+
Sbjct  220   PCKSIYAMEGNFIYQMETSKFRTRDPEKAHVFFLPISVTSIVHFIYDR--NSRGHWDPMR  277

Query  1081  QTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEG  1260
             QTV DYINLV+GKY YWNRSLGADHFMLACHDWGPE+SK+VPELFKNSIRALCNANTSEG
Sbjct  278   QTVMDYINLVSGKYPYWNRSLGADHFMLACHDWGPELSKSVPELFKNSIRALCNANTSEG  337

Query  1261  FKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDV  1440
             FKPSKDVS PEILLPGGTM+GL+GGPSPSRRSILAFFAGGLHGPIRPILLEHWENKD+D+
Sbjct  338   FKPSKDVSFPEILLPGGTMNGLLGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDDDI  397

Query  1441  QVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVL  1620
             QVH+YLPKG+SYY MLR +KFC+CPSGYEVASPRMVEALYTGCVPVL+KDHYV PFSDVL
Sbjct  398   QVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRMVEALYTGCVPVLLKDHYVPPFSDVL  457

Query  1621  NWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILH  1800
             NWKSFSVEVPV+ IP+LKKIL+GIS R+YIRLQRRG   RRHFEVN+  KRYDV HMILH
Sbjct  458   NWKSFSVEVPVDRIPDLKKILSGISTRQYIRLQRRGKQVRRHFEVNMFAKRYDVFHMILH  517

Query  1801  SAWLRRLNVRLHGIE  1845
             S WLRRLN+RLHG+E
Sbjct  518   SVWLRRLNMRLHGLE  532



>ref|XP_011094446.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=559

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/568 (63%), Positives = 424/568 (75%), Gaps = 25/568 (4%)
 Frame = +1

Query  196   MEGLKKRVWKssssssssTRLLWITAPllilvglvlalgSSKASSTWVFADSYYPWSWGP  375
             MEG K+RV     +SSSSTR+L    PL+++ GLV+    S  SS W+FA +YYPW+W  
Sbjct  1     MEGCKRRVCSWWKTSSSSTRVLGFILPLMVVSGLVVL--VSSKSSNWLFASNYYPWAWSS  58

Query  376   FLARDNQIpgspppppppndsstqppsTFPSVVPPDNGGGG--------------KILAY  513
              L        S       N SS       P   PPD+GG G              + ++ 
Sbjct  59    VLP-GASFSSSGIYGSFENTSSGLIKGFAP---PPDDGGSGLELRRRVVGGGERQEAISV  114

Query  514   NSSINS-STSPLHFESQEIQQP-DIQKEENLNisssipsiisssNETGTPLQVTIKRKFR  687
             + +++  +  PL  E  E + P + +KE+ +  ++       S +    PL   I R+F 
Sbjct  115   DYNLHRIAAPPLAIEVGEAEPPVEKRKEDFILTTNFSNVPPPSKDNRLLPLSSRIHRRFS  174

Query  688   NLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVY  867
             NLE LEA L +ARAAIR A  G N   D DY+PTGP+YWN + FHRSYLEMEK FK+FVY
Sbjct  175   NLEILEATLQQARAAIRDAQRG-NPAYDPDYIPTGPIYWNPSGFHRSYLEMEKHFKVFVY  233

Query  868   EEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
             EEGE P+FHNGPC SIY+ EGNFIY +ETS FRTRDPE+AHV+FLP S+T+IVHF+YD+ 
Sbjct  234   EEGEQPIFHNGPCGSIYSMEGNFIYKLETSKFRTRDPERAHVYFLPFSVTSIVHFIYDKR  293

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
             VH  +HWLPMKQTV DY++LVAGKY YWNRS+G+DH ML+CHDWGPE+SK++PELFKNSI
Sbjct  294   VH--DHWLPMKQTVKDYVDLVAGKYPYWNRSIGSDHVMLSCHDWGPELSKSLPELFKNSI  351

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPIL  1407
             RALCNANTSEGF+PSKDVSIPEI LPGG  +GLIGGPSPS+R IL FFAGGLHGPIRPIL
Sbjct  352   RALCNANTSEGFRPSKDVSIPEINLPGGRTNGLIGGPSPSKRPILVFFAGGLHGPIRPIL  411

Query  1408  LEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIK  1587
             LEHWENK  DVQVHRYLPK +SY  M+RK++FCICPSGYEVASPRMVEALYTGCVPVLIK
Sbjct  412   LEHWENKGQDVQVHRYLPKDVSYSAMMRKSRFCICPSGYEVASPRMVEALYTGCVPVLIK  471

Query  1588  DHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPP  1767
             DHYV PFSDVLNWKSFSVE+ V DIPNLKKILTGIS R+YIR+QRRG+  RRHFEVNL P
Sbjct  472   DHYVPPFSDVLNWKSFSVEISVADIPNLKKILTGISMRQYIRMQRRGVAVRRHFEVNLSP  531

Query  1768  KRYDVTHMILHSAWLRRLNVRLHGIEDT  1851
             KRYDV HM LHS WLRRLN+RLHG+ED+
Sbjct  532   KRYDVFHMTLHSIWLRRLNIRLHGVEDS  559



>gb|EYU41561.1| hypothetical protein MIMGU_mgv1a004154mg [Erythranthe guttata]
Length=541

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/557 (61%), Positives = 413/557 (74%), Gaps = 23/557 (4%)
 Frame = +1

Query  196   MEGLKKRVWKssssssssTRLLWITAPllilvglvlalgSSKASSTWVFADSYYPWSWGP  375
             MEG +K V     ++SSSTRLL    PL+++  +V+ +G +  SS W F   +YPW+WG 
Sbjct  1     MEGCRKSVCSWWKTASSSTRLLGFMLPLMVVSVMVVLMGYN--SSNWFFDSGFYPWAWGS  58

Query  376   FLARDNQIpgspppppppndsstqppsTFPSVVPPDNGGGGK-----ILAYNSSINSSTS  540
                          PPP              +VV    GGGG+     ++ YN    S+  
Sbjct  59    VYPPRAPFSQGFVPPPADGGIDAFQWRQ--TVV----GGGGEREEALVVDYNLH-RSAAP  111

Query  541   PLHFESQEIQQPDIQKEENLNisssipsiisssNETGTPLQVTIKRKFRNLERLEANLGK  720
             PL  +    + P  +K ++L     + +   SS+    PL   I R+F NL+ LEA + +
Sbjct  112   PLSIQVSAAEPPVTKKNDDL-----MNATNKSSDSRVLPLSPGINRRFSNLQILEAKMQQ  166

Query  721   ARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNG  900
             +R AIR A    +   D DYVP+GP+YWN + FHRSYLEMEK FK+FVYEEGE P+FHNG
Sbjct  167   SRTAIRDA-RKESVIHDPDYVPSGPIYWNPSAFHRSYLEMEKNFKVFVYEEGEHPIFHNG  225

Query  901   PCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMK  1080
             PC SIY+ EGNFIY +E S FRTRDPEKAHVFFLP S+T+IVHF++D+  ++++HWLPMK
Sbjct  226   PCGSIYSMEGNFIYKLEISKFRTRDPEKAHVFFLPFSVTSIVHFIFDK--NSRDHWLPMK  283

Query  1081  QTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEG  1260
             QTVSDY+ LVA KY YWNRSLG+DHFML+CHDWGPE+SK++PELF NSIRALCNANT+EG
Sbjct  284   QTVSDYVELVAAKYPYWNRSLGSDHFMLSCHDWGPELSKSLPELFNNSIRALCNANTTEG  343

Query  1261  FKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWEN-KDND  1437
             FKPSKDVSIPEI LPGG  +GLIGGPSPSRR +L FFAGGLHGPIRP LLEHWEN KD D
Sbjct  344   FKPSKDVSIPEINLPGGRTNGLIGGPSPSRRPVLVFFAGGLHGPIRPALLEHWENSKDKD  403

Query  1438  VQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDV  1617
             VQ+H+YLPK +SY  ++RK+K+C+CPSGYEVASPRMVEALYTGCVPVL+KDHYV PFSDV
Sbjct  404   VQIHQYLPKNVSYSALMRKSKYCVCPSGYEVASPRMVEALYTGCVPVLVKDHYVPPFSDV  463

Query  1618  LNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMIL  1797
             LNWKSF+VE+PV DIPNL+ IL GIS R+YIR+QRRG+  RRHFEVNL PKRYDV HMIL
Sbjct  464   LNWKSFAVEIPVGDIPNLRNILLGISTRQYIRMQRRGVTVRRHFEVNLTPKRYDVFHMIL  523

Query  1798  HSAWLRRLNVRLHGIED  1848
             HS WLRRLNVRLHG+ED
Sbjct  524   HSIWLRRLNVRLHGVED  540



>ref|XP_002528630.1| catalytic, putative [Ricinus communis]
 gb|EEF33733.1| catalytic, putative [Ricinus communis]
Length=574

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/396 (76%), Positives = 339/396 (86%), Gaps = 5/396 (1%)
 Frame = +1

Query  652   TPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSY  831
             + ++ T ++ F NLERLEA L  ARAAI+ A +G NQT+D +YVP GP+YWN+ VFHRSY
Sbjct  175   SSIKTTHQKAFTNLERLEAGLQNARAAIKEAKNG-NQTEDPEYVPIGPMYWNSKVFHRSY  233

Query  832   LEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPI  1008
             LEMEKQFK+FVYEEGEPPVFHNGPCKSIY+ EGNFI+ ME    FRT+DPEKAHV+FLP 
Sbjct  234   LEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHRMEIDDQFRTKDPEKAHVYFLPF  293

Query  1009  SITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPE  1188
             S+  +V FVY R  H+   + P+K+TV DY+NLVAGKY YWNRSLGADHFMLACHDWGPE
Sbjct  294   SVAMMVQFVYVRDSHD---FGPIKRTVRDYVNLVAGKYPYWNRSLGADHFMLACHDWGPE  350

Query  1189  ISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAF  1368
              S ++P+L KNSIRALCNANTSE F P KDVS PEI L  GT  G IGGPSPS+RSILAF
Sbjct  351   TSFSLPDLAKNSIRALCNANTSERFNPIKDVSFPEINLQTGTTKGFIGGPSPSKRSILAF  410

Query  1369  FAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMV  1548
             FAGGLHGPIRPILLEHWENKDND++VHRYLPKG+SYYEM+RK+KFC+CPSGYEVASPR+V
Sbjct  411   FAGGLHGPIRPILLEHWENKDNDMKVHRYLPKGVSYYEMMRKSKFCLCPSGYEVASPRVV  470

Query  1549  EALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRG  1728
             EALYTGCVPVLI DHYV PFSDVLNWKSFSVEVPV DIPNLK+ILT IS R+YIR+QRR 
Sbjct  471   EALYTGCVPVLISDHYVPPFSDVLNWKSFSVEVPVSDIPNLKRILTSISSRQYIRMQRRV  530

Query  1729  LIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             L  RRHFEVN PPKRYDV HMILHS WLRRLNV++H
Sbjct  531   LQVRRHFEVNSPPKRYDVFHMILHSIWLRRLNVKIH  566



>ref|XP_003553575.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=537

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/457 (66%), Positives = 363/457 (79%), Gaps = 6/457 (1%)
 Frame = +1

Query  469   VVPPDNGGGGKILAYNSSINSSTSPLHFESQEIQQPDIQKEENLNisssipsiisssNET  648
             VV  +N GG K+++ ++  N S++P  F  Q IQ P    ++  N+S    ++   +   
Sbjct  83    VVAVENRGGEKVISDDTDFNHSSTP-PFSVQAIQTPQQPNKDEQNVSQLWANVTGVNESY  141

Query  649   GTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRS  828
               P +  ++RKF  L+R EA L +ARAAIR A +G NQT D DYVP GP+Y NAN FHRS
Sbjct  142   LPPERPKLQRKFSILDRTEAGLRQARAAIREARNG-NQTQDIDYVPVGPMYNNANAFHRS  200

Query  829   YLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS-PFRTRDPEKAHVFFLP  1005
             YLEMEKQFK+FVYEEGEPPVFHNGPCKSIY+ EGNFI+ +E +  FRTRDPE+AHVFFLP
Sbjct  201   YLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPEEAHVFFLP  260

Query  1006  ISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGP  1185
              S+  +V FVY R  H+   + P+K+TV+DY+N++ G+Y YWNRSLGADHF LACHDWGP
Sbjct  261   FSVAMLVQFVYVRDSHD---FGPIKKTVTDYVNVIGGRYPYWNRSLGADHFYLACHDWGP  317

Query  1186  EISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILA  1365
             E S+++P L KNSIR LCNANTSEGFKPSKDVS PEI L  G+++G IGGPS SRR +LA
Sbjct  318   ETSRSIPNLNKNSIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASRRPLLA  377

Query  1366  FFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FFAGGLHGPIRP+LLEHWENKD D+QVH+YLPKG+SYYEMLRK+KFC+CPSGYEVASPR+
Sbjct  378   FFAGGLHGPIRPVLLEHWENKDEDIQVHKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRV  437

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             VEA+YTGCVPVLI DHYV PF+DVLNWKSFSVEV V+DIP LK+IL  IS R+YIR+QRR
Sbjct  438   VEAIYTGCVPVLISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRQYIRMQRR  497

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
                 RRHFEV+ PPKRYDV HMILHS WLRRLN R+H
Sbjct  498   VGQVRRHFEVHSPPKRYDVFHMILHSVWLRRLNFRVH  534



>gb|KHN02275.1| Putative glycosyltransferase [Glycine soja]
Length=537

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/457 (66%), Positives = 363/457 (79%), Gaps = 6/457 (1%)
 Frame = +1

Query  469   VVPPDNGGGGKILAYNSSINSSTSPLHFESQEIQQPDIQKEENLNisssipsiisssNET  648
             VV  +N GG K+++ ++  N S++P  F  Q IQ P    ++  N+S    ++   +   
Sbjct  83    VVAVENRGGEKVISDDTDFNHSSTP-PFSVQAIQTPQQPNKDEQNVSQLWANVTGVNESY  141

Query  649   GTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRS  828
               P +  ++RKF  L+R EA L +ARAAIR A +G NQT D DYVP GP+Y NAN FHRS
Sbjct  142   LPPERPKLQRKFSILDRTEAGLRQARAAIREARNG-NQTQDIDYVPVGPMYNNANAFHRS  200

Query  829   YLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS-PFRTRDPEKAHVFFLP  1005
             YLEMEKQFK+FVYEEGEPPVFHNGPCKSIY+ EGNF++ +E +  FRTRDPE+AHVFFLP
Sbjct  201   YLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFVHAIEMNDQFRTRDPEEAHVFFLP  260

Query  1006  ISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGP  1185
              S+  +V FVY R  H+   + P+K+TV+DY+N++ G+Y YWNRSLGADHF LACHDWGP
Sbjct  261   FSVAMLVQFVYVRDSHD---FGPIKKTVTDYVNVIGGRYPYWNRSLGADHFYLACHDWGP  317

Query  1186  EISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILA  1365
             E S+++P L KNSIR LCNANTSEGFKPSKDVS PEI L  G+++G IGGPS SRR +LA
Sbjct  318   ETSRSIPNLNKNSIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASRRPLLA  377

Query  1366  FFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FFAGGLHGPIRP+LLEHWENKD D+QVH+YLPKG+SYYEMLRK+KFC+CPSGYEVASPR+
Sbjct  378   FFAGGLHGPIRPVLLEHWENKDEDIQVHKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRV  437

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             VEA+YTGCVPVLI DHYV PF+DVLNWKSFSVEV V+DIP LK+IL  IS R+YIR+QRR
Sbjct  438   VEAIYTGCVPVLISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRQYIRMQRR  497

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
                 RRHFEV+ PPKRYDV HMILHS WLRRLN R+H
Sbjct  498   VGQVRRHFEVHSPPKRYDVFHMILHSVWLRRLNFRVH  534



>ref|XP_004494122.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=526

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/439 (69%), Positives = 361/439 (82%), Gaps = 11/439 (3%)
 Frame = +1

Query  529   SSTSPLHFESQEIQQPDIQKEENLNisssipsiisssNETG-TPLQV-TIKRKFRNLERL  702
             SST PL  ++ +     + K+E  + +S I +  +S NE+   PL+   + RKF  L+R 
Sbjct  93    SSTPPLSIQTLQ----KLNKDEESDNASQIWTNTTSMNESYYIPLEKPNLPRKFSILDRT  148

Query  703   EANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEP  882
             EA L +ARAAIR A +G NQT D DYVP GP+Y+N N FHRSYLEMEKQFK+FVYEEGEP
Sbjct  149   EAGLLQARAAIRKARNG-NQTQDIDYVPIGPMYYNPNAFHRSYLEMEKQFKVFVYEEGEP  207

Query  883   PVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRSVHNK  1059
             PVFHNGPCKSIY+ EGNFI+ +E +  FRTRDP+KAHVFFLP S+  +V FVY R  H+ 
Sbjct  208   PVFHNGPCKSIYSMEGNFIHTIEMNDQFRTRDPDKAHVFFLPFSVAMMVQFVYVRDSHD-  266

Query  1060  EHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALC  1239
               + P+K+TV+DYIN+++ +Y +WNRSLGADHFML+CHDWGPE+S +VP L+KNSIRALC
Sbjct  267   --FSPIKKTVADYINVISERYPFWNRSLGADHFMLSCHDWGPEVSNSVPNLYKNSIRALC  324

Query  1240  NANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHW  1419
             NANTSEGFKP+KDVS PEI L  GT+HG +GGPSPS+RS+LAFFAGGLHGPIRPILL+HW
Sbjct  325   NANTSEGFKPAKDVSFPEINLQTGTIHGFVGGPSPSKRSVLAFFAGGLHGPIRPILLDHW  384

Query  1420  ENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYV  1599
             ENKD D+QVH+YLPKG+SYY+MLRK+KFC+CPSGYEVASPR+VEA+YTGCVPVLI DHYV
Sbjct  385   ENKDEDIQVHKYLPKGVSYYDMLRKSKFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYV  444

Query  1600  APFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYD  1779
              PFSDVLNWKSFSVEV V+DIPNLKKIL  IS R+YIR+QRR    RRHFEV+ PPKR+D
Sbjct  445   PPFSDVLNWKSFSVEVSVDDIPNLKKILLSISPRQYIRMQRRVGQVRRHFEVHSPPKRFD  504

Query  1780  VTHMILHSAWLRRLNVRLH  1836
             V HMILHS WLRRLN R+H
Sbjct  505   VFHMILHSIWLRRLNFRVH  523



>gb|KEH24081.1| glycosyltransferase [Medicago truncatula]
Length=401

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/401 (73%), Positives = 339/401 (85%), Gaps = 6/401 (1%)
 Frame = +1

Query  640   NETGTPLQV-TIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANV  816
             NE+   LQ   + RKF  L+R EA L +ARAAIR A    N+T D DYVPTGP+Y N N 
Sbjct  2     NESQILLQKPNLPRKFSILDRTEAGLLQARAAIRKA-RNENRTQDIDYVPTGPMYHNPNS  60

Query  817   FHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHV  993
             FHRSYLEMEKQFK+FVYEEGEPPVFHNGPCKSIY+ EGNFI+ +E +  FRTRDPEKAHV
Sbjct  61    FHRSYLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDRFRTRDPEKAHV  120

Query  994   FFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACH  1173
             FFLP S+  +V FVY R  H+   + P+++T++DYIN+V+ KY +WNRSLGADHFML+CH
Sbjct  121   FFLPFSVAKMVQFVYVRDSHD---FSPIRKTITDYINVVSEKYPFWNRSLGADHFMLSCH  177

Query  1174  DWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRR  1353
             DWGPE SK+VP L+KNSIRALCNANTSEGFKP+KDVSIPE  L  GT+HG++GGPSPS+R
Sbjct  178   DWGPETSKSVPNLYKNSIRALCNANTSEGFKPAKDVSIPETNLQTGTIHGIVGGPSPSKR  237

Query  1354  SILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVA  1533
             S+LAFFAGG+HGP+RP+LLEHWE+KD D+QVH+YLPKG+SYY+MLRK+KFC+CPSGYEVA
Sbjct  238   SVLAFFAGGVHGPVRPVLLEHWEHKDEDLQVHKYLPKGVSYYDMLRKSKFCLCPSGYEVA  297

Query  1534  SPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             SPR+VEA+YTGCVPVLI DHYV PFSDVLNWKSFSVEV V DIPNLKKILT IS R+YIR
Sbjct  298   SPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVSVNDIPNLKKILTSISPRQYIR  357

Query  1714  LQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             +QRR    RRHFEV+ PP R+DV HMILHS WLRRLN RLH
Sbjct  358   MQRRVGQVRRHFEVHSPPTRFDVFHMILHSIWLRRLNFRLH  398



>ref|XP_003521429.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=534

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/458 (66%), Positives = 363/458 (79%), Gaps = 10/458 (2%)
 Frame = +1

Query  469   VVPPDNGGGGKILAYNSSINSSTSPLHFESQEIQQPDIQKEENLNisssipsiisssNET  648
             VV  +N GG K ++ ++  N S++P  F  Q IQ P    E+N++  S   + +   NE+
Sbjct  82    VVAVENRGGEKAISDDTDFNHSSTP-PFSVQAIQTPQQPDEQNVSQLSPNVTPV---NES  137

Query  649   GTPLQV-TIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHR  825
               P +   ++RK   L+R EA L +ARAAI  A +G NQT D DYVP GP+Y NAN FHR
Sbjct  138   YVPPERPKLQRKLSILDRTEAGLIQARAAISEARNG-NQTQDKDYVPVGPMYNNANAFHR  196

Query  826   SYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS-PFRTRDPEKAHVFFL  1002
             SYLEMEKQFK+FVYEEGEPPVFHNGPCKSIY+ EGNFI+ +E +  FRTRDPEKAHVFFL
Sbjct  197   SYLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPEKAHVFFL  256

Query  1003  PISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWG  1182
             P S+  +V FVY R  H+   + P+K+TV+DY+N++AG+Y YWNRSLGADHF LACHDWG
Sbjct  257   PFSVAMLVQFVYVRDSHD---FGPIKKTVTDYVNVIAGRYPYWNRSLGADHFYLACHDWG  313

Query  1183  PEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSIL  1362
             PE S+++P L +NSIR LCNANTSEGFKPSKDVS PEI L  G+++G IGGPS S R +L
Sbjct  314   PETSRSIPNLNENSIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASGRPLL  373

Query  1363  AFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPR  1542
             AFFAGGLHGPIRP+LLEHWEN+D D+QVH+YLPKG+SYYEMLRK++FC+CPSGYEVASPR
Sbjct  374   AFFAGGLHGPIRPVLLEHWENRDEDIQVHKYLPKGVSYYEMLRKSRFCLCPSGYEVASPR  433

Query  1543  MVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQR  1722
             +VEA+YTGCVPVLI DHYV PF+DVLNWKSFSVEV V+DIP LK+IL  IS R YIR+QR
Sbjct  434   VVEAIYTGCVPVLISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRHYIRMQR  493

Query  1723  RGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             R  + RRHFEV+ PPKRYDV HMILHS WLRRLN R+H
Sbjct  494   RVGLVRRHFEVHSPPKRYDVFHMILHSVWLRRLNFRVH  531



>gb|KDP29231.1| hypothetical protein JCGZ_16620 [Jatropha curcas]
Length=452

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/389 (74%), Positives = 329/389 (85%), Gaps = 4/389 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             K  + +LERLEA L  AR+AI+ A +G    +D +YVPTGP+YWN+ VFHRSYLEMEKQF
Sbjct  59    KEYYSSLERLEAGLQNARSAIKDAKNGNQTLEDPEYVPTGPMYWNSKVFHRSYLEMEKQF  118

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVH  1029
             ++FVYEEGEPPVFHNGPCKSIY+ EGNFI+ ME    FRT+DP+KAHV+FLP S+T +V 
Sbjct  119   RVFVYEEGEPPVFHNGPCKSIYSMEGNFIHRMEIDDQFRTKDPDKAHVYFLPFSVTMMVR  178

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             FVY R  H+   + P+++TV DY++L+AGKY +WNRSLGADHFMLACHDWGPE S +VP 
Sbjct  179   FVYVRDSHD---FGPIRRTVGDYVSLIAGKYPFWNRSLGADHFMLACHDWGPETSFSVPY  235

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L KNSIRALCNANTSE F P KDVS PEI L  G+  GLIGGPSPS+RSILAF+AGGLHG
Sbjct  236   LGKNSIRALCNANTSERFNPIKDVSFPEINLQTGSTKGLIGGPSPSKRSILAFYAGGLHG  295

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             PIRPILL HWENKD+D++VHRYLPKG+SYYEM+RK+KFC+CPSGYEVASPR+VEA YTGC
Sbjct  296   PIRPILLAHWENKDDDIKVHRYLPKGVSYYEMMRKSKFCLCPSGYEVASPRVVEAFYTGC  355

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI DHYV PFSDVLNWKSFSVEVPV  IPNLK+ILT IS R+YIR+QRR    RRHF
Sbjct  356   VPVLISDHYVPPFSDVLNWKSFSVEVPVSKIPNLKRILTSISPRQYIRMQRRVQQIRRHF  415

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             EVN PPKRYDV HMILHS WLRRLNVR+H
Sbjct  416   EVNSPPKRYDVFHMILHSIWLRRLNVRIH  444



>ref|XP_007162830.1| hypothetical protein PHAVU_001G184500g [Phaseolus vulgaris]
 gb|ESW34824.1| hypothetical protein PHAVU_001G184500g [Phaseolus vulgaris]
Length=537

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/458 (66%), Positives = 357/458 (78%), Gaps = 8/458 (2%)
 Frame = +1

Query  469   VVPPDNGGGGKILAYNSSINSSTSPLHFESQEIQQPDIQKEENLNisssipsiisssNET  648
             VV  DN  G  +++ ++  N S++P  F  Q IQ P  Q   +          +SS NE+
Sbjct  78    VVAVDNRAGENVISDDTHFNLSSTP-PFSVQAIQTPQ-QHNRDEETVPQNLGNLSSVNES  135

Query  649   GTPLQV-TIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHR  825
                 +   ++RKF  L+R EA L KARAAIR A +G NQT D DYVP GP+Y NA  FHR
Sbjct  136   YVAAERPKLQRKFSILDRTEAGLVKARAAIREARNG-NQTQDADYVPIGPMYMNAKAFHR  194

Query  826   SYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS-PFRTRDPEKAHVFFL  1002
             S+LEMEKQ K++VYEEGE PVFHNGPCKSIY+ EGNFI+ +E +  FRTRDPEKAHVFFL
Sbjct  195   SFLEMEKQLKVYVYEEGEAPVFHNGPCKSIYSMEGNFIHGIEMNEKFRTRDPEKAHVFFL  254

Query  1003  PISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWG  1182
             P S+  +V FVY R  H+   + P+K+TV+DY+N++AG+Y YWNRSLGADHF +ACHDWG
Sbjct  255   PFSVAMLVQFVYVRDSHD---FGPIKKTVTDYVNVIAGRYPYWNRSLGADHFYIACHDWG  311

Query  1183  PEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSIL  1362
             PE S++VP L  NSIR LCNANTSEGFKPSKDVS+PEI L  G+++GLIGGPS S+R +L
Sbjct  312   PETSRSVPNLQDNSIRVLCNANTSEGFKPSKDVSLPEINLQSGSINGLIGGPSASKRPLL  371

Query  1363  AFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPR  1542
             AFFAGGLHGPIRPILLEHWENK  D+QVHRYLPKG+SYYEMLRK++FC+CPSGYEVASPR
Sbjct  372   AFFAGGLHGPIRPILLEHWENKQEDMQVHRYLPKGVSYYEMLRKSRFCLCPSGYEVASPR  431

Query  1543  MVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQR  1722
             +VEA+YTGCVPVLI DHYV PFSDVLNWKSFSVEV VEDIP LK IL  IS  +YIR+QR
Sbjct  432   VVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVSVEDIPKLKDILLSISPTQYIRMQR  491

Query  1723  RGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             R +  RRHFEV+ PPKR+DV HMILHS WLRRLN ++H
Sbjct  492   RVVQVRRHFEVHSPPKRFDVFHMILHSVWLRRLNFKVH  529



>gb|KHN18714.1| Putative glycosyltransferase [Glycine soja]
Length=546

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/467 (64%), Positives = 362/467 (78%), Gaps = 16/467 (3%)
 Frame = +1

Query  469   VVPPDNGGGGKILAYNSSINSSTSPLHFESQEIQQPD---------IQKEENLNisssip  621
             VV  +N GG K ++ ++  N S++P  F  Q IQ P          I   ++    S + 
Sbjct  82    VVAVENRGGEKAISDDTDFNHSSTP-PFSVQAIQTPQQPVIMTHRFIYHNKDEQNVSQLS  140

Query  622   siisssNETGTPLQV-TIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPV  798
               ++  NE+  P +   ++RK   L+R EA L +ARAAI  A +G NQT D DYVP GP+
Sbjct  141   PNVTPVNESYVPPERPKLQRKLSILDRTEAGLIQARAAISEARNG-NQTQDKDYVPVGPM  199

Query  799   YWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS-PFRTRD  975
             Y NAN FHRSYLEMEKQFK+FVYEEGEPPVFHNGPCKSIY+ EGNFI+ +E +  FRTRD
Sbjct  200   YNNANAFHRSYLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRD  259

Query  976   PEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADH  1155
             PEKAHVFFLP S+  +V FVY R  H+   + P+K+TV+DY+N++AG+Y YWNRSLGADH
Sbjct  260   PEKAHVFFLPFSVAMLVQFVYVRDSHD---FGPIKKTVTDYVNVIAGRYPYWNRSLGADH  316

Query  1156  FMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGG  1335
             F LACHDWGPE S+++P L +NSIR LCNANTSEGFKPSKDVS PEI L  G+++G IGG
Sbjct  317   FYLACHDWGPETSRSIPNLNENSIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGG  376

Query  1336  PSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICP  1515
             PS S R +LAFFAGGLHGPIRP+LLEHWEN+D D+QVH+YLPKG+SYYEMLRK++FC+CP
Sbjct  377   PSASGRPLLAFFAGGLHGPIRPVLLEHWENRDEDIQVHKYLPKGVSYYEMLRKSRFCLCP  436

Query  1516  SGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGIS  1695
             SGYEVASPR+VEA+YTGCVPVLI DHYV PF+DVLNWKSFSVEV V+DIP LK+IL  IS
Sbjct  437   SGYEVASPRVVEAIYTGCVPVLISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSIS  496

Query  1696  QRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
              R YIR+QRR  + RRHFEV+ PPKRYDV HMILHS WLRRLN R+H
Sbjct  497   PRHYIRMQRRVGLVRRHFEVHSPPKRYDVFHMILHSVWLRRLNFRVH  543



>ref|XP_002284018.2| PREDICTED: probable glycosyltransferase At5g03795 [Vitis vinifera]
Length=546

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/401 (72%), Positives = 333/401 (83%), Gaps = 6/401 (1%)
 Frame = +1

Query  640   NET-GTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANV  816
             NET   P+    +R++  LER+EA L +AR+AIR A  G N+T D DY+P GP+YWN N 
Sbjct  144   NETHALPVTSRPQRQYTTLERVEAGLRRARSAIREAKIG-NRTPDPDYIPNGPIYWNVNA  202

Query  817   FHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHV  993
             FHRSYLEMEKQ K++VY+EGEPP+FHNGPCKSIY+ EGNFI+ ME  S FRT+DPEKAH+
Sbjct  203   FHRSYLEMEKQLKVYVYDEGEPPLFHNGPCKSIYSMEGNFIHKMEMDSHFRTKDPEKAHL  262

Query  994   FFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACH  1173
             FFLP S+  +V FVY R  H+     P+KQTV DY+N+V+ KY YWNRSLGADHFMLACH
Sbjct  263   FFLPFSVAMLVRFVYVRDSHDLG---PIKQTVIDYVNVVSTKYPYWNRSLGADHFMLACH  319

Query  1174  DWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRR  1353
             DWGPE S ++P L KNSIR LCNANTSEGF PSKDVS PEI L  G+    IGGPSPS R
Sbjct  320   DWGPETSFSIPYLHKNSIRVLCNANTSEGFNPSKDVSFPEINLLTGSTDSFIGGPSPSHR  379

Query  1354  SILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVA  1533
             ++LAFFAGGLHGPIRPILLEHWENKD DV+VH+YLPKG+SYYEM+RK+K+C+CPSGYEVA
Sbjct  380   TLLAFFAGGLHGPIRPILLEHWENKDEDVKVHKYLPKGVSYYEMMRKSKYCLCPSGYEVA  439

Query  1534  SPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             SPR+VEALYTGCVPVLI DHYV PFSDVLNWKSFSVEVPV +IPNLK+IL  IS R+YIR
Sbjct  440   SPRVVEALYTGCVPVLISDHYVPPFSDVLNWKSFSVEVPVREIPNLKRILMDISPRQYIR  499

Query  1714  LQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             +QRRG+ ARRHFEVN PPKRYDV HMILHS WLRRLN R+H
Sbjct  500   MQRRGIQARRHFEVNSPPKRYDVFHMILHSLWLRRLNFRVH  540



>ref|XP_010242926.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=530

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/400 (70%), Positives = 322/400 (81%), Gaps = 5/400 (1%)
 Frame = +1

Query  652   TPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGI-NQTDDHDYVPTGPVYWNANVFHRS  828
              P  + +++    LERLEA L K RAAIR A H   NQT D DYVP GP+YWNA  FHRS
Sbjct  131   APTIIKMQKNHTQLERLEAGLAKIRAAIREAAHQKGNQTSDFDYVPEGPMYWNAQAFHRS  190

Query  829   YLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLP  1005
             YL MEKQFKIF+Y+EGEPP+FH+GPC+SIY+ EGNFI+ +E    FRTR+P++AH FFLP
Sbjct  191   YLVMEKQFKIFIYDEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPKEAHAFFLP  250

Query  1006  ISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGP  1185
              S+T +V FVY   V N     P+KQTV DY+NL+AGKY YWNRSL ADHFML+CHDWGP
Sbjct  251   FSVTKMVRFVY---VPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSCHDWGP  307

Query  1186  EISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILA  1365
               S  VP L+KN IR LCNANTSEGF P+KD S PEI L  G   G IGGPSPSRR IL 
Sbjct  308   LTSSYVPHLYKNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGFIGGPSPSRRPILX  367

Query  1366  FFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FFAGGLHGPIRP+LLEHW+NKD DV+V+ YLPKG+SYY+M++K+K+CICPSGYEVASPR+
Sbjct  368   FFAGGLHGPIRPVLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEVASPRI  427

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             VEA+Y GCVPVLI DHYV PFSDVLNWKSFSVEVPV +IPNLK+IL  IS R+YIR+QRR
Sbjct  428   VEAIYAGCVPVLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSISTRQYIRMQRR  487

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIE  1845
             GL  RRHFEVN PPKR+DV HMILHS WLRRLNVR+H ++
Sbjct  488   GLKVRRHFEVNFPPKRFDVYHMILHSVWLRRLNVRIHDLQ  527



>ref|XP_010098868.1| putative glycosyltransferase [Morus notabilis]
 gb|EXB75956.1| putative glycosyltransferase [Morus notabilis]
Length=465

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/388 (71%), Positives = 325/388 (84%), Gaps = 5/388 (1%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFK  855
             R++ +LERLEA L KAR+AI  A  G N+T D +YVPTGP+YWN+  FHRSY+EMEK+FK
Sbjct  79    REYSDLERLEARLMKARSAISEAKVG-NETQDPEYVPTGPMYWNSKAFHRSYIEMEKEFK  137

Query  856   IFVYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISITAIVHF  1032
             +FVYEEGEPP+FHNGPCKSIY+ EGNFI+ +E  S FRT+DP KAHVFFLP S+T +V +
Sbjct  138   VFVYEEGEPPLFHNGPCKSIYSMEGNFIHEIEMNSQFRTKDPNKAHVFFLPFSVTMLVRY  197

Query  1033  VYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPEL  1212
             VY R  H+   + P+KQTV DY+N+V+ K+ +WNRSL ADHFML+CHDWGPE S++   L
Sbjct  198   VYVRDSHD---FHPIKQTVIDYVNVVSEKHPFWNRSLAADHFMLSCHDWGPEASRSNRFL  254

Query  1213  FKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGP  1392
              +NSIR LCNANTSEGF PSKDVS PEI L  G   GL+GGPS SRR  LAFFAGG+HGP
Sbjct  255   HQNSIRVLCNANTSEGFNPSKDVSFPEINLLSGATDGLLGGPSASRRPNLAFFAGGVHGP  314

Query  1393  IRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCV  1572
             IRPILLEHWENKD D+++ +YLPKG+SYY+MLRK+K+CICPSGYEVASPR+VEA+YTGCV
Sbjct  315   IRPILLEHWENKDEDMKIQQYLPKGVSYYDMLRKSKYCICPSGYEVASPRIVEAIYTGCV  374

Query  1573  PVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFE  1752
             PVLI DHYV PFSDVLNWKSFSVEVPV+DIPNLK IL  IS R+YIR+QRR L  RRHFE
Sbjct  375   PVLISDHYVPPFSDVLNWKSFSVEVPVKDIPNLKTILMSISPRQYIRMQRRVLKVRRHFE  434

Query  1753  VNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             VN PPKR+DV HMILHS WLRRLN+R+H
Sbjct  435   VNSPPKRFDVFHMILHSVWLRRLNIRIH  462



>gb|EPS64188.1| hypothetical protein M569_10593, partial [Genlisea aurea]
Length=383

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/386 (72%), Positives = 325/386 (84%), Gaps = 4/386 (1%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVY  867
             NL  LEA L +AR +IR + +G    DD DYVP GPVY + + FHRSY EMEK F++FVY
Sbjct  1     NLHILEAKLKRARNSIRESRNG-TAIDDPDYVPYGPVYHSPSAFHRSYKEMEKHFRVFVY  59

Query  868   EEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
              EGE P+FHNGPC SIY++EGNFIY +E S FRTRDPEKA VFFLP+S+ AIV FVYDR+
Sbjct  60    GEGEHPIFHNGPCGSIYSTEGNFIYTVEGSSFRTRDPEKASVFFLPLSVAAIVRFVYDRN  119

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
               + + W PMK+TV DY++LVA +Y YWNRSLG+DH ML+CHDWGPE+SK+VPELFKNSI
Sbjct  120   --SGDQWGPMKRTVKDYVDLVAMRYPYWNRSLGSDHVMLSCHDWGPELSKSVPELFKNSI  177

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGG-TMHGLIGGPSPSRRSILAFFAGGLHGPIRPI  1404
             RALCNANT+EGFKP+KDV+IPEI LPGG    GLIGG S S+R+ILAFFAGG+HGP+RPI
Sbjct  178   RALCNANTTEGFKPAKDVAIPEINLPGGGRTKGLIGGLSASKRTILAFFAGGVHGPVRPI  237

Query  1405  LLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLI  1584
             LLEHWENKD DVQV++YLPK +SY + +RK++FCICPSGYEVASPR+VEALY GCVPVLI
Sbjct  238   LLEHWENKDPDVQVYQYLPKRLSYSDQMRKSRFCICPSGYEVASPRIVEALYNGCVPVLI  297

Query  1585  KDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLP  1764
              DHYV PF DVLNWK+F+VEVPV +IPNLKKILT IS R+YIRL+RRG   RRHFEVN P
Sbjct  298   NDHYVPPFGDVLNWKAFAVEVPVGEIPNLKKILTAISTRQYIRLKRRGETVRRHFEVNFP  357

Query  1765  PKRYDVTHMILHSAWLRRLNVRLHGI  1842
             PKRYDV HM LHS WLRRLN+RLHG+
Sbjct  358   PKRYDVFHMTLHSIWLRRLNLRLHGV  383



>ref|XP_010248410.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=646

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/405 (69%), Positives = 327/405 (81%), Gaps = 8/405 (2%)
 Frame = +1

Query  646   TGTPLQVTIKRKFRN---LERLEANLGKARAAIRAAVHGI-NQTDDHDYVPTGPVYWNAN  813
              G+ +  TI +  +N   LER+E+ L K RAAIR A H   N+T D DYVP GP+YWNA 
Sbjct  242   NGSDVSATIIKMQKNHSQLERMESGLAKIRAAIREAAHQKGNRTSDFDYVPEGPMYWNAQ  301

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAH  990
              FHRSYLEMEKQFKIF+Y+EGEPP+FH+GPC+SIY+ EGNFI+ +E    FRTR+PE+AH
Sbjct  302   AFHRSYLEMEKQFKIFIYDEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPEEAH  361

Query  991   VFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLAC  1170
             VFFLP S+T +V FVY   V N     P+KQTV DY+NL+AGKY YWNRSL ADHFML+C
Sbjct  362   VFFLPFSVTKMVRFVY---VPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSC  418

Query  1171  HDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR  1350
             HDWGP  S  VP L+KN IR LCNANTSEGF P+KD S PEI L  G   GLIGGP PS 
Sbjct  419   HDWGPLTSSYVPHLYKNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGLIGGPPPSC  478

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             R ILAFFAGGLHGPIRP+LLEHW+NKD DV+V+ YLPKG+SYY+M++K+K+CICPSGYEV
Sbjct  479   RPILAFFAGGLHGPIRPLLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEV  538

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPR+VEA+Y GCVPVLI DHYV PFSDVLNWKSFSVEVPV +IPNLK+IL  IS R+YI
Sbjct  539   ASPRIVEAIYAGCVPVLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSISTRQYI  598

Query  1711  RLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIE  1845
             R+QRRGL  RRHFEVN PPKR+DV HMILHS WLRRLNVR+H ++
Sbjct  599   RMQRRGLKVRRHFEVNFPPKRFDVYHMILHSVWLRRLNVRIHDLQ  643



>ref|XP_010039041.1| PREDICTED: probable glycosyltransferase At5g03795 [Eucalyptus 
grandis]
Length=562

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/388 (73%), Positives = 321/388 (83%), Gaps = 5/388 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             KR   +LERLEA L +AR+ IR A  G N  +D DYVP GP+Y NAN FHRSYLEMEKQF
Sbjct  175   KRVDTDLERLEAGLRRARSGIREAKTG-NPMEDPDYVPVGPMYRNANAFHRSYLEMEKQF  233

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVH  1029
             KIFVY+EG+PPVFHNGPCKSIYA EGNFI+ +E +  FRT DP KAHVFFLP S+  +V 
Sbjct  234   KIFVYKEGDPPVFHNGPCKSIYAKEGNFIHMVEINKRFRTGDPRKAHVFFLPFSVAMMVQ  293

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             FVY R  H+   + P+K+TV DYI++VA KY YWNRSLGADHFMLACHDWGPE S AVP 
Sbjct  294   FVYVRDSHD---FGPIKRTVIDYIDVVASKYPYWNRSLGADHFMLACHDWGPEASFAVPH  350

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L +NSIR LCNANTSEGF PSKDVS PE+ L  G + GLIGGPSPS RSILAFFAGGLHG
Sbjct  351   LQRNSIRVLCNANTSEGFDPSKDVSFPEVNLHTGAISGLIGGPSPSHRSILAFFAGGLHG  410

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             PIRPILL+HWENKD DV+VHRYLP+G+SYY+M+R++KFCICPSGYEVASPR+VEA+YTGC
Sbjct  411   PIRPILLQHWENKDEDVKVHRYLPRGVSYYDMMRRSKFCICPSGYEVASPRVVEAIYTGC  470

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI DHYV PFSDVLNW+SFSVEV V +IPNLK IL  IS R+YIR+QRR    RRHF
Sbjct  471   VPVLISDHYVPPFSDVLNWRSFSVEVTVREIPNLKTILASISSRQYIRMQRRVAQVRRHF  530

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             EV+ PPKRYDV HMILHS WLRRLNV L
Sbjct  531   EVHSPPKRYDVFHMILHSVWLRRLNVGL  558



>ref|XP_006381337.1| hypothetical protein POPTR_0006s11930g [Populus trichocarpa]
 gb|ERP59134.1| hypothetical protein POPTR_0006s11930g [Populus trichocarpa]
Length=510

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/389 (71%), Positives = 325/389 (84%), Gaps = 5/389 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             K +  +LE+LEA L KAR A++ A +G  Q DD DY P GP+YWNA VFHRSYLEMEKQF
Sbjct  118   KTEHTSLEKLEAGLQKARVALKEAKNG-KQADDPDYAPAGPMYWNAEVFHRSYLEMEKQF  176

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVH  1029
             K+FVY EGEPPVFHNGPC+SIY+ EGNFI+ ME    FRT+DP+KAHV+FLP S+  +V 
Sbjct  177   KVFVYGEGEPPVFHNGPCRSIYSMEGNFIHRMEIDGHFRTKDPDKAHVYFLPFSVAMMVR  236

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             FVY+R   +   + P+++TVSDYINL++GKY +WNRSLGADHFMLACHDWGPE S +VP 
Sbjct  237   FVYERESRD---FGPIRRTVSDYINLISGKYPFWNRSLGADHFMLACHDWGPEASFSVPH  293

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L K SIRALCNANTSE F P KDVS+PEI L  G++ G +GG SPS+RSILAFFAG LHG
Sbjct  294   LGKISIRALCNANTSEKFNPIKDVSLPEINLRTGSIKGFVGGLSPSKRSILAFFAGRLHG  353

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             PIRP++LEHWENKD+D++VH+ LPKG+SYYEM+R +KFC+CPSGYEVASPR+VEALY GC
Sbjct  354   PIRPVVLEHWENKDDDIKVHQQLPKGVSYYEMMRGSKFCLCPSGYEVASPRIVEALYAGC  413

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI DHYV PFSDVLNWKSFSVEVPV DIP+LKKILT IS R+YIR+QRR L  RRHF
Sbjct  414   VPVLISDHYVPPFSDVLNWKSFSVEVPVSDIPSLKKILTSISPRQYIRMQRRVLQVRRHF  473

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             EVN PPKR+DV HMILHS WLRRLNV +H
Sbjct  474   EVNSPPKRFDVFHMILHSIWLRRLNVGIH  502



>ref|XP_003537031.2| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=491

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/388 (71%), Positives = 324/388 (84%), Gaps = 5/388 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             KRK   ++R E  L +ARAAIR A +  NQT D DYVP GP+YWNA  FHRSYLEMEKQF
Sbjct  104   KRKLSFIDRNEVVLAQARAAIREAKNE-NQTQDSDYVPIGPMYWNAKTFHRSYLEMEKQF  162

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVH  1029
             K+FVYEEGE PVFHNGPCKSIY+ EGNFI+ +E +  FRT+DP+KAHVFFLP S+  +V 
Sbjct  163   KVFVYEEGETPVFHNGPCKSIYSMEGNFIHAIEMNDHFRTKDPKKAHVFFLPFSVVMMVR  222

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             FVY R   +   + P+++TV DYINL+A +Y+YWNRSLGADHFMLACHDWGPE S ++P 
Sbjct  223   FVYQR---DSRDFGPIRKTVIDYINLIAARYSYWNRSLGADHFMLACHDWGPEASLSLPY  279

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L KNSIR LCNANTSEGFKP+KDVS PEI L  G+++G IGGPS S+RSILAFFAGG+HG
Sbjct  280   LHKNSIRVLCNANTSEGFKPAKDVSFPEINLQTGSINGFIGGPSASKRSILAFFAGGVHG  339

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             PIRPILLEHWENKD D+QVH+YLPKG+SYY+ LR +KFC+CPSGYEVASPR+VEA+YTGC
Sbjct  340   PIRPILLEHWENKDEDIQVHKYLPKGVSYYDKLRNSKFCLCPSGYEVASPRVVEAIYTGC  399

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI +HYV PFSDVLNWKSFSVE+ V+DIPNLK IL  IS R+YIR+QRR +  +RHF
Sbjct  400   VPVLISEHYVPPFSDVLNWKSFSVELSVKDIPNLKDILMSISPRQYIRMQRRVIQIQRHF  459

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             EV+ PPKR+DV HMILHS WLRRLN R+
Sbjct  460   EVHSPPKRFDVFHMILHSVWLRRLNFRM  487



>ref|XP_010243080.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nelumbo nucifera]
Length=598

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/399 (69%), Positives = 319/399 (80%), Gaps = 5/399 (1%)
 Frame = +1

Query  652   TPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGI-NQTDDHDYVPTGPVYWNANVFHRS  828
              P  + +++    LERLEA L K RAAIR A H   NQT D DYVP GP+YWNA  FHRS
Sbjct  199   APTIIKMQKNHTQLERLEAGLAKIRAAIREAAHQKGNQTSDFDYVPEGPMYWNAQAFHRS  258

Query  829   YLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLP  1005
             YL MEKQFKIF+YEEGEPP+FH+GPC+SIY+ EGNFI+ +E    FRTR+PE+A+ FFLP
Sbjct  259   YLVMEKQFKIFIYEEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPEEAYAFFLP  318

Query  1006  ISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGP  1185
              S+T +V FVY   V N     P+KQTV DY+NL+AGKY YWNRSL ADHFML+CHDWGP
Sbjct  319   FSVTQMVRFVY---VPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSCHDWGP  375

Query  1186  EISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILA  1365
               S  VP L+KN IR LCNANTSEGF P+KD S PEI L  G   GLIGGP PS R ILA
Sbjct  376   LTSSYVPHLYKNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGLIGGPPPSCRPILA  435

Query  1366  FFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FFAGGLHGPIRP+LLEHW+NKD DV+V+ YLPKG+SYY+M++K+K+CICPSGYEVASPR+
Sbjct  436   FFAGGLHGPIRPLLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEVASPRI  495

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             VEA+Y GCVPVLI DHYV PFSDVLNWKSFSVEVPV +IPNLK+IL  I  R+Y R+QRR
Sbjct  496   VEAIYAGCVPVLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSIPTRQYKRMQRR  555

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             GL  RRHFEVN PPKR+DV HMILHS WLRRLNVR+H +
Sbjct  556   GLKVRRHFEVNFPPKRFDVYHMILHSVWLRRLNVRIHDL  594



>ref|XP_011018855.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
 ref|XP_011018857.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
 ref|XP_011018858.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
Length=513

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/392 (70%), Positives = 329/392 (84%), Gaps = 5/392 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             K +  +LE+LEA L KAR A++ A +G  Q DD DYVP GP+YWNA VFHRSYLEME+QF
Sbjct  118   KTEHTSLEKLEAGLQKARVALKEAKNG-KQADDPDYVPAGPMYWNAKVFHRSYLEMEEQF  176

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVH  1029
             K+FVYEEGEPP+FHNGPC+SIY+ EGNFI+ ME +  FRT+DP+KAHV+FLP S+  +V 
Sbjct  177   KVFVYEEGEPPLFHNGPCRSIYSMEGNFIHMMEINGHFRTKDPDKAHVYFLPFSVAMMVR  236

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             FVY+R   +   + P+++TVSDYINL++ KY++WNRSLGADHFMLACHDWGPE S +VP 
Sbjct  237   FVYERQSRD---FGPIRRTVSDYINLISRKYSFWNRSLGADHFMLACHDWGPEASFSVPH  293

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L K SIRALCNANTSE F P KDVS+PEI L  G++ G +GG SPS+R ILAFFAG LHG
Sbjct  294   LGKISIRALCNANTSEKFNPVKDVSLPEINLLTGSIKGFVGGLSPSKRLILAFFAGRLHG  353

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             PIRP++LEHWENKD+D++VH+ LPKG+SYYEM+R +KFC+CPSGYEVASPR+VEALY GC
Sbjct  354   PIRPVVLEHWENKDDDIKVHQQLPKGVSYYEMMRGSKFCLCPSGYEVASPRIVEALYAGC  413

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI DHYV PFSDVLNWKSFSVEVPV DIP+LKKILT IS R+YIR+QRR L  RRHF
Sbjct  414   VPVLISDHYVPPFSDVLNWKSFSVEVPVSDIPSLKKILTSISPRQYIRMQRRVLQVRRHF  473

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRLHGIE  1845
             EVN PPKR+DV HMILHS WLRRLN+ +H ++
Sbjct  474   EVNYPPKRFDVFHMILHSIWLRRLNIGIHDVQ  505



>ref|XP_010543482.1| PREDICTED: probable glycosyltransferase At5g03795 [Tarenaya hassleriana]
Length=489

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/428 (66%), Positives = 343/428 (80%), Gaps = 5/428 (1%)
 Frame = +1

Query  562   EIQQPDIQKEENLNisssipsiisssNETGTPLQVTIKRKFRNLERLEANLGKARAAIRA  741
             E  Q D ++ + +N + S  S +    E+  P     KR   N+E++EA L +ARAAI+ 
Sbjct  66    EFVQEDGERMQLMNSTISNSSTVEDGAESVLPPLTVKKRILSNMEKIEAELQRARAAIKG  125

Query  742   AVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYA  921
             A    +  DD DYVP GP+YWNA VFHRSYLEMEKQFKIFVY+EGEPP+FH+GPCKSIY+
Sbjct  126   ASFE-DDMDDPDYVPLGPMYWNAKVFHRSYLEMEKQFKIFVYKEGEPPLFHDGPCKSIYS  184

Query  922   SEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDY  1098
              EGNFIY MET + FRT DP++AH F+LP+S+  +V +VY+R  H+   + P+++TV DY
Sbjct  185   MEGNFIYQMETDTRFRTTDPDRAHAFYLPLSVVKMVRYVYERDSHD---FSPIRKTVRDY  241

Query  1099  INLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKD  1278
             I+LV GKY YWNRS+GADHF+L+CHDWGPE S + P+L +NSIRALCNANTSE FKP KD
Sbjct  242   IDLVDGKYPYWNRSIGADHFILSCHDWGPEASFSHPQLGENSIRALCNANTSERFKPRKD  301

Query  1279  VSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYL  1458
             VSIPEI L  GT+ GL+GGPSPSRR ILAFFAGG+HGP+RPILL+HWEN+D DV+VH+YL
Sbjct  302   VSIPEINLRTGTLTGLVGGPSPSRRPILAFFAGGVHGPVRPILLKHWENRDEDVRVHKYL  361

Query  1459  PKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFS  1638
             PKG SY +M+R +KFCICPSGYEVASPR+VEALY+GCVPVLI + YV PFSDVLNW+SFS
Sbjct  362   PKGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVPVLINEGYVPPFSDVLNWRSFS  421

Query  1639  VEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRR  1818
             V VPVE+IPNLKKIL GIS R+YIR+ RR L  +RHF+VN PPKR+DV HMILHS W+RR
Sbjct  422   VVVPVEEIPNLKKILMGISPRQYIRMYRRVLKVQRHFQVNSPPKRFDVFHMILHSIWVRR  481

Query  1819  LNVRLHGI  1842
             LNVR+  I
Sbjct  482   LNVRIREI  489



>ref|XP_010039055.1| PREDICTED: probable glycosyltransferase At5g03795 [Eucalyptus 
grandis]
Length=562

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/388 (73%), Positives = 321/388 (83%), Gaps = 5/388 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             KR   +LERLEA L +AR+ IR A  G N  +D DYVP GP+Y NAN FHRSYLEMEKQF
Sbjct  175   KRVDTDLERLEAGLRRARSGIREAKTG-NPMEDPDYVPVGPMYRNANAFHRSYLEMEKQF  233

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVH  1029
             KIFVY+EG+PPVFHNGPCKSIYA EGNFI+ +E +  FRT DP +AHVFFLP S+  +V 
Sbjct  234   KIFVYKEGDPPVFHNGPCKSIYAMEGNFIHMVEINKRFRTEDPREAHVFFLPFSVAMMVQ  293

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             FVY R  H+   + P+K+TV DYI++VA KY YWNRSLGADHFMLACHDWGPE S AVP 
Sbjct  294   FVYVRDSHD---FGPIKRTVIDYIDVVASKYPYWNRSLGADHFMLACHDWGPEASFAVPH  350

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L +NSIR LCNANTSEGF PSKDVS PE+ L  G + GLIGGPSPS RSILAFFAGGLHG
Sbjct  351   LHRNSIRVLCNANTSEGFDPSKDVSFPEVNLHTGAIGGLIGGPSPSHRSILAFFAGGLHG  410

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             PIRPILL+HWENKD DV+VHRYLP+G+SYY+M++++KFCICPSGYEVASPR+VEA+YTGC
Sbjct  411   PIRPILLQHWENKDEDVKVHRYLPRGVSYYDMMKRSKFCICPSGYEVASPRVVEAIYTGC  470

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI DHYV PFSDVLNW+SFSVEV V +IPNLK IL  IS R+YIR+QRR    RRHF
Sbjct  471   VPVLISDHYVPPFSDVLNWRSFSVEVTVREIPNLKTILASISSRQYIRMQRRVAQVRRHF  530

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             EV+ PPKRYDV HMILHS WLRRLNV L
Sbjct  531   EVHSPPKRYDVFHMILHSVWLRRLNVGL  558



>ref|XP_004303053.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=549

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/391 (69%), Positives = 324/391 (83%), Gaps = 5/391 (1%)
 Frame = +1

Query  667   TIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEK  846
             T ++++ +L RLE  L +AR AIR A    N+T D DY+P GP+YWNAN F RSYLEMEK
Sbjct  160   TRRKEYTHLGRLEGRLRRARVAIREAKFA-NKTHDADYIPNGPMYWNANAFQRSYLEMEK  218

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAI  1023
             +FK+FVYEEGEPP+FHNGPCKSIY+ EGNFI+ +E +  FRTR+PE+AHV+FLP S+T +
Sbjct  219   RFKVFVYEEGEPPLFHNGPCKSIYSMEGNFIHEIEVNKQFRTRNPEEAHVYFLPYSVTML  278

Query  1024  VHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             V FVY R  H+   + P++QTV DY+N+++ KY YWNRSL ADHF +ACHDWGPE S + 
Sbjct  279   VRFVYVRDSHD---FSPIRQTVRDYVNIISTKYPYWNRSLAADHFTVACHDWGPETSNSD  335

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
             P L KNSIR LCNANTSEGF PSKDVS PE+ L  G  HG +GGPSP  RSILAFFAGG+
Sbjct  336   PYLRKNSIRGLCNANTSEGFNPSKDVSFPEVNLQTGDTHGFLGGPSPRLRSILAFFAGGV  395

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HGPIRPILLEHWENKD D++VH+YLPKG+SYY+M++K+KFC+CPSGYEVASPR+VEA+YT
Sbjct  396   HGPIRPILLEHWENKDKDMRVHQYLPKGVSYYDMMKKSKFCLCPSGYEVASPRVVEAIYT  455

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
             GCVPVLI DHYV PFSDVLNWKSFSVEV V DIPNLK ILT IS R+Y+R+Q+R +  R+
Sbjct  456   GCVPVLISDHYVPPFSDVLNWKSFSVEVSVSDIPNLKNILTSISTRQYLRMQKRVIQVRK  515

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             HFEVN PPKR+DV HMILHS WLRRLNVR+H
Sbjct  516   HFEVNSPPKRFDVFHMILHSIWLRRLNVRVH  546



>ref|XP_010243073.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nelumbo nucifera]
Length=620

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/399 (69%), Positives = 319/399 (80%), Gaps = 5/399 (1%)
 Frame = +1

Query  652   TPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGI-NQTDDHDYVPTGPVYWNANVFHRS  828
              P  + +++    LERLEA L K RAAIR A H   NQT D DYVP GP+YWNA  FHRS
Sbjct  221   APTIIKMQKNHTQLERLEAGLAKIRAAIREAAHQKGNQTSDFDYVPEGPMYWNAQAFHRS  280

Query  829   YLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLP  1005
             YL MEKQFKIF+YEEGEPP+FH+GPC+SIY+ EGNFI+ +E    FRTR+PE+A+ FFLP
Sbjct  281   YLVMEKQFKIFIYEEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPEEAYAFFLP  340

Query  1006  ISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGP  1185
              S+T +V FVY   V N     P+KQTV DY+NL+AGKY YWNRSL ADHFML+CHDWGP
Sbjct  341   FSVTQMVRFVY---VPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSCHDWGP  397

Query  1186  EISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILA  1365
               S  VP L+KN IR LCNANTSEGF P+KD S PEI L  G   GLIGGP PS R ILA
Sbjct  398   LTSSYVPHLYKNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGLIGGPPPSCRPILA  457

Query  1366  FFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FFAGGLHGPIRP+LLEHW+NKD DV+V+ YLPKG+SYY+M++K+K+CICPSGYEVASPR+
Sbjct  458   FFAGGLHGPIRPLLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEVASPRI  517

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             VEA+Y GCVPVLI DHYV PFSDVLNWKSFSVEVPV +IPNLK+IL  I  R+Y R+QRR
Sbjct  518   VEAIYAGCVPVLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSIPTRQYKRMQRR  577

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             GL  RRHFEVN PPKR+DV HMILHS WLRRLNVR+H +
Sbjct  578   GLKVRRHFEVNFPPKRFDVYHMILHSVWLRRLNVRIHDL  616



>ref|XP_008359607.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=539

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/442 (66%), Positives = 345/442 (78%), Gaps = 22/442 (5%)
 Frame = +1

Query  529   SSTSPLHFESQ-----EIQQPDIQKEENLNisssipsiisssNETGTPLQVTIKRKFRNL  693
             SS+ P+  E +      +QQP++   ++            S NET   +    +RK  NL
Sbjct  111   SSSPPIAIEDEAEALPTLQQPNVTNRDD------------SRNETYASIMEKRQRKNTNL  158

Query  694   ERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEE  873
               LEA L +ARAAIR A  G NQT D DY+P GP+YWNAN FH SYLEME++FK+FVY E
Sbjct  159   GLLEARLRRARAAIREAKFG-NQTHDVDYIPNGPMYWNANAFHSSYLEMEEKFKVFVYAE  217

Query  874   GEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRSV  1050
             GEPP+FHNGPCKSIY+ EGNFI+ +E +  FRTRDPEKAHV+FLP S+T +V FVY R  
Sbjct  218   GEPPLFHNGPCKSIYSMEGNFIHQIEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDS  277

Query  1051  HNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIR  1230
             H+   + P++QTV DY+N+V+ KY YWNRSLGADHFMLACHDWGPE S + P L KNSIR
Sbjct  278   HD---FSPIRQTVRDYVNIVSEKYPYWNRSLGADHFMLACHDWGPETSNSNPHLRKNSIR  334

Query  1231  ALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILL  1410
             ALCNANTSEGF PSKDVS PEI L  G  HG +GGPSP  RS LAFFAGG+HGPIRPILL
Sbjct  335   ALCNANTSEGFNPSKDVSFPEINLQTGDTHGFLGGPSPRLRSNLAFFAGGVHGPIRPILL  394

Query  1411  EHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKD  1590
             EHWENKD D++VH+YLPKG+SYY M+R+++FC+CPSGYEVASPR+VEA+YTGCVPVLI D
Sbjct  395   EHWENKDPDMRVHQYLPKGVSYYNMMRQSRFCLCPSGYEVASPRVVEAIYTGCVPVLISD  454

Query  1591  HYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPK  1770
             HYV PFSD+LNWKSFSVEV V DIPNLKKILT IS R+Y+R+QRR L  R+HFEVN PPK
Sbjct  455   HYVPPFSDILNWKSFSVEVSVSDIPNLKKILTSISSRQYVRMQRRVLQVRKHFEVNSPPK  514

Query  1771  RYDVTHMILHSAWLRRLNVRLH  1836
             R+DV HMILHS WLRRLNVR+H
Sbjct  515   RFDVFHMILHSIWLRRLNVRVH  536



>ref|XP_003541440.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
 gb|KHN48210.1| Putative glycosyltransferase [Glycine soja]
Length=491

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/388 (72%), Positives = 324/388 (84%), Gaps = 5/388 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             KRKF  L+R E  L +ARAAIR A    N+T D DYVPTGP+YWNA  FHRSYLEMEKQF
Sbjct  104   KRKFSFLDRTEVVLAQARAAIREA-RNRNRTLDSDYVPTGPMYWNAKAFHRSYLEMEKQF  162

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVH  1029
             K+FVYEEGE PVFHNGPCKSIY+ EGNFI+ +E +  FRT+DP+KAHVFFLP S+  +V 
Sbjct  163   KVFVYEEGETPVFHNGPCKSIYSMEGNFIHAIEMNDHFRTKDPKKAHVFFLPFSVVMMVR  222

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             FVY+R   +   + P+K+TV DY+NL+A +Y YWNRSLGADHFMLACHDWGPE S ++P 
Sbjct  223   FVYER---DSRDFGPIKKTVIDYVNLIATRYPYWNRSLGADHFMLACHDWGPEASFSLPY  279

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L KNSIR LCNANTSEGFKP+KDVS PEI L  G+++G +GGPS S+RSILAFFAGG+HG
Sbjct  280   LHKNSIRVLCNANTSEGFKPAKDVSFPEINLQTGSINGFVGGPSASKRSILAFFAGGVHG  339

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             PIRPILLEHWENKD D+QVH+YLPKG+SYY MLRK+KFC+CPSGYEVASPR+VEA+YTGC
Sbjct  340   PIRPILLEHWENKDEDIQVHKYLPKGVSYYGMLRKSKFCLCPSGYEVASPRVVEAIYTGC  399

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI +HYV PFSDVLNWKSFSVE+ V+DIP LK IL  IS R++IR+QRR    RRHF
Sbjct  400   VPVLISEHYVPPFSDVLNWKSFSVELSVKDIPILKDILMSISPRQHIRMQRRVGQIRRHF  459

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             EV+ PPKR+DV HMILHS WLRRLN R+
Sbjct  460   EVHSPPKRFDVFHMILHSVWLRRLNFRV  487



>ref|XP_004497579.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=518

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/390 (72%), Positives = 320/390 (82%), Gaps = 8/390 (2%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQT-DDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             +RKF  L+R EA L +ARAAIR A    NQT  D DYVP GP+YWNA  FHRSYLEMEKQ
Sbjct  132   QRKFSILDRTEAGLLQARAAIREAT---NQTLQDPDYVPIGPMYWNAKAFHRSYLEMEKQ  188

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS-PFRTRDPEKAHVFFLPISITAIV  1026
             FK+FVYEEGEPPVFHNGPCKSIY+ EGNFI+ +E +  FRTRDP+KA VFFLP S+  +V
Sbjct  189   FKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPDKAQVFFLPFSVVMLV  248

Query  1027  HFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVP  1206
              FVY R   +   + P+++TV+DYIN++AGKY YWNRSLGADHFMLACHDWGPE S +VP
Sbjct  249   RFVYLR---DSRDFGPIRKTVNDYINVIAGKYPYWNRSLGADHFMLACHDWGPETSFSVP  305

Query  1207  ELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLH  1386
              L KNSIR LCNANTSE F PSKDVS PEI L  G+++G IGGPS S+R ILAFFAGGLH
Sbjct  306   YLHKNSIRVLCNANTSEKFNPSKDVSFPEINLQTGSINGFIGGPSASKRPILAFFAGGLH  365

Query  1387  GPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
             G IR ILL+HWENKD D+ V +YLPKG+SYYEMLRK+KFC+CPSGYEVASPR+VEA+YTG
Sbjct  366   GYIRSILLDHWENKDQDIMVQKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRVVEAIYTG  425

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             CVPVLI +HYV PFSDVLNWKSFSVEV VEDIPNLK IL  IS  +YIR+QRR    RRH
Sbjct  426   CVPVLISEHYVLPFSDVLNWKSFSVEVKVEDIPNLKDILMRISTTQYIRMQRRVGQIRRH  485

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             FEV+ PPKR+DV HMILHS WLRRLN R+H
Sbjct  486   FEVHSPPKRFDVFHMILHSVWLRRLNFRVH  515



>ref|XP_010247793.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=592

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/390 (69%), Positives = 315/390 (81%), Gaps = 5/390 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGI-NQTDDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             K++   LERLEA L +AR  IR A H   NQT D DYVP GP+YWNA  FHRSYLEMEKQ
Sbjct  202   KKRRSKLERLEAGLSRARVTIREAAHQKRNQTPDLDYVPQGPMYWNAQAFHRSYLEMEKQ  261

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIV  1026
             FK+FVYEEGEPP+FHNGPC SIY+SEGNFI+ ME    FRT+ PE+AHVFFLP S+  +V
Sbjct  262   FKVFVYEEGEPPLFHNGPCGSIYSSEGNFIHQMEMDKRFRTQHPEEAHVFFLPFSVAMMV  321

Query  1027  HFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVP  1206
              FVY R  H+     P+K TV+DY+N++AGKY YWNRSL ADHFML+CHDWGP  S  VP
Sbjct  322   RFVYVRDSHDIG---PIKHTVTDYVNIIAGKYPYWNRSLAADHFMLSCHDWGPATSTYVP  378

Query  1207  ELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLH  1386
              L+ N IR LCNANTSEGF P+KD S PEI +    + GLIGGPSPS R  LAFFAG LH
Sbjct  379   HLYNNGIRVLCNANTSEGFNPAKDASFPEINMVTREIKGLIGGPSPSHRPTLAFFAGKLH  438

Query  1387  GPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
             GP+RP+L EHW+NKD DVQV+  LP+G+SYY+M+RK+K+CICPSGYEVASPR+VEALY G
Sbjct  439   GPVRPVLFEHWKNKDEDVQVYESLPRGLSYYDMMRKSKYCICPSGYEVASPRVVEALYVG  498

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             CVPVLI DHYV PFSD+LNW+SFSVEVPV +IPNLK+IL  IS ++YIR+QRRGL+ R+H
Sbjct  499   CVPVLISDHYVPPFSDILNWRSFSVEVPVNEIPNLKRILLNISSKQYIRMQRRGLLVRKH  558

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             FEVN PPKR+DV HMILHS WLRRLNVR+H
Sbjct  559   FEVNFPPKRFDVYHMILHSVWLRRLNVRIH  588



>ref|XP_009631064.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
tomentosiformis]
Length=461

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/392 (67%), Positives = 316/392 (81%), Gaps = 3/392 (1%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFK  855
             +++  LE+LEA L KARAAI       N   + +Y+P GP+Y NA  FHRSYLEME +FK
Sbjct  73    KRYSKLEKLEAGLAKARAAILKENKSWNNQTEDEYIPHGPMYLNATAFHRSYLEMENKFK  132

Query  856   IFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFV  1035
             ++VY+EGEPPVFH GPCK  YA EG FI+ ME S FRT DP KAHV+FLP+S+T +  F+
Sbjct  133   VYVYKEGEPPVFHFGPCKHTYAIEGYFIHTMEISEFRTSDPNKAHVYFLPMSVTMLTQFI  192

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             Y   VH+   W  MK T  DY+N+++ KY YWNRSLGADHFMLACHDWGPEIS A+P L+
Sbjct  193   Y---VHDSHEWGLMKNTALDYVNVISNKYPYWNRSLGADHFMLACHDWGPEISFAIPYLY  249

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
             KNSIRALCNANTSE F P+KDVSIPEI LP GT  GL+GGP PS R +L FFAGGLHGPI
Sbjct  250   KNSIRALCNANTSEKFNPTKDVSIPEIHLPYGTTEGLLGGPPPSERPVLVFFAGGLHGPI  309

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RPILL+HWENKD DVQ+H+YLPKGISYY+M++K+K+CICPSGYEVASPRMVE LY GCVP
Sbjct  310   RPILLQHWENKDKDVQIHKYLPKGISYYDMIKKSKYCICPSGYEVASPRMVEGLYMGCVP  369

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLIKD+YV PFSDVL+W +FSV +PV+DIPNLKKIL  I Q +Y+ +Q+RG+  R+HFEV
Sbjct  370   VLIKDNYVIPFSDVLDWNTFSVIIPVKDIPNLKKILLDIPQEKYLEMQKRGIQMRKHFEV  429

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRLHGIEDT  1851
             N PPKRYDV HMILHS WLRRLNVR+  ++++
Sbjct  430   NSPPKRYDVFHMILHSIWLRRLNVRIRDVDES  461



>ref|XP_009340969.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=542

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/442 (66%), Positives = 347/442 (79%), Gaps = 22/442 (5%)
 Frame = +1

Query  529   SSTSPLHFESQE-----IQQPDIQKEENLNisssipsiisssNETGTPLQVTIKRKFRNL  693
             SS+ P+  E +      +QQP++ K ++            S NET   +    +RK  NL
Sbjct  114   SSSPPIAIEDEAEALPTLQQPNVTKGDD------------SRNETHASIMEKRQRKNTNL  161

Query  694   ERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEE  873
               LEA L +ARAAIR A  G NQT D DY+P GP+YWNAN FHRSYLEME++FK+FVY E
Sbjct  162   GWLEARLRRARAAIREAKFG-NQTRDVDYIPNGPMYWNANAFHRSYLEMEEKFKVFVYAE  220

Query  874   GEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRSV  1050
             GEPP+FHNGPCKSIY+ EGNFI+ +E +  FRT+DPEKAHV+FLP S+T +V FVY R  
Sbjct  221   GEPPLFHNGPCKSIYSMEGNFIHEIEVNKQFRTQDPEKAHVYFLPFSVTMLVRFVYVRDS  280

Query  1051  HNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIR  1230
             H+   + P++QTV DY+N+V+ KY YWNRSLGADHFMLACHDWGPE S + P L KNSIR
Sbjct  281   HD---FSPIRQTVRDYVNIVSEKYPYWNRSLGADHFMLACHDWGPETSNSNPHLRKNSIR  337

Query  1231  ALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILL  1410
             ALCNANTSEGF PS+DVS PEI L  G  HG +GGPSP  RS LAFFAGG+HGPIRPILL
Sbjct  338   ALCNANTSEGFNPSRDVSFPEINLQTGDTHGFLGGPSPRLRSNLAFFAGGVHGPIRPILL  397

Query  1411  EHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKD  1590
             EHWENKD D++VH+YLPKG SYY+M+R+++FC+CPSGYEVASPR+VEA+YTGCVPVLI D
Sbjct  398   EHWENKDPDMRVHQYLPKGASYYDMMRQSRFCLCPSGYEVASPRVVEAIYTGCVPVLISD  457

Query  1591  HYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPK  1770
             HYV PFSD+LNWKSFSVEV V DIPNLKKILT IS R+Y+R+QRR L  R+HFEVN PPK
Sbjct  458   HYVPPFSDILNWKSFSVEVSVSDIPNLKKILTRISSRQYVRMQRRVLQVRKHFEVNSPPK  517

Query  1771  RYDVTHMILHSAWLRRLNVRLH  1836
             R+DV HMILHS WLRRLNVR+H
Sbjct  518   RFDVFHMILHSIWLRRLNVRVH  539



>ref|XP_009375632.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=543

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/424 (68%), Positives = 337/424 (79%), Gaps = 17/424 (4%)
 Frame = +1

Query  568   QQPDIQKEENLNisssipsiisssNETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAV  747
             QQP++ + ++              NET   +    +RK  NL  LEA L +ARAAIR A 
Sbjct  133   QQPNVTRGDDF------------MNETHASIMERRQRKKTNLGWLEARLRRARAAIREAK  180

Query  748   HGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASE  927
              G NQT   DY+P GP+YWNAN FHRSYLEME++FK+FVY EGEPP+FHNGPCKSIY+ E
Sbjct  181   FG-NQTRGVDYIPNGPMYWNANAFHRSYLEMEEKFKVFVYGEGEPPLFHNGPCKSIYSME  239

Query  928   GNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYIN  1104
             GNFI+ +E +  FRTRDPEKAHV+FLP S+T +V FVY R  H+   + P+++TV DY+N
Sbjct  240   GNFIHEIEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHD---FGPIRRTVRDYVN  296

Query  1105  LVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVS  1284
             +V+ KY YWNRSLGADHFMLACHDWGPE S + P L KNSIRALCNANTSEGFKPSKDVS
Sbjct  297   IVSEKYPYWNRSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFKPSKDVS  356

Query  1285  IPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPK  1464
              PEI L  G  HG IGGPSP  RSIL FFAGG+HGPIRPILLEHWENKD D++VH+YLPK
Sbjct  357   FPEINLQTGDTHGFIGGPSPRLRSILGFFAGGVHGPIRPILLEHWENKDPDLRVHQYLPK  416

Query  1465  GISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVE  1644
             G+SYY+M+R+++FC+CPSGYEVASPR+VEA+Y GCVPVLI DHYV PFSDVLNW SFS+E
Sbjct  417   GVSYYDMMRQSRFCLCPSGYEVASPRVVEAIYAGCVPVLISDHYVPPFSDVLNWNSFSIE  476

Query  1645  VPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLN  1824
             V V DIPNLKKILT IS RRY+R+QRR L  RRHFEVN PPKR+DV HMILHS WLRRLN
Sbjct  477   VSVSDIPNLKKILTSISSRRYLRMQRRMLQVRRHFEVNSPPKRFDVFHMILHSIWLRRLN  536

Query  1825  VRLH  1836
             VR+H
Sbjct  537   VRVH  540



>ref|XP_007202112.1| hypothetical protein PRUPE_ppa006842mg [Prunus persica]
 gb|EMJ03311.1| hypothetical protein PRUPE_ppa006842mg [Prunus persica]
Length=393

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/361 (74%), Positives = 306/361 (85%), Gaps = 4/361 (1%)
 Frame = +1

Query  757   NQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNF  936
             NQT D DY+P GP+YWNAN F RSYLEMEK+FK+FVY EGEPP+FHNGPCKSIY+ EGNF
Sbjct  33    NQTQDVDYIPNGPMYWNANAFQRSYLEMEKRFKVFVYGEGEPPLFHNGPCKSIYSMEGNF  92

Query  937   IYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVA  1113
             I+ +E +  FRTRDPEKAHV+FLP S+T +V FVY R  H+   + P++QTV DY+N+V+
Sbjct  93    IHEIEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHD---FGPIRQTVRDYVNIVS  149

Query  1114  GKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPE  1293
             GKY YWNRSLGADHFMLACHDWGPE S + P L KNSIR LCNANTSEGF PSKDVS PE
Sbjct  150   GKYPYWNRSLGADHFMLACHDWGPETSNSDPHLRKNSIRVLCNANTSEGFNPSKDVSFPE  209

Query  1294  ILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGIS  1473
             I L  G  HG +GGPSP  RSILAFFAGG+HGPIRP+LLEHWENKD D++VH+YLPKGIS
Sbjct  210   INLQTGDTHGFLGGPSPRLRSILAFFAGGVHGPIRPVLLEHWENKDEDLRVHQYLPKGIS  269

Query  1474  YYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPV  1653
             YY+M+R +KFC+CPSGYEVASPR+VEA+YTGCVPVLI DHYV PFSDVLNWKSFSVEV V
Sbjct  270   YYDMMRHSKFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVKV  329

Query  1654  EDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              +IPNLK IL  IS ++YIR+QRR +  RRHFEVN PPKR+DV HMILHS WLRRLNVR+
Sbjct  330   SEIPNLKNILMSISTKQYIRMQRRVVQVRRHFEVNSPPKRFDVFHMILHSIWLRRLNVRV  389

Query  1834  H  1836
             H
Sbjct  390   H  390



>ref|XP_008392545.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=542

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/425 (68%), Positives = 338/425 (80%), Gaps = 17/425 (4%)
 Frame = +1

Query  565   IQQPDIQKEENLNisssipsiisssNETGTPLQVTIKRKFRNLERLEANLGKARAAIRAA  744
             +QQP++ + ++              NET   +    +RK  NL  LEA L +ARAAIR A
Sbjct  131   LQQPNVIRGDDFT------------NETHASIMERRQRKKTNLGWLEARLRRARAAIREA  178

Query  745   VHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYAS  924
               G NQT D DY+P GP+YWNAN FHRSYLEME+ FK+FVY EGEPP+FHNGPCKSIY+ 
Sbjct  179   KFG-NQTRDVDYIPNGPMYWNANAFHRSYLEMEEXFKVFVYGEGEPPLFHNGPCKSIYSM  237

Query  925   EGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYI  1101
             EGNFI+ +E +  FRTRDPEKAHV+FLP S+T +V FVY R  H+   + P+++TV DY+
Sbjct  238   EGNFIHEIEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHD---FGPIRRTVRDYV  294

Query  1102  NLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDV  1281
             N+V+ KY YWNRSLGADHFMLACHDWGPE S + P L KNSIRALCNANTSEGF PSKDV
Sbjct  295   NIVSEKYPYWNRSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFNPSKDV  354

Query  1282  SIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLP  1461
             S PEI L  G  HG IGGPSP  RSIL FFAGG+HGPIRPILLEHWENKD D++VH+YLP
Sbjct  355   SFPEINLQTGDTHGFIGGPSPRLRSILGFFAGGVHGPIRPILLEHWENKDPDLRVHQYLP  414

Query  1462  KGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSV  1641
             KG+SYY+M+R+++FC+CPSGYEVASPR+VEA+YTGC+PVLI DHYV PFSDVLNW+SFS+
Sbjct  415   KGVSYYDMMRQSRFCLCPSGYEVASPRVVEAIYTGCIPVLISDHYVPPFSDVLNWRSFSI  474

Query  1642  EVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRL  1821
             EV   DIPNLKKILT IS R+Y+R+QRR L  RRHFEVN PPKR+DV HMILHS WLRRL
Sbjct  475   EVSASDIPNLKKILTSISSRQYLRMQRRVLQVRRHFEVNSPPKRFDVFHMILHSIWLRRL  534

Query  1822  NVRLH  1836
             NVR+H
Sbjct  535   NVRVH  539



>ref|XP_010683939.1| PREDICTED: probable glycosyltransferase At5g03795 [Beta vulgaris 
subsp. vulgaris]
Length=538

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/407 (67%), Positives = 333/407 (82%), Gaps = 7/407 (2%)
 Frame = +1

Query  640   NETGTP--LQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNAN  813
             NET  P   ++ +++   +L+RLE  L ++RAAI+ A +     DD D+ P GP+YWNAN
Sbjct  134   NETHAPPMRKLELEKMATDLDRLEIGLQQSRAAIKEAKYTNRTYDDPDFKPLGPMYWNAN  193

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS-PFRTRDPEKAH  990
              FHRSYLEME++FK++VYEEGEPP+FHNGPCKSIY++EGNFI+ ME +  FRT+  ++AH
Sbjct  194   AFHRSYLEMERRFKVYVYEEGEPPLFHNGPCKSIYSTEGNFIHLMEINDQFRTKKLDEAH  253

Query  991   VFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLAC  1170
             VFFLP S+  +VHFVY R  H+   + P++QTV DYIN+V+ KY YWNRSLGADHFML+C
Sbjct  254   VFFLPFSVVMMVHFVYLRDSHD---FGPIRQTVRDYINVVSTKYPYWNRSLGADHFMLSC  310

Query  1171  HDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR  1350
             HDWGPE S +VP L KNSIR LCNANTSEGFKP KDVS+PEI L  G ++G +GGPSPSR
Sbjct  311   HDWGPETSFSVPYLAKNSIRVLCNANTSEGFKPHKDVSLPEINLRTGAINGFVGGPSPSR  370

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDN-DVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
             RSILAFFAGGLHGPIRPILLEHW NKD+ D+++  YLPKG+SYY+MLR +KFCICPSGYE
Sbjct  371   RSILAFFAGGLHGPIRPILLEHWGNKDDKDLKIFTYLPKGVSYYDMLRNSKFCICPSGYE  430

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA+YTGCVPVLI DHYV PFSDVLNWKSFSVEV V+DIPNLK ILT IS ++Y
Sbjct  431   VASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVSVKDIPNLKTILTNISTKKY  490

Query  1708  IRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIED  1848
             +++ RR L  RRHFEV+ PPKRYD  HMILHS WLRRLNV +H +++
Sbjct  491   LKMYRRVLQVRRHFEVHAPPKRYDFFHMILHSVWLRRLNVHVHDLQE  537



>gb|KEH24082.1| glycosyltransferase [Medicago truncatula]
Length=402

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/387 (71%), Positives = 322/387 (83%), Gaps = 5/387 (1%)
 Frame = +1

Query  679   KFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKI  858
             K  NL+R+EA+L +ARAAIR AV+G  QT D DYVPTGP+Y   N+FHRSYLEMEK+FK+
Sbjct  17    KLSNLDRVEADLLQARAAIRKAVNG-KQTQDIDYVPTGPMYHKPNLFHRSYLEMEKRFKV  75

Query  859   FVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS-PFRTRDPEKAHVFFLPISITAIVHFV  1035
             FVYEEGEPPVFH+GPC+ IY+ EG FI  ME +  F T+DPEKAHVFFL  S+  +VH+V
Sbjct  76    FVYEEGEPPVFHDGPCRDIYSMEGIFINQMEMNDKFITKDPEKAHVFFLSYSVAMMVHYV  135

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             Y   V +   +  ++ TV DYIN+++ KY YWNRS GADHF+LACHDWGPE+S AVP L+
Sbjct  136   Y---VRDSRAYDLLRITVKDYINVLSEKYPYWNRSHGADHFILACHDWGPEVSNAVPNLY  192

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
             KNSIRA CNANTSEGFKP KDVSIPEI +  G +  L+GGPSPS+RSILAFFAGGLHG I
Sbjct  193   KNSIRAFCNANTSEGFKPVKDVSIPEINVRTGIIDDLLGGPSPSKRSILAFFAGGLHGDI  252

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             R +LLEHWE+KD D+QVH+YLPKG+SYY MLRK+KFC+CPSG+EVASPR+VEA+YTGCVP
Sbjct  253   RNVLLEHWEHKDEDIQVHKYLPKGVSYYAMLRKSKFCLCPSGWEVASPRVVEAIYTGCVP  312

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI DHYV PFSDVLNWKSFSVEV V DIPNLKKIL+ IS R+YIR+QRR    R+HFEV
Sbjct  313   VLISDHYVPPFSDVLNWKSFSVEVSVNDIPNLKKILSNISPRQYIRMQRRVGQVRKHFEV  372

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             N PPKR+DV HMILHS WLRRLN++LH
Sbjct  373   NSPPKRFDVFHMILHSIWLRRLNLKLH  399



>ref|XP_006481931.1| PREDICTED: probable glycosyltransferase At5g03795-like [Citrus 
sinensis]
Length=555

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/402 (69%), Positives = 327/402 (81%), Gaps = 6/402 (1%)
 Frame = +1

Query  640   NET-GTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANV  816
             NET   P++   KR    LE+LEA L +AR AI+ A  G NQT D D+VP GP+YW++  
Sbjct  151   NETHAVPMKAERKRAVTKLEKLEAGLQRARVAIKEASIG-NQTQDPDFVPLGPMYWDSKA  209

Query  817   FHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHV  993
             FHRSYLEME++FK+FVYEEGEPPVFH+GPCKSIY+ EGNFIY ME +  FRT++ +KAHV
Sbjct  210   FHRSYLEMEQKFKVFVYEEGEPPVFHDGPCKSIYSMEGNFIYTMEVNKQFRTKEADKAHV  269

Query  994   FFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACH  1173
             FFLP S+  +V FVY R  H+   + P+++TV DY+NL+AGKY YWNRSLGADHFMLACH
Sbjct  270   FFLPFSVVKLVRFVYVRDSHD---FGPIRRTVVDYVNLIAGKYPYWNRSLGADHFMLACH  326

Query  1174  DWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRR  1353
             DWGPE S +VP L KNSIR LCNANTSE F P KDVS PEI L  G + GLIGGPSPSRR
Sbjct  327   DWGPETSFSVPYLGKNSIRVLCNANTSEKFSPVKDVSFPEINLQTGGLTGLIGGPSPSRR  386

Query  1354  SILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVA  1533
             SILAFFAGG+HGPIRP+LLEHWENKD D++VH+YLPKG+SYYEM+RK+K+C+CPSGYEVA
Sbjct  387   SILAFFAGGVHGPIRPVLLEHWENKDEDIRVHKYLPKGVSYYEMMRKSKYCLCPSGYEVA  446

Query  1534  SPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             SPR+VEA+YTGCVPVLI +HYV PFSDVLNWKSFSV +   DIPNLK ILT IS R+YIR
Sbjct  447   SPRVVEAIYTGCVPVLISEHYVPPFSDVLNWKSFSVALSTRDIPNLKSILTSISPRQYIR  506

Query  1714  LQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
             + RR +  RRHFE N PPKR+DV HMILHS WLRRLNVR+  
Sbjct  507   MHRRVVQVRRHFEFNSPPKRFDVFHMILHSIWLRRLNVRIQN  548



>gb|AES60658.2| exostosin family protein [Medicago truncatula]
Length=488

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/390 (71%), Positives = 318/390 (82%), Gaps = 6/390 (2%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             +RKF  L+R EA L  ARAAIR A +   QT D DYVP GP+YWNA  FHRSYLEMEKQF
Sbjct  100   QRKFSILDRTEAGLLHARAAIREASYS-TQTQDPDYVPIGPMYWNAKAFHRSYLEMEKQF  158

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISITAIVH  1029
             K+FVYEEGEPPVFHNGPCKSIY+ EGNFI+ +E    FRTRDP+KAHV+FLP S+  +V 
Sbjct  159   KVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIELNDQFRTRDPQKAHVYFLPFSVVMLVR  218

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             FVY R   +   + P+++TV+DYIN++AGKY YWNRSLGADHFMLACHDWGPE S +VP 
Sbjct  219   FVYLR---DSRDFGPIRKTVTDYINVIAGKYPYWNRSLGADHFMLACHDWGPETSFSVPY  275

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L KNSIR LCNANTSE F P+KDVS PEI L  G+++G +GG S S+R ILAFFAGGLHG
Sbjct  276   LHKNSIRVLCNANTSERFNPAKDVSFPEINLQTGSINGFLGGLSASKRPILAFFAGGLHG  335

Query  1390  PIRPILLEHWEN-KDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
              IR ILLEHWEN KD D+ + +YLPKG+SYYEMLRK+KFC+CPSGYEVASPR+VEA+YTG
Sbjct  336   HIRAILLEHWENNKDQDMMIQKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRIVEAIYTG  395

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             CVPVLI DHYV PFSDVLNWKSFSVE+ VEDIP LK IL  IS  +YIR+QRR +  RRH
Sbjct  396   CVPVLISDHYVPPFSDVLNWKSFSVEISVEDIPKLKDILMRISPTQYIRMQRRVVQIRRH  455

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             FEV+ PPKR+DV HMILHS WLRRLN R+H
Sbjct  456   FEVHSPPKRFDVFHMILHSVWLRRLNFRVH  485



>gb|KDO60990.1| hypothetical protein CISIN_1g048582mg [Citrus sinensis]
Length=555

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/402 (69%), Positives = 327/402 (81%), Gaps = 6/402 (1%)
 Frame = +1

Query  640   NET-GTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANV  816
             NET   P++   KR    LE+LEA L +AR AI+ A  G NQT D D+VP GP+YW++  
Sbjct  151   NETHAVPMKAERKRAVTKLEKLEAGLQRARVAIKEASIG-NQTQDPDFVPLGPMYWDSKA  209

Query  817   FHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHV  993
             FHRSYLEME++FK+FVYEEGEPPVFH+GPCKSIY+ EGNFIY ME +  FRT++ +KAHV
Sbjct  210   FHRSYLEMEQKFKVFVYEEGEPPVFHDGPCKSIYSMEGNFIYTMEVNKQFRTKEADKAHV  269

Query  994   FFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACH  1173
             FFLP S+  +V FVY R  H+   + P+++TV DY+NL+AGKY YWNRSLGADHFMLACH
Sbjct  270   FFLPFSVVKLVRFVYVRDSHD---FGPIRRTVIDYVNLIAGKYPYWNRSLGADHFMLACH  326

Query  1174  DWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRR  1353
             DWGPE S +VP L KNSIR LCNANTSE F P KDVS PEI L  G + GLIGGPSPSRR
Sbjct  327   DWGPETSFSVPYLGKNSIRVLCNANTSEKFSPVKDVSFPEINLQTGGLTGLIGGPSPSRR  386

Query  1354  SILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVA  1533
             SILAFFAGG+HGPIRP+LLEHWENKD D++VH+YLPKG+SYYEM+RK+K+C+CPSGYEVA
Sbjct  387   SILAFFAGGVHGPIRPVLLEHWENKDEDIRVHKYLPKGVSYYEMMRKSKYCLCPSGYEVA  446

Query  1534  SPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             SPR+VEA+YTGCVPVLI +HYV PFSDVLNWKSFSV +   DIPNLK ILT IS R+YIR
Sbjct  447   SPRVVEAIYTGCVPVLISEHYVPPFSDVLNWKSFSVALSTRDIPNLKSILTSISPRQYIR  506

Query  1714  LQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
             + RR +  RRHFE N PPKR+DV HMILHS WLRRLNVR+  
Sbjct  507   MHRRVVQVRRHFEFNSPPKRFDVFHMILHSIWLRRLNVRIQN  548



>ref|XP_006430348.1| hypothetical protein CICLE_v10011407mg [Citrus clementina]
 gb|ESR43588.1| hypothetical protein CICLE_v10011407mg [Citrus clementina]
Length=552

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/401 (70%), Positives = 327/401 (82%), Gaps = 6/401 (1%)
 Frame = +1

Query  640   NET-GTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANV  816
             NET   P++   KR    LE+LEA L +AR AI+ A  G NQT D D+VP GP+YW++  
Sbjct  148   NETHAVPMKAERKRAVTKLEKLEAGLQRARVAIKEASIG-NQTQDPDFVPLGPMYWDSKA  206

Query  817   FHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHV  993
             FHRSYLEME++FK+FVYEEGEPPVFH+GPCKSIY+ EGNFIY ME +  FRT++ +KAHV
Sbjct  207   FHRSYLEMEQKFKVFVYEEGEPPVFHDGPCKSIYSMEGNFIYTMEVNKQFRTKEADKAHV  266

Query  994   FFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACH  1173
             FFLP S+  +V FVY R  H+   + P+++TV DY+NL+AGKY YWNRSLGADHFMLACH
Sbjct  267   FFLPFSVVKLVRFVYVRDSHD---FGPIRRTVIDYVNLIAGKYPYWNRSLGADHFMLACH  323

Query  1174  DWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRR  1353
             DWGPE S +VP L KNSIR LCNANTSE F P KDVS PEI L  G + GLIGGPSPSRR
Sbjct  324   DWGPETSFSVPYLGKNSIRVLCNANTSEKFSPVKDVSFPEINLQTGGLTGLIGGPSPSRR  383

Query  1354  SILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVA  1533
             SILAFFAGG+HGPIRP+LLEHWENKD D++VH+YLPKG+SYYEM+RK+K+C+CPSGYEVA
Sbjct  384   SILAFFAGGVHGPIRPVLLEHWENKDEDIRVHKYLPKGVSYYEMMRKSKYCLCPSGYEVA  443

Query  1534  SPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             SPR+VEA+YTGCVPVLI +HYV PFSDVLNWKSFSV +   DIPNLK ILT IS R+YIR
Sbjct  444   SPRVVEAIYTGCVPVLISEHYVPPFSDVLNWKSFSVALSTRDIPNLKSILTSISPRQYIR  503

Query  1714  LQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             + RR +  RRHFE N PPKR+DV HMILHS WLRRLNVR+ 
Sbjct  504   MHRRVVQVRRHFEFNSPPKRFDVFHMILHSIWLRRLNVRIQ  544



>ref|XP_003542567.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
 gb|KHN48212.1| Putative glycosyltransferase [Glycine soja]
Length=505

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/388 (71%), Positives = 317/388 (82%), Gaps = 5/388 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             KRKF  L++ EA L +ARAAIR A    NQT D DYVP GP+YWN   FHRSYLEMEKQF
Sbjct  118   KRKFSFLDKTEAVLAQARAAIREA-ENWNQTQDSDYVPVGPMYWNPKEFHRSYLEMEKQF  176

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVH  1029
             K+FVYEEGE PVFH GPC SIY++EG+FI+ +E +  FRTRDP+KAHVFFLP S+  +V 
Sbjct  177   KVFVYEEGELPVFHEGPCASIYSTEGSFIHAIEMNEHFRTRDPKKAHVFFLPFSVVMMVR  236

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             +VY R  H+   + P+K+TV DYIN++A +Y YWNRSLGADHFML+CHDWGPE SK  P 
Sbjct  237   YVYIRDSHD---FGPIKRTVRDYINVIAARYPYWNRSLGADHFMLSCHDWGPEASKFSPY  293

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L KNSIR LCNANTSEGF P KDVS PEI L  G + GL+GGPS S+RSILAFFAGG+HG
Sbjct  294   LRKNSIRVLCNANTSEGFDPRKDVSFPEINLQRGPIDGLLGGPSASQRSILAFFAGGIHG  353

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             PIRPILLEHWE KD D+QVH+YLPKG+SYY MLRK+KFC+CPSGYEVASPR+VEA+YTGC
Sbjct  354   PIRPILLEHWEKKDEDIQVHQYLPKGVSYYGMLRKSKFCLCPSGYEVASPRVVEAIYTGC  413

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI DHYV PFSDVLNWK FSVEV +++IPNLK IL  IS R+YIR+Q+R    RRHF
Sbjct  414   VPVLISDHYVPPFSDVLNWKMFSVEVSMKEIPNLKDILMNISPRKYIRMQKRVRQIRRHF  473

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             EV+ PPKRYDV HMILHS WLRRLN R+
Sbjct  474   EVHSPPKRYDVFHMILHSVWLRRLNFRV  501



>ref|XP_003590407.1| hypothetical protein MTR_1g061760 [Medicago truncatula]
Length=508

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/390 (71%), Positives = 318/390 (82%), Gaps = 6/390 (2%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             +RKF  L+R EA L  ARAAIR A +   QT D DYVP GP+YWNA  FHRSYLEMEKQF
Sbjct  120   QRKFSILDRTEAGLLHARAAIREASYS-TQTQDPDYVPIGPMYWNAKAFHRSYLEMEKQF  178

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISITAIVH  1029
             K+FVYEEGEPPVFHNGPCKSIY+ EGNFI+ +E    FRTRDP+KAHV+FLP S+  +V 
Sbjct  179   KVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIELNDQFRTRDPQKAHVYFLPFSVVMLVR  238

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             FVY R   +   + P+++TV+DYIN++AGKY YWNRSLGADHFMLACHDWGPE S +VP 
Sbjct  239   FVYLR---DSRDFGPIRKTVTDYINVIAGKYPYWNRSLGADHFMLACHDWGPETSFSVPY  295

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L KNSIR LCNANTSE F P+KDVS PEI L  G+++G +GG S S+R ILAFFAGGLHG
Sbjct  296   LHKNSIRVLCNANTSERFNPAKDVSFPEINLQTGSINGFLGGLSASKRPILAFFAGGLHG  355

Query  1390  PIRPILLEHWEN-KDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
              IR ILLEHWEN KD D+ + +YLPKG+SYYEMLRK+KFC+CPSGYEVASPR+VEA+YTG
Sbjct  356   HIRAILLEHWENNKDQDMMIQKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRIVEAIYTG  415

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             CVPVLI DHYV PFSDVLNWKSFSVE+ VEDIP LK IL  IS  +YIR+QRR +  RRH
Sbjct  416   CVPVLISDHYVPPFSDVLNWKSFSVEISVEDIPKLKDILMRISPTQYIRMQRRVVQIRRH  475

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             FEV+ PPKR+DV HMILHS WLRRLN R+H
Sbjct  476   FEVHSPPKRFDVFHMILHSVWLRRLNFRVH  505



>ref|XP_009774930.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana sylvestris]
Length=455

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/392 (67%), Positives = 313/392 (80%), Gaps = 3/392 (1%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFK  855
             +++  LE+LEA L KARA I    +  N   + +Y+P GP+Y NA  FHRSYLEMEK FK
Sbjct  67    KRYSKLEKLEAGLAKARATILRENNNWNNQTEDEYIPHGPMYLNATAFHRSYLEMEKNFK  126

Query  856   IFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFV  1035
             ++VY+EGEPPVFH GPCK  YA EG FI+ ME S FRT DP KAHV+FLP+S+T +  FV
Sbjct  127   VYVYKEGEPPVFHFGPCKHTYAIEGYFIHAMEISKFRTSDPNKAHVYFLPMSVTMLTQFV  186

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             Y R  H    W  MK    DY+N+++ KY +WNRSLGADHF+LACHDWGPEIS A+P L+
Sbjct  187   YVRDSHE---WGLMKNIALDYVNIISNKYPFWNRSLGADHFILACHDWGPEISFAIPYLY  243

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
             KNSIRALCNANTSE F P+KDVSIPEI LP GT  GL+GGP PS R +L FFAGGLHGPI
Sbjct  244   KNSIRALCNANTSEKFNPTKDVSIPEIHLPYGTTKGLLGGPPPSERPVLVFFAGGLHGPI  303

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RPILL+HWENKD DVQ+H+YLPKGISYY+M++K+K+CICPSGYEVASPRMVE LY GCVP
Sbjct  304   RPILLQHWENKDEDVQIHKYLPKGISYYDMIKKSKYCICPSGYEVASPRMVEGLYMGCVP  363

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLIKD+YV PFSDVL+W +FSV +PV+DIPNLKKIL  I Q +Y+ +Q+RG+  RRHFEV
Sbjct  364   VLIKDNYVIPFSDVLDWTTFSVLIPVKDIPNLKKILLDIPQEKYLEMQKRGIQMRRHFEV  423

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRLHGIEDT  1851
             N PPK YDV HMILHS WLRRLNVR+  ++++
Sbjct  424   NSPPKIYDVFHMILHSIWLRRLNVRIRHVDES  455



>ref|XP_009774931.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana sylvestris]
Length=454

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/392 (67%), Positives = 313/392 (80%), Gaps = 3/392 (1%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFK  855
             +++  LE+LEA L KARA I    +  N   + +Y+P GP+Y NA  FHRSYLEMEK FK
Sbjct  66    KRYSKLEKLEAGLAKARATILRENNNWNNQTEDEYIPHGPMYLNATAFHRSYLEMEKNFK  125

Query  856   IFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFV  1035
             ++VY+EGEPPVFH GPCK  YA EG FI+ ME S FRT DP KAHV+FLP+S+T +  FV
Sbjct  126   VYVYKEGEPPVFHFGPCKHTYAIEGYFIHAMEISKFRTSDPNKAHVYFLPMSVTMLTQFV  185

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             Y R  H    W  MK    DY+N+++ KY +WNRSLGADHF+LACHDWGPEIS A+P L+
Sbjct  186   YVRDSHE---WGLMKNIALDYVNIISNKYPFWNRSLGADHFILACHDWGPEISFAIPYLY  242

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
             KNSIRALCNANTSE F P+KDVSIPEI LP GT  GL+GGP PS R +L FFAGGLHGPI
Sbjct  243   KNSIRALCNANTSEKFNPTKDVSIPEIHLPYGTTKGLLGGPPPSERPVLVFFAGGLHGPI  302

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RPILL+HWENKD DVQ+H+YLPKGISYY+M++K+K+CICPSGYEVASPRMVE LY GCVP
Sbjct  303   RPILLQHWENKDEDVQIHKYLPKGISYYDMIKKSKYCICPSGYEVASPRMVEGLYMGCVP  362

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLIKD+YV PFSDVL+W +FSV +PV+DIPNLKKIL  I Q +Y+ +Q+RG+  RRHFEV
Sbjct  363   VLIKDNYVIPFSDVLDWTTFSVLIPVKDIPNLKKILLDIPQEKYLEMQKRGIQMRRHFEV  422

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRLHGIEDT  1851
             N PPK YDV HMILHS WLRRLNVR+  ++++
Sbjct  423   NSPPKIYDVFHMILHSIWLRRLNVRIRHVDES  454



>ref|XP_008241335.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=541

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/361 (73%), Positives = 304/361 (84%), Gaps = 4/361 (1%)
 Frame = +1

Query  757   NQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNF  936
             NQT D DY+P GP+YW AN F RSYLEMEK+FK+FVY EGEPP+FHNGPCKSIY+ EGNF
Sbjct  181   NQTQDVDYIPNGPMYWKANAFQRSYLEMEKRFKVFVYGEGEPPLFHNGPCKSIYSMEGNF  240

Query  937   IYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVA  1113
             I+ +E +  FRT DPEKAHV+FLP S+T +V FVY R  H+   + P++QTV DY+N+V+
Sbjct  241   IHEIEVNKQFRTHDPEKAHVYFLPFSVTMLVRFVYVRDSHD---FGPIRQTVRDYVNIVS  297

Query  1114  GKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPE  1293
             GKY YWNRSLGADHFMLACHDWGPE S + P L KNSIR LCNANTSEGF PSKDVS PE
Sbjct  298   GKYPYWNRSLGADHFMLACHDWGPETSNSDPHLRKNSIRVLCNANTSEGFNPSKDVSFPE  357

Query  1294  ILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGIS  1473
             I L  G  HG +GGPSP  RSILAFFAGG+HGPIRP+LLEHWENKD D++VH+YLPKGIS
Sbjct  358   INLQTGDTHGFLGGPSPRLRSILAFFAGGVHGPIRPVLLEHWENKDEDLRVHQYLPKGIS  417

Query  1474  YYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPV  1653
             YY+M+R +KFC+CPSGYEVASPR+VEA+YTGCVPVLI DHYV PFSDVLNWKSFSVEV V
Sbjct  418   YYDMMRHSKFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVKV  477

Query  1654  EDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              +IPNLK IL  IS ++YIR+QRR +  RRHFEVN PPKR+DV HMILHS WLRRLNVR+
Sbjct  478   SEIPNLKNILMSISTKQYIRMQRRVVQVRRHFEVNSPPKRFDVFHMILHSIWLRRLNVRV  537

Query  1834  H  1836
             H
Sbjct  538   H  538



>ref|XP_004156325.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cucumis 
sativus]
Length=516

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/390 (68%), Positives = 320/390 (82%), Gaps = 5/390 (1%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFH  822
             E+   ++   +R++  LER+EA L +ARAA       +NQT D D+VP+GP+YWN+  FH
Sbjct  122   ESAVKVRARRQREYTKLERIEAGLRRARAA-IREAKFLNQTQDPDFVPSGPMYWNSKAFH  180

Query  823   RSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFF  999
             RSYLEMEK+ KIFVYEEGEPP+FHNGPCKSIY++EGNFI+ +E  S FRT+DP KAHVFF
Sbjct  181   RSYLEMEKEMKIFVYEEGEPPLFHNGPCKSIYSTEGNFIHAIEMDSQFRTKDPNKAHVFF  240

Query  1000  LPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDW  1179
             LP+S+  +V FVY   VH+   + P++ TV DYIN++  KY +WNRSLGADHFML+CHDW
Sbjct  241   LPLSVAMLVRFVY---VHDSHDFTPIRHTVVDYINVIGTKYPFWNRSLGADHFMLSCHDW  297

Query  1180  GPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSI  1359
             GPE SK+VP L+KNSIR LCNANTSEGF PSKDVS PEI L  G + G +GGPSPS R I
Sbjct  298   GPEASKSVPNLYKNSIRVLCNANTSEGFNPSKDVSFPEINLQTGHLTGFLGGPSPSHRPI  357

Query  1360  LAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASP  1539
             LAFFAGGLHGPIRPIL++ WEN+D D+QVH+YLPKG+SY +M+RK+KFC+CPSGYEVASP
Sbjct  358   LAFFAGGLHGPIRPILIQQWENQDQDIQVHQYLPKGVSYIDMMRKSKFCLCPSGYEVASP  417

Query  1540  RMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQ  1719
             R+VEA+YTGCVPVLI DHYV PFSDV+NWKSFSVEV V+DIPNLK ILTGIS R+Y+R+ 
Sbjct  418   RIVEAIYTGCVPVLISDHYVPPFSDVINWKSFSVEVSVDDIPNLKTILTGISTRQYLRMY  477

Query  1720  RRGLIARRHFEVNLPPKRYDVTHMILHSAW  1809
             RR +  RRHFEVN PPKRYDV HMILHS W
Sbjct  478   RRVVKVRRHFEVNSPPKRYDVYHMILHSVW  507



>ref|XP_009122667.1| PREDICTED: probable glycosyltransferase At5g03795 [Brassica rapa]
 emb|CDX70282.1| BnaA10g26310D [Brassica napus]
Length=501

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/403 (67%), Positives = 324/403 (80%), Gaps = 6/403 (1%)
 Frame = +1

Query  640   NETGTP-LQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANV  816
             N T T  L++  KR   NLE++E  L KAR AI+AA    +  DD DY P GP+YWNA  
Sbjct  103   NVTSTASLKLMKKRVISNLEKIEFELQKARVAIKAASMN-DPLDDPDYAPLGPMYWNAKA  161

Query  817   FHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHV  993
             FHRSYLEMEKQFKIFVY+EGEPP+FH+GPCKSIY+ EGNFIY MET+  FRT +PEKAH 
Sbjct  162   FHRSYLEMEKQFKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYEMETNTRFRTNNPEKAHA  221

Query  994   FFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACH  1173
             F+LP+S+  +V +VY+R  H+   + P+++TV DYI+LV  KY YWNRS+GADHF+L+CH
Sbjct  222   FYLPLSVVKMVRYVYERDSHD---FSPIRKTVRDYIDLVGDKYPYWNRSIGADHFILSCH  278

Query  1174  DWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRR  1353
             DWGPE S + P L +NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GGPSPS R
Sbjct  279   DWGPEASFSHPHLGQNSIRALCNANTSERFKPRKDVSIPEINLLTGSLKGLVGGPSPSSR  338

Query  1354  SILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVA  1533
              ILAFFAGG+HGP+RP+LL+HWENKD+D++VH+YLPKG SY +M+R +KFCICPSGYEVA
Sbjct  339   PILAFFAGGVHGPVRPVLLQHWENKDSDIRVHKYLPKGTSYSDMMRNSKFCICPSGYEVA  398

Query  1534  SPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             SPR+VEALY+GCVPVLI   YV PFSDVLNW SFSV V VEDIPNLK ILT IS R+Y+R
Sbjct  399   SPRIVEALYSGCVPVLINSGYVPPFSDVLNWASFSVIVSVEDIPNLKTILTSISPRQYLR  458

Query  1714  LQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             + RR L  RRHFEVN P KR+DV HMILHS W+RRLNVR+  +
Sbjct  459   MYRRVLKVRRHFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  501



>ref|XP_004143371.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cucumis 
sativus]
 gb|KGN48221.1| hypothetical protein Csa_6G449280 [Cucumis sativus]
Length=516

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/390 (68%), Positives = 320/390 (82%), Gaps = 5/390 (1%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFH  822
             E+   ++   +R++  LER+EA L +ARAA       +NQT D D+VP+GP+YWN+  FH
Sbjct  122   ESAVKVRARRQREYTKLERIEAGLRRARAA-IREAKFLNQTQDPDFVPSGPMYWNSKAFH  180

Query  823   RSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFF  999
             RSYLEMEK+ KIFVYEEGEPP+FHNGPCKSIY++EGNFI+ +E  S FRT+DP KAHVFF
Sbjct  181   RSYLEMEKEMKIFVYEEGEPPLFHNGPCKSIYSTEGNFIHAIEMDSQFRTKDPNKAHVFF  240

Query  1000  LPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDW  1179
             LP+S+  +V FVY   VH+   + P++ TV DYIN++  KY +WNRSLGADHFML+CHDW
Sbjct  241   LPLSVAMLVRFVY---VHDSHDFTPIRHTVVDYINVIGTKYPFWNRSLGADHFMLSCHDW  297

Query  1180  GPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSI  1359
             GPE SK+VP L+KNSIR LCNANTSEGF PSKDVS PEI L  G + G +GGPSPS R I
Sbjct  298   GPEASKSVPNLYKNSIRVLCNANTSEGFNPSKDVSFPEINLQTGHLTGFLGGPSPSHRPI  357

Query  1360  LAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASP  1539
             +AFFAGGLHGPIRPIL++ WEN+D D+QVH+YLPKG+SY +M+RK+KFC+CPSGYEVASP
Sbjct  358   MAFFAGGLHGPIRPILIQRWENQDQDIQVHQYLPKGVSYIDMMRKSKFCLCPSGYEVASP  417

Query  1540  RMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQ  1719
             R+VEA+YTGCVPVLI DHYV PFSDV+NWKSFSVEV V+DIPNLK ILTGIS R+Y+R+ 
Sbjct  418   RIVEAIYTGCVPVLISDHYVPPFSDVINWKSFSVEVSVDDIPNLKTILTGISTRQYLRMY  477

Query  1720  RRGLIARRHFEVNLPPKRYDVTHMILHSAW  1809
             RR +  RRHFEVN PPKRYDV HMILHS W
Sbjct  478   RRVVKVRRHFEVNSPPKRYDVYHMILHSVW  507



>ref|XP_007027562.1| Exostosin family protein [Theobroma cacao]
 gb|EOY08064.1| Exostosin family protein [Theobroma cacao]
Length=569

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/463 (63%), Positives = 353/463 (76%), Gaps = 21/463 (5%)
 Frame = +1

Query  505   LAYNSSINSSTSP-LHFES-QEIQQPDIQKEENLNiss----sipsiisssNETGTPLQV  666
             L+  +++N   SP L  E+  +IQ+ +  KEE+LNIS      + + ++    T TP   
Sbjct  108   LSDEAALNRPASPPLAVEAVTQIQELNETKEESLNISIPDSDRLNTSMTGIQNTTTPRNE  167

Query  667   TI------KRKFRN-LERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHR  825
             +I       R+ R  L++LEA L +ARAAI+ A +G +   D DYVP GP+YW+A  FHR
Sbjct  168   SIALPLNQSRQVRTKLDKLEAGLQRARAAIKEAKNG-SLLQDPDYVPIGPMYWDAKAFHR  226

Query  826   SYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFL  1002
             SYLEMEKQFKIFVY+EGEPPVFH+GPCKSIY+ EGNFI+ M+  S F+T+DPEKAHVF+L
Sbjct  227   SYLEMEKQFKIFVYKEGEPPVFHDGPCKSIYSMEGNFIHKMDVDSNFQTKDPEKAHVFYL  286

Query  1003  PISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWG  1182
             P S+  +V FVY R   +   + P+++TV DY+NL+A KY YWNRSLGADHFMLACHDWG
Sbjct  287   PFSVAKMVRFVYLR---DSRDFSPIRRTVVDYVNLIAEKYPYWNRSLGADHFMLACHDWG  343

Query  1183  PEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSIL  1362
             PE S ++P L KNSIRALCNANTSE F P KDVSIPEI L  G + GLIGGPS SRR IL
Sbjct  344   PEASFSLPYLQKNSIRALCNANTSEKFNPVKDVSIPEINLLTGKLTGLIGGPSASRRPIL  403

Query  1363  AFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPR  1542
             AFFAGG+HGPIRPILLEHWE KD D++VH+YLPKG++YYEM++ +K+CICPSGYEVASPR
Sbjct  404   AFFAGGVHGPIRPILLEHWEGKDEDIRVHKYLPKGVNYYEMMKNSKYCICPSGYEVASPR  463

Query  1543  MVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQR  1722
             +VEALY GCVPVLI   YV PFSDVL WKSFSV V V+DIP LK+ILT IS R+YIR+QR
Sbjct  464   IVEALYNGCVPVLISKSYVPPFSDVLRWKSFSVVVSVDDIPKLKEILTKISSRQYIRMQR  523

Query  1723  RGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL---HGI  1842
             R L  RRHF  N PPKR+DV HMILHS WLRRLNVR+   HG+
Sbjct  524   RVLQVRRHFAFNSPPKRFDVFHMILHSIWLRRLNVRISDDHGV  566



>emb|CDP15333.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/385 (68%), Positives = 311/385 (81%), Gaps = 4/385 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             K K+ NLE LEA+L +ARAAI+ A  G  +    D+VP GP+Y NA  F RSYLEMEK+F
Sbjct  56    KNKYSNLEILEASLAEARAAIKGARIG-QEAPHEDFVPKGPMYLNATAFRRSYLEMEKRF  114

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHF  1032
             K+F+YEEG PPVFH GPCK  YA EG FI  +E SP RT DP KAH+++LP S+T I  F
Sbjct  115   KVFIYEEGGPPVFHVGPCKHTYAIEGYFIQALEVSPIRTTDPSKAHLYYLPFSVTRITEF  174

Query  1033  VYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPEL  1212
             +Y   V     W  MK  V+DY+N ++ KY YWNRSLGADHFMLACHDWGPE+S AVP L
Sbjct  175   IY---VPESREWGLMKSFVADYVNTISHKYPYWNRSLGADHFMLACHDWGPELSFAVPYL  231

Query  1213  FKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGP  1392
             + NSIRALCNANTSE F PS+DVSIPEI LP GT  G+IGGPSPS+R IL F+AGG+HGP
Sbjct  232   YTNSIRALCNANTSERFAPSRDVSIPEIHLPLGTTKGMIGGPSPSKRPILVFYAGGIHGP  291

Query  1393  IRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCV  1572
             IRPILLE+WE+KD DVQ+H+YLPKG+SYY M+RK+++CICPSGYEVASPRMVEALY GCV
Sbjct  292   IRPILLEYWEDKDADVQIHQYLPKGVSYYGMMRKSRYCICPSGYEVASPRMVEALYMGCV  351

Query  1573  PVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFE  1752
             PVLIK+ YV PFSD+LNWK+F+V +PV+DIPNLK+IL  IS R+YIR+QRRG+  RRHFE
Sbjct  352   PVLIKEGYVIPFSDILNWKAFAVVIPVQDIPNLKRILMAISPRQYIRMQRRGIQVRRHFE  411

Query  1753  VNLPPKRYDVTHMILHSAWLRRLNV  1827
             +N PPKRYDV HMILHS WLRRLN+
Sbjct  412   INTPPKRYDVFHMILHSIWLRRLNI  436



>gb|KCW48746.1| hypothetical protein EUGRSUZ_K02385, partial [Eucalyptus grandis]
Length=352

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/354 (75%), Positives = 300/354 (85%), Gaps = 4/354 (1%)
 Frame = +1

Query  766   DDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYH  945
             +D DYVP GP+Y NAN FHRSYLEMEKQFKIFVY+EG+PPVFHNGPCKSIYA EGNFI+ 
Sbjct  2     EDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPVFHNGPCKSIYAKEGNFIHM  61

Query  946   METSP-FRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKY  1122
             +E +  FRT DP KAHVFFLP S+  +V FVY R  H+   + P+K+TV DYI++VA KY
Sbjct  62    VEINKRFRTGDPRKAHVFFLPFSVAMMVQFVYVRDSHD---FGPIKRTVIDYIDVVASKY  118

Query  1123  AYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILL  1302
              YWNRSLGADHFMLACHDWGPE S AVP L +NSIR LCNANTSEGF PSKDVS PE+ L
Sbjct  119   PYWNRSLGADHFMLACHDWGPEASFAVPHLQRNSIRVLCNANTSEGFDPSKDVSFPEVNL  178

Query  1303  PGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYE  1482
               G + GLIGGPSPS RSILAFFAGGLHGPIRPILL+HWENKD DV+VHRYLP+G+SYY+
Sbjct  179   HTGAISGLIGGPSPSHRSILAFFAGGLHGPIRPILLQHWENKDEDVKVHRYLPRGVSYYD  238

Query  1483  MLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDI  1662
             M+R++KFCICPSGYEVASPR+VEA+YTGCVPVLI DHYV PFSDVLNW+SFSVEV V +I
Sbjct  239   MMRRSKFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWRSFSVEVTVREI  298

Query  1663  PNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLN  1824
             PNLK IL  IS R+YIR+QRR    RRHFEV+ PPKRYDV HMILHS WLRRLN
Sbjct  299   PNLKTILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMILHSVWLRRLN  352



>gb|KHG20191.1| hypothetical protein F383_08256 [Gossypium arboreum]
Length=575

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/412 (66%), Positives = 326/412 (79%), Gaps = 15/412 (4%)
 Frame = +1

Query  640   NETGTPLQVTI------KRKFRN-LERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPV  798
             N   T L  TI       R+ R  L+++EA L +AR+AIR A +G +Q  + DYVP GP+
Sbjct  165   NNATTSLNETIALPLKHSRQVRTKLDKVEAGLQRARSAIREAKNG-SQLQESDYVPIGPM  223

Query  799   YWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRD  975
             YW+A  FHRSYLEMEKQFK+FVY+EGEPPVFH+GPCKSIY+ EGNFIY ++  + F+T+D
Sbjct  224   YWDAKAFHRSYLEMEKQFKVFVYKEGEPPVFHDGPCKSIYSMEGNFIYKLDVDTKFQTKD  283

Query  976   PEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADH  1155
             P+KAHVF+LP S+  +V FVY R   +   + P+++TV DYINLVA KY YWNRS GADH
Sbjct  284   PQKAHVFYLPFSVAKMVRFVYSR---DSRDFSPIRRTVVDYINLVAQKYPYWNRSHGADH  340

Query  1156  FMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGG  1335
             FMLACHDWGPE S ++P L KNSIRALCNANTSE F P KDVSIPEI L    + GL+GG
Sbjct  341   FMLACHDWGPEASFSLPHLEKNSIRALCNANTSERFNPVKDVSIPEINLITDKLTGLMGG  400

Query  1336  PSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICP  1515
             PS S+R ILAFFAGG+HGPIRP+LLEHWE+KD D++VH+YLP+G++YY+M+R +K+CICP
Sbjct  401   PSASQRQILAFFAGGVHGPIRPVLLEHWEDKDEDIKVHKYLPRGVNYYDMMRNSKYCICP  460

Query  1516  SGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGIS  1695
             SGYEVASPR+VEALY GCVPVLI   YVAPFSDVL WKSFSV V V+DIP LK+IL  IS
Sbjct  461   SGYEVASPRIVEALYNGCVPVLISKSYVAPFSDVLRWKSFSVTVSVDDIPKLKEILMNIS  520

Query  1696  QRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL---HGI  1842
              R+YIR+QRR L  RRHFE N PPKRYDV HMILHS WLRRLNVR+   HG+
Sbjct  521   TRQYIRMQRRVLQVRRHFEFNSPPKRYDVFHMILHSVWLRRLNVRITDDHGV  572



>emb|CDY42006.1| BnaC04g00840D [Brassica napus]
Length=506

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/397 (68%), Positives = 322/397 (81%), Gaps = 7/397 (2%)
 Frame = +1

Query  658   LQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQ-TDDHDYVPTGPVYWNANVFHRSYL  834
             L++  KR   NL+++E  L KAR AI+AA   IN   DD DYVP GP+YWNA  FHRSYL
Sbjct  115   LKLMKKRVISNLKKIEFELQKARVAIKAA--SINDPLDDPDYVPLGPMYWNAKAFHRSYL  172

Query  835   EMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPIS  1011
             EMEKQFKIFVY+EGEPP+FH+GPCKSIY+ EGNFIY MET + FRT +PEKAH F+LP+S
Sbjct  173   EMEKQFKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYEMETDTRFRTNNPEKAHAFYLPLS  232

Query  1012  ITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEI  1191
             +  +V +VY+R  H+   + P+++TV DYI+LV  KY YWNRS+GADHF+L+CHDWGPE 
Sbjct  233   VVKMVRYVYERDSHD---FSPIRKTVRDYIDLVGDKYPYWNRSIGADHFILSCHDWGPEA  289

Query  1192  SKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFF  1371
             S + P L +NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GGPSPS R ILAFF
Sbjct  290   SFSHPHLGQNSIRALCNANTSERFKPRKDVSIPEINLLTGSLKGLVGGPSPSSRPILAFF  349

Query  1372  AGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVE  1551
             AGG+HGP+RP+LL+HWENKD+D++VH+YLPKG SY + +R +KFCICPSGYEVASPR+VE
Sbjct  350   AGGVHGPVRPVLLQHWENKDSDIRVHKYLPKGTSYSDTMRNSKFCICPSGYEVASPRIVE  409

Query  1552  ALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGL  1731
             ALY+GCVPVLI   YV PFSDVLNW SFSV V VEDIPNLK ILT IS R+Y+R+ RR L
Sbjct  410   ALYSGCVPVLINSGYVPPFSDVLNWPSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVL  469

Query  1732  IARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
               RRHFEVN P KR+DV HMILHS W+RRLNVR+  +
Sbjct  470   KVRRHFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  506



>gb|KHG04052.1| hypothetical protein F383_28592 [Gossypium arboreum]
Length=541

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/456 (62%), Positives = 347/456 (76%), Gaps = 20/456 (4%)
 Frame = +1

Query  529   SSTSPLHFESQ--EIQQPDIQKEENLNisssipsiisssNETGTP---------LQVTIK  675
             SS   L  E+Q  EI++ D  KE++LNI+++  + ++  + TG P         + + +K
Sbjct  88    SSNKSLDVEAQVMEIREFDETKEDSLNITTNELNNLNI-SVTGVPNATISLNESISLPLK  146

Query  676   RKFR---NLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEK  846
             R  R    L++LEA L +ARAAI+ A +  +Q  D +YVP GP+YW+A  FHRSY+EMEK
Sbjct  147   RNRRVRTKLDKLEARLQRARAAIKDAKNS-SQLLDPEYVPIGPMYWDAKAFHRSYMEMEK  205

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAI  1023
             QFK+FVY+EGEPPVFH+GPCKSIY+ EGNFIY M+  + FRT DPEKAH F+LP S+  +
Sbjct  206   QFKVFVYKEGEPPVFHDGPCKSIYSMEGNFIYQMDVNTKFRTNDPEKAHAFYLPFSVAKM  265

Query  1024  VHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             V FVY R   +   + P+++TV DY+N+V+ KY YWNRSLGADHFMLACHDWGPE S + 
Sbjct  266   VQFVYLR---DSRDFGPIRRTVIDYVNVVSEKYPYWNRSLGADHFMLACHDWGPEASFSN  322

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
             P L KNSIRALCNANTSE F P KDVSIPE+ L  G + GLIGGPS SRR ILAFFAGG+
Sbjct  323   PYLGKNSIRALCNANTSEKFNPVKDVSIPEMNLRTGKLTGLIGGPSASRRPILAFFAGGV  382

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HGPIRPILLEHWE KD++++VH+YLPKGI+YYEM+R +K+C+CPSGYEVASPR+VEALY 
Sbjct  383   HGPIRPILLEHWEGKDDEIKVHKYLPKGINYYEMMRSSKYCLCPSGYEVASPRIVEALYN  442

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
             GCVPVLI   YV PFSDVL WKSFSV V VEDIP LK+IL  IS R+YIR+QRR L  RR
Sbjct  443   GCVPVLISKSYVPPFSDVLRWKSFSVVVSVEDIPRLKEILMKISSRQYIRMQRRVLQVRR  502

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIEDT  1851
             HFE + PPKR+DV HMILHS WLRRLNVR+    D 
Sbjct  503   HFEFHSPPKRFDVFHMILHSIWLRRLNVRVSDGNDV  538



>ref|XP_004249828.2| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=431

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/405 (66%), Positives = 314/405 (78%), Gaps = 5/405 (1%)
 Frame = +1

Query  640   NETGTPLQVTIKRKF-RNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANV  816
             +E   P  V +++KF  NLE++EA L + R AI+ A       DD +YVPTGP+YWN   
Sbjct  29    HENINPPIVQLEKKFISNLEKVEAGLVRVRVAIKEAQSKNQTLDDPEYVPTGPIYWNPTA  88

Query  817   FHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVF  996
             FHRSY+EMEK FKIFVYEEGEPPVFH    + I   EG  I+ +E S FRT DPEKAHV+
Sbjct  89    FHRSYMEMEKHFKIFVYEEGEPPVFHYSASEGILGIEGILIHQIEISKFRTNDPEKAHVY  148

Query  997   FLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHD  1176
             FLP S+ +IV +VY   V +   W PM+ T +DYI+ ++ KY YWNRSLG+DHFMLACHD
Sbjct  149   FLPFSVLSIVSYVY---VVDSRSWGPMQNTAADYIDSISRKYPYWNRSLGSDHFMLACHD  205

Query  1177  WGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRS  1356
             W P IS AVP L+KNSIR LCNANTSE F P+KDVS+PEI LP G M GLIGGPSPS RS
Sbjct  206   WAPTISFAVPYLYKNSIRVLCNANTSERFDPTKDVSLPEIYLPQGKMDGLIGGPSPSHRS  265

Query  1357  ILAFFAGGLHGPIRPILLEHW-ENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVA  1533
             +L F+AGG+HG IR +L+EHW +N D DVQ+H YLPK +SYY M+RK+KFCICPSGYEVA
Sbjct  266   VLVFYAGGIHGYIRQVLMEHWGKNDDLDVQIHEYLPKNMSYYGMIRKSKFCICPSGYEVA  325

Query  1534  SPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             SPRMVEALY GCVPVL+KDHYVAPFSDVLNWKSFSV++   DIPNLKKIL  ISQ +YIR
Sbjct  326   SPRMVEALYMGCVPVLLKDHYVAPFSDVLNWKSFSVQMNSRDIPNLKKILMSISQTQYIR  385

Query  1714  LQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIED  1848
             +Q+RGL  RRHFEVN PPKRYDV HMILHS W RRLN+++H  +D
Sbjct  386   MQKRGLQVRRHFEVNFPPKRYDVFHMILHSIWFRRLNIQVHDTKD  430



>ref|XP_009787886.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=460

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/397 (66%), Positives = 316/397 (80%), Gaps = 6/397 (2%)
 Frame = +1

Query  664   VTIKRKFRNLERLEANLGKARAAIRAAVHGINQT-DDHDYVPTGPVYWNANVFHRSYLEM  840
             V +++K  +LERLEA L +ARAAI+ A    NQT DD +YVPTGP+YWN   FHRSYLEM
Sbjct  68    VKLQKKLSSLERLEAGLVRARAAIKQA-QSKNQTFDDPEYVPTGPIYWNPIAFHRSYLEM  126

Query  841   EKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITA  1020
             EK FKI+VYEEGEPPVFH    + I   EG  I+ +E S FRT DPEKAHV+FLP S+ +
Sbjct  127   EKHFKIYVYEEGEPPVFHYSASQGILGIEGILIHQLEISKFRTNDPEKAHVYFLPFSVLS  186

Query  1021  IVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKA  1200
             IV +VY   V +   W PM+ T +DYI+ ++ KY YWNRSLG+DHFMLACHDWGP IS A
Sbjct  187   IVSYVY---VVDSREWGPMRNTAADYIDNISRKYPYWNRSLGSDHFMLACHDWGPRISLA  243

Query  1201  VPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGG  1380
             +P L+KNSIR LCNANTSE F PSKDVS+PEI LP GT  GLIGGPSPS RS+L F+AGG
Sbjct  244   IPYLYKNSIRVLCNANTSERFNPSKDVSLPEIYLPQGTTDGLIGGPSPSHRSVLVFYAGG  303

Query  1381  LHGPIRPILLEHW-ENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEAL  1557
             +HG IR +L+E+W +N D DVQ+H YLPK +SYY M+RK+K+CICPSG+EVASPRMVEAL
Sbjct  304   IHGYIRQVLMEYWGKNDDPDVQIHEYLPKNVSYYGMIRKSKYCICPSGWEVASPRMVEAL  363

Query  1558  YTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIA  1737
             Y GCVP+L+KDHYVAPFSDVLNWKSF+VE+   DIPNLKKIL  I QR+YI++Q+RGL  
Sbjct  364   YMGCVPILLKDHYVAPFSDVLNWKSFAVEMTSNDIPNLKKILNAIPQRQYIKMQKRGLQV  423

Query  1738  RRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIED  1848
             RRHFEVN PP+RYDV HMILHS WLRRLN+ +H  ++
Sbjct  424   RRHFEVNFPPRRYDVFHMILHSIWLRRLNIHVHDTKE  460



>ref|XP_008462519.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
Length=518

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/391 (68%), Positives = 320/391 (82%), Gaps = 6/391 (2%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFH  822
             E+   ++   +R++  LER+EA L +ARAA       +NQT D D+VP+GP+YWN+  FH
Sbjct  123   ESAVKVRARRQREYTKLERIEAGLRRARAA-IREAKFLNQTQDPDFVPSGPMYWNSKAFH  181

Query  823   RSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFF  999
             RSYLEMEK+ KIFVYEEGEPP+FHNGPCKSIY++EGNFI+ +E  S FRT+DP KAHVFF
Sbjct  182   RSYLEMEKEMKIFVYEEGEPPLFHNGPCKSIYSTEGNFIHAIEMDSQFRTKDPNKAHVFF  241

Query  1000  LPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDW  1179
             LP+S+  +V FVY   VH+   + P++ TV DYIN++  KY +WNRSLGADHFML+CHDW
Sbjct  242   LPLSVAMLVRFVY---VHDSHDFTPIRHTVIDYINVIGTKYPFWNRSLGADHFMLSCHDW  298

Query  1180  GPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSI  1359
             GPE SK+VP L+KNSIR LCNANTSEGF PSKDVS PEI L  G + G +GGPSPS R I
Sbjct  299   GPEASKSVPNLYKNSIRVLCNANTSEGFNPSKDVSFPEINLQTGYLTGFLGGPSPSHRPI  358

Query  1360  LAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKG-ISYYEMLRKTKFCICPSGYEVAS  1536
             LAFFAGGLHGPIRPIL++ WEN+D D+QVH+YLPKG +SY +M+RK+KFC+CPSGYEVAS
Sbjct  359   LAFFAGGLHGPIRPILIQQWENQDQDIQVHQYLPKGVVSYIDMMRKSKFCLCPSGYEVAS  418

Query  1537  PRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRL  1716
             PR+VEA+YTGCVPVLI DHYV PFSDV+NWKSFSVEV V++IPNLK ILTGIS R+Y+R+
Sbjct  419   PRIVEAIYTGCVPVLISDHYVPPFSDVINWKSFSVEVSVDEIPNLKTILTGISTRQYLRM  478

Query  1717  QRRGLIARRHFEVNLPPKRYDVTHMILHSAW  1809
              RR +  RRHFEVN PPKRYDV HMILHS W
Sbjct  479   YRRVVKVRRHFEVNSPPKRYDVYHMILHSVW  509



>ref|XP_009776098.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=484

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/396 (67%), Positives = 314/396 (79%), Gaps = 6/396 (2%)
 Frame = +1

Query  655   PLQVTIKRKFRNLERLEANLGKARAAIR-AAVHGINQT-DDHDYVPTGPVYWNANVFHRS  828
             P  +  K+K  NL R+EA LGK R AIR A  +  NQT DD +YVP GP YWN + FHRS
Sbjct  89    PQMIFSKKKLSNLGRVEAGLGKVRGAIREAQSNSNNQTFDDSEYVPRGPCYWNPSAFHRS  148

Query  829   YLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPI  1008
             Y+EMEK FKI+VYE+GEPPVFH    + I   EG  I+ +E S FRT DPEKAHV+FLP 
Sbjct  149   YIEMEKHFKIYVYEKGEPPVFHYSSSEGILGIEGIMIHQIEISKFRTNDPEKAHVYFLPF  208

Query  1009  SITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPE  1188
             S+ +IV +VY   V +   W PMK TV+DYI+ ++ KY YWNRSLG+DHFMLACHDW PE
Sbjct  209   SVFSIVSYVY---VVDSHQWGPMKNTVADYIDGISTKYPYWNRSLGSDHFMLACHDWAPE  265

Query  1189  ISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAF  1368
             IS AVP L+KNSIR LCNANTSE F PSKDV++PEI LP GTM GLIGGPSPS+RS+L F
Sbjct  266   ISTAVPYLYKNSIRVLCNANTSERFNPSKDVTLPEIYLPQGTMKGLIGGPSPSQRSVLVF  325

Query  1369  FAGGLHGPIRPILLEHW-ENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
              AGG+HG IR +L+E W +N D +VQ+H YLPK +SYY M+RK+KFCICPSG+EVASPRM
Sbjct  326   HAGGIHGYIRQVLMEKWGKNDDQEVQIHEYLPKNVSYYGMIRKSKFCICPSGWEVASPRM  385

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             VEALY GCVPVL+KDHYVAPFSDVLNWKSF+VE+   DIPNLKKIL  ISQ++YI++Q+R
Sbjct  386   VEALYMGCVPVLLKDHYVAPFSDVLNWKSFAVEMTSNDIPNLKKILMAISQKQYIKMQKR  445

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             GL  RRHFEVN PPKRYDV HMILHS WLRRLN+++
Sbjct  446   GLQVRRHFEVNFPPKRYDVFHMILHSIWLRRLNIQV  481



>ref|XP_010039048.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At5g03795 [Eucalyptus grandis]
Length=382

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/382 (71%), Positives = 308/382 (81%), Gaps = 10/382 (3%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYE  870
              +     L  AR+ IR A  G N  +D DYVP GP+Y NAN FHRSYLEMEKQFKIFVY+
Sbjct  6     FKEFSDELVPARSGIREAKTG-NPMEDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYK  64

Query  871   EGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
             EG+PPVFHNGPCKSIYA+E NFI+ +E +  FRT DP KAHVFFLP S+  +V FVY R 
Sbjct  65    EGDPPVFHNGPCKSIYATERNFIHMVEINKRFRTGDPRKAHVFFLPFSVAMMVQFVYVRD  124

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
              H+   + P+K+TV DYI++VAGKY YWNRSLGADHFMLACHDWGP     VP L +NSI
Sbjct  125   SHD---FGPIKRTVIDYIDVVAGKYPYWNRSLGADHFMLACHDWGP-----VPRLHRNSI  176

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPIL  1407
             R LCNANTSEGF PSKDVS PE+ L  G + GLIG  SPS RSILAFFAGGLHGPIRPIL
Sbjct  177   RVLCNANTSEGFDPSKDVSFPEVNLHTGAISGLIGEASPSHRSILAFFAGGLHGPIRPIL  236

Query  1408  LEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIK  1587
             L+HWENKD DV+VHRYLP+G+SYY+M++++KFCICPSGYEVASPR+VEA+YTGCVPVLI 
Sbjct  237   LQHWENKDEDVKVHRYLPRGVSYYDMMKRSKFCICPSGYEVASPRVVEAIYTGCVPVLIS  296

Query  1588  DHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPP  1767
             DHYV PFSDVLNW+SFSVEV V +IPNLK IL  IS R+YIR+QRR    RRHFEV+ PP
Sbjct  297   DHYVPPFSDVLNWRSFSVEVTVREIPNLKTILASISSRQYIRMQRRVAQVRRHFEVHSPP  356

Query  1768  KRYDVTHMILHSAWLRRLNVRL  1833
             KRYDV HMILHS WLRRLNV L
Sbjct  357   KRYDVFHMILHSVWLRRLNVGL  378



>gb|KHN24379.1| Putative glycosyltransferase [Glycine soja]
Length=502

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/389 (69%), Positives = 311/389 (80%), Gaps = 5/389 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             KRK   L+R E  L +ARA IR A    N T D DYVP GP+YWNA  FHRSYLEMEKQF
Sbjct  107   KRKPSFLDRTEVVLAQARATIREA-KNWNLTQDSDYVPIGPMYWNAKEFHRSYLEMEKQF  165

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVH  1029
             K+FVYEEGE PVFH+GPC SIY++EG+FI+ +E +  FRTRDP+KA+VFFLP SI  +V 
Sbjct  166   KVFVYEEGELPVFHDGPCSSIYSTEGSFIHAIEMNEHFRTRDPKKANVFFLPFSIAWMVR  225

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             +VY R   N   + P+K+TV DY+N++A +Y YWNRSLGADHFML+CHDWGPE SK++P 
Sbjct  226   YVYIR---NSYDFGPIKRTVRDYVNVIATRYPYWNRSLGADHFMLSCHDWGPETSKSIPY  282

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L KNSIR LCNANTSEGF P KD S PEI L  G     IGGP  S+RSILAFFAGG HG
Sbjct  283   LRKNSIRVLCNANTSEGFDPIKDASFPEINLQPGLKDSFIGGPPASKRSILAFFAGGNHG  342

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             PIRPILLEHWENKD D+QVH+YLPKG+SYY MLR +KFC+CPSGYEVASPR+VEA+YTGC
Sbjct  343   PIRPILLEHWENKDEDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRVVEAIYTGC  402

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI +HYV PFSDVLNWK FSV V V++IPNLK ILT IS R+YIR+Q+R    RRHF
Sbjct  403   VPVLISEHYVPPFSDVLNWKMFSVNVSVKEIPNLKDILTSISPRQYIRMQKRVGQIRRHF  462

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             EV+ PPKRYDV HMILHS WLRRLN R+H
Sbjct  463   EVHSPPKRYDVFHMILHSVWLRRLNFRVH  491



>ref|XP_006339262.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=456

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/406 (66%), Positives = 319/406 (79%), Gaps = 7/406 (2%)
 Frame = +1

Query  640   NETGTPLQVTIKRKF-RNLERLEANLGKARAAIRAAVHGINQT-DDHDYVPTGPVYWNAN  813
             +E  +P  V +++K   NLE++EA L + R AI+ A    NQT DD +YVPTGP+YWN  
Sbjct  54    HENISPPIVQLEKKLISNLEKVEAGLVRVRVAIKEA-QSKNQTFDDPEYVPTGPIYWNPT  112

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHV  993
              FHRSY+EMEK FKI+VYEEGEPPVFH    + I   EG  I+H+E S FRT DPEKAHV
Sbjct  113   AFHRSYMEMEKHFKIYVYEEGEPPVFHYSASEGILGIEGILIHHIEISKFRTNDPEKAHV  172

Query  994   FFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACH  1173
             +FLP S+ +IV +VY   V N   W PM+ T +DYI+ ++ KY YWNRSLGADHFMLACH
Sbjct  173   YFLPFSVLSIVSYVY---VVNSRSWGPMQNTAADYIDGISRKYPYWNRSLGADHFMLACH  229

Query  1174  DWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRR  1353
             DW P IS AVP L+KNSIR LCNANTSE F P+KDVS+PEI LP G M GLIGGPSPS R
Sbjct  230   DWAPTISFAVPYLYKNSIRVLCNANTSERFDPTKDVSLPEIYLPQGKMDGLIGGPSPSHR  289

Query  1354  SILAFFAGGLHGPIRPILLEHW-ENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             S+L F+AGG+HG IR +L+E W +N D+DVQ+H YLPK +SYY M+RK+KFCICPSGYEV
Sbjct  290   SVLVFYAGGIHGYIRQVLMELWGKNDDSDVQIHEYLPKNMSYYGMIRKSKFCICPSGYEV  349

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPRMVEALY GCVPVL+KDHYVAPF+DVLNWKSF+V++   DIPNLKKIL  ISQ +YI
Sbjct  350   ASPRMVEALYMGCVPVLLKDHYVAPFNDVLNWKSFAVQMNSTDIPNLKKILMSISQTQYI  409

Query  1711  RLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIED  1848
             R+Q+RGL  RRHFEVN PP+RYDV HMILHS WLRRLN+++H  +D
Sbjct  410   RMQKRGLQVRRHFEVNFPPRRYDVFHMILHSIWLRRLNIQVHDTKD  455



>ref|XP_003535253.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=523

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/389 (69%), Positives = 311/389 (80%), Gaps = 5/389 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             KRK   L+R E  L +ARA IR A    N T D DYVP GP+YWNA  FHRSYLEMEKQF
Sbjct  128   KRKPSFLDRTEVVLAQARATIREA-KNWNLTQDSDYVPIGPMYWNAKEFHRSYLEMEKQF  186

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVH  1029
             K+FVYEEGE PVFH+GPC SIY++EG+FI+ +E +  FRTRDP+KA+VFFLP SI  +V 
Sbjct  187   KVFVYEEGELPVFHDGPCSSIYSTEGSFIHAIEMNEHFRTRDPKKANVFFLPFSIAWMVR  246

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             +VY R   N   + P+K+TV DY+N++A +Y YWNRSLGADHFML+CHDWGPE SK++P 
Sbjct  247   YVYIR---NSYDFGPIKRTVRDYVNVIATRYPYWNRSLGADHFMLSCHDWGPETSKSIPY  303

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L KNSIR LCNANTSEGF P KD S PEI L  G     +GGP  S+RSILAFFAGG HG
Sbjct  304   LRKNSIRVLCNANTSEGFDPIKDASFPEINLQPGLKDSFVGGPPASKRSILAFFAGGNHG  363

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             PIRPILLEHWENKD D+QVH+YLPKG+SYY MLR +KFC+CPSGYEVASPR+VEA+YTGC
Sbjct  364   PIRPILLEHWENKDEDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRVVEAIYTGC  423

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI +HYV PFSDVLNWK FSV V V++IPNLK ILT IS R+YIR+Q+R    RRHF
Sbjct  424   VPVLISEHYVPPFSDVLNWKMFSVNVSVKEIPNLKDILTSISPRQYIRMQKRVGQIRRHF  483

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             EV+ PPKRYDV HMILHS WLRRLN R+H
Sbjct  484   EVHSPPKRYDVFHMILHSVWLRRLNFRVH  512



>ref|XP_004249790.2| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=472

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/402 (64%), Positives = 317/402 (79%), Gaps = 10/402 (2%)
 Frame = +1

Query  661   QVTIKRKFRNLERLEANLGKARAAIRAAVHGINQT----DDHDYVPTGPVYWNANVFHRS  828
               T  ++F  +++LEA L ++RAAI  +    N+T    ++ +Y+P GP+Y NA  FHRS
Sbjct  76    NTTTPKRFSKIDKLEAGLARSRAAILLSRQ--NKTNHIEEEEEYIPHGPMYLNATSFHRS  133

Query  829   YLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPI  1008
             YLEMEK+FK++VY+EG+PP++H GPCK  YA EG FI  ME S FRT +P KAHV+FLP+
Sbjct  134   YLEMEKKFKVYVYKEGDPPLYHFGPCKHTYAIEGYFIQAMEVSKFRTENPNKAHVYFLPL  193

Query  1009  SITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPE  1188
             SIT ++ F+Y    H    W  MK T  DYIN+++ KY YWN SLGADHFMLACHDWGPE
Sbjct  194   SITMLIEFIYVAESHE---WGLMKNTTMDYINVISQKYPYWNTSLGADHFMLACHDWGPE  250

Query  1189  ISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAF  1368
             IS A+P L+KNSIRALCNANTSE F P+KDVSIPEI LP GT  GL+GGP PS R +L F
Sbjct  251   ISFAIPHLYKNSIRALCNANTSEKFNPTKDVSIPEIHLPLGTTKGLLGGPPPSDRRVLVF  310

Query  1369  FAGGLHGPIRPILLEHWEN-KDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FAGG+HGPIRPILL+HWEN KD DVQ+H+YLPKG+SYY+M+RK+K+CICPSGYEVASPRM
Sbjct  311   FAGGVHGPIRPILLQHWENSKDEDVQIHKYLPKGVSYYDMIRKSKYCICPSGYEVASPRM  370

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             VE LY GCVPVLIKD+YV PFSDVL+W +F V + V+DIPNLKKIL  I Q +Y+ +Q+R
Sbjct  371   VEGLYMGCVPVLIKDNYVTPFSDVLDWDTFVVTIHVKDIPNLKKILMDIPQHKYLEMQKR  430

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIEDT  1851
             G+  RRHFEVN PPKRYDV HMILHS WLRRLN R+H +E++
Sbjct  431   GIQMRRHFEVNSPPKRYDVFHMILHSIWLRRLNFRVHDVEES  472



>ref|XP_011101498.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=486

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/395 (68%), Positives = 322/395 (82%), Gaps = 5/395 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAA-VHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             ++++ +LE +EA+L +A AAIR A V G NQT+D DY+P GP+YWN+ VFHRSYLEMEK+
Sbjct  95    EKRYSDLEMVEADLVQAPAAIREAIVTGGNQTEDPDYIPNGPMYWNSKVFHRSYLEMEKR  154

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVH  1029
              KIF+YEEG+PPVFH GPCK  YA EG F+ +ME S FRT D  KAH+FFLP S+T I  
Sbjct  155   LKIFIYEEGDPPVFHFGPCKHTYAIEGIFMANMEVSRFRTFDHNKAHLFFLPFSVTMITQ  214

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
              +Y   V     W  MK T SDYIN++A K+ YWNR+LGADHFMLACHDWGPEIS A+P 
Sbjct  215   VIY---VPESHEWSQMKNTASDYINVIAQKHPYWNRTLGADHFMLACHDWGPEISFAIPN  271

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L+KNSIRALCNANTSE F PS+DVSIPEI LPGG   G+IGGP PS+R IL F+AGG+HG
Sbjct  272   LYKNSIRALCNANTSEQFNPSRDVSIPEIHLPGGGTRGMIGGPPPSKRPILVFYAGGVHG  331

Query  1390  PIRPILLEHWENK-DNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
             PIRPILLEHWENK D DVQ+++YLP+ +SYY M+RK+++CICPSGYEVASPRMVE LY G
Sbjct  332   PIRPILLEHWENKSDPDVQIYKYLPQNVSYYGMMRKSRYCICPSGYEVASPRMVEGLYMG  391

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             CVPVLIKD YV PFSDVLNW++F+V VPV+DIPNLK ILT I  ++Y+++Q+RG+  RRH
Sbjct  392   CVPVLIKDGYVIPFSDVLNWETFAVIVPVKDIPNLKTILTAIPMKKYVQMQQRGIQMRRH  451

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIEDT  1851
             FEVN PPKRYDV HMILHS WLRRLNVRLH  ED+
Sbjct  452   FEVNSPPKRYDVFHMILHSIWLRRLNVRLHEHEDS  486



>ref|XP_006339310.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=427

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/401 (64%), Positives = 315/401 (79%), Gaps = 9/401 (2%)
 Frame = +1

Query  667   TIKRKFRNLERLEANLGKARAAI-----RAAVHGINQTDDHDYVPTGPVYWNANVFHRSY  831
             T  ++F  +E+LEA L +ARAAI       + H   + +D +Y+P GP+Y NA  FHRSY
Sbjct  30    TTPKRFSKIEKLEAGLARARAAILLLRQNKSNHIEEEEEDDEYIPHGPMYLNATSFHRSY  89

Query  832   LEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPIS  1011
             LEMEK+FK++VY+EGEPP++H GPCK  YA EG FI  +E S FRT +P KAHV+FLP+S
Sbjct  90    LEMEKKFKVYVYKEGEPPLYHFGPCKQTYAIEGYFIQAIEVSKFRTENPNKAHVYFLPLS  149

Query  1012  ITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEI  1191
             +T ++ F+Y    H    W  MK T  DY+N+++ KY YWNRSLGADHFMLACHDW PEI
Sbjct  150   VTMLIEFIYVAESHE---WGLMKNTTMDYVNVISQKYPYWNRSLGADHFMLACHDWAPEI  206

Query  1192  SKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFF  1371
             S A+P L+KNSIRALCNANTSE F P+KDVSIPEI LP GT  GL+GGP PS R +L FF
Sbjct  207   SFAIPHLYKNSIRALCNANTSEKFNPTKDVSIPEIHLPLGTTKGLLGGPPPSDRPVLVFF  266

Query  1372  AGGLHGPIRPILLEHWEN-KDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMV  1548
             AGG+HGPIRPILL+HWEN KD DVQ+H+YLPKG+SYY+M+RK+K+CICPSGYEVASPRMV
Sbjct  267   AGGVHGPIRPILLQHWENSKDEDVQIHKYLPKGVSYYDMIRKSKYCICPSGYEVASPRMV  326

Query  1549  EALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRG  1728
             E LY GCVPVLIKD+YV PFSDVL+W +F V + V+DIP LKKIL  I Q +Y+ +Q+RG
Sbjct  327   EGLYMGCVPVLIKDNYVTPFSDVLDWDTFVVTIHVKDIPKLKKILMDIPQDKYLEMQKRG  386

Query  1729  LIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIEDT  1851
             +  RRHFEVN PPKRYDV HMILHS WLRRLN R+H ++++
Sbjct  387   IQMRRHFEVNSPPKRYDVFHMILHSIWLRRLNFRVHDVDES  427



>gb|EYU38594.1| hypothetical protein MIMGU_mgv1a021350mg [Erythranthe guttata]
Length=485

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/393 (69%), Positives = 316/393 (80%), Gaps = 6/393 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTDDHD--YVPTGPVYWNANVFHRSYLEMEKQ  849
             R + +LE +EA+L + R AI  A  G N+T D D  YVP GP+YWN  VFHRSYLEMEK+
Sbjct  93    RTYSSLEMVEADLAQTRDAISQAKKGGNETRDPDPDYVPDGPMYWNPKVFHRSYLEMEKK  152

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVH  1029
              K+FVYEEG+PPVFH GPCK  YA EG FI +ME S FRT D +KAH+FFLP S+T I  
Sbjct  153   MKVFVYEEGDPPVFHFGPCKHTYAIEGIFISNMEVSRFRTMDQDKAHLFFLPFSVTMITQ  212

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
              +Y +  H    W  MK   SDY+N++A K+ YWNRSLGADHFMLACHDWGPEIS AVP 
Sbjct  213   VIYVKDSHE---WGLMKNAASDYVNVIAQKHPYWNRSLGADHFMLACHDWGPEISFAVPN  269

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L+KN+IRALCNANTSE F PS+DVSIPEI LPGGT  G+IGGP PS+R IL F+AGG+HG
Sbjct  270   LYKNAIRALCNANTSERFDPSRDVSIPEIHLPGGTTQGIIGGPPPSKRPILVFYAGGVHG  329

Query  1390  PIRPILLEHWENK-DNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
             PIRPILLEHWENK D DVQ++RYLPK +SYY M+RK+++CICPSGYEVASPRMVE LY G
Sbjct  330   PIRPILLEHWENKTDPDVQIYRYLPKNMSYYGMMRKSRYCICPSGYEVASPRMVEGLYLG  389

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             CVPVLIKD YV PFSDVLNW++F+V VPV DIPNLKKILTGIS + Y+++QRRG+  RRH
Sbjct  390   CVPVLIKDSYVIPFSDVLNWETFAVIVPVRDIPNLKKILTGISSKEYMKMQRRGVQMRRH  449

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIE  1845
             FE+N PPKRYDV HMILHS WLRRLN+RLH  E
Sbjct  450   FEINSPPKRYDVFHMILHSIWLRRLNIRLHENE  482



>ref|XP_006398838.1| hypothetical protein EUTSA_v10016080mg [Eutrema salsugineum]
 gb|ESQ40291.1| hypothetical protein EUTSA_v10016080mg [Eutrema salsugineum]
Length=517

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/403 (66%), Positives = 320/403 (79%), Gaps = 6/403 (1%)
 Frame = +1

Query  640   NETGTPLQVTIKRK-FRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANV  816
             N T T     IK++   NLE++E  L KAR AI+AA       D       GP+YWNA V
Sbjct  119   NVTSTASSEQIKKRVMSNLEKIEFELQKARVAIKAASMDDPVDDPDYVP-LGPMYWNAKV  177

Query  817   FHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHV  993
             FHRSYLEMEKQFKIFVY+EGEPP+FH+GPCKSIY+ EGNFIY MET + FRT +P+KAH 
Sbjct  178   FHRSYLEMEKQFKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYEMETDTRFRTNNPDKAHA  237

Query  994   FFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACH  1173
             F+LP+S+  +V +VY   V N   + P+++TV DYI+LV+ KY+YWNRS+GADHF+L+CH
Sbjct  238   FYLPLSVVKMVRYVY---VSNSHDFSPIRKTVRDYIDLVSDKYSYWNRSIGADHFILSCH  294

Query  1174  DWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRR  1353
             DWGPE S + P L +NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GGPSPS R
Sbjct  295   DWGPEASFSHPHLGQNSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSSR  354

Query  1354  SILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVA  1533
              ILAFFAGG+HGP+RP+LL+HWENKDND++VH+YLP+G SY +M+R +KFCICPSGYEVA
Sbjct  355   PILAFFAGGVHGPVRPVLLQHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVA  414

Query  1534  SPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             SPR+VEALY+GCVPVLI   YV PFSDVLNW+SFSV V VEDIPNLK ILT IS R+Y+R
Sbjct  415   SPRIVEALYSGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYLR  474

Query  1714  LQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             + RR L  RRHFEVN P KR+DV HMILHS W+RRLNVR+  +
Sbjct  475   MYRRVLKVRRHFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  517



>gb|KFK24839.1| hypothetical protein AALP_AA8G031400 [Arabis alpina]
Length=498

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/395 (69%), Positives = 322/395 (82%), Gaps = 5/395 (1%)
 Frame = +1

Query  661   QVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEM  840
             +V  KR   NLE++E  L KARAAI+A+    +  DD DYVP GP+YWNA VFHRSYLEM
Sbjct  108   EVIQKRILSNLEKVEFELQKARAAIKAS-SIDDPVDDPDYVPLGPMYWNAKVFHRSYLEM  166

Query  841   EKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISIT  1017
             EKQFKIFVY+EGEPP+FH+GPCKSIY+ EG+FIY MET+  FRT +P+KAH F+LP+S+ 
Sbjct  167   EKQFKIFVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETNTHFRTNNPDKAHAFYLPLSVV  226

Query  1018  AIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
              +V FVYDR   N   + P++ TV DYI LV+ +Y YWNRS+GADHF+L+CHDWGPE S 
Sbjct  227   KMVRFVYDR---NSRDFGPIRNTVRDYIELVSDRYPYWNRSIGADHFILSCHDWGPEASF  283

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAG  1377
             + P L +NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GGPSPS R ILAFFAG
Sbjct  284   SHPHLGQNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAG  343

Query  1378  GLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEAL  1557
             G+HGP+RPILLEHWENKDND++VH+YLPKG SY +M+R +KFCICPSGYEVASPR+VEAL
Sbjct  344   GVHGPVRPILLEHWENKDNDIRVHKYLPKGTSYSDMMRNSKFCICPSGYEVASPRIVEAL  403

Query  1558  YTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIA  1737
             Y+GCVPVLI   YV PFSDVLNWKSFSV V VE+IPNLK ILT IS R+Y+R+ RR L  
Sbjct  404   YSGCVPVLINSGYVPPFSDVLNWKSFSVIVSVEEIPNLKTILTSISPRQYLRMYRRVLKV  463

Query  1738  RRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             RRHFEVN P KR+DV HMILHS W+RRLNVR+  +
Sbjct  464   RRHFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  498



>gb|KCW48767.1| hypothetical protein EUGRSUZ_K02411, partial [Eucalyptus grandis]
Length=345

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/347 (75%), Positives = 294/347 (85%), Gaps = 4/347 (1%)
 Frame = +1

Query  766   DDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYH  945
             +D DYVP GP+Y NAN FHRSYLEMEKQFKIFVY+EG+PPVFHNGPCKSIYA EGNFI+ 
Sbjct  2     EDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPVFHNGPCKSIYAMEGNFIHM  61

Query  946   METSP-FRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKY  1122
             +E +  FRT DP +AHVFFLP S+  +V FVY R  H+   + P+K+TV DYI++VA KY
Sbjct  62    VEINKRFRTEDPREAHVFFLPFSVAMMVQFVYVRDSHD---FGPIKRTVIDYIDVVASKY  118

Query  1123  AYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILL  1302
              YWNRSLGADHFMLACHDWGPE S AVP L +NSIR LCNANTSEGF PSKDVS PE+ L
Sbjct  119   PYWNRSLGADHFMLACHDWGPEASFAVPHLHRNSIRVLCNANTSEGFDPSKDVSFPEVNL  178

Query  1303  PGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYE  1482
               G + GLIGGPSPS RSILAFFAGGLHGPIRPILL+HWENKD DV+VHRYLP+G+SYY+
Sbjct  179   HTGAIGGLIGGPSPSHRSILAFFAGGLHGPIRPILLQHWENKDEDVKVHRYLPRGVSYYD  238

Query  1483  MLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDI  1662
             M++++KFCICPSGYEVASPR+VEA+YTGCVPVLI DHYV PFSDVLNW+SFSVEV V +I
Sbjct  239   MMKRSKFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWRSFSVEVTVREI  298

Query  1663  PNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHS  1803
             PNLK IL  IS R+YIR+QRR    RRHFEV+ PPKRYDV HMILHS
Sbjct  299   PNLKTILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMILHS  345



>gb|KHN45704.1| Putative glycosyltransferase [Glycine soja]
Length=348

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/347 (73%), Positives = 297/347 (86%), Gaps = 4/347 (1%)
 Frame = +1

Query  796   VYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTR  972
             +YWNA  FHRSYLEMEKQFK+FVYEEGE PVFHNGPCKSIY+ EGNFI+ +E +  FRT+
Sbjct  1     MYWNAKTFHRSYLEMEKQFKVFVYEEGETPVFHNGPCKSIYSMEGNFIHAIEMNDHFRTK  60

Query  973   DPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGAD  1152
             DP+KAHVFFLP S+  +V FVY R   +   + P+++TV DYINL+A +Y+YWNRSLGAD
Sbjct  61    DPKKAHVFFLPFSVVMMVRFVYQR---DSRDFGPIRKTVIDYINLIAARYSYWNRSLGAD  117

Query  1153  HFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIG  1332
             HFMLACHDWGPE S ++P L KNSIR LCNANTSEGFKP+KDVS PEI L  G+++G IG
Sbjct  118   HFMLACHDWGPEASLSLPYLHKNSIRVLCNANTSEGFKPAKDVSFPEINLQTGSINGFIG  177

Query  1333  GPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCIC  1512
             GPS S+RSILAFFAGG+HGPIRPILLEHWENKD D+QVH+YLPKG+SYY+ LR +KFC+C
Sbjct  178   GPSASKRSILAFFAGGVHGPIRPILLEHWENKDEDIQVHKYLPKGVSYYDKLRNSKFCLC  237

Query  1513  PSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGI  1692
             PSGYEVASPR+VEA+YTGCVPVLI +HYV PFSDVLNWKSFSVE+ V+DIPNLK IL  I
Sbjct  238   PSGYEVASPRVVEAIYTGCVPVLISEHYVPPFSDVLNWKSFSVELSVKDIPNLKDILMSI  297

Query  1693  SQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             S R+YIR+QRR +  +RHFEV+ PPKR+DV HMILHS WLRRLN R+
Sbjct  298   SPRQYIRMQRRVIQIQRHFEVHSPPKRFDVFHMILHSVWLRRLNFRM  344



>dbj|BAB08605.1| unnamed protein product [Arabidopsis thaliana]
Length=408

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/396 (66%), Positives = 315/396 (80%), Gaps = 5/396 (1%)
 Frame = +1

Query  658   LQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLE  837
             L+   +R   NLE++E  L KARA+I+AA       D       GP+YWNA VFHRSYLE
Sbjct  17    LEPKKRRVLSNLEKIEFKLQKARASIKAASMDDPVDDPDYVP-LGPMYWNAKVFHRSYLE  75

Query  838   MEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISI  1014
             MEKQFKI+VY+EGEPP+FH+GPCKSIY+ EG+FIY +ET + FRT +P+KAHVF+LP S+
Sbjct  76    MEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEIETDTRFRTNNPDKAHVFYLPFSV  135

Query  1015  TAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEIS  1194
               +V +VY+R   N   + P++ TV DYINLV  KY YWNRS+GADHF+L+CHDWGPE S
Sbjct  136   VKMVRYVYER---NSRDFSPIRNTVKDYINLVGDKYPYWNRSIGADHFILSCHDWGPEAS  192

Query  1195  KAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFA  1374
              + P L  NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GGPSPS R ILAFFA
Sbjct  193   FSHPHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFA  252

Query  1375  GGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
             GG+HGP+RP+LL+HWENKDND++VH+YLP+G SY +M+R +KFCICPSGYEVASPR+VEA
Sbjct  253   GGVHGPVRPVLLQHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEA  312

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             LY+GCVPVLI   YV PFSDVLNW+SFSV V VEDIPNLK ILT IS R+Y+R+ RR L 
Sbjct  313   LYSGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLK  372

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
              RRHFEVN P KR+DV HMILHS W+RRLNV++  +
Sbjct  373   VRRHFEVNSPAKRFDVFHMILHSIWVRRLNVKIREV  408



>ref|XP_010490872.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
Length=521

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/398 (66%), Positives = 314/398 (79%), Gaps = 5/398 (1%)
 Frame = +1

Query  652   TPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSY  831
              P +   +R   NL+++E  L KARA+I+AA       D       GP+YWNA +FHRSY
Sbjct  128   APSEPKKRRVLSNLQKIEFELQKARASIKAASMDDPVDDPDYVP-LGPMYWNAKIFHRSY  186

Query  832   LEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPI  1008
             LEMEKQFKI+VY+EGEPP+FH+GPCKSIY+ EG+FIY MET+  FRT +P+KAH F+LP 
Sbjct  187   LEMEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETNTRFRTNNPDKAHAFYLPF  246

Query  1009  SITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPE  1188
             S+  +V FVY+R   N   + P++ TV DYINLV  KY YWNRS+GADHFML+CHDWGPE
Sbjct  247   SVVKMVRFVYER---NSRDFGPIRNTVRDYINLVGDKYPYWNRSIGADHFMLSCHDWGPE  303

Query  1189  ISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAF  1368
              S + P L  NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GGPSPS R ILAF
Sbjct  304   ASFSHPHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAF  363

Query  1369  FAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMV  1548
             FAGG+HGP+RP+LLEHWENKDND++VH+YLP+G SY +M+R +KFCICPSGYEVASPR+V
Sbjct  364   FAGGVHGPVRPVLLEHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIV  423

Query  1549  EALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRG  1728
             EALY+GCVPVLI   YV PFSDVLNWKSFSV V VEDIPNLK ILT IS R+Y+R+ RR 
Sbjct  424   EALYSGCVPVLINSGYVPPFSDVLNWKSFSVIVSVEDIPNLKTILTAISPRQYLRMYRRV  483

Query  1729  LIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             L  RRHFEVN P KR+DV HMILHS W+RRLNVR+  +
Sbjct  484   LKVRRHFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  521



>ref|XP_002873114.1| hypothetical protein ARALYDRAFT_487158 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49373.1| hypothetical protein ARALYDRAFT_487158 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/396 (66%), Positives = 314/396 (79%), Gaps = 5/396 (1%)
 Frame = +1

Query  658   LQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLE  837
             L+   +R   NLE++E  L KARA+I+AA       D       GP+YWNA VFHRSYLE
Sbjct  128   LEPKKRRVLSNLEKIEFELQKARASIKAASMDDPVDDPDYVP-LGPMYWNAKVFHRSYLE  186

Query  838   MEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISI  1014
             MEKQFKI+VY+EGEPP+FH+GPCKSIY+ EG+FIY MET + FRT +P+KAH F+LP S+
Sbjct  187   MEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETDTRFRTNNPDKAHAFYLPFSV  246

Query  1015  TAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEIS  1194
               +V +VY+R   N   + P++ TV DYINLV  KY YWNRS+GADHF+L+CHDWGPE S
Sbjct  247   VKMVRYVYER---NSRDFSPIRNTVRDYINLVGDKYPYWNRSIGADHFILSCHDWGPEAS  303

Query  1195  KAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFA  1374
              + P L  NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GGPSPS R ILAFFA
Sbjct  304   FSHPHLGHNSIRALCNANTSEKFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFA  363

Query  1375  GGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
             GG+HGP+RP+LLEHWENKDND++VH+YLP+G SY +M+R +KFCICPSGYEVASPR+VEA
Sbjct  364   GGVHGPVRPVLLEHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEA  423

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             LY+GCVPVLI   YV PFSDVLNW+SFSV V VEDIPNLK ILT IS R+Y+R+ RR L 
Sbjct  424   LYSGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTAISPRQYLRMYRRVLK  483

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
              RRHFEVN P KR+DV HMILHS W+RRLNVR+  +
Sbjct  484   VRRHFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  519



>ref|XP_010423660.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
Length=514

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/391 (67%), Positives = 310/391 (79%), Gaps = 5/391 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             +R   NLE++E  L KARA+I+AA       D       GP+YWNA VFHRSYLEMEKQF
Sbjct  128   RRVLSNLEKIEFELQKARASIKAASMDDPVDDPDYVP-LGPMYWNAKVFHRSYLEMEKQF  186

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVH  1029
             KI+VY+EGEPP+FH+GPCKSIY+ EG+FIY MET+  FRT  P+KAH F+LP S+  +V 
Sbjct  187   KIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETNTRFRTNKPDKAHAFYLPFSVVKMVR  246

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             FVY+R   N   + P++ TV DYINLV  KY YWNRS+GADHF+L+CHDWGPE S + P 
Sbjct  247   FVYER---NSRDFGPIRNTVRDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFSHPH  303

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L  NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GG SPS R ILAFFAGG+HG
Sbjct  304   LGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGRSPSSRPILAFFAGGVHG  363

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             P+RP+LLEHWENKDND++VH+YLP+G SY +M+R +KFCICPSGYEVASPR+VEALY+GC
Sbjct  364   PVRPVLLEHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGC  423

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI   YV PFSDVLNWKSFSV V VEDIPNLK ILT IS R+Y+R+ RR L  RRHF
Sbjct  424   VPVLINSGYVPPFSDVLNWKSFSVVVSVEDIPNLKTILTAISPRQYLRMYRRVLKVRRHF  483

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             EVN P KR+DV HMILHS W+RRLNVR+  +
Sbjct  484   EVNSPAKRFDVFHMILHSIWVRRLNVRIREV  514



>ref|NP_001031828.1| Exostosin family protein [Arabidopsis thaliana]
 sp|Q9FFN2.2|GLYT3_ARATH RecName: Full=Probable glycosyltransferase At5g03795 [Arabidopsis 
thaliana]
 gb|AED90655.1| Exostosin family protein [Arabidopsis thaliana]
Length=518

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/396 (66%), Positives = 315/396 (80%), Gaps = 5/396 (1%)
 Frame = +1

Query  658   LQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLE  837
             L+   +R   NLE++E  L KARA+I+AA       D       GP+YWNA VFHRSYLE
Sbjct  127   LEPKKRRVLSNLEKIEFKLQKARASIKAASMDDPVDDPDYVP-LGPMYWNAKVFHRSYLE  185

Query  838   MEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISI  1014
             MEKQFKI+VY+EGEPP+FH+GPCKSIY+ EG+FIY +ET + FRT +P+KAHVF+LP S+
Sbjct  186   MEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEIETDTRFRTNNPDKAHVFYLPFSV  245

Query  1015  TAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEIS  1194
               +V +VY+R   N   + P++ TV DYINLV  KY YWNRS+GADHF+L+CHDWGPE S
Sbjct  246   VKMVRYVYER---NSRDFSPIRNTVKDYINLVGDKYPYWNRSIGADHFILSCHDWGPEAS  302

Query  1195  KAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFA  1374
              + P L  NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GGPSPS R ILAFFA
Sbjct  303   FSHPHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFA  362

Query  1375  GGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
             GG+HGP+RP+LL+HWENKDND++VH+YLP+G SY +M+R +KFCICPSGYEVASPR+VEA
Sbjct  363   GGVHGPVRPVLLQHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEA  422

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             LY+GCVPVLI   YV PFSDVLNW+SFSV V VEDIPNLK ILT IS R+Y+R+ RR L 
Sbjct  423   LYSGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLK  482

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
              RRHFEVN P KR+DV HMILHS W+RRLNV++  +
Sbjct  483   VRRHFEVNSPAKRFDVFHMILHSIWVRRLNVKIREV  518



>ref|XP_009413449.1| PREDICTED: probable glycosyltransferase At5g03795 [Musa acuminata 
subsp. malaccensis]
Length=514

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/403 (64%), Positives = 317/403 (79%), Gaps = 7/403 (2%)
 Frame = +1

Query  640   NETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGI-NQTD--DHDYVPTGPVYWNA  810
              E   PL     +++  L+RLE  LG+ARAAI+ A     N+T   D DYVP GP+Y NA
Sbjct  109   TEDAIPLPRGRGKRYTKLQRLELGLGRARAAIKKAFRNAGNRTALPDKDYVPQGPLYRNA  168

Query  811   NVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKA  987
               FHRSYLEMEK FK++VYEEGEPP+FH+GPC+SIY+SEG FI  ME  S +RTR+P+ A
Sbjct  169   YAFHRSYLEMEKLFKVYVYEEGEPPLFHDGPCRSIYSSEGRFINSMEMDSRYRTRNPDLA  228

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
             HVFFLP S+  +V F+Y     +     P+K+T++DYI++VA +Y YWNRSLGADHFML+
Sbjct  229   HVFFLPFSVAKMVKFIYKPESFDIS---PIKKTIADYIDVVAERYPYWNRSLGADHFMLS  285

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
             CHDWGP  SKAVP L+ NS+R LCNANTSEGF PSKDVS+PEI +    M  ++GGPS S
Sbjct  286   CHDWGPHSSKAVPNLYGNSVRVLCNANTSEGFDPSKDVSLPEINIKTDVMADMMGGPSAS  345

Query  1348  RRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
              R ILAFFAGG HGP+RP+LLE W++KD DVQVH YLPKG+SYY+ +RK+K+C+CPSGYE
Sbjct  346   HRPILAFFAGGDHGPVRPLLLEAWKDKDPDVQVHEYLPKGVSYYDTMRKSKYCLCPSGYE  405

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA+Y GCVPV I DHYV PFSDVL+WK+FSV++ VEDIPN+KKIL GIS  +Y
Sbjct  406   VASPRIVEAIYLGCVPVTINDHYVLPFSDVLDWKAFSVQISVEDIPNIKKILMGISPTQY  465

Query  1708  IRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             IRLQRRG + +RHF VN PP+R+DV HMILHS WLRRLN+R+H
Sbjct  466   IRLQRRGAMVQRHFVVNSPPRRFDVFHMILHSIWLRRLNIRMH  508



>ref|XP_006287392.1| hypothetical protein CARUB_v10000598mg, partial [Capsella rubella]
 gb|EOA20290.1| hypothetical protein CARUB_v10000598mg, partial [Capsella rubella]
Length=562

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/391 (67%), Positives = 312/391 (80%), Gaps = 5/391 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             +R   NLE++E  L KARA+I+AA       D       GP+YWNA VFHRSYLEMEKQF
Sbjct  176   RRVLSNLEKIELELQKARASIKAASMDDPVDDPDYVP-LGPMYWNAKVFHRSYLEMEKQF  234

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVH  1029
             KI+VY+EGEPP+FH+GPCKSIY+ EG+FIY MET + FRT +P+KAH F+LP S+  +V 
Sbjct  235   KIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETDTRFRTNNPDKAHAFYLPFSVVKMVR  294

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             +VY+R   N   + P++ TV DYINLV  KY YWNRS+GADHF+L+CHDWGPE S + P 
Sbjct  295   YVYER---NSRDFGPIRNTVRDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFSHPH  351

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L  NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GGPSPS R ILAFFAGG+HG
Sbjct  352   LGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSSRPILAFFAGGVHG  411

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             P+RP+LL+HWE+KDND++VH+YLP+G SY +M+R +KFCICPSGYEVASPR+VEALY+GC
Sbjct  412   PVRPVLLDHWEDKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGC  471

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI   YV PFSDVLNWKSFSV V VEDIPNLK ILT IS R+Y+R+ RR L  RRHF
Sbjct  472   VPVLINSGYVPPFSDVLNWKSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVRRHF  531

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             EVN P KR+DV HMILHS W+RRLNVR+  +
Sbjct  532   EVNSPAKRFDVFHMILHSIWVRRLNVRIREV  562



>emb|CBI30213.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/334 (75%), Positives = 286/334 (86%), Gaps = 4/334 (1%)
 Frame = +1

Query  838   MEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISI  1014
             MEKQ K++VY+EGEPP+FHNGPCKSIY+ EGNFI+ ME  S FRT+DPEKAH+FFLP S+
Sbjct  1     MEKQLKVYVYDEGEPPLFHNGPCKSIYSMEGNFIHKMEMDSHFRTKDPEKAHLFFLPFSV  60

Query  1015  TAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEIS  1194
               +V FVY R  H+     P+KQTV DY+N+V+ KY YWNRSLGADHFMLACHDWGPE S
Sbjct  61    AMLVRFVYVRDSHDLG---PIKQTVIDYVNVVSTKYPYWNRSLGADHFMLACHDWGPETS  117

Query  1195  KAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFA  1374
              ++P L KNSIR LCNANTSEGF PSKDVS PEI L  G+    IGGPSPS R++LAFFA
Sbjct  118   FSIPYLHKNSIRVLCNANTSEGFNPSKDVSFPEINLLTGSTDSFIGGPSPSHRTLLAFFA  177

Query  1375  GGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
             GGLHGPIRPILLEHWENKD DV+VH+YLPKG+SYYEM+RK+K+C+CPSGYEVASPR+VEA
Sbjct  178   GGLHGPIRPILLEHWENKDEDVKVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEA  237

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             LYTGCVPVLI DHYV PFSDVLNWKSFSVEVPV +IPNLK+IL  IS R+YIR+QRRG+ 
Sbjct  238   LYTGCVPVLISDHYVPPFSDVLNWKSFSVEVPVREIPNLKRILMDISPRQYIRMQRRGIQ  297

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             ARRHFEVN PPKRYDV HMILHS WLRRLN R+H
Sbjct  298   ARRHFEVNSPPKRYDVFHMILHSLWLRRLNFRVH  331



>emb|CDX80888.1| BnaC03g01420D [Brassica napus]
Length=515

 Score =   538 bits (1385),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 255/391 (65%), Positives = 312/391 (80%), Gaps = 5/391 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             KR  + ++++E  L KAR AI+AA       D       GP+YWNA VFHRSYLEMEKQF
Sbjct  129   KRVTKKIDKIEFELQKARVAIKAASMDDPVDDPDYVP-IGPMYWNAKVFHRSYLEMEKQF  187

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISITAIVH  1029
             KIFVY EG+PP+FH+GPCKSIY+ EGNFIY ME  + FRT +P+KAH F+LP+S+  +V 
Sbjct  188   KIFVYREGDPPLFHDGPCKSIYSMEGNFIYEMERDTHFRTNNPDKAHAFYLPLSVVKMVR  247

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             +VY R  H+   + P+++TV DYI+LV+ +Y YWNRS+GADHF+L+CHDWGPE S + P 
Sbjct  248   YVYQRDSHD---FGPIRRTVRDYIDLVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPH  304

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L +NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GGPSPS R ILAFFAGG+HG
Sbjct  305   LGQNSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSVRPILAFFAGGVHG  364

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             P+RP+LL+HWENKDND++VH+YLPKG SY +M+R +KFC+CPSGYEVASPR+VEALY+GC
Sbjct  365   PVRPVLLQHWENKDNDIRVHKYLPKGTSYPDMMRSSKFCLCPSGYEVASPRIVEALYSGC  424

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI   YV PFSDVLNW+SFSV V VEDIP LK ILT IS R+Y+++ RR L  RRHF
Sbjct  425   VPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPKLKTILTSISPRQYLKMYRRVLKVRRHF  484

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             EVN P KR+DV HMILHS W+RRLNVR+  +
Sbjct  485   EVNSPAKRFDVFHMILHSIWVRRLNVRIREV  515



>ref|XP_009130782.1| PREDICTED: probable glycosyltransferase At5g03795 [Brassica rapa]
Length=518

 Score =   537 bits (1383),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 254/391 (65%), Positives = 312/391 (80%), Gaps = 5/391 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             KR  + ++++E  L KAR AI+AA       D       GP+YWNA VFHRSYLEMEKQF
Sbjct  132   KRVTKKIDKIEFELQKARVAIKAASMDDPVDDPDYVP-IGPMYWNAKVFHRSYLEMEKQF  190

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISITAIVH  1029
             KIFVY+EG+PP+FH+GPCKSIY+ EGNFIY ME  + FRT +P+KAH F+LP+S+  +V 
Sbjct  191   KIFVYKEGDPPLFHDGPCKSIYSMEGNFIYEMERDTHFRTNNPDKAHAFYLPLSVVKMVR  250

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             +VY R  H+   + P+++TV DYI+LV+ +Y YWNRS+GADHF+L+CHDWGPE S + P 
Sbjct  251   YVYQRDSHD---FGPIRRTVRDYIDLVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPH  307

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L +NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GGPSPS R ILAFFAGG+HG
Sbjct  308   LGQNSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSIRPILAFFAGGVHG  367

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             P+RP+LL+HWENKDND++VH+YLPKG SY +M+R +KFC+CPSGYEVA PR+VEALY+GC
Sbjct  368   PVRPVLLQHWENKDNDIRVHKYLPKGTSYPDMMRSSKFCLCPSGYEVAGPRIVEALYSGC  427

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI   YV PFSDVLNW+SFSV V VEDIP LK ILT IS R+Y+++ RR L  RRHF
Sbjct  428   VPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPKLKTILTSISPRQYLKMYRRVLKVRRHF  487

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             EVN P KR+DV HMILHS W+RRLNVR+  +
Sbjct  488   EVNSPAKRFDVFHMILHSIWVRRLNVRIREV  518



>emb|CDY11270.1| BnaA03g01060D [Brassica napus]
Length=389

 Score =   531 bits (1368),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 254/391 (65%), Positives = 311/391 (80%), Gaps = 5/391 (1%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             KR  + ++++E  L KAR AI+AA       D       GP+YWNA VFHRSYLEMEKQF
Sbjct  3     KRVTKKIDKIEFELQKARVAIKAASMDDPVDDPDYVP-IGPMYWNAKVFHRSYLEMEKQF  61

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISITAIVH  1029
             KIFVY+EG+PP+FH+GPCKSIY+ EGNFIY ME  + FRT +P+KAH F+LP+S+  +V 
Sbjct  62    KIFVYKEGDPPLFHDGPCKSIYSMEGNFIYEMERDTHFRTNNPDKAHAFYLPLSVVKMVR  121

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             +VY R  H+   + P+++TV DYI+LV+ +Y YWNRS+GADHF+L+CHDWGPE S + P 
Sbjct  122   YVYQRDSHD---FGPIRRTVRDYIDLVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPH  178

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L +NSIRALCNANTSE FKP KDVSIPEI L  G++ GL+GGPSPS R ILAFFAGG+HG
Sbjct  179   LGQNSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSIRPILAFFAGGVHG  238

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             P+RP+LL+HWENKD D+ VH+YLPKG SY +M+R +KFC+CPSGYEVASPR+VEALY+GC
Sbjct  239   PVRPVLLQHWENKDKDISVHKYLPKGTSYPDMMRSSKFCLCPSGYEVASPRIVEALYSGC  298

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVLI   YV PFSDVLNW+SFSV V VEDIP LK ILT IS R+Y+++ RR L  RRHF
Sbjct  299   VPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPKLKTILTSISPRQYLKMYRRVLKVRRHF  358

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             EVN P KR+DV HMILHS W+RRLNVR+  +
Sbjct  359   EVNSPAKRFDVFHMILHSIWVRRLNVRIREV  389



>ref|XP_011101497.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=465

 Score =   525 bits (1351),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 242/389 (62%), Positives = 299/389 (77%), Gaps = 3/389 (1%)
 Frame = +1

Query  670   IKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             +++ + +LER EA+L +ARA I+ A      + D DYVP+GP+Y N N FHRSYLEMEK 
Sbjct  75    VEKNYSDLERAEASLARARARIQEAQRSNQTSYDPDYVPSGPMYRNPNAFHRSYLEMEKL  134

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVH  1029
             F+I+VYE+G+PP+FH      I   EG  I+H+E S FRTRDP KAHVFF+PIS  +I +
Sbjct  135   FRIYVYEDGDPPLFHYSKSLGILGIEGILIHHIEISNFRTRDPGKAHVFFVPISAQSIAN  194

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
             + Y   +HN+  W P++    DY+NL++ KY YWNR+LG DHFMLACHDW P+ISK VP 
Sbjct  195   YAY--VIHNRA-WSPLQNIARDYVNLISTKYPYWNRTLGHDHFMLACHDWAPKISKGVPL  251

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             LFKNSIR LCNANTSEGFKPS DVS+PEI LPGG M GLIGGP PS RS+L F++GG+HG
Sbjct  252   LFKNSIRVLCNANTSEGFKPSVDVSMPEIYLPGGKMDGLIGGPPPSTRSVLVFYSGGVHG  311

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
              IR IL++ W++KD +VQ+H YLP+ +SYY M RK+K+CICPSG+EVASPR VEALYTGC
Sbjct  312   YIRQILMDQWKDKDPEVQIHEYLPRNMSYYGMFRKSKYCICPSGWEVASPRTVEALYTGC  371

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPVL+KDHY  PF DVL+W  FSV++ V  IP LK +L  I + RYI +QR G+  RRHF
Sbjct  372   VPVLLKDHYAKPFDDVLDWSKFSVDIRVSQIPELKNVLKAIPEERYIEMQRIGVEVRRHF  431

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             EVN PPKRYDV HMILHS WLRR+NV+LH
Sbjct  432   EVNFPPKRYDVFHMILHSIWLRRMNVQLH  460



>gb|EMT30821.1| Exostosin-2 [Aegilops tauschii]
Length=537

 Score =   525 bits (1351),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 250/388 (64%), Positives = 299/388 (77%), Gaps = 7/388 (2%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQ---TDDHDYVPTGPVYWNANVFHRSYLEMEKQFKI  858
              LER+E  L KAR  IR A+   ++     D DYVP GPVY NA  FHRSYLEMEK FK+
Sbjct  151   KLERVELGLAKARLVIREAIRNKDKRPPLTDRDYVPVGPVYRNAYAFHRSYLEMEKLFKV  210

Query  859   FVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVHFV  1035
             +VYEEGEPPVFH+GPC+SIY+SEG FI+ ME  +  RTRDPE AHVFFLP S+  +V  +
Sbjct  211   YVYEEGEPPVFHDGPCRSIYSSEGRFIFAMEMENRMRTRDPELAHVFFLPFSVVKMVKMI  270

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             Y+ + H+ E   P+++T+SDYI++++ KY YWNRSLGADHFML+CHDWGP +S A   LF
Sbjct  271   YEPNSHDME---PLRRTLSDYIDVLSTKYPYWNRSLGADHFMLSCHDWGPYVSSADGHLF  327

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
              NSIR LCNANTSEGF PSKDVS+PEI L    +   +GGPS SRR ILAFFAGG HGP+
Sbjct  328   SNSIRVLCNANTSEGFNPSKDVSLPEITLRTDIVDNQVGGPSASRRPILAFFAGGDHGPV  387

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RP+LL HW+ KD DVQV  YLP+G+SY  ++R++KFC+CPSGYEVASPR+VEA+Y  CVP
Sbjct  388   RPLLLRHWKGKDADVQVSEYLPRGVSYINVMRRSKFCLCPSGYEVASPRVVEAIYLECVP  447

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             V+I D YV PFSDVLNW +FSV V V DIPNLK IL  +S R+YIR+QR     RRHF V
Sbjct  448   VVIGDDYVLPFSDVLNWPAFSVRVAVADIPNLKTILAAVSPRQYIRMQRGVRPVRRHFMV  507

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
             N PP+R+DV HMILHS WLRRLNVRLHG
Sbjct  508   NGPPRRFDVFHMILHSIWLRRLNVRLHG  535



>ref|XP_011094445.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=497

 Score =   523 bits (1347),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 239/388 (62%), Positives = 298/388 (77%), Gaps = 3/388 (1%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVY  867
             NL+ +EA+L +ARA I+ A      + D DYVPTGP+Y N N F RSYLEMEK FKI+VY
Sbjct  113   NLDMVEASLAQARATIQEAQRNNETSYDPDYVPTGPMYRNPNAFLRSYLEMEKLFKIYVY  172

Query  868   EEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
             E+GEPP++H      I   EG  I+ +E S FRTRDP KAHV+F+P+S+ +IV + Y R 
Sbjct  173   EDGEPPLYHYSKSLGILGIEGILIHQIEISKFRTRDPGKAHVYFIPLSVQSIVAYAYVR-  231

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
              HN+  W P++    DY+ L++ KY YWNR+LG DHF+L CHDW P IS AVP+LFKNSI
Sbjct  232   -HNRA-WSPLQNIARDYVKLISTKYPYWNRTLGCDHFILGCHDWTPMISNAVPDLFKNSI  289

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPIL  1407
             R LCNANTSEGFKPS DVS+PEI LP GTM GLIGG  PS RS+L F+AGG+HG IR +L
Sbjct  290   RVLCNANTSEGFKPSTDVSLPEIYLPHGTMDGLIGGMPPSERSVLVFYAGGIHGYIRQVL  349

Query  1408  LEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIK  1587
             ++ W++KD D+Q+H YLPK +SYY M RK+K+CICPSG+EVASPRMVE LY GCVPVL+K
Sbjct  350   MDQWKDKDPDIQIHEYLPKNMSYYSMFRKSKYCICPSGWEVASPRMVEGLYMGCVPVLLK  409

Query  1588  DHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPP  1767
             DHY  PF+DVL+W +FSV+VPV  IP+LKKILT I Q +Y  +Q+ G++ RRHFEVN PP
Sbjct  410   DHYAKPFNDVLDWSTFSVDVPVNQIPDLKKILTAIPQEQYQEMQKTGILVRRHFEVNFPP  469

Query  1768  KRYDVTHMILHSAWLRRLNVRLHGIEDT  1851
             KRYDV HMILHS WLRR+N++LH   ++
Sbjct  470   KRYDVFHMILHSIWLRRINIQLHDTHES  497



>ref|XP_007027565.1| Exostosin family protein, putative [Theobroma cacao]
 gb|EOY08067.1| Exostosin family protein, putative [Theobroma cacao]
Length=546

 Score =   524 bits (1349),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 264/464 (57%), Positives = 342/464 (74%), Gaps = 17/464 (4%)
 Frame = +1

Query  469   VVPPDNGGGGKILAYNSSINSSTSP-LHFESQEIQQPDIQKEENLNisssipsiiss---  636
             VV  D+    + L+  ++++ S SP +  +S ++QQ + + E+N N+S S     ++   
Sbjct  82    VVSVDDHSRKEALSDEAALSKSVSPTIDAQSLQVQQFNGRNEDNPNMSISENFSSTTPLK  141

Query  637   sNET-GTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNAN  813
              NE+   PL+   +R +  L+RLE  L KARAAI+ A++G +Q  D DY+P GP+Y NA 
Sbjct  142   ENESIDPPLKHRRRRVYTKLDRLEDGLRKARAAIKKAMNG-SQLQDPDYIPDGPIYRNAK  200

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAH  990
              FHRSYLEMEK+FKI+VY+EGE P+FH+GPC+ +Y  EG FI  ME +  FRT +PEKAH
Sbjct  201   FFHRSYLEMEKKFKIYVYKEGELPLFHDGPCRLLYTMEGQFINKMEVNKKFRTYNPEKAH  260

Query  991   VFFLPISITAIVHFVYDRSVHNKEHWLPMKQ---TVSDYINLVAGKYAYWNRSLGADHFM  1161
             VF+LP S+T +V + + R         PMK+    V DY+N++AGKY +WNRSLGADHFM
Sbjct  261   VFYLPYSVTRMVQYNWVRGT-------PMKRLGGIVLDYVNVIAGKYPFWNRSLGADHFM  313

Query  1162  LACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPS  1341
             L+CHDWGP  S  VP+L KNSIRALCNANTSE F P KDVSIPEI L    + GLIGGPS
Sbjct  314   LSCHDWGPATSFYVPDLVKNSIRALCNANTSERFNPMKDVSIPEISLKSSRLEGLIGGPS  373

Query  1342  PSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSG  1521
             PS+R+ILAFFAGG HG +RPIL  HWE KD  ++VH YLP+ + YY+++R++K+C+CPSG
Sbjct  374   PSQRTILAFFAGGNHGFVRPILFRHWEKKDPAIRVHNYLPRRVPYYDLMRQSKYCLCPSG  433

Query  1522  YEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQR  1701
             YEVASPR+VEALY GCVPVLI   YV PFSDVLNWK FSV V +EDIPNLKKIL  I +R
Sbjct  434   YEVASPRVVEALYNGCVPVLISKSYVPPFSDVLNWKMFSVMVSLEDIPNLKKILMSIPER  493

Query  1702  RYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +YI++Q+R +  RRHFE+++ PKR+DV HMILHS WLRRLNV++
Sbjct  494   QYIKMQKRVVQVRRHFELHVTPKRFDVFHMILHSIWLRRLNVKV  537



>ref|XP_008381668.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=526

 Score =   520 bits (1339),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 248/402 (62%), Positives = 306/402 (76%), Gaps = 7/402 (2%)
 Frame = +1

Query  640   NETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNA  810
             N T   +  T  +++  LE+LEANL   RA+IR A    N T  H   DYVP GP+Y NA
Sbjct  122   NGTSAIITSTSIKRYSRLEKLEANLAGVRASIREAARVRNLTSTHEDPDYVPRGPIYRNA  181

Query  811   NVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKA  987
             N FHRSYL+MEK FKI+VYEEGEPP+FHNGPCKSIY++EG FI+ ME  + +RTRDP++A
Sbjct  182   NAFHRSYLKMEKHFKIYVYEEGEPPIFHNGPCKSIYSTEGRFIHEMEMENIYRTRDPDQA  241

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
              V+FLP S+  +V ++Y    H+ +   P+ + V DY+N+++ K+ +WNRSLGADHFML+
Sbjct  242   LVYFLPFSVVMLVQYLYVADSHDTQ---PIGRAVVDYVNVISDKHPFWNRSLGADHFMLS  298

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
             CHDWGP  S  VP L++NSIR LCNANTSEGF PSKDVS PEI L  G   GL+GG SPS
Sbjct  299   CHDWGPSTSAYVPHLYQNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGETKGLLGGLSPS  358

Query  1348  RRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
             RRSILAFFAG LHG IR +LL  W+ KD DVQV+  LP G+SY  ML+K++FC+CPSGYE
Sbjct  359   RRSILAFFAGRLHGHIRYLLLNEWKEKDQDVQVYDQLPNGVSYESMLKKSRFCLCPSGYE  418

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA+Y  CVPVLI D YV PFSDVL WKSFSV+V V+DIPN+K+IL GISQ +Y
Sbjct  419   VASPRVVEAIYAECVPVLISDSYVPPFSDVLEWKSFSVQVQVKDIPNIKRILMGISQSQY  478

Query  1708  IRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +R+QRR    +RHF VN P KR+DV HMI+HS WLRRLN+R+
Sbjct  479   LRMQRRVKQVQRHFVVNGPSKRFDVFHMIVHSIWLRRLNIRI  520



>ref|XP_010252860.1| PREDICTED: probable glycosyltransferase At3g07620 [Nelumbo nucifera]
Length=517

 Score =   518 bits (1334),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 252/399 (63%), Positives = 306/399 (77%), Gaps = 12/399 (3%)
 Frame = +1

Query  661   QVTIKRKFRNLERLEANLGKARAAIR-AAVHGINQT-----DDHDYVPTGPVYWNANVFH  822
             +V +KR +  L RLEA L +ARA+IR A+    NQT     DD DYVP GP+Y NA VFH
Sbjct  121   EVGVKR-YSKLMRLEAGLARARASIRMASAQSRNQTSTHDDDDPDYVPRGPIYRNAFVFH  179

Query  823   RSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP--FRTRDPEKAHVF  996
             RSYLEMEK FKIFVYEEG+PP+FHNGPC+SIY++EG FI  ME +   +RTRDP++AHV+
Sbjct  180   RSYLEMEKIFKIFVYEEGDPPLFHNGPCRSIYSTEGRFINEMEKAGNHYRTRDPDEAHVY  239

Query  997   FLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHD  1176
             FLP S+  +V F+Y    H  +    + +TV DYIN+++ KY YWNRSLGADHFML+CHD
Sbjct  240   FLPFSVVMMVQFLYVPDSHEID---SIGRTVVDYINILSAKYPYWNRSLGADHFMLSCHD  296

Query  1177  WGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRS  1356
             WGP  S  V ELF NSIR LCNANTSEGF P KD S PEI L  G + GL+GG SPSRR 
Sbjct  297   WGPRTSAYVRELFDNSIRVLCNANTSEGFNPLKDASFPEIHLRTGEITGLLGGLSPSRRP  356

Query  1357  ILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVAS  1536
             +LAFFAG LHG IR +LL+ W+++D DVQV+  LP G+SY EML+K+K+C+CPSGYEVAS
Sbjct  357   LLAFFAGRLHGNIRLLLLQEWKDRDKDVQVYDELPDGMSYNEMLKKSKYCLCPSGYEVAS  416

Query  1537  PRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRL  1716
             PR+VEA+Y  CVPVLI DHYV PFSDVLNW SFSV++ V DIPN+K IL+ ISQ +YIR+
Sbjct  417   PRIVEAIYAECVPVLISDHYVPPFSDVLNWNSFSVQIAVSDIPNIKTILSSISQTQYIRM  476

Query  1717  QRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             QRR    +RHF VN PP+R+DV HMILHS WLRRLN+ +
Sbjct  477   QRRVKQVQRHFVVNGPPQRFDVFHMILHSIWLRRLNIHI  515



>ref|XP_009593673.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana tomentosiformis]
Length=486

 Score =   516 bits (1328),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 242/369 (66%), Positives = 289/369 (78%), Gaps = 4/369 (1%)
 Frame = +1

Query  655   PLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYL  834
             P  ++ K+   NLE++EA LGK RAAIR A      +DD +Y P GP YWN++ FHRSYL
Sbjct  83    PQMISSKKNLSNLEKVEAGLGKVRAAIREAQTKNLTSDDSEYAPKGPCYWNSSAFHRSYL  142

Query  835   EMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISI  1014
             EMEK FKI+VYEEGEPPVFH    + I   EG  I+ +E S FRT  PEKAHV+FLP S+
Sbjct  143   EMEKHFKIYVYEEGEPPVFHYSSSEGILGIEGILIHQIEISKFRTNYPEKAHVYFLPFSV  202

Query  1015  TAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEIS  1194
              +IV +VY   V +   W PMK T +DYI+ ++ KY +WNRSLG+DHFMLACHDW PEIS
Sbjct  203   FSIVSYVY---VVDSHQWGPMKNTAADYIDSISRKYPFWNRSLGSDHFMLACHDWAPEIS  259

Query  1195  KAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFA  1374
              AVP L+KNSIR LCNANTSE F PSKDV++PEI LP GTM GLIGGPSPS+RSIL F+A
Sbjct  260   TAVPYLYKNSIRVLCNANTSERFNPSKDVTLPEIYLPQGTMEGLIGGPSPSQRSILVFYA  319

Query  1375  GGLHGPIRPILLEHW-ENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVE  1551
             GG+HG IR +L+E W EN D +VQ+H YLPK +SYY M+RK+KFCICPSG+EVASPRMVE
Sbjct  320   GGIHGYIRQVLMEQWGENDDPEVQIHEYLPKNVSYYGMIRKSKFCICPSGWEVASPRMVE  379

Query  1552  ALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGL  1731
             A Y GCVPVL+KD+YVAPFSDVLNWKSF+VE+   DIPNLKKIL  ISQ++YI++Q+RGL
Sbjct  380   AFYIGCVPVLLKDNYVAPFSDVLNWKSFAVEMTSNDIPNLKKILMSISQKQYIKMQKRGL  439

Query  1732  IARRHFEVN  1758
               RRHFEVN
Sbjct  440   QVRRHFEVN  448



>ref|XP_009593674.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana tomentosiformis]
Length=402

 Score =   512 bits (1318),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 241/366 (66%), Positives = 288/366 (79%), Gaps = 4/366 (1%)
 Frame = +1

Query  664   VTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEME  843
             ++ K+   NLE++EA LGK RAAIR A      +DD +Y P GP YWN++ FHRSYLEME
Sbjct  2     ISSKKNLSNLEKVEAGLGKVRAAIREAQTKNLTSDDSEYAPKGPCYWNSSAFHRSYLEME  61

Query  844   KQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAI  1023
             K FKI+VYEEGEPPVFH    + I   EG  I+ +E S FRT  PEKAHV+FLP S+ +I
Sbjct  62    KHFKIYVYEEGEPPVFHYSSSEGILGIEGILIHQIEISKFRTNYPEKAHVYFLPFSVFSI  121

Query  1024  VHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             V +VY   V +   W PMK T +DYI+ ++ KY +WNRSLG+DHFMLACHDW PEIS AV
Sbjct  122   VSYVY---VVDSHQWGPMKNTAADYIDSISRKYPFWNRSLGSDHFMLACHDWAPEISTAV  178

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
             P L+KNSIR LCNANTSE F PSKDV++PEI LP GTM GLIGGPSPS+RSIL F+AGG+
Sbjct  179   PYLYKNSIRVLCNANTSERFNPSKDVTLPEIYLPQGTMEGLIGGPSPSQRSILVFYAGGI  238

Query  1384  HGPIRPILLEHW-ENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALY  1560
             HG IR +L+E W EN D +VQ+H YLPK +SYY M+RK+KFCICPSG+EVASPRMVEA Y
Sbjct  239   HGYIRQVLMEQWGENDDPEVQIHEYLPKNVSYYGMIRKSKFCICPSGWEVASPRMVEAFY  298

Query  1561  TGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIAR  1740
              GCVPVL+KD+YVAPFSDVLNWKSF+VE+   DIPNLKKIL  ISQ++YI++Q+RGL  R
Sbjct  299   IGCVPVLLKDNYVAPFSDVLNWKSFAVEMTSNDIPNLKKILMSISQKQYIKMQKRGLQVR  358

Query  1741  RHFEVN  1758
             RHFEVN
Sbjct  359   RHFEVN  364



>ref|XP_008794078.1| PREDICTED: probable glycosyltransferase At5g03795 [Phoenix dactylifera]
Length=552

 Score =   517 bits (1332),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 245/391 (63%), Positives = 307/391 (79%), Gaps = 8/391 (2%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTD--DHDYVPTGPVYWNANVFHRSYLEMEK  846
             +RK   LERLE  L +ARAAI+ AV   N+T   D DYVP GPVY NA  FH+SYLEMEK
Sbjct  164   RRKDTKLERLELGLARARAAIKEAVRNPNRTALVDKDYVPKGPVYRNAYAFHKSYLEMEK  223

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAI  1023
              FK++VY+EGEPP+FH+GPCKSIY++EG FI  M+  S  RTRDP++AHVFFLP S+  +
Sbjct  224   LFKVYVYQEGEPPIFHDGPCKSIYSTEGFFINSMDMESRLRTRDPDRAHVFFLPFSVVRM  283

Query  1024  VHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             V ++Y R  H+ +   P+++TV DYIN+++GKY YWNRSLGADHFML+CHDWGP  S   
Sbjct  284   VQYIYPRDHHDMK---PLRRTVLDYINVISGKYPYWNRSLGADHFMLSCHDWGPYASGGH  340

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
             P+LF NSIR LCNANTSE F  S+DV++PE+ +    +   +GGPS S R ILAFFAGG 
Sbjct  341   PQLFFNSIRVLCNANTSEWFNASRDVTLPEMNVRSHVVK--VGGPSASGRPILAFFAGGN  398

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HGPIRP+LL+HW++ D DVQVH YLPKG+SY ++++K+KFC+CPSGYEVASPR++EA+Y 
Sbjct  399   HGPIRPLLLKHWKDIDGDVQVHEYLPKGVSYVDLMKKSKFCLCPSGYEVASPRIMEAIYY  458

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
              CVPV I  HYV PFSDVLNWK+FSV+V VEDIPNLK IL  IS R+YIR+QRR    +R
Sbjct  459   ECVPVTINAHYVLPFSDVLNWKAFSVQVSVEDIPNLKNILMSISPRQYIRMQRRVRTVQR  518

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             HF +N PP+R+D+ HM+LHS WLRRLN+R+H
Sbjct  519   HFMINGPPRRFDLYHMLLHSIWLRRLNIRIH  549



>ref|XP_002320538.2| hypothetical protein POPTR_0014s16920g [Populus trichocarpa]
 gb|EEE98853.2| hypothetical protein POPTR_0014s16920g [Populus trichocarpa]
Length=452

 Score =   510 bits (1314),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 245/403 (61%), Positives = 303/403 (75%), Gaps = 8/403 (2%)
 Frame = +1

Query  640   NETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNA  810
             N+ G   +  +KR  + LE++EANL K R++IR A    N T   +D DYVP GP+Y NA
Sbjct  53    NDEGAVARGVVKRHSK-LEKMEANLAKIRSSIREAARVRNLTSIYEDPDYVPKGPIYRNA  111

Query  811   NVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS-PFRTRDPEKA  987
             N FHRSYLEMEK FKI++Y+EG+PP+FH+GPCKSIY+SEG FI+ +E    F T DP++A
Sbjct  112   NAFHRSYLEMEKLFKIYIYKEGDPPMFHDGPCKSIYSSEGRFIHELEKGKSFTTTDPDEA  171

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
              V+FLP S+  +V ++Y    H  +    +  TV DYIN++A KY +WNRSLGADHF+L+
Sbjct  172   LVYFLPFSVVMLVQYLYVPGSHEID---AIGNTVVDYINVIADKYPFWNRSLGADHFILS  228

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
             CHDWGP  S  VP LF NSIR LCNANTSEGF P KD S PEI L  G + GL+GGPSPS
Sbjct  229   CHDWGPRTSSYVPHLFNNSIRVLCNANTSEGFNPKKDASFPEIHLRTGEITGLVGGPSPS  288

Query  1348  RRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
             RRSILAFFAG LHG IR +LLE W++KD DVQVH  L  G+SY  ML+ ++FC+CPSGYE
Sbjct  289   RRSILAFFAGRLHGHIRRLLLEQWKDKDQDVQVHDQLRNGMSYDSMLKNSRFCLCPSGYE  348

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA+Y  CVPVLI D YV PFSDVLNWK+FS++V V+DIP +K IL GISQR+Y
Sbjct  349   VASPRIVEAIYAECVPVLISDGYVPPFSDVLNWKAFSIQVQVKDIPKIKDILMGISQRQY  408

Query  1708  IRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             +R+QRR    +RHF VN  PKR+DV HM +HS WLRRLN+R+H
Sbjct  409   LRMQRRVKQVQRHFVVNGIPKRFDVFHMTIHSIWLRRLNIRIH  451



>ref|XP_002524591.1| catalytic, putative [Ricinus communis]
 gb|EEF37799.1| catalytic, putative [Ricinus communis]
Length=507

 Score =   509 bits (1312),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 239/399 (60%), Positives = 304/399 (76%), Gaps = 7/399 (2%)
 Frame = +1

Query  664   VTIKRKFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYL  834
             V + +++  LE+LEA+L + R++IR A    N +   DD DYVP GPVY NAN FHRSYL
Sbjct  112   VKVVKRYSRLEKLEASLARVRSSIREAAQVRNLSSVHDDPDYVPQGPVYRNANAFHRSYL  171

Query  835   EMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPIS  1011
             EMEKQFKI+VYEEG PP++H+GPCKSIY+SEG FI+ +E    +RT DP++A V+FLP S
Sbjct  172   EMEKQFKIYVYEEGGPPMYHDGPCKSIYSSEGRFIHELEKGKLYRTLDPDEALVYFLPFS  231

Query  1012  ITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEI  1191
             +  +V ++Y    H       + + + DYI++++ K+ +WNRSLGADHFML+CHDWGP  
Sbjct  232   VVMMVEYLYVPDSHETN---AIGRAIVDYIHVISNKHPFWNRSLGADHFMLSCHDWGPRA  288

Query  1192  SKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFF  1371
             S  VP LF +SIR LCNANTSEGF PSKD S PEI L  G + GL+GG SPSRRSILAFF
Sbjct  289   SSYVPHLFNSSIRVLCNANTSEGFNPSKDASFPEIHLKTGEISGLLGGVSPSRRSILAFF  348

Query  1372  AGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVE  1551
             AG LHG IR ILLE W+NKD DVQV+  +P G+SY  ML+ ++FC+CPSGYEVASPR+VE
Sbjct  349   AGRLHGHIRQILLEQWKNKDEDVQVYDQMPNGVSYESMLKTSRFCLCPSGYEVASPRIVE  408

Query  1552  ALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGL  1731
             A+YT CVPVLI D+YV PFSDVLNWK+FSV++ V DIP +K+IL GISQR+Y+R+QRR  
Sbjct  409   AIYTECVPVLISDNYVPPFSDVLNWKAFSVQIQVRDIPKIKEILMGISQRQYLRMQRRLK  468

Query  1732  IARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIED  1848
               +RHF VN PPKR+D+ HM +HS WLRRLN+ +  + +
Sbjct  469   QVQRHFVVNGPPKRFDMFHMTIHSIWLRRLNIHIQDLSN  507



>ref|XP_004292405.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=526

 Score =   510 bits (1314),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 242/402 (60%), Positives = 305/402 (76%), Gaps = 8/402 (2%)
 Frame = +1

Query  640   NETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNA  810
             N T     +TIKR +  LE+LEA+L   RA+IR A    N T  H   DYVP GP+Y NA
Sbjct  124   NATTASETITIKR-YSRLEKLEASLAGVRASIREAARVRNLTSTHEDPDYVPQGPIYRNA  182

Query  811   NVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKA  987
             N FHRSYLEME+ FKI+VY+EG+PP+FHNGPCKSIY++EG FI+ ME  + +RT++P+ A
Sbjct  183   NAFHRSYLEMERLFKIYVYQEGDPPIFHNGPCKSIYSTEGMFIHEMEMDNTYRTKNPDDA  242

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
              V+FLP S+  +V ++Y+   H+ E    + + V DY+N+++ K+ +WNRSLGADHFML+
Sbjct  243   LVYFLPFSVVMLVQYLYEAESHSTES---IGRAVVDYVNVISDKHPFWNRSLGADHFMLS  299

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
             CHDWGP  S  VP+L+  SIR LCNANTSEGF PSKDVS PEI L  G   GL+GG SPS
Sbjct  300   CHDWGPRTSSYVPQLYHKSIRVLCNANTSEGFNPSKDVSFPEIHLRTGETKGLLGGLSPS  359

Query  1348  RRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
             RRS+LAFFAG LHG IR +LL  W+ KD DVQV+  LP G+SY  ML+++KFC+CPSGYE
Sbjct  360   RRSVLAFFAGRLHGHIRCLLLNEWKEKDQDVQVYDQLPNGVSYESMLKQSKFCLCPSGYE  419

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA+Y  CVPVLI D+YV PFSDVL WK+FSV+V V+DIPN+K IL GISQ +Y
Sbjct  420   VASPRIVEAIYAECVPVLISDNYVPPFSDVLEWKTFSVQVQVKDIPNIKTILMGISQSQY  479

Query  1708  IRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +R+ RR  + +RHF VN P KRYDV +MI+HS WLRRLN+R+
Sbjct  480   LRMHRRVKLVQRHFVVNGPSKRYDVFNMIVHSIWLRRLNIRI  521



>ref|XP_009782027.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X4 
[Nicotiana sylvestris]
Length=523

 Score =   510 bits (1313),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 241/402 (60%), Positives = 300/402 (75%), Gaps = 7/402 (2%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHG---INQTDDHDYVPTGPVYWNAN  813
             E G      + + +  LER+EA L K+R++IR A      I+   D DYVP GP+Y NAN
Sbjct  124   EHGNNATAGVLKMYSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNAN  183

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPF-RTRDPEKAH  990
              FHRSYLEMEK FK +VYEEGEPP+FHNGPC+SIY++EG FI+ ME   F RT DP++A 
Sbjct  184   SFHRSYLEMEKSFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAM  243

Query  991   VFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLAC  1170
             V+FLP S+  +VH++Y    H+      +  TV+DY+ +++ ++ +WNRSLGADHFML+C
Sbjct  244   VYFLPFSVVVMVHYLYVPGAHDMH---TIGTTVADYVKVISSRHTFWNRSLGADHFMLSC  300

Query  1171  HDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR  1350
             HDWGP  +  VP LF NSIR LCNANTSEGF P KDVS+PEI L  G + GL+GGPSPS 
Sbjct  301   HDWGPHSTSYVPHLFNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPST  360

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             RSILAFFAGGLHG IR  LLE W+ KD +V V+  LP+G SY  ML+ +KFC+CPSGYEV
Sbjct  361   RSILAFFAGGLHGNIRHHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEV  420

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPR+VEA+Y  C+PVLI D YV PFSDVLNWKSFSV V V+DIPN+KKIL  ISQ +Y+
Sbjct  421   ASPRIVEAIYAECIPVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYL  480

Query  1711  RLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             R+ RR    +RHF +N PPKR+D+ HMI+HS WLRRLN+R+H
Sbjct  481   RMHRRVKQVQRHFMINGPPKRFDLFHMIVHSIWLRRLNIRVH  522



>ref|XP_009622709.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
tomentosiformis]
Length=524

 Score =   509 bits (1312),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 242/402 (60%), Positives = 300/402 (75%), Gaps = 7/402 (2%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHG---INQTDDHDYVPTGPVYWNAN  813
             E G      + + +  LER+EA L KAR++IR A      I+   D DYVP GP+Y NAN
Sbjct  125   EHGNNATAGVVKMYSRLERVEAILAKARSSIREAARNGSMISSHQDPDYVPQGPMYHNAN  184

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPF-RTRDPEKAH  990
              FHRSYLEMEK FK +VYEEGEPP+FHNGPC+SIY++EG FI+ ME   F RT+DP++A 
Sbjct  185   SFHRSYLEMEKNFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTKDPDEAM  244

Query  991   VFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLAC  1170
             V+FLP S+  +VH++Y    H+      +  TV+DY+ +++ ++ +WNRSLGADHFML+C
Sbjct  245   VYFLPFSVVVMVHYLYVPGAHDMH---TIGTTVADYVKVISSRHTFWNRSLGADHFMLSC  301

Query  1171  HDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR  1350
             HDWGP  +  VP LF NSIR LCNANTSEGF P KDVS+PEI L  G + GLIGGPSPS 
Sbjct  302   HDWGPRSTSYVPHLFNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLIGGPSPST  361

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             RSILAFFAGGLHG IR  LL+ W+ KD DV V+  LP+  SY  ML+K+KFC+CPSGYEV
Sbjct  362   RSILAFFAGGLHGNIRHHLLKQWKGKDEDVLVYEKLPRSKSYESMLKKSKFCLCPSGYEV  421

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPR+VEA+Y  C+PVLI D YV PFSDVLNWKSFSV V V+DIPN+KKIL  ISQ +Y+
Sbjct  422   ASPRVVEAIYAECIPVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYL  481

Query  1711  RLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             R+ RR    +RHF +N PPKR+D+ HM +HS WLRRLN+R+H
Sbjct  482   RMHRRVKQVQRHFVINGPPKRFDLFHMTVHSIWLRRLNIRVH  523



>ref|XP_009782026.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X3 
[Nicotiana sylvestris]
Length=524

 Score =   509 bits (1311),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 241/402 (60%), Positives = 300/402 (75%), Gaps = 7/402 (2%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHG---INQTDDHDYVPTGPVYWNAN  813
             E G      + + +  LER+EA L K+R++IR A      I+   D DYVP GP+Y NAN
Sbjct  125   EHGNNATAGVLKMYSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNAN  184

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPF-RTRDPEKAH  990
              FHRSYLEMEK FK +VYEEGEPP+FHNGPC+SIY++EG FI+ ME   F RT DP++A 
Sbjct  185   SFHRSYLEMEKSFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAM  244

Query  991   VFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLAC  1170
             V+FLP S+  +VH++Y    H+      +  TV+DY+ +++ ++ +WNRSLGADHFML+C
Sbjct  245   VYFLPFSVVVMVHYLYVPGAHDMH---TIGTTVADYVKVISSRHTFWNRSLGADHFMLSC  301

Query  1171  HDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR  1350
             HDWGP  +  VP LF NSIR LCNANTSEGF P KDVS+PEI L  G + GL+GGPSPS 
Sbjct  302   HDWGPHSTSYVPHLFNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPST  361

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             RSILAFFAGGLHG IR  LLE W+ KD +V V+  LP+G SY  ML+ +KFC+CPSGYEV
Sbjct  362   RSILAFFAGGLHGNIRHHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEV  421

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPR+VEA+Y  C+PVLI D YV PFSDVLNWKSFSV V V+DIPN+KKIL  ISQ +Y+
Sbjct  422   ASPRIVEAIYAECIPVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYL  481

Query  1711  RLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             R+ RR    +RHF +N PPKR+D+ HMI+HS WLRRLN+R+H
Sbjct  482   RMHRRVKQVQRHFMINGPPKRFDLFHMIVHSIWLRRLNIRVH  523



>ref|XP_006447859.1| hypothetical protein CICLE_v10017948mg [Citrus clementina]
 gb|ESR61099.1| hypothetical protein CICLE_v10017948mg [Citrus clementina]
Length=524

 Score =   509 bits (1311),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 252/445 (57%), Positives = 322/445 (72%), Gaps = 19/445 (4%)
 Frame = +1

Query  523   INSSTSPLHFESQEIQQPDIQKEENLNisssipsiisssNETGTPLQVTIKRKFRNLERL  702
             +N S+S     ++ IQ   +Q++E L  S          NE+   ++    +K+  LER+
Sbjct  92    VNGSSSGFFVANESIQL--VQEQEKLKHS----------NESDEEVRTDAVKKYNKLERV  139

Query  703   EANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEE  873
             EA+L +AR++IR A    N T  H   DYVP GP+Y NAN FHRSYL MEK FKI+VYEE
Sbjct  140   EASLVRARSSIREAALVRNLTSVHQDPDYVPRGPIYRNANAFHRSYLLMEKLFKIYVYEE  199

Query  874   GEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRSV  1050
             GEPP+FH+GPCKSIY++EG FI+ ME S  ++T+DPEKA V+FLP S+  +V  +Y    
Sbjct  200   GEPPMFHDGPCKSIYSTEGRFIHEMERSNMYKTKDPEKALVYFLPFSVVMMVEHLYVPGA  259

Query  1051  HNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIR  1230
             H       + +++ DYI++++ KY +WNRSLGADHFML+CHDWGP  S  VP LF+NSIR
Sbjct  260   HEIN---AIGRSIVDYISIISHKYPFWNRSLGADHFMLSCHDWGPRSSSFVPHLFRNSIR  316

Query  1231  ALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILL  1410
              LCNANTSEGF P KD S+PEI L  G + GLIGGPSPSRRSILAFFAG LHG IR +LL
Sbjct  317   VLCNANTSEGFNPVKDASLPEINLLTGEVTGLIGGPSPSRRSILAFFAGRLHGHIRHLLL  376

Query  1411  EHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKD  1590
             ++W+NKD DVQV+  LP  +SY  MLRK+KFC+CPSGYEVASPR+VEA+Y+ CVPVLI D
Sbjct  377   DNWKNKDQDVQVYDKLPNNVSYNSMLRKSKFCLCPSGYEVASPRVVEAIYSECVPVLISD  436

Query  1591  HYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPK  1770
              +V PFSDVLNW +FSV++ V+DIP +K+IL GISQR+Y+R+QRR    +RHF  N   K
Sbjct  437   SFVPPFSDVLNWNAFSVQIDVKDIPKIKEILKGISQRQYLRMQRRVKQVQRHFVANQSLK  496

Query  1771  RYDVTHMILHSAWLRRLNVRLHGIE  1845
             R+DV HM +HS WLRRLN+ +   E
Sbjct  497   RFDVFHMTVHSVWLRRLNIHIRDFE  521



>ref|XP_006469477.1| PREDICTED: probable glycosyltransferase At5g03795-like [Citrus 
sinensis]
Length=524

 Score =   509 bits (1310),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 252/445 (57%), Positives = 322/445 (72%), Gaps = 19/445 (4%)
 Frame = +1

Query  523   INSSTSPLHFESQEIQQPDIQKEENLNisssipsiisssNETGTPLQVTIKRKFRNLERL  702
             +N S+S     ++ IQ   +Q++E L  S          NE+   ++    +K+  LER+
Sbjct  92    VNGSSSGFFVANESIQL--VQEQEKLKHS----------NESDEEVRTDAVKKYNKLERV  139

Query  703   EANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEE  873
             EA+L +AR++IR A    N T  H   DYVP GP+Y NAN FHRSYL MEK FKI+VYEE
Sbjct  140   EASLVRARSSIREAALVRNLTSVHQDPDYVPRGPIYRNANAFHRSYLLMEKLFKIYVYEE  199

Query  874   GEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRSV  1050
             GEPP+FH+GPCKSIY++EG FI+ ME S  ++T+DPEKA V+FLP S+  +V  +Y    
Sbjct  200   GEPPMFHDGPCKSIYSTEGRFIHEMERSNMYKTKDPEKALVYFLPFSVVMMVAHLYVPGA  259

Query  1051  HNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIR  1230
             H       + +++ DYI++++ KY +WNRSLGADHFML+CHDWGP  S  VP LF+NSIR
Sbjct  260   HEIN---AIGRSIVDYISIISHKYPFWNRSLGADHFMLSCHDWGPRSSSFVPHLFRNSIR  316

Query  1231  ALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILL  1410
              LCNANTSEGF P KD S+PEI L  G + GLIGGPSPSRRSILAFFAG LHG IR +LL
Sbjct  317   VLCNANTSEGFNPVKDASLPEINLLTGEVTGLIGGPSPSRRSILAFFAGRLHGHIRHLLL  376

Query  1411  EHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKD  1590
             ++W+NKD DVQV+  LP  +SY  MLRK+KFC+CPSGYEVASPR+VEA+Y+ CVPVLI D
Sbjct  377   DNWKNKDQDVQVYDKLPNNVSYNSMLRKSKFCLCPSGYEVASPRVVEAIYSECVPVLISD  436

Query  1591  HYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPK  1770
              +V PFSDVLNW +FSV++ V+DIP +K+IL GISQR+Y+R+QRR    +RHF  N   K
Sbjct  437   SFVPPFSDVLNWNAFSVQIDVKDIPKIKEILKGISQRQYLRMQRRVKQVQRHFVANQSLK  496

Query  1771  RYDVTHMILHSAWLRRLNVRLHGIE  1845
             R+DV HM +HS WLRRLN+ +   E
Sbjct  497   RFDVFHMTVHSVWLRRLNIHIRDFE  521



>ref|XP_009782024.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana sylvestris]
Length=553

 Score =   509 bits (1312),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 241/402 (60%), Positives = 300/402 (75%), Gaps = 7/402 (2%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHG---INQTDDHDYVPTGPVYWNAN  813
             E G      + + +  LER+EA L K+R++IR A      I+   D DYVP GP+Y NAN
Sbjct  154   EHGNNATAGVLKMYSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNAN  213

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPF-RTRDPEKAH  990
              FHRSYLEMEK FK +VYEEGEPP+FHNGPC+SIY++EG FI+ ME   F RT DP++A 
Sbjct  214   SFHRSYLEMEKSFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAM  273

Query  991   VFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLAC  1170
             V+FLP S+  +VH++Y    H+      +  TV+DY+ +++ ++ +WNRSLGADHFML+C
Sbjct  274   VYFLPFSVVVMVHYLYVPGAHDMH---TIGTTVADYVKVISSRHTFWNRSLGADHFMLSC  330

Query  1171  HDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR  1350
             HDWGP  +  VP LF NSIR LCNANTSEGF P KDVS+PEI L  G + GL+GGPSPS 
Sbjct  331   HDWGPHSTSYVPHLFNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPST  390

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             RSILAFFAGGLHG IR  LLE W+ KD +V V+  LP+G SY  ML+ +KFC+CPSGYEV
Sbjct  391   RSILAFFAGGLHGNIRHHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEV  450

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPR+VEA+Y  C+PVLI D YV PFSDVLNWKSFSV V V+DIPN+KKIL  ISQ +Y+
Sbjct  451   ASPRIVEAIYAECIPVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYL  510

Query  1711  RLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             R+ RR    +RHF +N PPKR+D+ HMI+HS WLRRLN+R+H
Sbjct  511   RMHRRVKQVQRHFMINGPPKRFDLFHMIVHSIWLRRLNIRVH  552



>ref|XP_009782025.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana sylvestris]
Length=549

 Score =   509 bits (1311),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 241/402 (60%), Positives = 300/402 (75%), Gaps = 7/402 (2%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHG---INQTDDHDYVPTGPVYWNAN  813
             E G      + + +  LER+EA L K+R++IR A      I+   D DYVP GP+Y NAN
Sbjct  150   EHGNNATAGVLKMYSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNAN  209

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPF-RTRDPEKAH  990
              FHRSYLEMEK FK +VYEEGEPP+FHNGPC+SIY++EG FI+ ME   F RT DP++A 
Sbjct  210   SFHRSYLEMEKSFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAM  269

Query  991   VFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLAC  1170
             V+FLP S+  +VH++Y    H+      +  TV+DY+ +++ ++ +WNRSLGADHFML+C
Sbjct  270   VYFLPFSVVVMVHYLYVPGAHDMH---TIGTTVADYVKVISSRHTFWNRSLGADHFMLSC  326

Query  1171  HDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR  1350
             HDWGP  +  VP LF NSIR LCNANTSEGF P KDVS+PEI L  G + GL+GGPSPS 
Sbjct  327   HDWGPHSTSYVPHLFNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPST  386

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             RSILAFFAGGLHG IR  LLE W+ KD +V V+  LP+G SY  ML+ +KFC+CPSGYEV
Sbjct  387   RSILAFFAGGLHGNIRHHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEV  446

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPR+VEA+Y  C+PVLI D YV PFSDVLNWKSFSV V V+DIPN+KKIL  ISQ +Y+
Sbjct  447   ASPRIVEAIYAECIPVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYL  506

Query  1711  RLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             R+ RR    +RHF +N PPKR+D+ HMI+HS WLRRLN+R+H
Sbjct  507   RMHRRVKQVQRHFMINGPPKRFDLFHMIVHSIWLRRLNIRVH  548



>ref|XP_008237734.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=415

 Score =   504 bits (1297),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 241/399 (60%), Positives = 300/399 (75%), Gaps = 9/399 (2%)
 Frame = +1

Query  652   TPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFH  822
             T    TIKR +  LE+LEANL   RA+IR A    N T  H   DYVP GP+Y NAN FH
Sbjct  16    TSASTTIKR-YSRLEKLEANLAGVRASIREAARVRNLTSTHEDPDYVPKGPIYRNANAFH  74

Query  823   RSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVF  996
             RSYLEME+ FKI+VYEEG+PP+FHNGPCKSIY++EG FI+ ME   + +RTRDP++A V+
Sbjct  75    RSYLEMERLFKIYVYEEGDPPIFHNGPCKSIYSTEGRFIHEMEMDNNIYRTRDPDEALVY  134

Query  997   FLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHD  1176
             FLP S+  +V ++Y    HN +    + + V DY+N+++ K+ +WNRSLGADHFML+CHD
Sbjct  135   FLPFSVVMLVQYLYAADSHNTD---SIGRAVIDYVNVISDKHPFWNRSLGADHFMLSCHD  191

Query  1177  WGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRS  1356
             WGP  S  VP L+  SIR LCNANTSEGF PSKD S PEI L  G + GL+GG SPSRRS
Sbjct  192   WGPRTSSYVPHLYHKSIRVLCNANTSEGFNPSKDASFPEIHLRTGEIKGLLGGLSPSRRS  251

Query  1357  ILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVAS  1536
             ILAFFAG LHG IR +LL  W+ KD DVQV+  LP G+SY  ML+K++FC+CPSGYEVA+
Sbjct  252   ILAFFAGRLHGHIRYLLLNEWKEKDQDVQVYDQLPHGVSYESMLKKSRFCLCPSGYEVAN  311

Query  1537  PRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRL  1716
             PR+VEA+Y  C+PVLI D YV PFSDVL+WKSFSV++ V+DIPN+K IL GISQ +Y+R+
Sbjct  312   PRVVEAIYAECIPVLISDSYVPPFSDVLDWKSFSVQIQVKDIPNIKTILMGISQSQYLRM  371

Query  1717  QRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              RR    +RHF VN P KR+DV +MI+HS WLRRLN+ +
Sbjct  372   HRRVKQVQRHFVVNGPSKRFDVFNMIVHSIWLRRLNIHI  410



>ref|XP_007049438.1| Catalytic, putative [Theobroma cacao]
 gb|EOX93595.1| Catalytic, putative [Theobroma cacao]
Length=545

 Score =   508 bits (1308),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 242/397 (61%), Positives = 300/397 (76%), Gaps = 8/397 (2%)
 Frame = +1

Query  670   IKRKFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYLEM  840
             + +++  LERLEANL +AR++I+ A    N T    +HDYVP GP+Y N+N FHRSYLEM
Sbjct  150   VVKRYSKLERLEANLARARSSIKEAALVRNLTSIHQNHDYVPHGPIYRNSNAFHRSYLEM  209

Query  841   EKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPF-RTRDPEKAHVFFLPISIT  1017
             EK FKI+VY+EGEPP+FHNGPC+SIY+SEG FI+ +E   F RT+DP++A V+FLP S+ 
Sbjct  210   EKLFKIYVYQEGEPPIFHNGPCRSIYSSEGRFIHELEKGKFYRTQDPDEALVYFLPFSVV  269

Query  1018  AIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
              +VH++YD    + +    + + V DYI+++A K+ YWNRSLGADH ML+CHDWGP  S 
Sbjct  270   MLVHYLYDPETFDTD---AIGRAVVDYIDVIASKHPYWNRSLGADHVMLSCHDWGPRASS  326

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAG  1377
              VP L+  SIR LCNANTSEGF P+KD S PEI L  G + GL+GGPSPSRRSILAFFAG
Sbjct  327   YVPHLYHKSIRVLCNANTSEGFNPAKDASFPEINLLTGDVEGLLGGPSPSRRSILAFFAG  386

Query  1378  GLHGPIRPILLEHWENK-DNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
              LHG IR +LL  W++K D DVQV   LPKG+SY   L+ ++FC+CPSGYEVASPR+VEA
Sbjct  387   RLHGYIRYLLLNEWKDKRDPDVQVFDQLPKGVSYMSKLKNSRFCLCPSGYEVASPRIVEA  446

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             +Y  CVPVLI D YV PFSDVLNW SFSV+V  +DIPN+KKIL  ISQRRY+R+QRR   
Sbjct  447   IYAECVPVLISDSYVPPFSDVLNWNSFSVQVAAKDIPNIKKILMSISQRRYLRMQRRVKQ  506

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIE  1845
              +RHF VN  PKRYDV HMI HS WLRRLN+ +   +
Sbjct  507   VQRHFVVNATPKRYDVFHMITHSIWLRRLNIHVQDFD  543



>ref|XP_010923285.1| PREDICTED: probable glycosyltransferase At5g03795 [Elaeis guineensis]
Length=522

 Score =   506 bits (1304),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 239/391 (61%), Positives = 299/391 (76%), Gaps = 8/391 (2%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQ--TDDHDYVPTGPVYWNANVFHRSYLEMEK  846
             +RK   LERLE  L +ARAAIR  V   N+    D DYVP GP Y NA  FHRSYLEMEK
Sbjct  134   RRKDIKLERLELGLARARAAIREDVQNSNRPALADKDYVPIGPAYRNAYAFHRSYLEMEK  193

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAI  1023
               K++VY EGEPP+FH+GPC SIY++EG FI  M+  +  RTRDP++AHVFFLP S+  +
Sbjct  194   LLKVYVYGEGEPPIFHDGPCLSIYSTEGLFINSMDMENRLRTRDPDRAHVFFLPFSVVRM  253

Query  1024  VHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             V  +Y R   ++    P+++TV DYI++++ KY YWNRSLGADHFML+CHDWGP  S   
Sbjct  254   VQHIYQR---DRRDMSPLRRTVRDYIDVISRKYPYWNRSLGADHFMLSCHDWGPYASGGH  310

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
               LF NSIR LCNANTSEGF P KDVS+PE+ +    ++  +GGPS S R ILAFFAGG 
Sbjct  311   SHLFFNSIRVLCNANTSEGFNPLKDVSLPEMNMRSAVVN--VGGPSASGRPILAFFAGGN  368

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HGP+RP+L++HW++KD D+QVH YLP+G+SY ++++K+KFC+CPSGYEVASPR++EA+Y 
Sbjct  369   HGPVRPVLIKHWKDKDKDIQVHEYLPQGVSYIDLMKKSKFCLCPSGYEVASPRIMEAIYL  428

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
              CVPV I DHYV P SDVLNWK+FSV+V VEDIPNLK IL  IS R+YIR+QRR  I +R
Sbjct  429   ECVPVTINDHYVLPLSDVLNWKAFSVQVSVEDIPNLKNILMSISPRQYIRMQRRVKIVQR  488

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             HF +N PPKR+D+ HM+LHS WLRRLNV +H
Sbjct  489   HFMLNSPPKRFDLYHMLLHSVWLRRLNVHIH  519



>ref|XP_011009812.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Populus euphratica]
Length=510

 Score =   505 bits (1301),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 244/403 (61%), Positives = 300/403 (74%), Gaps = 8/403 (2%)
 Frame = +1

Query  640   NETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNA  810
             N  G   +  +KR  + LE++EANL K R++IR A    N T   +D DYVP GP+Y NA
Sbjct  111   NGEGAVARGVVKRHSK-LEKMEANLAKIRSSIREAARVRNLTSIYEDPDYVPKGPIYRNA  169

Query  811   NVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS-PFRTRDPEKA  987
             N FHRSYLEMEK FKI++Y+EG+PP+FH+GPCKSIY+SEG FI+ +E    F T DP+KA
Sbjct  170   NAFHRSYLEMEKLFKIYIYKEGDPPMFHDGPCKSIYSSEGRFIHELEKGKSFTTTDPDKA  229

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
              V+FLP S+  +V ++Y    H  +    +  TV DYI ++A KY +WNRSLGADHF+L+
Sbjct  230   LVYFLPFSVVMLVQYLYVPGSHEID---AIGNTVVDYIKVIADKYPFWNRSLGADHFILS  286

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
             CHDWGP  S  VP LF NSIR LCNANTSEGF P KD S PEI L  G + GL+GGPSPS
Sbjct  287   CHDWGPRTSSYVPHLFNNSIRVLCNANTSEGFNPKKDASFPEIHLRTGEITGLVGGPSPS  346

Query  1348  RRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
             RRSILAFFAG LHG IR +LLE W++KD D+QVH  L  G+SY  ML+ ++FC+CPSGYE
Sbjct  347   RRSILAFFAGRLHGHIRRLLLEQWKDKDQDMQVHDQLRNGMSYDSMLKNSRFCLCPSGYE  406

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA+Y  CVPVLI D YV PFSDVLNWK+FS++V V+DIP LK IL GISQR+Y
Sbjct  407   VASPRIVEAIYAECVPVLISDGYVPPFSDVLNWKAFSIQVQVKDIPKLKDILMGISQRQY  466

Query  1708  IRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             +R+QRR    +RHF VN  PKR+D  HM +HS WLRRLN+R+H
Sbjct  467   LRMQRRVKQVQRHFVVNGLPKRFDEFHMTIHSIWLRRLNIRIH  509



>gb|EYU41560.1| hypothetical protein MIMGU_mgv1a005355mg [Erythranthe guttata]
Length=487

 Score =   504 bits (1298),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 234/389 (60%), Positives = 296/389 (76%), Gaps = 4/389 (1%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVY  867
             NL+ +EA+L KAR  +  A      + D DYVP G +Y NAN FHRSYLEMEK FKI+VY
Sbjct  102   NLDMVEASLAKARETMHQARLNNETSFDPDYVPEGSIYRNANAFHRSYLEMEKLFKIYVY  161

Query  868   EEGEPPVFHNGPCKSIYASEGNFIYHMETSPFRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
             E+G+PP+FH    K I   EG  I+ +E S FRTRDP KAHV+F+P+S+ +I  + Y   
Sbjct  162   EDGDPPLFHYSKSKGILGIEGILIHQIEISKFRTRDPGKAHVYFIPLSVQSIATYAY--V  219

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
             +HN+  W P++    DY+ L++ KY +WN++LG DHF+L CHDW P IS  VP LFKNSI
Sbjct  220   IHNRA-WSPLQNIARDYVKLISTKYPHWNQTLGRDHFILGCHDWTPTISHGVPLLFKNSI  278

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPIL  1407
             R LCNANTSEGFKPS DVS+PEI LP GTM GLIGGP PS RSIL F+AGG+HGPIR +L
Sbjct  279   RVLCNANTSEGFKPSIDVSMPEIYLPEGTMDGLIGGPPPSDRSILVFYAGGVHGPIRQML  338

Query  1408  LEHW-ENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLI  1584
             ++ W +NKD +VQ+H YLPK +SYY++ R++K+CICPSG+EVASPRMVEALY GCVPVL+
Sbjct  339   MDQWKDNKDPEVQIHEYLPKNMSYYDVFRRSKYCICPSGWEVASPRMVEALYMGCVPVLL  398

Query  1585  KDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLP  1764
             K+ Y  PF DVL+W +F+V+V V++I +LKKIL GIS  +Y+ +QR G+  RRHFEVN P
Sbjct  399   KESYAKPFDDVLDWSTFAVDVRVDEIRDLKKILMGISTEKYVEMQREGIRVRRHFEVNFP  458

Query  1765  PKRYDVTHMILHSAWLRRLNVRLHGIEDT  1851
             PKRYDV HM+LHS WLRR+NV+LH   +T
Sbjct  459   PKRYDVFHMVLHSIWLRRINVQLHDAHET  487



>ref|XP_011009813.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Populus euphratica]
Length=381

 Score =   497 bits (1279),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 238/383 (62%), Positives = 290/383 (76%), Gaps = 7/383 (2%)
 Frame = +1

Query  700   LEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYE  870
             +EANL K R++IR A    N T   +D DYVP GP+Y NAN FHRSYLEMEK FKI++Y+
Sbjct  1     MEANLAKIRSSIREAARVRNLTSIYEDPDYVPKGPIYRNANAFHRSYLEMEKLFKIYIYK  60

Query  871   EGEPPVFHNGPCKSIYASEGNFIYHMETS-PFRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
             EG+PP+FH+GPCKSIY+SEG FI+ +E    F T DP+KA V+FLP S+  +V ++Y   
Sbjct  61    EGDPPMFHDGPCKSIYSSEGRFIHELEKGKSFTTTDPDKALVYFLPFSVVMLVQYLYVPG  120

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
              H  +    +  TV DYI ++A KY +WNRSLGADHF+L+CHDWGP  S  VP LF NSI
Sbjct  121   SHEID---AIGNTVVDYIKVIADKYPFWNRSLGADHFILSCHDWGPRTSSYVPHLFNNSI  177

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPIL  1407
             R LCNANTSEGF P KD S PEI L  G + GL+GGPSPSRRSILAFFAG LHG IR +L
Sbjct  178   RVLCNANTSEGFNPKKDASFPEIHLRTGEITGLVGGPSPSRRSILAFFAGRLHGHIRRLL  237

Query  1408  LEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIK  1587
             LE W++KD D+QVH  L  G+SY  ML+ ++FC+CPSGYEVASPR+VEA+Y  CVPVLI 
Sbjct  238   LEQWKDKDQDMQVHDQLRNGMSYDSMLKNSRFCLCPSGYEVASPRIVEAIYAECVPVLIS  297

Query  1588  DHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPP  1767
             D YV PFSDVLNWK+FS++V V+DIP LK IL GISQR+Y+R+QRR    +RHF VN  P
Sbjct  298   DGYVPPFSDVLNWKAFSIQVQVKDIPKLKDILMGISQRQYLRMQRRVKQVQRHFVVNGLP  357

Query  1768  KRYDVTHMILHSAWLRRLNVRLH  1836
             KR+D  HM +HS WLRRLN+R+H
Sbjct  358   KRFDEFHMTIHSIWLRRLNIRIH  380



>ref|XP_006845223.1| hypothetical protein AMTR_s00005p00255230 [Amborella trichopoda]
 gb|ERN06898.1| hypothetical protein AMTR_s00005p00255230 [Amborella trichopoda]
Length=384

 Score =   497 bits (1279),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 242/385 (63%), Positives = 296/385 (77%), Gaps = 8/385 (2%)
 Frame = +1

Query  697   RLEANLGKARAAIR-AAVHGINQT---DDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFV  864
             +LEA L KARAAIR A +   N+T   D  DY P G +Y N+  FHRSYLEMEK+FKIFV
Sbjct  2     KLEAGLSKARAAIREATLSHRNRTPIEDPDDYAPKGGIYRNSYAFHRSYLEMEKRFKIFV  61

Query  865   YEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVHFVYD  1041
             YEEGEPP+ HNGPCKSIY+SEG FI+ M   + FRTR  E+AHV FLP S+ A++ FVY 
Sbjct  62    YEEGEPPLVHNGPCKSIYSSEGIFIHEMVLGNRFRTRSQERAHVHFLPFSVVAMIQFVYT  121

Query  1042  RSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKN  1221
              S  +     P+K  V+DYI++++ KY YWN+SLGADHFML+CHDWGP  S A P L KN
Sbjct  122   PSSFD---LYPVKNLVADYIDVISKKYHYWNQSLGADHFMLSCHDWGPHTSAANPLLNKN  178

Query  1222  SIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRP  1401
             SIR LCNAN+SE F P +DV +PEI +P G++ G++GG  PS R+ILAFFAGG+HG IR 
Sbjct  179   SIRVLCNANSSEDFYPQRDVPLPEINIPSGSIEGMLGGLRPSARTILAFFAGGVHGWIRS  238

Query  1402  ILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVL  1581
             ILL+HW+NKD D+Q   YLP  +SY++MLRK+KFC+CPSGYEVASPR+VEA+Y  CVPV+
Sbjct  239   ILLQHWKNKDPDIQAFEYLPHDLSYWDMLRKSKFCLCPSGYEVASPRLVEAIYAECVPVI  298

Query  1582  IKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNL  1761
             I DHYV PFSDVLNW SFSVEV V +I  LK+IL GIS  +Y+R+QRR    +RHF VN 
Sbjct  299   ISDHYVLPFSDVLNWASFSVEVKVGEIERLKEILEGISMEKYVRMQRRVKQVQRHFVVNE  358

Query  1762  PPKRYDVTHMILHSAWLRRLNVRLH  1836
             PPKRYDV HM++HS WLRRLN++LH
Sbjct  359   PPKRYDVFHMVIHSVWLRRLNLKLH  383



>emb|CBI28483.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   498 bits (1282),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 237/391 (61%), Positives = 298/391 (76%), Gaps = 7/391 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFHRSYLEMEK  846
             +++  LERLEA L +AR++IR A    +    H   DYVP GP+Y NAN FHRSYLEMEK
Sbjct  28    KRYSKLERLEAGLARARSSIREAARNGSLKSTHEDPDYVPQGPIYRNANAFHRSYLEMEK  87

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAI  1023
              FKI+VYEEGEPP+FHNGPCKSIY++EG FI+ ME  S +RT DP++A ++FLP S+  +
Sbjct  88    LFKIYVYEEGEPPMFHNGPCKSIYSTEGRFIHEMEKGSVYRTTDPDQALLYFLPFSVVMM  147

Query  1024  VHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             V ++Y   V +      +++TV DYINL++  + +WNRSLGADHFML+CHDWGP  S +V
Sbjct  148   VQYLY---VPDSHEIHAIEKTVIDYINLISHNHPFWNRSLGADHFMLSCHDWGPRASTSV  204

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
             P L+ NSIR LCNANTSEGF PSKDVS PEI L  G M G +GG SPSRR IL FFAG L
Sbjct  205   PYLYNNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGEMSGPLGGLSPSRRPILGFFAGRL  264

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HG IR +LLE W++KD D+QV+  LP G+SY  ML+K++FC+CPSGYEVASPR+VEA+Y 
Sbjct  265   HGHIRYLLLEQWKDKDKDLQVYDQLPNGLSYDSMLKKSRFCLCPSGYEVASPRVVEAIYA  324

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
              CVPVLI D+YV PF+DVLNWKSF+V+V V DI N+K+IL GISQ +Y+R+ RR    +R
Sbjct  325   ECVPVLISDNYVPPFNDVLNWKSFAVQVQVRDIANIKRILMGISQTQYLRMYRRVKQVQR  384

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             HF VN  P+R+DV HM +HS WLRRLN+R+ 
Sbjct  385   HFMVNAAPQRFDVFHMTIHSIWLRRLNIRIQ  415



>ref|XP_007145275.1| hypothetical protein PHAVU_007G225300g [Phaseolus vulgaris]
 gb|ESW17269.1| hypothetical protein PHAVU_007G225300g [Phaseolus vulgaris]
Length=490

 Score =   500 bits (1287),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 244/383 (64%), Positives = 296/383 (77%), Gaps = 11/383 (3%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYE  870
             L+ +E  L +ARAAIR A +G   T D DYVP GP+YWNA  FHRSYLEMEKQFK+F Y 
Sbjct  110   LDNIEIGLAQARAAIREARNGTG-TPDSDYVPKGPMYWNAKAFHRSYLEMEKQFKVFSYG  168

Query  871   EGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
             EGEPPVFHN PCKS Y+ EGNF++ +E +  FRT+DPE+AHVFFLP      V + Y+  
Sbjct  169   EGEPPVFHNAPCKSKYSMEGNFMHAIEMNNHFRTKDPEEAHVFFLPR-----VGYGYEGV  223

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
               +     P+K+T +DY++++A +Y YWNRSLGADHF LACHD     S ++P   KNSI
Sbjct  224   SQDLS---PVKKTATDYVSVIAARYPYWNRSLGADHFTLACHDMCRGTSLSLPTPHKNSI  280

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPIL  1407
             R LCNANTSEGFKP+KDVS PEI L   ++   IGG S S+RSIL FFAGG+HGPI P+L
Sbjct  281   RVLCNANTSEGFKPAKDVSFPEINLKISSIR-FIGGQSASKRSILTFFAGGVHGPIAPVL  339

Query  1408  LEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIK  1587
             L+HWENKD D+Q+ +YLPKGISY+EM+RK+KFC+CPSGYE ASPR+VEA+YTGCVPV I 
Sbjct  340   LKHWENKDEDIQILKYLPKGISYHEMMRKSKFCLCPSGYEGASPRVVEAIYTGCVPVFIS  399

Query  1588  DHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPP  1767
             +H V PFSDVLNWKSFSVEV V+DIPNLK+IL  I  ++YIR+QRR     RHFEV+ PP
Sbjct  400   EHSVPPFSDVLNWKSFSVEVSVKDIPNLKEILMSIPPKQYIRMQRRVEQIGRHFEVHSPP  459

Query  1768  KRYDVTHMILHSAWLRRLNVRLH  1836
             KR+DV HMILHS WLRRLN+ +H
Sbjct  460   KRFDVFHMILHSVWLRRLNLEVH  482



>ref|XP_006357695.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=492

 Score =   499 bits (1286),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 299/392 (76%), Gaps = 6/392 (2%)
 Frame = +1

Query  670   IKRKFRNLERLEANLGKARAAIRAAVHG---INQTDDHDYVPTGPVYWNANVFHRSYLEM  840
             I +++  LERLEA L KAR++IR A      I+   D DYVP GP+Y N N FHRSYLEM
Sbjct  103   IVKRYNRLERLEAILAKARSSIREAARNGSMISNHQDPDYVPQGPIYRNTNAFHRSYLEM  162

Query  841   EKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISIT  1017
             EK+FKI+VYEEGE P+FHNGPC+SIY++EG FIY ME  + +RT+DPE+A V+FLP S+ 
Sbjct  163   EKKFKIYVYEEGELPIFHNGPCRSIYSTEGRFIYEMEKGNMYRTKDPEEALVYFLPFSVV  222

Query  1018  AIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
              +V ++Y     +  H +   +TV+DYI++++ ++++WN SLGADHFML+CHDWGP  + 
Sbjct  223   VMVRYLYVSGGPDSRHVI--GRTVADYIHVISSRHSFWNTSLGADHFMLSCHDWGPHTTS  280

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAG  1377
              VP LF NSIR LCNANT+EGF P KDVS+PEI L      G+IGGPSPSRRS LAFFAG
Sbjct  281   YVPHLFNNSIRVLCNANTTEGFNPQKDVSLPEINLKTDDTIGIIGGPSPSRRSTLAFFAG  340

Query  1378  GLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEAL  1557
             GLHG IR  L++ W+ KD DV V+  LP G SY  ML+ +KFC+CPSGYEVASPR+VEA+
Sbjct  341   GLHGAIRNNLMQQWKGKDQDVLVYEELPPGKSYETMLKNSKFCLCPSGYEVASPRVVEAI  400

Query  1558  YTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIA  1737
             Y  CVPVLI D YV PFSDVLNW +FSV+V VEDIPN+KKIL  ISQ +Y+R+Q+R    
Sbjct  401   YAECVPVLISDGYVPPFSDVLNWNAFSVKVAVEDIPNIKKILMSISQTQYLRMQKRVKQV  460

Query  1738  RRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +RHF +N PPKR+D+ HMI+HS WLRRLN+R+
Sbjct  461   QRHFVMNGPPKRFDLFHMIVHSIWLRRLNIRV  492



>ref|NP_001059081.1| Os07g0188700 [Oryza sativa Japonica Group]
 dbj|BAC83913.1| putative pectin-glucuronyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAD31848.1| putative pectin-glucuronyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF20995.1| Os07g0188700 [Oryza sativa Japonica Group]
 gb|EAZ38963.1| hypothetical protein OsJ_23384 [Oryza sativa Japonica Group]
 dbj|BAG93622.1| unnamed protein product [Oryza sativa Japonica Group]
Length=606

 Score =   503 bits (1295),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 243/400 (61%), Positives = 302/400 (76%), Gaps = 11/400 (3%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYLEME  843
             +R+   LE LE  L KARA IR A+   +      D DYVP GPVY NA  FHRSYLEME
Sbjct  210   RRRDVKLELLELGLAKARATIREAIQNKDNKPPLTDKDYVPVGPVYRNAYAFHRSYLEME  269

Query  844   KQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITA  1020
             K FK+FVYEEGEPPVFH+GPC+SIY++EG FIY ME  +  RTRDP++AHVFFLP S+  
Sbjct  270   KVFKVFVYEEGEPPVFHDGPCRSIYSTEGRFIYAMEMENRMRTRDPDQAHVFFLPFSVVK  329

Query  1021  IVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKA  1200
             +V  +Y+ + H+ +   P+++T+SDYIN+V+ KY +WNRSLGADHFML+CHDWGP +S A
Sbjct  330   MVKMIYEPNSHDMD---PLRRTISDYINVVSTKYPHWNRSLGADHFMLSCHDWGPYVSSA  386

Query  1201  VPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGG  1380
                LF NSIR LCNANTSEGF PS+DVS+PEI L    +   +GGPS S R ILAFFAGG
Sbjct  387   NGHLFSNSIRVLCNANTSEGFDPSRDVSLPEINLRSDVVDRQVGGPSASHRPILAFFAGG  446

Query  1381  LHGPIRPILLEHW-ENKDNDVQVHRYLPK--GISYYEMLRKTKFCICPSGYEVASPRMVE  1551
              HGP+RP+LL+HW + +D D+QV  YLP+  G+SY +M+R+++FC+CPSGYEVASPR+VE
Sbjct  447   DHGPVRPLLLQHWGKGQDADIQVSEYLPRRHGMSYTDMMRRSRFCLCPSGYEVASPRVVE  506

Query  1552  ALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGL  1731
             A+Y  CVPV+I D Y  PF+DVLNW +FSV V V DIP LK+IL  +S R+YIR+QRR  
Sbjct  507   AIYLECVPVVIGDDYTLPFADVLNWAAFSVRVAVGDIPRLKEILAAVSPRQYIRMQRRVR  566

Query  1732  IARRHFEV-NLPPKRYDVTHMILHSAWLRRLNVRLHGIED  1848
               RRHF V +  P+R+DV HMILHS WLRRLNVR+   ED
Sbjct  567   AVRRHFMVSDGAPRRFDVFHMILHSIWLRRLNVRVIARED  606



>ref|XP_008796633.1| PREDICTED: probable glycosyltransferase At5g03795 [Phoenix dactylifera]
Length=499

 Score =   499 bits (1284),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 245/391 (63%), Positives = 299/391 (76%), Gaps = 8/391 (2%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQ--TDDHDYVPTGPVYWNANVFHRSYLEMEK  846
             +RK   LERLE  L +ARAAIR AV   N+    D DYVP GP Y N+  FHRSYLEMEK
Sbjct  111   RRKDTKLERLELGLARARAAIREAVQNSNRPALADKDYVPKGPAYRNSYAFHRSYLEMEK  170

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAI  1023
               K++VYEEGEPP+FH+GPC SIY++EG FI  M+  S  RTRDP++AHVFFLP S+  +
Sbjct  171   LLKVYVYEEGEPPIFHDGPCLSIYSTEGLFINDMDMESRLRTRDPDRAHVFFLPFSVVRM  230

Query  1024  VHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             V  +Y R   ++    P+++TV  YIN ++GKY YWNRSLGADHFML+CHDWGP  S   
Sbjct  231   VQHIYQR---DRRDMSPLRRTVLAYINDISGKYPYWNRSLGADHFMLSCHDWGPYASGGH  287

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
               LF NSIR LCNAN SEGF P KDVS+PE+ +    +   +GGPS S R ILAFFAGG 
Sbjct  288   SHLFLNSIRVLCNANMSEGFNPLKDVSLPEMNMRSAVVD--VGGPSASGRPILAFFAGGN  345

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HGP+RP+LL+HW++KD D+QVH YLPKG+SY +++RK+KFC+CPSGYEVASPR++EA+Y 
Sbjct  346   HGPVRPVLLKHWKDKDKDMQVHEYLPKGVSYVDLMRKSKFCLCPSGYEVASPRIMEAIYL  405

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
              CVPV I DHYV P SDVLNWK+FSV+V VEDIPNLK IL  IS R+YIR+QRR  I +R
Sbjct  406   ECVPVTINDHYVLPLSDVLNWKAFSVQVSVEDIPNLKNILMSISPRQYIRMQRRVKIVQR  465

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             HF +N PPKR+D+ HM+LHS WLRRLNVR+H
Sbjct  466   HFMLNGPPKRFDLYHMLLHSIWLRRLNVRIH  496



>ref|XP_002264076.2| PREDICTED: probable glycosyltransferase At5g03795 [Vitis vinifera]
Length=484

 Score =   498 bits (1282),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 239/391 (61%), Positives = 303/391 (77%), Gaps = 7/391 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIR-AAVHGINQT--DDHDYVPTGPVYWNANVFHRSYLEMEK  846
             +++  LERLEA L +AR++IR AA +G  ++  +D DYVP GP+Y NAN FHRSYLEMEK
Sbjct  96    KRYSKLERLEAGLARARSSIREAARNGSLKSTHEDPDYVPQGPIYRNANAFHRSYLEMEK  155

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAI  1023
              FKI+VYEEGEPP+FHNGPCKSIY++EG FI+ ME  S +RT DP++A ++FLP S+  +
Sbjct  156   LFKIYVYEEGEPPMFHNGPCKSIYSTEGRFIHEMEKGSVYRTTDPDQALLYFLPFSVVMM  215

Query  1024  VHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             V ++Y   V +      +++TV DYINL++  + +WNRSLGADHFML+CHDWGP  S +V
Sbjct  216   VQYLY---VPDSHEIHAIEKTVIDYINLISHNHPFWNRSLGADHFMLSCHDWGPRASTSV  272

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
             P L+ NSIR LCNANTSEGF PSKDVS PEI L  G M G +GG SPSRR IL FFAG L
Sbjct  273   PYLYNNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGEMSGPLGGLSPSRRPILGFFAGRL  332

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HG IR +LLE W++KD D+QV+  LP G+SY  ML+K++FC+CPSGYEVASPR+VEA+Y 
Sbjct  333   HGHIRYLLLEQWKDKDKDLQVYDQLPNGLSYDSMLKKSRFCLCPSGYEVASPRVVEAIYA  392

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
              CVPVLI D+YV PF+DVLNWKSF+V+V V DI N+K+IL GISQ +Y+R+ RR    +R
Sbjct  393   ECVPVLISDNYVPPFNDVLNWKSFAVQVQVRDIANIKRILMGISQTQYLRMYRRVKQVQR  452

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             HF VN  P+R+DV HM +HS WLRRLN+R+ 
Sbjct  453   HFMVNAAPQRFDVFHMTIHSIWLRRLNIRIQ  483



>emb|CDP08577.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   498 bits (1283),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 236/390 (61%), Positives = 299/390 (77%), Gaps = 7/390 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHG---INQTDDHDYVPTGPVYWNANVFHRSYLEMEK  846
             +++  LERLE  L KAR +IR A      I+  +D DYVP GP+Y NAN FHRSYLEMEK
Sbjct  121   KRYNKLERLETMLSKARYSIREAAKNGSMISTHEDADYVPHGPMYINANGFHRSYLEMEK  180

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPF-RTRDPEKAHVFFLPISITAI  1023
              FK++VY+EGEPP+FH+G CKSIY++EG FI+ ME   F RT++P+ A V+FLP S+ A+
Sbjct  181   SFKVYVYQEGEPPMFHDGLCKSIYSTEGRFIHEMEKGNFYRTKNPDDALVYFLPFSVVAM  240

Query  1024  VHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             V ++Y+   H+++    +  T++DYI L++GK+ +WNRSLGADHFML+CHDWGP  +  V
Sbjct  241   VQYLYEPGGHDRQ---AIGHTLADYIGLISGKHPFWNRSLGADHFMLSCHDWGPYSTSYV  297

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
             P+LF NSIR LCNANTSEGF P KDVS+PEI L  G + GLIG PSPSRR ILAFFAG L
Sbjct  298   PQLFNNSIRVLCNANTSEGFNPLKDVSLPEIHLRTGEITGLIGCPSPSRRPILAFFAGRL  357

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HG IR +LLE W+ KD  +QV+  LP G+SY  MLRK+KFC+CPSGYEVASPR+VEA+Y 
Sbjct  358   HGHIRYLLLEQWKEKDQGIQVYDSLPAGVSYESMLRKSKFCLCPSGYEVASPRVVEAIYA  417

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
              C+P+LI D Y  PFSDVLNWKSFSVEV V+DI N+KKILT ISQ +Y R+ RR    +R
Sbjct  418   ECIPILISDSYAPPFSDVLNWKSFSVEVAVKDILNIKKILTSISQTQYRRMHRRLKQVQR  477

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             HF +N PPKR+D+ H I+HS WL+RLN+++
Sbjct  478   HFVINGPPKRFDLFHTIMHSIWLQRLNIQI  507



>ref|XP_004243882.1| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=508

 Score =   497 bits (1280),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 300/392 (77%), Gaps = 6/392 (2%)
 Frame = +1

Query  670   IKRKFRNLERLEANLGKARAAIRAAVHG---INQTDDHDYVPTGPVYWNANVFHRSYLEM  840
             I +++  LER+EA L KAR++IR A      I+  +D DYVP GP+Y N N FHRSYLEM
Sbjct  119   IVKRYNRLERVEAILAKARSSIREAARNGSMISNHEDPDYVPQGPIYRNTNAFHRSYLEM  178

Query  841   EKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISIT  1017
             EK+FKI+VYEEGE P+FHNGPC+SIY++EG FIY ME  + +RT++P++A V+FLP S+ 
Sbjct  179   EKKFKIYVYEEGELPIFHNGPCRSIYSTEGRFIYEMEKGNMYRTKNPDEALVYFLPFSVV  238

Query  1018  AIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
              +V ++Y     +  H +   +TV+DYI++++ ++++WN SLGADHFML+CHDWGP  + 
Sbjct  239   VMVRYLYVSGGPDSRHVI--GRTVADYIHVISSRHSFWNTSLGADHFMLSCHDWGPHTTS  296

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAG  1377
              VP LF NSIR LCNANT+EGF P KDVS+PEI L      G+IGGPSPSRRSILAFFAG
Sbjct  297   YVPHLFNNSIRVLCNANTTEGFNPQKDVSLPEINLKTDDTIGIIGGPSPSRRSILAFFAG  356

Query  1378  GLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEAL  1557
             GLHG IR  L++ W+ KD DV V+  LP G SY  ML+ +KFC+CPSGYEVASPR+VEA+
Sbjct  357   GLHGAIRNNLMQQWKGKDQDVLVYEELPSGESYESMLKNSKFCLCPSGYEVASPRVVEAI  416

Query  1558  YTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIA  1737
             Y  CVPVLI D YV PFSDVLNW +FSV+V VEDIPN+KKIL  ISQ +Y+R+QRR    
Sbjct  417   YAECVPVLISDGYVPPFSDVLNWNAFSVKVAVEDIPNIKKILMSISQTQYLRMQRRVKQV  476

Query  1738  RRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +RHF +N P KR+D+ HMI+HS WLRRLN+R+
Sbjct  477   QRHFVMNGPSKRFDLFHMIVHSIWLRRLNIRV  508



>gb|EAZ03045.1| hypothetical protein OsI_25187 [Oryza sativa Indica Group]
Length=601

 Score =   498 bits (1283),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 243/400 (61%), Positives = 299/400 (75%), Gaps = 11/400 (3%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYLEME  843
             +R+   LERLE  L KARA IR A+   +      D DYVP GPVY NA  FHRSYLEME
Sbjct  205   RRRDVKLERLELGLAKARATIREAIQNKDNKPPLTDKDYVPVGPVYRNAYAFHRSYLEME  264

Query  844   KQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITA  1020
             K FK+FVYEEGEPPVFH+GPC SIY++EG FIY ME  +  RTRDP +AHVFFLP S+  
Sbjct  265   KVFKVFVYEEGEPPVFHDGPCHSIYSTEGRFIYAMEMENRMRTRDPNQAHVFFLPFSVVK  324

Query  1021  IVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKA  1200
             +V  +Y+ + H+ +   P+++T+SDYIN+V+ KY +WNRSLGADHFML+CHDWGP +S A
Sbjct  325   MVKMIYEPNSHDMD---PLRRTISDYINVVSTKYPHWNRSLGADHFMLSCHDWGPYVSSA  381

Query  1201  VPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGG  1380
                LF NSIR LCNANTSEGF PS+DVS+PEI L    +   +GGPS S R ILAFFAGG
Sbjct  382   NGHLFSNSIRVLCNANTSEGFDPSRDVSLPEINLRSDVVARQVGGPSASHRPILAFFAGG  441

Query  1381  LHGPIRPILLEHW-ENKDNDVQVHRYLPK--GISYYEMLRKTKFCICPSGYEVASPRMVE  1551
              HGP+RP+LL+HW + +D D+QV  YLP+   +SY +M+R+++FC+CPSGYEVASPR+VE
Sbjct  442   DHGPVRPLLLQHWGKGQDADIQVSEYLPRRHSMSYTDMMRRSRFCLCPSGYEVASPRVVE  501

Query  1552  ALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGL  1731
             A+Y  CVPV+I D Y  PF+DVLNW +FSV V V DIP LK+IL  +S R+YIR+QRR  
Sbjct  502   AIYLECVPVVIGDDYALPFADVLNWAAFSVRVAVGDIPRLKEILAAVSPRQYIRMQRRVR  561

Query  1732  IARRHFEV-NLPPKRYDVTHMILHSAWLRRLNVRLHGIED  1848
               RRHF V +  P R+DV HMILHS WLRRLNVR+   ED
Sbjct  562   AVRRHFMVSDGAPWRFDVFHMILHSIWLRRLNVRVIARED  601



>ref|XP_010068733.1| PREDICTED: probable glycosyltransferase At5g03795 [Eucalyptus 
grandis]
 gb|KCW89056.1| hypothetical protein EUGRSUZ_A01382 [Eucalyptus grandis]
Length=496

 Score =   494 bits (1272),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 236/396 (60%), Positives = 299/396 (76%), Gaps = 9/396 (2%)
 Frame = +1

Query  664   VTIKRKFRNLERLEANLGKARAAIRAAVHGINQTD---DHDYVPTGPVYWNANVFHRSYL  834
             V   +++   ERLEA+L +AR+AIR A    N T    D DY+P GP+Y NAN FHRSYL
Sbjct  100   VRAVKRYSRFERLEASLSRARSAIREAALVRNLTSVHADADYIPQGPIYRNANAFHRSYL  159

Query  835   EMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPI  1008
             EMEK FKI+VY+EGEPP+FH+GPCKSIY++EG FI+ ME   + +RT  P++A V+FLP 
Sbjct  160   EMEKLFKIYVYQEGEPPMFHDGPCKSIYSTEGRFIHEMERGHNMYRTTGPDEALVYFLPF  219

Query  1009  SITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPE  1188
             S+  +VH++Y+   H       + + V DYI+++A K+ +WNRSLGADHFML+CHDWGP 
Sbjct  220   SVVMLVHYLYEPGSHETH---AIGRAVVDYIDVIAAKHPFWNRSLGADHFMLSCHDWGPR  276

Query  1189  ISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAF  1368
              S  VP LF  SIR LCNANTSEGF P KD S+PEI L  G + GL+GGPSPSRR  LAF
Sbjct  277   TSSYVPNLFSKSIRVLCNANTSEGFDPFKDASLPEINLKTGEIFGLLGGPSPSRRGTLAF  336

Query  1369  FAGGLHGPIRPILLEHWENK-DNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FAG LHG IR +LL+ W++K D DV+V+  LP+G+SY  MLR++++C+CPSGYEVASPR+
Sbjct  337   FAGHLHGHIRYLLLQEWKDKEDPDVRVYDKLPRGVSYESMLRQSRYCLCPSGYEVASPRI  396

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             VEA+Y  CVPVLI D YV PFSDVLNWK+FSV+V V+DIPN+KKIL  IS  +Y+R+QRR
Sbjct  397   VEAIYAECVPVLISDGYVPPFSDVLNWKAFSVQVQVKDIPNIKKILMAISPSQYLRMQRR  456

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
                 +RHF  N PP+RYDV HM +HS WLRRLN+R+
Sbjct  457   VKQVQRHFVANGPPRRYDVFHMTVHSIWLRRLNIRI  492



>ref|XP_010048370.1| PREDICTED: probable glycosyltransferase At3g07620 [Eucalyptus 
grandis]
Length=521

 Score =   494 bits (1273),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 297/392 (76%), Gaps = 9/392 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTD---DHDYVPTGPVYWNANVFHRSYLEMEK  846
             +++   ERLEA+L +AR+AIR A    N T    D DYVP GP+Y NAN FHRSYLEMEK
Sbjct  129   KRYSRFERLEASLSQARSAIREAALVRNLTSVHADADYVPRGPIYRNANAFHRSYLEMEK  188

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPISITA  1020
              FKI+VY+EGEPP+FH+GPCKSIY++EG FI+ ME   + +RT DP++A V+FLP S+  
Sbjct  189   LFKIYVYQEGEPPMFHDGPCKSIYSTEGRFIHEMERGHNMYRTTDPDEALVYFLPFSVVM  248

Query  1021  IVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKA  1200
             +V ++Y+   H       +   V DYI+++A K+ +WNRSLGADHFML+CHDWGP  S  
Sbjct  249   LVQYLYEPGSHETH---AIGHAVVDYIDVIAAKHPFWNRSLGADHFMLSCHDWGPRTSSY  305

Query  1201  VPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGG  1380
             VP LF  SIR LCNANTSEGF P KD S+PEI L  G + GL+GGPSPSRR  LAFFAG 
Sbjct  306   VPNLFSKSIRVLCNANTSEGFDPFKDASLPEINLKTGEIFGLLGGPSPSRRGTLAFFAGR  365

Query  1381  LHGPIRPILLEHWENK-DNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEAL  1557
             LHG IR +LL+ W++K D DV+V+  LP+G+SY  MLR++++C+CPSGYEVASPR+VEA+
Sbjct  366   LHGHIRHLLLQEWKDKEDPDVRVYDELPRGVSYESMLRQSRYCLCPSGYEVASPRIVEAI  425

Query  1558  YTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIA  1737
             Y  CVPVLI D YV PFSDVLNWK+FSV+V V+DIPN+KK+L  IS  +Y+R+QRR    
Sbjct  426   YAECVPVLISDSYVPPFSDVLNWKAFSVQVQVKDIPNIKKLLMAISPSQYLRMQRRVKQV  485

Query  1738  RRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +RHF  N PP+RYDV HM +HS WLRRLN+R+
Sbjct  486   QRHFVANGPPRRYDVFHMTVHSIWLRRLNIRI  517



>ref|XP_008394205.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=519

 Score =   494 bits (1271),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 237/389 (61%), Positives = 294/389 (76%), Gaps = 8/389 (2%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFHRSYLEMEKQFKI  858
              L+++EA+LG+AR++IR A    N+T  H   DYVP GP+Y N N FHRSYLEMEK FKI
Sbjct  133   QLDKVEASLGRARSSIREAALVRNKTSTHQDPDYVPRGPIYRNPNAFHRSYLEMEKVFKI  192

Query  859   FVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFV  1035
             +VYEEGE P+FH+GPC+SIY+SEG FI+ ME    +RT+DP KA V+FLP S+  +V ++
Sbjct  193   YVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGKMYRTKDPHKALVYFLPFSVVNMVQYI  252

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             Y     ++     MK+ V DYINL++ K+ +WNRSLGADHFML+CHDWGP  +  VP+LF
Sbjct  253   YMPETFDRSG---MKRAVVDYINLISHKHPFWNRSLGADHFMLSCHDWGPTTTSFVPDLF  309

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
              NSIR LCNANTSEGF P KD S PEI L    M G IGG  PS+RS LAFFAG LHG I
Sbjct  310   HNSIRVLCNANTSEGFNPLKDASFPEINLKTSEMPG-IGGRPPSKRSTLAFFAGRLHGHI  368

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             R +LL  W+ KD DVQV+  LP+ +SY  ML+ +KFC+CPSGYEVASPR+VEA+Y  CVP
Sbjct  369   RYLLLNEWKGKDQDVQVYDQLPRRVSYENMLKSSKFCLCPSGYEVASPRVVEAIYAECVP  428

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI D YV PFSDVLNWKSFSV++PV++I ++K ILT IS R+Y+R+QRR    +RHF V
Sbjct  429   VLISDGYVPPFSDVLNWKSFSVQIPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLV  488

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             N PPKRYDV HMI+HS WLRRLN+R+  +
Sbjct  489   NGPPKRYDVFHMIVHSIWLRRLNIRIQDV  517



>ref|XP_008227680.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=505

 Score =   493 bits (1268),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 237/398 (60%), Positives = 296/398 (74%), Gaps = 8/398 (2%)
 Frame = +1

Query  661   QVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFHRSY  831
             +   K     L++LEA+LG+AR++IR A    N+T  H   DYVP GP+Y N N FHRSY
Sbjct  110   KTVFKSSSSQLDKLEASLGRARSSIREAAKVRNKTSTHQDPDYVPRGPIYRNPNAFHRSY  169

Query  832   LEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPI  1008
             LEMEK FKI+VYEEGE P+FH+GPC+SIY+SEG FI+ ME  + +RTRDP+KA V+FLP 
Sbjct  170   LEMEKLFKIYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGNMYRTRDPDKALVYFLPF  229

Query  1009  SITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPE  1188
             S+  +V ++Y    +++     MK  + DY+NL+A K+++WNRSLGADHFML+CHDW P 
Sbjct  230   SVVRMVQYMYMPDSNDRHG---MKLAIIDYVNLIAQKHSFWNRSLGADHFMLSCHDWAPL  286

Query  1189  ISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAF  1368
              +  VP LF  SIR LCNANTSEGF PSKD S PEI L    M GL GG SPS RS LAF
Sbjct  287   TTSFVPLLFHKSIRILCNANTSEGFNPSKDASFPEINLKTSEMSGL-GGQSPSTRSTLAF  345

Query  1369  FAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMV  1548
             FAG LHG IR +LL  W+ KD DVQV+  LP G+SY +ML+ +KFC+CPSGYEVASPR+V
Sbjct  346   FAGRLHGHIRSLLLNEWKGKDQDVQVYDKLPPGVSYEKMLKGSKFCLCPSGYEVASPRVV  405

Query  1549  EALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRG  1728
             EA+Y  C+PVLI D Y+ PFSDVL+WKSFSV+VPV++I N+K IL  IS  +Y+R+QRR 
Sbjct  406   EAIYAECIPVLISDGYIPPFSDVLDWKSFSVQVPVKNISNIKNILMSISSGQYLRMQRRV  465

Query  1729  LIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
                +RHF VN PPKRYDV HMI+HS WLRRLN+R+  +
Sbjct  466   KQVQRHFLVNGPPKRYDVFHMIVHSIWLRRLNIRIQDL  503



>gb|KCW89058.1| hypothetical protein EUGRSUZ_A01384 [Eucalyptus grandis]
Length=559

 Score =   494 bits (1273),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 297/392 (76%), Gaps = 9/392 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTD---DHDYVPTGPVYWNANVFHRSYLEMEK  846
             +++   ERLEA+L +AR+AIR A    N T    D DYVP GP+Y NAN FHRSYLEMEK
Sbjct  167   KRYSRFERLEASLSQARSAIREAALVRNLTSVHADADYVPRGPIYRNANAFHRSYLEMEK  226

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPISITA  1020
              FKI+VY+EGEPP+FH+GPCKSIY++EG FI+ ME   + +RT DP++A V+FLP S+  
Sbjct  227   LFKIYVYQEGEPPMFHDGPCKSIYSTEGRFIHEMERGHNMYRTTDPDEALVYFLPFSVVM  286

Query  1021  IVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKA  1200
             +V ++Y+   H       +   V DYI+++A K+ +WNRSLGADHFML+CHDWGP  S  
Sbjct  287   LVQYLYEPGSHETH---AIGHAVVDYIDVIAAKHPFWNRSLGADHFMLSCHDWGPRTSSY  343

Query  1201  VPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGG  1380
             VP LF  SIR LCNANTSEGF P KD S+PEI L  G + GL+GGPSPSRR  LAFFAG 
Sbjct  344   VPNLFSKSIRVLCNANTSEGFDPFKDASLPEINLKTGEIFGLLGGPSPSRRGTLAFFAGR  403

Query  1381  LHGPIRPILLEHWENK-DNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEAL  1557
             LHG IR +LL+ W++K D DV+V+  LP+G+SY  MLR++++C+CPSGYEVASPR+VEA+
Sbjct  404   LHGHIRHLLLQEWKDKEDPDVRVYDELPRGVSYESMLRQSRYCLCPSGYEVASPRIVEAI  463

Query  1558  YTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIA  1737
             Y  CVPVLI D YV PFSDVLNWK+FSV+V V+DIPN+KK+L  IS  +Y+R+QRR    
Sbjct  464   YAECVPVLISDSYVPPFSDVLNWKAFSVQVQVKDIPNIKKLLMAISPSQYLRMQRRVKQV  523

Query  1738  RRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +RHF  N PP+RYDV HM +HS WLRRLN+R+
Sbjct  524   QRHFVANGPPRRYDVFHMTVHSIWLRRLNIRI  555



>ref|XP_009379540.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=540

 Score =   494 bits (1271),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 237/388 (61%), Positives = 291/388 (75%), Gaps = 8/388 (2%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             L+++EA+LG+AR+AIR A    N+T  H   DYVP GP+Y N N FHRSYLEMEK FKI+
Sbjct  155   LDKVEASLGRARSAIREAAKVRNKTSTHQDPDYVPRGPIYHNPNAFHRSYLEMEKVFKIY  214

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPF-RTRDPEKAHVFFLPISITAIVHFVY  1038
             VYEEGE P+FH GPC+ IY+SEG FI+ ME   F RT+DP KA V+FLP S+  +V ++Y
Sbjct  215   VYEEGEVPIFHEGPCRGIYSSEGRFIHEMEKGKFYRTKDPHKALVYFLPFSVVTMVQYIY  274

Query  1039  DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFK  1218
                  ++     MK  V DYINL++ K+ +WNRS GADHFML+CHDWGP  +  VP+LF 
Sbjct  275   MPETFDRNG---MKLAVVDYINLISYKHPFWNRSHGADHFMLSCHDWGPFTTSFVPDLFH  331

Query  1219  NSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIR  1398
             NSIR +CNANTSEGF PSKD S+PEI L    M G IGG  PS+RS LAF+AGGLHG IR
Sbjct  332   NSIRVVCNANTSEGFNPSKDASLPEINLKTSEMSG-IGGQPPSKRSTLAFYAGGLHGHIR  390

Query  1399  PILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPV  1578
              +LL  W+ KD DV V+  LP+G+SY  M + +KFC+CPSGYEVASPR+VEA+Y  CVPV
Sbjct  391   YLLLNEWKGKDQDVLVYDKLPQGMSYENMFKSSKFCLCPSGYEVASPRVVEAIYAECVPV  450

Query  1579  LIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVN  1758
             LI D YV PFSDVLNW SFSV+VPV++I ++K ILT IS R+Y+R+QRR    +RHF VN
Sbjct  451   LISDGYVPPFSDVLNWNSFSVQVPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLVN  510

Query  1759  LPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
              PPKRYDV HMI+HS WLRRLN+R+  I
Sbjct  511   GPPKRYDVFHMIVHSVWLRRLNIRIQDI  538



>ref|XP_009379539.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=521

 Score =   493 bits (1269),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 237/388 (61%), Positives = 294/388 (76%), Gaps = 8/388 (2%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             L+++EA+LG+AR++IR A    N+T  H   DYVP GP+Y N N FHRSYLEMEK FKI+
Sbjct  136   LDKVEASLGRARSSIREAALVRNKTSTHQDPDYVPRGPIYRNPNAFHRSYLEMEKVFKIY  195

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVY  1038
             VYEEGE P+FH+GPC+SIY+SEG FI+ ME    +RT+ P KA V+FLP S+  +V ++Y
Sbjct  196   VYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGQLYRTKAPHKALVYFLPFSVVNMVQYIY  255

Query  1039  DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFK  1218
                 +++     MK  V DYINL++ K+ +WNRSLGADHFML+CHDWGP  +  VP+LF 
Sbjct  256   MPETYDRSG---MKLAVVDYINLISHKHPFWNRSLGADHFMLSCHDWGPTTTSFVPDLFH  312

Query  1219  NSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIR  1398
             NSIR LCNANTSEGF PSKD S PEI L    M GL GG  PS+R  LAFFAG LHG IR
Sbjct  313   NSIRVLCNANTSEGFDPSKDASFPEINLKTSEMPGL-GGQPPSKRYTLAFFAGRLHGHIR  371

Query  1399  PILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPV  1578
              +LL  W+ KD DVQV+  LP+G+SY  ML+ +KFC+CPSGYEVASPR+VEA+Y  CVPV
Sbjct  372   YLLLNEWKGKDQDVQVYDQLPQGVSYENMLKSSKFCLCPSGYEVASPRVVEAIYAECVPV  431

Query  1579  LIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVN  1758
             LI D YV PFSDVLNWKSFSV+VPV++I ++K ILT IS R+Y+R+QRR    +RHF VN
Sbjct  432   LISDGYVPPFSDVLNWKSFSVQVPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLVN  491

Query  1759  LPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
              PPKR+DV HMI+HS WLRRLN+R+  +
Sbjct  492   GPPKRFDVFHMIVHSIWLRRLNIRIQDV  519



>ref|XP_006354423.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=511

 Score =   492 bits (1267),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 233/401 (58%), Positives = 299/401 (75%), Gaps = 7/401 (2%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHG---INQTDDHDYVPTGPVYWNAN  813
             E G      + + +  LERLEA L K+R++IR A      I+   D DYVP GP+Y NAN
Sbjct  112   EHGNNATKGVLKMYSKLERLEAILAKSRSSIREAARNGSMISNHHDPDYVPQGPMYHNAN  171

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAH  990
              FHRSYLEMEK FK++VYEEGEPP+FHNGPC+SIY++EG FI+ ME  S +RT++P++A 
Sbjct  172   AFHRSYLEMEKNFKVYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMERGSLYRTKNPDEAL  231

Query  991   VFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLAC  1170
             V+FLP S+  +V +++    H+      + +TV+DY+ +++ ++++WNRS GADHFML+C
Sbjct  232   VYFLPFSVVVMVQYLFVPGAHDMH---VIGRTVADYVKVISERHSFWNRSRGADHFMLSC  288

Query  1171  HDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR  1350
             HDWGP ++  VP LF  SIR LCNANTSEGF P KDVS+PEI L  G + GLIGGPSPSR
Sbjct  289   HDWGPHLTSYVPHLFNTSIRVLCNANTSEGFNPLKDVSLPEINLKTGDIKGLIGGPSPSR  348

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             RSILAFFAGGLHG IR  LLE W+ KD DV V+  LP   SY  ML+ ++FC+CPSGYEV
Sbjct  349   RSILAFFAGGLHGNIRHHLLEQWKGKDEDVLVYDKLPNDKSYETMLKNSRFCLCPSGYEV  408

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPR+VEA+Y  C+PVLI D YV PFSDVLNW +FSV + V+DIPN+KKIL  ISQ +Y+
Sbjct  409   ASPRIVEAIYAECIPVLISDSYVPPFSDVLNWNAFSVTIGVKDIPNIKKILISISQSQYL  468

Query  1711  RLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             R+ RR    +RHF +N  PKR+D+ HMI+HS WLRRLN+R+
Sbjct  469   RMHRRVKQVQRHFVINGSPKRFDLFHMIVHSIWLRRLNIRV  509



>ref|XP_004955715.1| PREDICTED: probable glycosyltransferase At5g03795-like [Setaria 
italica]
Length=567

 Score =   494 bits (1271),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 239/397 (60%), Positives = 295/397 (74%), Gaps = 16/397 (4%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTD------DHDYVPTGPVYWNANVFHRSYL  834
             +R+   LERLE  L KAR+AI   + GI   D      D DYVP GP+Y NA  FH+SYL
Sbjct  173   RRRDVKLERLELGLAKARSAI---MEGIRNKDNRPPLADKDYVPMGPIYRNAYAFHKSYL  229

Query  835   EMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPIS  1011
             EMEK FK++VYEEGEPPVFH+GPC+SIY++EG FIY ME  S  RTRDP+ AH FFLP S
Sbjct  230   EMEKLFKVYVYEEGEPPVFHDGPCRSIYSTEGRFIYSMEMESRLRTRDPDLAHAFFLPFS  289

Query  1012  ITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEI  1191
             +  +V  +Y+ + H+     P+K+TVSDYI +++ KY YWNRSLGADHFML+CHDWGP +
Sbjct  290   VVKMVKMIYEPNSHDMG---PLKRTVSDYIGVLSTKYPYWNRSLGADHFMLSCHDWGPYV  346

Query  1192  SKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFF  1371
             S A   LF NSIR LCNANTSEGF PSKDVS+PEI L    +   +GGPS SRR ILAFF
Sbjct  347   SSANGHLFGNSIRVLCNANTSEGFNPSKDVSLPEINLRSDVVDRQVGGPSASRRPILAFF  406

Query  1372  AGGLHGPIRPILLEHWENK-DNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMV  1548
             AGG HGP+RP LL HW+ K D DVQV  YLP+G+SY +M+R+++FC+CP GYEVASPR+ 
Sbjct  407   AGGNHGPVRPALLAHWKGKGDPDVQVSEYLPRGVSYTDMMRRSRFCLCPGGYEVASPRLA  466

Query  1549  EALYTGCVPVLIKD-HYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             EA+Y  CVPV+I D  Y  PF+DVLNW +F+V +P  DIP L+++L+ +S R+YIR+QRR
Sbjct  467   EAIYLECVPVVIDDGEYALPFADVLNWDAFAVRLPTADIPRLREVLSAVSPRQYIRMQRR  526

Query  1726  GLIARRHFEVN-LPPKRYDVTHMILHSAWLRRLNVRL  1833
                 RRHF V+   P+RYD  HMILHS WLRRLNVR+
Sbjct  527   VRAVRRHFMVHGGAPRRYDAFHMILHSVWLRRLNVRI  563



>ref|XP_008459522.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
Length=514

 Score =   491 bits (1265),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 234/395 (59%), Positives = 296/395 (75%), Gaps = 7/395 (2%)
 Frame = +1

Query  664   VTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFHRSYL  834
             ++  + +  L++LE  LG+ARAAIR A    N T  H   DYVPTGP+Y N N FHRSYL
Sbjct  122   ISKTKGYSKLKKLEEKLGRARAAIRKASQLHNLTSIHHDPDYVPTGPIYRNPNAFHRSYL  181

Query  835   EMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPIS  1011
             EME+  KI+VY+EGEPP+FH GPCKSIY++EG FI+ ME  + + T DP++A ++FLP S
Sbjct  182   EMERLLKIYVYKEGEPPMFHGGPCKSIYSTEGRFIHEMEKGNLYTTNDPDQALLYFLPFS  241

Query  1012  ITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEI  1191
             +  +V ++Y   V N      + + ++DYIN+++ K+ +W+RSLGADHFML+CHDWGP  
Sbjct  242   VVNLVQYLY---VPNSHEVNAIGRAITDYINVISKKHPFWDRSLGADHFMLSCHDWGPRT  298

Query  1192  SKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFF  1371
             +  VP LF NSIR LCNAN SEGF PSKD S PEI L  G + GLIGG SPSRRS+LAFF
Sbjct  299   TSYVPLLFNNSIRVLCNANVSEGFLPSKDASFPEIHLRTGEIDGLIGGLSPSRRSVLAFF  358

Query  1372  AGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVE  1551
             AG LHG IR +LL+ W+ KD DV V+  LP GISY  ML+K++FC+CPSGYEVASPR+VE
Sbjct  359   AGRLHGHIRYLLLQEWKEKDEDVLVYEELPSGISYNSMLKKSRFCLCPSGYEVASPRVVE  418

Query  1552  ALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGL  1731
             A+Y  CVPVLI + YV PFSDVLNWKSFSV++ V+DIPN+KKIL GISQ +Y+R+QRR  
Sbjct  419   AIYAECVPVLISESYVPPFSDVLNWKSFSVQIQVKDIPNIKKILKGISQTQYLRMQRRVK  478

Query  1732  IARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
               +RHF +N  PKR+D  HMILHS WLRRLN+ + 
Sbjct  479   QVQRHFALNGTPKRFDAFHMILHSIWLRRLNIHIQ  513



>ref|XP_010933454.1| PREDICTED: probable glycosyltransferase At5g03795 [Elaeis guineensis]
Length=524

 Score =   491 bits (1265),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 242/385 (63%), Positives = 300/385 (78%), Gaps = 8/385 (2%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAVHGINQTD--DHDYVPTGPVYWNANVFHRSYLEMEKQFKIFV  864
             LERLE  L +ARAAIR A    N+T   D DYVP GPVY NA  FH+SYLEMEK FK+FV
Sbjct  142   LERLEFGLARARAAIREAARNPNRTALVDKDYVPIGPVYRNAYAFHKSYLEMEKLFKVFV  201

Query  865   YEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVHFVYD  1041
             YEEGEPP+FH+GPC+SIY++EG FI +M+  S  RTRDP++AHVFFLP S+  +V ++Y 
Sbjct  202   YEEGEPPIFHDGPCRSIYSTEGFFINNMDMESRLRTRDPDRAHVFFLPFSVVRMVQYIYP  261

Query  1042  RSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKN  1221
             R  H+     P+++TV DYINL++GKY +WNRSLGADHFML+CHDWGP  S     LF N
Sbjct  262   RDHHDMR---PLRKTVLDYINLISGKYPFWNRSLGADHFMLSCHDWGPYASGGHHHLFVN  318

Query  1222  SIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRP  1401
             SIR LCNANTSE F  S+DVS+PE+ +    +   +GGPS S R ILAFFAGG HGP+RP
Sbjct  319   SIRVLCNANTSEWFNASRDVSLPEMNVRSDVIK--VGGPSASGRPILAFFAGGNHGPVRP  376

Query  1402  ILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVL  1581
             +LL+HW+ KDNDVQVH YLPKG+SY ++++K+KFC+CPSGYEVASPR++EA+Y  CVPV 
Sbjct  377   VLLKHWKGKDNDVQVHEYLPKGVSYVDLMKKSKFCLCPSGYEVASPRIMEAIYYECVPVT  436

Query  1582  IKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNL  1761
             I  +YV P SDVLNWK+FSV+V VEDIP LK IL  IS R+YIR+QRR    +RHF +N 
Sbjct  437   INANYVLPLSDVLNWKAFSVQVSVEDIPKLKNILMSISPRQYIRMQRRVKTVQRHFMMNG  496

Query  1762  PPKRYDVTHMILHSAWLRRLNVRLH  1836
             PP+R+D+ HM+LHS WLRRLN+R+H
Sbjct  497   PPQRFDLYHMLLHSIWLRRLNIRIH  521



>gb|AGZ15405.1| limonene cyclase-like protein [Phaseolus vulgaris]
Length=491

 Score =   490 bits (1261),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 240/383 (63%), Positives = 291/383 (76%), Gaps = 11/383 (3%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYE  870
             L+ +E  L +ARAAIR A +G   T D DYVP GP+YWNA  FHRSYLEMEKQFK+F Y 
Sbjct  111   LDNIEIGLAQARAAIREARNGTG-TPDSDYVPKGPMYWNAKAFHRSYLEMEKQFKVFSYG  169

Query  871   EGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
             EGEPP FHN PCKS Y+ EGNF++ +E +  FRT+DPE+AHVFFLP        + Y+R 
Sbjct  170   EGEPPNFHNAPCKSKYSMEGNFMHAIEMNNHFRTKDPEEAHVFFLPKG-----GYGYERV  224

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
               +     P+K+T +DY+N++A +Y YWNRSLGAD F LACHD     S ++P   KNS 
Sbjct  225   SQDLS---PVKKTATDYVNVIAARYLYWNRSLGADPFTLACHDMCRGKSFSLPYPHKNSF  281

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPIL  1407
             R LCNANTSEGFKP+KDVS PEI L   ++   IGG S  +RSIL FFAGG+HGPI P+L
Sbjct  282   RVLCNANTSEGFKPAKDVSFPEINLKISSIR-FIGGQSAFKRSILTFFAGGVHGPIAPVL  340

Query  1408  LEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIK  1587
              +HWENKD D+Q+ +YLPKGISYYEM+RK+KFC+CPSGYE ASPR+VEA+YTGCVPV I 
Sbjct  341   FKHWENKDEDIQILKYLPKGISYYEMMRKSKFCLCPSGYEGASPRVVEAIYTGCVPVFIF  400

Query  1588  DHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPP  1767
             +H V PFSDVLNWKSFSVE+ V+DIPNLK+IL  I  ++YIR+QRR     RHFEV+ PP
Sbjct  401   EHSVPPFSDVLNWKSFSVEISVKDIPNLKEILMSIPPKQYIRMQRRVEQIGRHFEVHSPP  460

Query  1768  KRYDVTHMILHSAWLRRLNVRLH  1836
             KR+DV HMILHS WLRRLN+ +H
Sbjct  461   KRFDVFHMILHSVWLRRLNLEVH  483



>ref|XP_010657501.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Vitis vinifera]
Length=410

 Score =   486 bits (1252),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 237/385 (62%), Positives = 289/385 (75%), Gaps = 7/385 (2%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAV---HGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             LER+EA L +ARA IR        I+     DYVP G +Y NA  FHRSYL MEK FKIF
Sbjct  29    LERVEAGLARARALIREGTTNWSSISAPVGADYVPQGDIYRNATAFHRSYLLMEKLFKIF  88

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISITAIVHFVY  1038
             +Y+EGEPP+FHNGPCKSIY+ EG F   ME  + FRT+DP++AHV+FLP S+  I+H ++
Sbjct  89    IYKEGEPPLFHNGPCKSIYSIEGVFFSLMEGDTHFRTQDPDEAHVYFLPFSVVMIIHHLF  148

Query  1039  DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFK  1218
             D  V +K     MK  VSDY+ +++ KY YWNRSLGADHFML+CHDWGP  +  VP+L+ 
Sbjct  149   DPIVRDK---YVMKHVVSDYVKVISQKYRYWNRSLGADHFMLSCHDWGPRATWYVPQLYY  205

Query  1219  NSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIR  1398
             NSIR LCNANTSE F P KD SIPEI L  G   GL GG  PS+R+ILAFFAGGLHG IR
Sbjct  206   NSIRLLCNANTSECFNPRKDASIPEINLIDGETIGLTGGLPPSKRTILAFFAGGLHGRIR  265

Query  1399  PILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPV  1578
             P LL+HW+ KD  VQV+  LP+G+SY ++++K+K+CICPSG+EVASPR+VEA+Y  CVPV
Sbjct  266   PALLQHWKEKDEQVQVYETLPEGLSYPDLMKKSKYCICPSGHEVASPRIVEAIYAECVPV  325

Query  1579  LIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVN  1758
             LI  HYV PFSDVL+W SFS++V V +IPNLKKIL GI Q RYIR+Q R    ++HF VN
Sbjct  326   LISQHYVLPFSDVLDWGSFSIQVSVNEIPNLKKILLGIPQDRYIRMQERVKQVQQHFVVN  385

Query  1759  LPPKRYDVTHMILHSAWLRRLNVRL  1833
              PPKR+DV HMI+HS WLRRLNV +
Sbjct  386   NPPKRFDVFHMIIHSIWLRRLNVAI  410



>gb|KDP22997.1| hypothetical protein JCGZ_01719 [Jatropha curcas]
Length=742

 Score =   498 bits (1282),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 243/406 (60%), Positives = 297/406 (73%), Gaps = 7/406 (2%)
 Frame = +1

Query  640   NETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNA  810
             +E G      + +++  LE++EANL + R +IR A    N T    D DYVP GP+Y NA
Sbjct  323   DEVGANATAEVVKRYSKLEKMEANLARVRVSIREAARIRNLTSLHQDEDYVPQGPIYRNA  382

Query  811   NVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKA  987
             N FHRSYLEMEK FKI+VYEEGE P+FH+GPCKSIY+SEG FI+ +E    +RTRDPE+A
Sbjct  383   NAFHRSYLEMEKLFKIYVYEEGETPLFHDGPCKSIYSSEGTFIHELEKGKSYRTRDPEEA  442

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
              V+FLP S+  +V ++Y  + H  E    + + V DYIN+++ KY +WNRSLGADHFML+
Sbjct  443   LVYFLPFSVVMMVEYLYVPNSHEIE---AIGRVVVDYINVISNKYPFWNRSLGADHFMLS  499

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
             CHDWGP  S  V +LFKNSIR LCNANTSEGF PSKD S PEI L  G + GLIGG SPS
Sbjct  500   CHDWGPRTSSYVSQLFKNSIRVLCNANTSEGFNPSKDASFPEIHLKTGEITGLIGGSSPS  559

Query  1348  RRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
             RRSILAFFAG LHG IR +LLE W+NKD DVQV   LPK +SY  ML+K++FC+CPSGYE
Sbjct  560   RRSILAFFAGRLHGDIRRLLLEKWKNKDKDVQVFEQLPKNVSYESMLKKSRFCLCPSGYE  619

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA+Y+ CVPVLI D YV PFSDVLNWK+FSV+V V+DIP +K+IL GISQR+Y
Sbjct  620   VASPRVVEAIYSECVPVLISDSYVPPFSDVLNWKAFSVQVEVKDIPKIKEILMGISQRQY  679

Query  1708  IRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGIE  1845
             +R+QRR    +RHF VN PPKR +       +  L R N R   IE
Sbjct  680   LRMQRRVKQVQRHFVVNGPPKRTNQLTADRSTTELLRNNGRFDLIE  725


 Score =   229 bits (585),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 158/245 (64%), Gaps = 7/245 (3%)
 Frame = +1

Query  682   FRNLERLEANLGKARAAIRAAV--HGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFK  855
              + +E+LEA L  ARA IR A   H    + D D    G +Y N   FHRSY+ MEK FK
Sbjct  9     LKRVEKLEATLSIARALIREAALDHNCKSSRDGD-GDDGNIYRNFCAFHRSYMLMEKLFK  67

Query  856   IFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVHF  1032
             IFVYEEGEPP+FH GPCK+IY++EG F+  MET + FRT +P +A  +FLP S+  I+  
Sbjct  68    IFVYEEGEPPLFHYGPCKNIYSTEGLFLSLMETNTKFRTFNPHEAVAYFLPFSVVMIIEH  127

Query  1033  VYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPEL  1212
             ++   + +K     +++T+ DY+ +++  + +WN S GADHFML+CHDWGP  +    +L
Sbjct  128   LFHPVIRDKA---VLERTIVDYVRIISHNHPFWNTSHGADHFMLSCHDWGPRATWYERQL  184

Query  1213  FKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGP  1392
             + NSIR LCNANTSE F P KD S+P I L  G   GL+GG SPS R+ILAFFA     P
Sbjct  185   YFNSIRVLCNANTSEYFNPKKDASLPAINLITGETTGLVGGLSPSNRTILAFFAENYVLP  244

Query  1393  IRPIL  1407
                +L
Sbjct  245   FSDVL  249



>ref|XP_004239536.1| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=535

 Score =   490 bits (1262),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 232/403 (58%), Positives = 302/403 (75%), Gaps = 8/403 (2%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNAN  813
             E G      + + +R LERLEA L K+R++IR A    +   +H   DYVP GP+Y NAN
Sbjct  135   EHGDNATKEVLKMYRRLERLEAILAKSRSSIREAARNGSMISNHHDPDYVPQGPMYHNAN  194

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAH  990
              FHRSYLEMEK FK++VYEEGEPP+FHNGPC+SIY++EG FI+ ME  S +RT++P++A 
Sbjct  195   SFHRSYLEMEKNFKVYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMERGSLYRTKNPDEAL  254

Query  991   VFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLAC  1170
             V+FLP S+  +V +++    H+      + +TV+DY+ +++ ++++WNRSLGADHFML+C
Sbjct  255   VYFLPFSVVVMVQYLFVPGAHDMH---ALGRTVADYVKVISERHSFWNRSLGADHFMLSC  311

Query  1171  HDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR  1350
             HDWGP ++  VP LF  SIR LCNANTSEGF P KDVS+PEI L  G + GLIGGPSPSR
Sbjct  312   HDWGPHLTSYVPHLFNTSIRVLCNANTSEGFNPLKDVSLPEINLKTGDIKGLIGGPSPSR  371

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             RSILAFFAGGLHG IR  LLE W+ KD D+ V+  LP   SY  ML+ ++FC+CPSGYEV
Sbjct  372   RSILAFFAGGLHGNIRHHLLEQWKGKDEDMLVYEKLPNDKSYETMLKNSRFCLCPSGYEV  431

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPR+VEA+Y  C+PVLI D+YV PFSDVLNW +FSV + V+DIPN+KKIL  ISQ +Y+
Sbjct  432   ASPRVVEAIYAECIPVLISDNYVPPFSDVLNWNAFSVTIGVKDIPNIKKILMSISQSQYL  491

Query  1711  RLQRRGLIARRHFEVNL-PPKRYDVTHMILHSAWLRRLNVRLH  1836
             R+ RR    +RHF +N   PKR+D+ +MI+HS WLRRLN+R+ 
Sbjct  492   RMHRRVKQVQRHFVINDGSPKRFDLLNMIVHSIWLRRLNIRVQ  534



>ref|XP_008227726.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=542

 Score =   491 bits (1263),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 236/389 (61%), Positives = 295/389 (76%), Gaps = 8/389 (2%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFHRSYLEMEKQFKI  858
              LE+LEA+LG+AR++IR A +  N+   H   DYVP GP+Y N N FHRSYLEME  FKI
Sbjct  156   QLEKLEASLGRARSSIREAANVRNKISTHQDPDYVPRGPIYRNPNAFHRSYLEMENLFKI  215

Query  859   FVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVHFV  1035
             +VYEEGE P+FH+GPC+SIY+SEG FI+ ME  + +RTRDP+KA V+FLP S+  +V ++
Sbjct  216   YVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGNMYRTRDPDKALVYFLPFSVARMVRYM  275

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             Y   V + +    MK  + DY+NL+A K+ +WNRSLGADHFML+CHDWGP  +  VP LF
Sbjct  276   Y---VPDSKDRHGMKLAIIDYVNLIAQKHPFWNRSLGADHFMLSCHDWGPFTTSFVPLLF  332

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
              NSIR LCNANTSEGF PSKD S PEI L    M GL GG  PS RS LAFFAGGLHG I
Sbjct  333   HNSIRVLCNANTSEGFNPSKDSSFPEINLKTSEMSGL-GGQPPSSRSTLAFFAGGLHGHI  391

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             R +LL  W+ KD DV+V+  LP+G+SY +ML+ +KFC+CPSGYEVASPR+VEA+Y  C+P
Sbjct  392   RSLLLNEWKGKDRDVRVYEKLPRGVSYEKMLKGSKFCLCPSGYEVASPRVVEAIYAECIP  451

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI D Y+ PFSDVL+WK+FSV+VPV++I ++K IL  IS R+Y+R QRR    +RHF V
Sbjct  452   VLISDGYIPPFSDVLDWKTFSVQVPVKNISDIKNILMSISSRQYLRTQRRVKEVQRHFLV  511

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
             N PPKRYDV HMI+HS WLRRLN+R+  +
Sbjct  512   NGPPKRYDVFHMIVHSIWLRRLNIRIQDL  540



>gb|AGV54221.1| glycosyltransferase [Phaseolus vulgaris]
Length=490

 Score =   488 bits (1257),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 239/383 (62%), Positives = 292/383 (76%), Gaps = 11/383 (3%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYE  870
             L+ +E  L +ARAAIR A +G   T D DYVP GP+YWNA  FHRSYLEMEKQFK+F Y 
Sbjct  110   LDNIEIGLAQARAAIREARNGTG-TPDSDYVPKGPMYWNAKAFHRSYLEMEKQFKVFSYG  168

Query  871   EGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
             EGEPP FHN PCKS Y+ EGNF++ +E +  FRT+DPE+AHVFFLP        +VY+  
Sbjct  169   EGEPPNFHNAPCKSKYSMEGNFMHAIEMNNHFRTKDPEEAHVFFLPKG-----GYVYEGI  223

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
                 + + P+K+T +DY++ +A +Y Y NR+L A HF LACHD     S ++P   KNSI
Sbjct  224   ---SQDFGPVKKTATDYVSAIAARYPYGNRNLEAKHFTLACHDMCRGTSLSLPTPHKNSI  280

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPIL  1407
             R LCNANTSEGFKP+KDVS PEI L   ++   IGG S S+RSIL FFAGG+HGPI P+L
Sbjct  281   RVLCNANTSEGFKPAKDVSFPEINLKISSIR-FIGGQSASKRSILTFFAGGVHGPIAPVL  339

Query  1408  LEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIK  1587
             L+HWENKD D+Q+ +YLPKGISYYEM+RK+KFC+CPSGYE ASPR+VEA+YTGCVPV I 
Sbjct  340   LKHWENKDEDIQILKYLPKGISYYEMMRKSKFCLCPSGYEGASPRVVEAIYTGCVPVFIS  399

Query  1588  DHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPP  1767
             +H V PFSDVLNWKSFSVE+ V+DIPNLK+IL  I  ++YIR+QRR     RHFEV+ PP
Sbjct  400   EHSVPPFSDVLNWKSFSVEISVKDIPNLKEILMSIPPKQYIRMQRRVEQIGRHFEVHSPP  459

Query  1768  KRYDVTHMILHSAWLRRLNVRLH  1836
             KR+DV HMILHS WLRRLN+ +H
Sbjct  460   KRFDVFHMILHSVWLRRLNLEVH  482



>ref|XP_002264111.3| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Vitis vinifera]
Length=454

 Score =   486 bits (1252),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 237/385 (62%), Positives = 289/385 (75%), Gaps = 7/385 (2%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAV---HGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             LER+EA L +ARA IR        I+     DYVP G +Y NA  FHRSYL MEK FKIF
Sbjct  73    LERVEAGLARARALIREGTTNWSSISAPVGADYVPQGDIYRNATAFHRSYLLMEKLFKIF  132

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISITAIVHFVY  1038
             +Y+EGEPP+FHNGPCKSIY+ EG F   ME  + FRT+DP++AHV+FLP S+  I+H ++
Sbjct  133   IYKEGEPPLFHNGPCKSIYSIEGVFFSLMEGDTHFRTQDPDEAHVYFLPFSVVMIIHHLF  192

Query  1039  DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFK  1218
             D  V +K     MK  VSDY+ +++ KY YWNRSLGADHFML+CHDWGP  +  VP+L+ 
Sbjct  193   DPIVRDK---YVMKHVVSDYVKVISQKYRYWNRSLGADHFMLSCHDWGPRATWYVPQLYY  249

Query  1219  NSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIR  1398
             NSIR LCNANTSE F P KD SIPEI L  G   GL GG  PS+R+ILAFFAGGLHG IR
Sbjct  250   NSIRLLCNANTSECFNPRKDASIPEINLIDGETIGLTGGLPPSKRTILAFFAGGLHGRIR  309

Query  1399  PILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPV  1578
             P LL+HW+ KD  VQV+  LP+G+SY ++++K+K+CICPSG+EVASPR+VEA+Y  CVPV
Sbjct  310   PALLQHWKEKDEQVQVYETLPEGLSYPDLMKKSKYCICPSGHEVASPRIVEAIYAECVPV  369

Query  1579  LIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVN  1758
             LI  HYV PFSDVL+W SFS++V V +IPNLKKIL GI Q RYIR+Q R    ++HF VN
Sbjct  370   LISQHYVLPFSDVLDWGSFSIQVSVNEIPNLKKILLGIPQDRYIRMQERVKQVQQHFVVN  429

Query  1759  LPPKRYDVTHMILHSAWLRRLNVRL  1833
              PPKR+DV HMI+HS WLRRLNV +
Sbjct  430   NPPKRFDVFHMIIHSIWLRRLNVAI  454



>ref|XP_007137813.1| hypothetical protein PHAVU_009G157700g [Phaseolus vulgaris]
 gb|ESW09807.1| hypothetical protein PHAVU_009G157700g [Phaseolus vulgaris]
Length=501

 Score =   488 bits (1255),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 241/403 (60%), Positives = 296/403 (73%), Gaps = 8/403 (2%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNAN  813
             + GT  +     K   L R+E NL KAR +IR A    N T    D DYVP GP+Y NAN
Sbjct  100   QKGTDKENLKGHKHSKLRRIEKNLAKARYSIREASKIRNLTSTLQDPDYVPQGPIYRNAN  159

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAH  990
              FHRSYLEMEK FK+FVYEEGEPP+FHNG  K IYA+EG FI  ME    +RT DP++A 
Sbjct  160   AFHRSYLEMEKVFKVFVYEEGEPPLFHNGLSKDIYATEGRFINEMEKGRHYRTYDPDEAF  219

Query  991   VFFLPISITAIVHFVYDR-SVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
             VF+LP S+  +V +VYDR S +N +   P+   V DYI  ++ K+ +WNRSLG DHFML+
Sbjct  220   VFYLPFSVVMLVEYVYDRGSNYNLD---PLGLVVKDYIQTISYKHPFWNRSLGHDHFMLS  276

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
             CHDWGP +S  V  L+ N+IR LCNANTSEGFKP+KDVS PEI L  G + GL+GG  PS
Sbjct  277   CHDWGPIVSSYVDLLYNNAIRVLCNANTSEGFKPAKDVSFPEIKLMRGEVTGLVGGYPPS  336

Query  1348  RRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
             +R+ILAFFAG LHG IR +LL  W+NKD DVQV+  +P+GISYY  LR +KFC+CPSGYE
Sbjct  337   QRTILAFFAGHLHGYIRYLLLHTWKNKDQDVQVYEEIPEGISYYTKLRSSKFCLCPSGYE  396

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA++  CVPVLI D YV PFSDVLNW SFSV+V V++IPN+KKIL GIS+R+Y
Sbjct  397   VASPRIVEAIFAECVPVLISDSYVPPFSDVLNWNSFSVQVAVKEIPNIKKILMGISERQY  456

Query  1708  IRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             +R+QRR    +RHF  N PP+RYD+ HM +HS WLRRLN+ + 
Sbjct  457   LRMQRRVKQVQRHFMPNEPPERYDMFHMTVHSIWLRRLNIHIQ  499



>gb|KGN52623.1| hypothetical protein Csa_5G647450 [Cucumis sativus]
Length=510

 Score =   488 bits (1255),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 233/402 (58%), Positives = 299/402 (74%), Gaps = 8/402 (2%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNAN  813
             ++ TP  ++   ++  L++LE  LG+ARAAIR A    N T  H   DYVPTGP+Y N N
Sbjct  112   KSATP-GISKTERYSKLKKLEEKLGRARAAIREASQIHNLTSIHHDPDYVPTGPIYRNPN  170

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAH  990
              FHRSY+EMEK  KI+VY+EGEPP+FH GPCKSIY++EG FI+ ME  + + T DP++A 
Sbjct  171   AFHRSYIEMEKLLKIYVYKEGEPPMFHGGPCKSIYSTEGRFIHEMEKGNLYTTNDPDQAL  230

Query  991   VFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLAC  1170
             ++FLP S+  +V ++Y   V N      +   ++DYIN+++ K+ +W+RSLGADHFML+C
Sbjct  231   LYFLPFSVVNLVQYLY---VPNSHEVNAIGTAITDYINVISNKHPFWDRSLGADHFMLSC  287

Query  1171  HDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR  1350
             HDWGP  +  VP LF NSIR LCNAN SEGF+PSKD S PEI L  G + GL+GG SPSR
Sbjct  288   HDWGPRTTSFVPLLFNNSIRVLCNANVSEGFRPSKDASFPEIHLRTGEIDGLLGGLSPSR  347

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             RS+LAFFAG LHG IR +LL+ W+ KD DV V+  LP GISY  ML+K++FC+CPSGYEV
Sbjct  348   RSVLAFFAGRLHGHIRYLLLQEWKEKDEDVLVYDELPSGISYDSMLKKSRFCLCPSGYEV  407

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPR+VEA+Y  CVPVLI + YV PFSDVLNW SF+V++ V+DIPN+KKIL GISQ +Y+
Sbjct  408   ASPRVVEAIYAECVPVLISESYVPPFSDVLNWNSFAVQIQVKDIPNIKKILNGISQTQYL  467

Query  1711  RLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             R+QRR    +RHF +N  PKR+D  HMILHS WLRRLN+ + 
Sbjct  468   RMQRRVKQVQRHFVLNGTPKRFDAFHMILHSIWLRRLNIHIQ  509



>gb|KEH35655.1| exostosin family protein [Medicago truncatula]
Length=495

 Score =   486 bits (1250),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 234/390 (60%), Positives = 290/390 (74%), Gaps = 7/390 (2%)
 Frame = +1

Query  679   KFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             K+  LE++E+ L KAR +I+ A    N T    D DYVP GP+Y N N FHRSYLEMEK 
Sbjct  106   KYSKLEKIESKLAKARYSIKEASKVQNLTSTHQDQDYVPQGPIYRNPNAFHRSYLEMEKV  165

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPF-RTRDPEKAHVFFLPISITAIV  1026
             FKIFVYEEGEPP+FHNG  K IY++EG FI  ME   + RT DP +A V+FLP S+  +V
Sbjct  166   FKIFVYEEGEPPLFHNGLSKDIYSTEGIFINEMEKGRYYRTNDPNEAFVYFLPFSVVMMV  225

Query  1027  HFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVP  1206
              ++Y    ++K    P+  TV DYI++++ KY +WN+SLG DHFML+CHDWGP+ S    
Sbjct  226   EYLYVGGSNDK---TPIGVTVKDYIHVISHKYPFWNQSLGHDHFMLSCHDWGPDASAYED  282

Query  1207  ELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLH  1386
              LF NSIR LCNANTSEGFKP+KD S PE+ L  G +  L+GG SPSRR+ILAFFAG LH
Sbjct  283   NLFNNSIRVLCNANTSEGFKPAKDASFPEMFLKKGEITNLVGGYSPSRRTILAFFAGHLH  342

Query  1387  GPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
             G IR +LL+ W+NKD DVQV+  LP   SY+  LR +KFC+CPSGYEVASPR+VEA++  
Sbjct  343   GYIRYLLLDTWKNKDQDVQVYEELPDEDSYHTKLRSSKFCLCPSGYEVASPRIVEAIFAE  402

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             CVPVLI D YV PFSDVLNWK+FSV++ V+DIPN+K IL GISQR+Y+++QRR    +RH
Sbjct  403   CVPVLISDSYVPPFSDVLNWKAFSVQIDVKDIPNIKNILMGISQRQYLKMQRRVKQVQRH  462

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             F  N PPKR+DV HM +HS WLRRLNVR+H
Sbjct  463   FVPNEPPKRFDVFHMTIHSIWLRRLNVRIH  492



>ref|XP_007216463.1| hypothetical protein PRUPE_ppa024503mg [Prunus persica]
 gb|EMJ17662.1| hypothetical protein PRUPE_ppa024503mg [Prunus persica]
Length=482

 Score =   483 bits (1243),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 233/401 (58%), Positives = 297/401 (74%), Gaps = 7/401 (2%)
 Frame = +1

Query  649   GTPLQVTIKRKFR-NLERLEANLGKARAAIRAAVHGINQT--DDHDYVPTGPVYWNANVF  819
             G  +  T KRK   NLERLEA L  ARA IR A    NQT  +D DYVP G +Y NA  F
Sbjct  85    GNSVSKTDKRKGDVNLERLEAGLATARALIREATSKFNQTALEDADYVPQGDIYRNAYAF  144

Query  820   HRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVF  996
             HRS+L ME  FKI+VYEEGEPP+FHNGPCK+IY+ EG F+  MET + FRT DP+KAHV+
Sbjct  145   HRSHLLMESLFKIYVYEEGEPPIFHNGPCKNIYSMEGLFLSFMETDTKFRTLDPDKAHVY  204

Query  997   FLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHD  1176
             FLP S+  I+ +++   + +K     +++TV DY+ +V+ KY +WNRSLGADH ML+CHD
Sbjct  205   FLPFSVVMIIEYLFHPIIRDKA---VLERTVVDYVRVVSNKYPFWNRSLGADHVMLSCHD  261

Query  1177  WGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRS  1356
             WGP  +  V +L+  +IR LCNANTSE F P KD S PEI L  G + GL+GG  PS R+
Sbjct  262   WGPRATWYVKQLYFVAIRVLCNANTSEHFNPKKDASFPEINLETGDITGLVGGLPPSERT  321

Query  1357  ILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVAS  1536
              LAFFAG +HG IRP+L +HW+ KD D+ V+  LP+G+SY++ML+K+K+CICPSG+EVAS
Sbjct  322   TLAFFAGRMHGRIRPLLFQHWKEKDKDLLVYETLPEGVSYHDMLKKSKYCICPSGHEVAS  381

Query  1537  PRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRL  1716
             PR+ EA+Y  CVPVLI  HYV PFSDVLNW+ FSV+V V +IP+LK+IL GI + +Y R+
Sbjct  382   PRIAEAIYAECVPVLISQHYVLPFSDVLNWEFFSVQVSVSEIPHLKEILMGIPEEQYRRM  441

Query  1717  QRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
             Q+R    +RHF VN PPKR+DV HMI+HS WLRRLNVR++G
Sbjct  442   QKRVKQVQRHFVVNSPPKRFDVFHMIIHSIWLRRLNVRIYG  482



>emb|CBI28482.3| unnamed protein product [Vitis vinifera]
Length=634

 Score =   488 bits (1257),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 237/385 (62%), Positives = 289/385 (75%), Gaps = 7/385 (2%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAV---HGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             LER+EA L +ARA IR        I+     DYVP G +Y NA  FHRSYL MEK FKIF
Sbjct  253   LERVEAGLARARALIREGTTNWSSISAPVGADYVPQGDIYRNATAFHRSYLLMEKLFKIF  312

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISITAIVHFVY  1038
             +Y+EGEPP+FHNGPCKSIY+ EG F   ME  + FRT+DP++AHV+FLP S+  I+H ++
Sbjct  313   IYKEGEPPLFHNGPCKSIYSIEGVFFSLMEGDTHFRTQDPDEAHVYFLPFSVVMIIHHLF  372

Query  1039  DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFK  1218
             D  V +K     MK  VSDY+ +++ KY YWNRSLGADHFML+CHDWGP  +  VP+L+ 
Sbjct  373   DPIVRDK---YVMKHVVSDYVKVISQKYRYWNRSLGADHFMLSCHDWGPRATWYVPQLYY  429

Query  1219  NSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIR  1398
             NSIR LCNANTSE F P KD SIPEI L  G   GL GG  PS+R+ILAFFAGGLHG IR
Sbjct  430   NSIRLLCNANTSECFNPRKDASIPEINLIDGETIGLTGGLPPSKRTILAFFAGGLHGRIR  489

Query  1399  PILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPV  1578
             P LL+HW+ KD  VQV+  LP+G+SY ++++K+K+CICPSG+EVASPR+VEA+Y  CVPV
Sbjct  490   PALLQHWKEKDEQVQVYETLPEGLSYPDLMKKSKYCICPSGHEVASPRIVEAIYAECVPV  549

Query  1579  LIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVN  1758
             LI  HYV PFSDVL+W SFS++V V +IPNLKKIL GI Q RYIR+Q R    ++HF VN
Sbjct  550   LISQHYVLPFSDVLDWGSFSIQVSVNEIPNLKKILLGIPQDRYIRMQERVKQVQQHFVVN  609

Query  1759  LPPKRYDVTHMILHSAWLRRLNVRL  1833
              PPKR+DV HMI+HS WLRRLNV +
Sbjct  610   NPPKRFDVFHMIIHSIWLRRLNVAI  634



>ref|XP_011009816.1| PREDICTED: probable glycosyltransferase At3g07620 [Populus euphratica]
Length=480

 Score =   482 bits (1240),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 232/393 (59%), Positives = 287/393 (73%), Gaps = 8/393 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQT----DDHDYVPTGPVYWNANVFHRSYLEME  843
             R    LER+EA L  ARA IR A    N T    DD DY+P G +Y NA  FHRSYL ME
Sbjct  91    RSDAKLERVEAGLAMARALIREAAEDSNCTSSLHDDLDYIPRGYIYRNACAFHRSYLLME  150

Query  844   KQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITA  1020
             K FKIFVYEEGEPP+FH G CK IY+ EG F+  MET + FRT +P++AHV+FLP S+  
Sbjct  151   KLFKIFVYEEGEPPLFHYGTCKDIYSMEGVFLSLMETNTKFRTSNPDEAHVYFLPFSVVM  210

Query  1021  IVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKA  1200
             I+  ++   + +K     +++TVSDY+ +++ KY YWNRSLGADHFML+CHDWGP  +  
Sbjct  211   IIEHLFHPIIRDKA---VLERTVSDYVRIISHKYLYWNRSLGADHFMLSCHDWGPRATWY  267

Query  1201  VPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGG  1380
             V +L+ NSIR LCNANTSE F P KD S PEI L  G + GL GG  PS R++LAFFAG 
Sbjct  268   VRQLYYNSIRVLCNANTSEYFNPKKDASFPEINLKTGEITGLTGGLPPSNRTVLAFFAGK  327

Query  1381  LHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALY  1560
             +HG +RP LL+HW  KD DVQV+  LP+GISY+EM+ K+K+CICPSG+EVASPR+ EA+Y
Sbjct  328   MHGKLRPALLQHWMGKDKDVQVYETLPQGISYHEMMTKSKYCICPSGHEVASPRIAEAIY  387

Query  1561  TGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIAR  1740
               CVPVLI  HY+ PFSDVLNW SF+++VPV +IPNLK IL GI + +Y+R+Q R    +
Sbjct  388   AECVPVLISQHYIFPFSDVLNWDSFTIQVPVTEIPNLKNILEGIPEDQYLRMQERVKQVQ  447

Query  1741  RHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
             RHF VN PP+RYDV HMI+HS WLRRLNVR  G
Sbjct  448   RHFVVNNPPRRYDVFHMIIHSIWLRRLNVRFPG  480



>emb|CDP15733.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   482 bits (1241),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 232/391 (59%), Positives = 290/391 (74%), Gaps = 24/391 (6%)
 Frame = +1

Query  667   TIKRKFRNLERLEANLGKARAAIRAAVHG---INQTDDHDYVPTGPVYWNANVFHRSYLE  837
                +++  LERLE  L KAR +IR A      I+  +D DY P GP+Y NAN FHRS+LE
Sbjct  118   AFNKRYNKLERLETILSKARYSIREAAKNGSMISTHEDADYAPHGPMYINANGFHRSHLE  177

Query  838   MEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPF-RTRDPEKAHVFFLPISI  1014
             MEK FK++VYEEGEPP+FH+GPCKSIY++EG FI+ ME   F RT++P+ A V+FLP S+
Sbjct  178   MEKSFKVYVYEEGEPPMFHDGPCKSIYSTEGRFIHEMEKGNFYRTKNPDDALVYFLPFSV  237

Query  1015  TAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEIS  1194
              A+V ++Y+   H+++    +  T++DYI L++GK+ +WN+S GADHFML+CHDW     
Sbjct  238   VAMVQYLYEPGGHDRQ---AIGHTLADYIGLISGKHPFWNQSFGADHFMLSCHDW-----  289

Query  1195  KAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFA  1374
                          LCNANTSEGF P KDVS+PEI L  G + GLIGGPSPSRR ILAFFA
Sbjct  290   ------------ILCNANTSEGFNPLKDVSLPEIHLRTGEITGLIGGPSPSRRPILAFFA  337

Query  1375  GGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
             G LHG IR +LLE W+ KD D+QV+  LP G+SY  MLRK+KFC+CPSGYEVASPR+VEA
Sbjct  338   GRLHGHIRYLLLEQWKEKDQDIQVYDNLPAGVSYESMLRKSKFCLCPSGYEVASPRVVEA  397

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             +Y  C+P+LI D YV PFSDVLNWKSFSVEV V+DIPN+KKILT ISQ +YIR+ RR   
Sbjct  398   IYAECIPILISDSYVPPFSDVLNWKSFSVEVAVKDIPNIKKILTSISQTQYIRMHRRLKQ  457

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNV  1827
              +RHF +N PPKR+D+ HMILHS WLRRLN+
Sbjct  458   VQRHFVINGPPKRFDLFHMILHSIWLRRLNI  488



>ref|XP_002320537.2| hypothetical protein POPTR_0014s16900g [Populus trichocarpa]
 gb|EEE98852.2| hypothetical protein POPTR_0014s16900g [Populus trichocarpa]
Length=461

 Score =   481 bits (1238),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 232/393 (59%), Positives = 288/393 (73%), Gaps = 8/393 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQT----DDHDYVPTGPVYWNANVFHRSYLEME  843
             R    LER+EA L  ARA IR A    N T    DD DY+P G +Y NA  FHRSYL ME
Sbjct  72    RSDAKLERVEAGLAMARALIREAAEDNNCTSSLHDDLDYIPRGYIYRNACAFHRSYLLME  131

Query  844   KQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITA  1020
             K FKIFVYEEGEPP+FH G CK IY+ EG F+  MET + FRT +P++AHV+FLP S+  
Sbjct  132   KLFKIFVYEEGEPPLFHYGTCKDIYSMEGVFLSLMETNTKFRTSNPDEAHVYFLPFSVVM  191

Query  1021  IVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKA  1200
             I+  ++   + +K     +++TVSDY+ +++ KY YWNRSLGADHFML+CHDWGP  +  
Sbjct  192   IIEHLFHPIIRDKA---VLERTVSDYVRIISHKYLYWNRSLGADHFMLSCHDWGPRATWY  248

Query  1201  VPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGG  1380
             V +L+ NSIR LCNANTSE F P KD S PEI L  G + GL GG  PS R++LAFFAG 
Sbjct  249   VRQLYYNSIRVLCNANTSEYFNPKKDASFPEINLKTGEITGLTGGLPPSNRTVLAFFAGK  308

Query  1381  LHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALY  1560
             +HG +RP LL+HW  KD DVQV+  LP+GISY+EM++K+K+CICPSG+EVASPR+ EA+Y
Sbjct  309   MHGKLRPALLQHWMGKDKDVQVYETLPQGISYHEMMKKSKYCICPSGHEVASPRIAEAIY  368

Query  1561  TGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIAR  1740
               CVPVLI  HY+ PFSDVLNW SF+++VPV +IPNLK IL GI + +Y+R+Q R    +
Sbjct  369   AECVPVLISQHYIFPFSDVLNWDSFTIQVPVTEIPNLKNILEGIPEDQYLRMQERVRQVQ  428

Query  1741  RHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
             RHF VN PP+RYDV HMI+HS WLRRLNVR  G
Sbjct  429   RHFVVNNPPRRYDVFHMIIHSIWLRRLNVRFPG  461



>ref|XP_004289488.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=399

 Score =   477 bits (1228),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 292/399 (73%), Gaps = 21/399 (5%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAV-------HGINQT---------DDHDYVPTGPVYWNANVFH  822
             L++LE +L KAR++IR A        + IN T          D DYVP G +Y NA  FH
Sbjct  3     LDKLEESLSKARSSIREAAATSLALKNKINSTSKSVQLVHDQDPDYVPHGRIYRNAQAFH  62

Query  823   RSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFF  999
             RSYL MEK FKI+VYEEGE P+FH GPCKSIY+SEG FI+ ME    +RT+DP++A V+F
Sbjct  63    RSYLLMEKLFKIYVYEEGEVPLFHAGPCKSIYSSEGRFIHEMEKGKLYRTKDPDEADVYF  122

Query  1000  LPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDW  1179
             +P+S+T +V ++Y   VH      P+K+   DYI ++A ++ +WNRSLGADHFML+CHDW
Sbjct  123   IPVSVTNLVEYLY---VHGTPDRDPIKRAFIDYIKVIADRHPFWNRSLGADHFMLSCHDW  179

Query  1180  GPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSI  1359
             GP  S +VP+ F NSIR LCNANTSEGF PSKD S PEI L  G +  L GGP PS R++
Sbjct  180   GPVTSSSVPDFFHNSIRVLCNANTSEGFNPSKDASFPEINLLTGEISSL-GGPPPSTRTV  238

Query  1360  LAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASP  1539
             LAFFAG LHG IR +LL  W+ KD DVQV+  LPK +SY   L+ +KFC+CPSGYEVASP
Sbjct  239   LAFFAGRLHGHIRYLLLNEWKGKDEDVQVYEVLPKKVSYENKLKSSKFCLCPSGYEVASP  298

Query  1540  RMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQ  1719
             R+VEA+Y  CVPVLI D YV PFSDVLNW+SFSV++PV++I ++K IL GIS R+Y+R+Q
Sbjct  299   RVVEAIYAECVPVLISDAYVPPFSDVLNWRSFSVQIPVQNISDIKNILMGISHRQYLRMQ  358

Query  1720  RRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             R     +RHF VN PPKRYDV HMI+HS WLRRLN+R+H
Sbjct  359   RNVKQVQRHFVVNGPPKRYDVFHMIVHSIWLRRLNIRVH  397



>ref|XP_008229804.1| PREDICTED: probable glycosyltransferase At3g07620 [Prunus mume]
Length=482

 Score =   479 bits (1234),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 227/387 (59%), Positives = 289/387 (75%), Gaps = 6/387 (2%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQT--DDHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             NLE+LEA L  ARA IR A    N T  +D DYVP G +Y NA  FHRS+L ME  FKI+
Sbjct  99    NLEKLEAGLATARALIREATSKFNHTALEDADYVPQGDIYRNAYAFHRSHLLMESLFKIY  158

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVHFVY  1038
             VYEEGEPP+FHNGPCK+IY+ EG F+  MET + FRT DP+KAHV+FLP S+  I+ +++
Sbjct  159   VYEEGEPPIFHNGPCKNIYSMEGLFLSFMETDTKFRTLDPDKAHVYFLPFSVVMIIEYLF  218

Query  1039  DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFK  1218
                + +K     +++TV DY+ +V+ KY +WNRSLGADH ML+CHDWGP  +  V +L+ 
Sbjct  219   HPIIRDKA---VLERTVVDYVRVVSNKYPFWNRSLGADHVMLSCHDWGPRATWYVKQLYF  275

Query  1219  NSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIR  1398
              +IR LCNANTSE F P KD S PEI L  G + GL+GG SPS R+ LAFFAG +HG IR
Sbjct  276   VAIRVLCNANTSEHFNPKKDASFPEINLETGDITGLVGGLSPSERTTLAFFAGRMHGRIR  335

Query  1399  PILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPV  1578
             P+L +HW+ KD D+ V+  LP+G+SY++ML+K+K+CICPSG+EVASPR+ EA+Y  CVPV
Sbjct  336   PLLFQHWKEKDKDLLVYETLPEGVSYHDMLKKSKYCICPSGHEVASPRIAEAIYAECVPV  395

Query  1579  LIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVN  1758
             LI  HYV PFSDVLNW+SFSV+V V +IP LK+IL GI + +Y R+Q+R    +RHF VN
Sbjct  396   LISQHYVLPFSDVLNWESFSVQVSVTEIPQLKEILMGIPEEQYRRMQKRVKQVQRHFVVN  455

Query  1759  LPPKRYDVTHMILHSAWLRRLNVRLHG  1839
               PKR+DV HMI+HS WLRRLNVR+ G
Sbjct  456   SSPKRFDVFHMIIHSIWLRRLNVRISG  482



>ref|XP_010228257.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Brachypodium distachyon]
Length=547

 Score =   481 bits (1237),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 235/386 (61%), Positives = 285/386 (74%), Gaps = 8/386 (2%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAVHGINQ---TDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             L RLE  L KAR+ I  A H  +      D DYVP GPVY NAN FHRSYLEMEK FKI+
Sbjct  159   LHRLELGLAKARSTIMEASHNKDNRPPLTDKDYVPVGPVYRNANAFHRSYLEMEKLFKIY  218

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVHFVY  1038
             VY+EGEPP++H+GPC +IY++EG FI+ ME  +  RT DP  AHVFFLP SI  +   +Y
Sbjct  219   VYDEGEPPIYHDGPCHNIYSTEGRFIHAMEMENRMRTTDPGLAHVFFLPFSIAKMEKTIY  278

Query  1039  DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFK  1218
                 H  E   P+++TV DYI++++ K+ YWNRS GADHFML+CHDWGP +S     LF 
Sbjct  279   VPGSHTME---PLRRTVFDYIDVLSTKHPYWNRSQGADHFMLSCHDWGPYVSSVDGNLFS  335

Query  1219  NSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIR  1398
             NSIR LCNANTSEGF PSKDVS+PEI          IGGPS S R ILAFFAGG HGP+R
Sbjct  336   NSIRVLCNANTSEGFIPSKDVSLPEINHLN-DFKKDIGGPSASGRPILAFFAGGNHGPVR  394

Query  1399  PILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPV  1578
             P+LL+HW+ KD DVQV  YLP G+SY E +R++KFC+CPSG+EVASPR+ EA+Y  CVPV
Sbjct  395   PLLLKHWKGKDPDVQVSEYLPAGVSYVETMRRSKFCLCPSGFEVASPRVAEAIYVECVPV  454

Query  1579  LIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVN  1758
             +I D YV PFSDVL+W +FS+ V V DIP++K+IL+ +S RRYIR+QRR    RRHF +N
Sbjct  455   VIADDYVLPFSDVLSWPAFSLRVAVRDIPDIKRILSAVSPRRYIRMQRRVRAVRRHFMLN  514

Query  1759  LPPKRYDVTHMILHSAWLRRLNVRLH  1836
               P+RYDV HMILHS WLRRLNVR+H
Sbjct  515   GVPQRYDVFHMILHSIWLRRLNVRIH  540



>ref|XP_010228256.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Brachypodium distachyon]
Length=548

 Score =   481 bits (1237),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 235/386 (61%), Positives = 285/386 (74%), Gaps = 8/386 (2%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAVHGINQ---TDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             L RLE  L KAR+ I  A H  +      D DYVP GPVY NAN FHRSYLEMEK FKI+
Sbjct  160   LHRLELGLAKARSTIMEASHNKDNRPPLTDKDYVPVGPVYRNANAFHRSYLEMEKLFKIY  219

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVHFVY  1038
             VY+EGEPP++H+GPC +IY++EG FI+ ME  +  RT DP  AHVFFLP SI  +   +Y
Sbjct  220   VYDEGEPPIYHDGPCHNIYSTEGRFIHAMEMENRMRTTDPGLAHVFFLPFSIAKMEKTIY  279

Query  1039  DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFK  1218
                 H  E   P+++TV DYI++++ K+ YWNRS GADHFML+CHDWGP +S     LF 
Sbjct  280   VPGSHTME---PLRRTVFDYIDVLSTKHPYWNRSQGADHFMLSCHDWGPYVSSVDGNLFS  336

Query  1219  NSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIR  1398
             NSIR LCNANTSEGF PSKDVS+PEI          IGGPS S R ILAFFAGG HGP+R
Sbjct  337   NSIRVLCNANTSEGFIPSKDVSLPEINHLN-DFKKDIGGPSASGRPILAFFAGGNHGPVR  395

Query  1399  PILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPV  1578
             P+LL+HW+ KD DVQV  YLP G+SY E +R++KFC+CPSG+EVASPR+ EA+Y  CVPV
Sbjct  396   PLLLKHWKGKDPDVQVSEYLPAGVSYVETMRRSKFCLCPSGFEVASPRVAEAIYVECVPV  455

Query  1579  LIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVN  1758
             +I D YV PFSDVL+W +FS+ V V DIP++K+IL+ +S RRYIR+QRR    RRHF +N
Sbjct  456   VIADDYVLPFSDVLSWPAFSLRVAVRDIPDIKRILSAVSPRRYIRMQRRVRAVRRHFMLN  515

Query  1759  LPPKRYDVTHMILHSAWLRRLNVRLH  1836
               P+RYDV HMILHS WLRRLNVR+H
Sbjct  516   GVPQRYDVFHMILHSIWLRRLNVRIH  541



>ref|XP_009379541.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=536

 Score =   480 bits (1235),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 231/388 (60%), Positives = 288/388 (74%), Gaps = 8/388 (2%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             L+++EA+L +AR+AIR A    N+T  H   DYVP GP+Y N N FHRSYLEME  FKI+
Sbjct  151   LDKVEASLSRARSAIREAAKVRNKTSTHQDPDYVPRGPIYHNPNAFHRSYLEMENVFKIY  210

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVY  1038
             VYEEGE P+FH+GPC+SIY+SEG FI+ ME    +RT+DP KA V+FLP S+  +V ++Y
Sbjct  211   VYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGKLYRTKDPHKALVYFLPFSVVNMVQYIY  270

Query  1039  DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFK  1218
                  +      MK  V DYINL++ K+ +WNRS GADHFML+CHDWGP  +  VP+LF 
Sbjct  271   MPETFDLSG---MKLAVVDYINLISHKHPFWNRSHGADHFMLSCHDWGPLTTSFVPDLFH  327

Query  1219  NSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIR  1398
             NSIR +CNANTSEGF PSKD S+PEI L    M G IGG  PS+RS LAF+AGG HG IR
Sbjct  328   NSIRVMCNANTSEGFNPSKDASLPEINLKTSEMSG-IGGQPPSKRSTLAFYAGGQHGHIR  386

Query  1399  PILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPV  1578
              +LL  W+ K+ DV V+  LP+G+SY  M +  KFC+CPSGYEVASPR+VEA+Y  CVPV
Sbjct  387   YLLLNEWKGKEQDVLVYDKLPQGMSYENMFKSGKFCLCPSGYEVASPRVVEAIYAECVPV  446

Query  1579  LIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVN  1758
             LI D YV PFSDVLNW SFSV+VPV++I ++K ILT IS R+Y+R+QRR    +RHF VN
Sbjct  447   LISDGYVPPFSDVLNWNSFSVQVPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLVN  506

Query  1759  LPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
              PPKRYDV HM+++S WLRRLN+R+  I
Sbjct  507   GPPKRYDVFHMLVYSIWLRRLNIRIQDI  534



>ref|XP_010246563.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At5g03795 [Nelumbo nucifera]
Length=494

 Score =   478 bits (1230),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 236/409 (58%), Positives = 293/409 (72%), Gaps = 16/409 (4%)
 Frame = +1

Query  640   NETG---TPLQVTI-KRKFRNLERLEANLGKARAAIRAAVHGINQTD----DHDYVPTGP  795
             N+TG     + +T+ K     L+RLEANL +ARA IR A    NQT       DY+P G 
Sbjct  91    NKTGLYSNQMSITVVKGGHSKLQRLEANLARARALIRKASQ--NQTSPLQSGEDYIPQGT  148

Query  796   VYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP--FRT  969
             +Y NA+ FHRSYLEMEK FKIFVYE+G+PP+FHNGPCK IY++EG FI+ +E +    RT
Sbjct  149   IYHNAHEFHRSYLEMEKLFKIFVYEDGDPPLFHNGPCKGIYSTEGRFIHQIEINKQFLRT  208

Query  970   RDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGA  1149
             RDP +A V+FLPISI   V  +Y   V +     P+K+    Y+N +A KY YWNRSLGA
Sbjct  209   RDPARALVYFLPISIARSVQLLY---VPDSRDIGPIKRXC-HYVNAIAAKYPYWNRSLGA  264

Query  1150  DHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLI  1329
             DHF+ +CHDWGP IS  +P L +NSIR LCNANTSEGF PS+DVS PEI L  G +   +
Sbjct  265   DHFLFSCHDWGPLISAYIPYLHQNSIRVLCNANTSEGFNPSRDVSFPEINLRRGDISAFL  324

Query  1330  GGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCI  1509
             GG  P  R ILAFFAG  HG +R +L EHW++KD ++QV+ +LP+GISY EM+R++ +C+
Sbjct  325   GGLPPQARQILAFFAGKQHGHVRLLLFEHWKDKDEELQVYEHLPRGISYREMMRRSNYCL  384

Query  1510  CPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTG  1689
             CPSGYEVASPR+ EA+Y  CVPVLI DHYV PFSDVLNWKSFSV+V V DIPNLK IL G
Sbjct  385   CPSGYEVASPRVAEAIYAECVPVLISDHYVPPFSDVLNWKSFSVQVQVRDIPNLKSILMG  444

Query  1690  ISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
              S+ +YIR+Q R    ++HF VN PP R+D  HM +HS WLRRLNV +H
Sbjct  445   TSEAQYIRMQARVKQVQKHFIVNDPPTRFDAFHMTIHSIWLRRLNVHIH  493



>ref|XP_008342266.1| PREDICTED: probable glycosyltransferase At3g07620 [Malus domestica]
Length=476

 Score =   476 bits (1224),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 227/386 (59%), Positives = 287/386 (74%), Gaps = 7/386 (2%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYLEMEKQFKI  858
             NL++LEA L  ARA I  A+  +N T    D DY+P G +Y NA  FHRSYL MEK FKI
Sbjct  94    NLKKLEAGLAAARALIGEAIKNLNHTTPLKDADYIPKGDIYRNAYAFHRSYLLMEKMFKI  153

Query  859   FVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVHFV  1035
             +VYEEGE P+FHNGPCK+IY+ EG F+  MET + FRTR+PE AHV+FLP S+  IV ++
Sbjct  154   YVYEEGELPIFHNGPCKNIYSMEGLFLSFMETDTKFRTREPENAHVYFLPFSVVMIVEYL  213

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             +   + +K     +++TV DY+ +++ +Y YWNRSLGADH ML+CHDWGP  +  V +L+
Sbjct  214   FHPIIRDKA---VLERTVVDYVRIISNRYPYWNRSLGADHVMLSCHDWGPRATWYVKQLY  270

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
               +IR LCNANTSE F P KD S PEI L  G + GLIGG  PS+R+ILAFFAG +HG I
Sbjct  271   FVAIRVLCNANTSEHFNPKKDASFPEINLETGEITGLIGGLHPSKRTILAFFAGRMHGRI  330

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RP L EHW+ KD D+ V+  LP+ +SY++ML+K+K+CICPSG+EVASPR+VEA+Y  CVP
Sbjct  331   RPFLFEHWKGKDRDLLVYEKLPEELSYHDMLKKSKYCICPSGHEVASPRIVEAIYADCVP  390

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI  HYV PFSDVLNW SFSV+V V +IP LK+IL GI + +Y R+Q R    +RHF V
Sbjct  391   VLISQHYVLPFSDVLNWDSFSVQVSVSEIPKLKEILMGIPEEQYRRMQERVKQVQRHFVV  450

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRL  1833
             N PPKRYDV HMI+HS WLRRLNV++
Sbjct  451   NNPPKRYDVFHMIIHSIWLRRLNVQI  476



>ref|XP_008227724.1| PREDICTED: probable glycosyltransferase At3g07620 [Prunus mume]
Length=520

 Score =   477 bits (1228),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 231/392 (59%), Positives = 291/392 (74%), Gaps = 8/392 (2%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFHRSYLEMEKQFKI  858
             +LE+LEA+LG+AR++IR A    N+T  H   DYVP GP+Y N N FHRSYLEMEK FKI
Sbjct  133   HLEKLEASLGRARSSIREAAKVRNKTSTHQDPDYVPRGPIYRNPNAFHRSYLEMEKLFKI  192

Query  859   FVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFV  1035
             +VYEEG+ P+FH+GPC  +Y +EG FI+ ME    +RT DP +A V+FLP S+  +V F+
Sbjct  193   YVYEEGQVPIFHDGPCFHMYLTEGRFIHEMENGKLYRTTDPNQALVYFLPFSVVRMVQFL  252

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             Y    +++     +K  V DYINL+A K+ +WNRSLGADHFML+CHDWGP  +  VP LF
Sbjct  253   YLPDTYDRNG---LKLAVIDYINLIAHKHPFWNRSLGADHFMLSCHDWGPFTTAFVPHLF  309

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
               SIR LCNANTSEGF PSKD S+PEI L    +  L GG  PS+RS LAFFAGGLHG I
Sbjct  310   HKSIRVLCNANTSEGFNPSKDASLPEIKLLTPEIPRL-GGQPPSKRSTLAFFAGGLHGHI  368

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             R +LL  W+ KD DV V+  +P G+SY EM++ +KFC+CPSGYEVASPR+VEA+Y  CVP
Sbjct  369   RYLLLNEWKGKDQDVLVYEKVPHGVSYEEMMKSSKFCLCPSGYEVASPRVVEAIYAECVP  428

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI D Y+ PFSDVL+WKSFSV+VPV++I ++K IL  IS R+Y+R+QRR    +RHF +
Sbjct  429   VLISDGYIPPFSDVLDWKSFSVQVPVKNISDMKNILMSISNRQYLRMQRRLKQVQRHFLM  488

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRLHGIEDT  1851
             N PPKRYDV HMI+HS WLRRLN+R+  +  T
Sbjct  489   NGPPKRYDVFHMIVHSIWLRRLNIRIQDLLST  520



>ref|XP_004503012.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=488

 Score =   473 bits (1216),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 232/390 (59%), Positives = 288/390 (74%), Gaps = 7/390 (2%)
 Frame = +1

Query  679   KFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             K+  LER+E+ L KAR +I+ A    N T    D DYVP GP+Y NA  FHRSYLEMEK 
Sbjct  99    KYTQLERIESKLVKARYSIKEASKVRNLTSTHQDQDYVPHGPIYRNAKAFHRSYLEMEKI  158

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIV  1026
             FKIFVYEEGEPP+FHNG  K+IY++EG FI  ME    +RT DP++A V+FLP S+  +V
Sbjct  159   FKIFVYEEGEPPMFHNGLSKNIYSTEGRFINEMEKWRYYRTNDPDEAFVYFLPFSVVMMV  218

Query  1027  HFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVP  1206
              ++Y   VH       +  +V DYI++++ KY +WN+SLG DHFML+CHDWGP  S  V 
Sbjct  219   EYLY---VHGSNDRSSIGLSVQDYIHIISHKYPFWNQSLGHDHFMLSCHDWGPIASAYVD  275

Query  1207  ELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLH  1386
              LF NSIR LCNAN SEGFKPSKDVS PE+ L  G + GL+GG  PS+R+ LAFFAG LH
Sbjct  276   NLFNNSIRVLCNANISEGFKPSKDVSFPEMNLKTGEVTGLVGGYPPSQRTTLAFFAGHLH  335

Query  1387  GPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
             G IR +LL  W+NKD DVQV+  LP   SY   LR +KFC+CPSGYEVASPR+VEA++  
Sbjct  336   GHIRYLLLNTWKNKDQDVQVYDELPHEDSYNTKLRSSKFCLCPSGYEVASPRIVEAIFAE  395

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             CVPVLI D+YV PFSDVLNWKSFSV++ V++IPN+KKIL GISQR+Y+++Q R    +RH
Sbjct  396   CVPVLISDNYVPPFSDVLNWKSFSVQIDVKEIPNIKKILMGISQRQYLKMQGRVKQVQRH  455

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             F  N PP+R+DV HM +HS WLRRLN+R+H
Sbjct  456   FVPNEPPERFDVFHMTIHSIWLRRLNIRIH  485



>ref|XP_009417384.1| PREDICTED: probable glycosyltransferase At5g03795 [Musa acuminata 
subsp. malaccensis]
Length=378

 Score =   468 bits (1203),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 227/368 (62%), Positives = 285/368 (77%), Gaps = 7/368 (2%)
 Frame = +1

Query  718   KARAAIRAAVHG---INQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPV  888
             +ARAAI+ A      ++   D DYVP GP Y +A  FHRSYLEMEK FK++VYEEGEPP+
Sbjct  2     RARAAIKEAFRNHSNVSPLFDKDYVPQGPSYRDAYAFHRSYLEMEKLFKVYVYEEGEPPL  61

Query  889   FHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEH  1065
             FH+GPC+SIY+SEG FI+ ++    FRTRDP+ AHVFFLP S+  +V  +Y     +   
Sbjct  62    FHDGPCRSIYSSEGRFIHGIDMDTWFRTRDPDLAHVFFLPFSVVKMVKLIYKPKSFDIS-  120

Query  1066  WLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNA  1245
               P+ +T++DYI+++A +Y YWNRSLGADHFML+CHDWGP  S+A   L+ +SIR LCNA
Sbjct  121   --PITRTIADYISVIAERYPYWNRSLGADHFMLSCHDWGPHASEAHSHLYGDSIRVLCNA  178

Query  1246  NTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWEN  1425
             NTSEGF P KDVS+PEI L    M  ++GGPS SRR +LAFFAGG HGP+RP+LL+ W+ 
Sbjct  179   NTSEGFDPRKDVSLPEINLKTDVMADMMGGPSASRRPVLAFFAGGDHGPVRPLLLQAWKG  238

Query  1426  KDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAP  1605
             +D  VQVH YLP+G+SYY M+R+++FC+CPSGYEVASPR+VEA+Y GCVPV I   YV P
Sbjct  239   RDPSVQVHEYLPRGVSYYAMMRRSRFCLCPSGYEVASPRVVEAIYLGCVPVTISHRYVLP  298

Query  1606  FSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVT  1785
             FSDVLNWK+FSV+V  EDIP+LK+ILT IS R+YIR+QRR  + RRHFEVN PP+R+DV 
Sbjct  299   FSDVLNWKAFSVQVSPEDIPDLKRILTAISPRQYIRMQRRVRMVRRHFEVNSPPRRFDVF  358

Query  1786  HMILHSAW  1809
             HMILHS W
Sbjct  359   HMILHSVW  366



>gb|KHN09672.1| Putative glycosyltransferase, partial [Glycine soja]
Length=399

 Score =   468 bits (1205),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 233/391 (60%), Positives = 289/391 (74%), Gaps = 9/391 (2%)
 Frame = +1

Query  679   KFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             K+  L  +EA L KAR +IR A    N T    D DYVP G +Y NAN FHRSYLEMEK 
Sbjct  11    KYTKLGSIEARLAKARYSIREASKIPNFTPTLQDPDYVPQGSIYRNANAFHRSYLEMEKV  70

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPF-RTRDPEKAHVFFLPISITAIV  1026
             FKIFVYEEGEPP+FHNG  K IYA+EG FI+ ME   + RT DP++A V++LP S+  +V
Sbjct  71    FKIFVYEEGEPPLFHNGLSKDIYATEGRFIHEMEKGRYYRTYDPDEAFVYYLPFSVVMLV  130

Query  1027  HFVYDR-SVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
              +VYDR S +N +   P+   V DYI ++A K+ +WNRSLG DH ML+CHDWGP +S  V
Sbjct  131   EYVYDRGSNYNLD---PLGLVVKDYIQIIAHKHPFWNRSLGHDHVMLSCHDWGPLVSSYV  187

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
               L+ N+IR LCNANTSEGFKP+KDVS PEI L  G + GL GG  PS+R+ILAFFAG L
Sbjct  188   DHLYNNAIRVLCNANTSEGFKPAKDVSFPEIKLIKGEVKGL-GGYPPSQRTILAFFAGHL  246

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HG IR +LL  W+NKD D+Q++  LP+GISYY  LR +KFC+CPSGYEVASPR+VEA++ 
Sbjct  247   HGYIRYLLLSTWKNKDQDMQIYEELPEGISYYTKLRSSKFCLCPSGYEVASPRVVEAIFA  306

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
              CVPVLI D YV PFSDVLNW SFSV+V V+DIPN+K+IL  IS+++Y+R+ +R    +R
Sbjct  307   ECVPVLISDSYVPPFSDVLNWNSFSVQVNVKDIPNIKRILMEISEKQYLRMHKRVKQVQR  366

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             HF  N PPKRYD+ HM +HS WLRRLN+ + 
Sbjct  367   HFVPNEPPKRYDMFHMTVHSIWLRRLNINIQ  397



>ref|XP_011085648.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=438

 Score =   469 bits (1208),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 227/392 (58%), Positives = 285/392 (73%), Gaps = 14/392 (4%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAVHG--INQTDDHD--------YVPTGPVYWNANVFHRSYLEM  840
             L++ EA L KAR +IR       +N T D +        Y+P GPVY N   F RSY EM
Sbjct  47    LKKAEAVLAKARFSIRDVAQSKLVNSTSDQEHDDDDDDDYIPQGPVYRNPTAFLRSYQEM  106

Query  841   EKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSPF-RTRDPEKAHVFFLPISIT  1017
             EK FKI+VYEEGE P+FH+GPC+SIY++EGNFIY +E   F RT DP +AHVFFLP S+ 
Sbjct  107   EKVFKIYVYEEGERPIFHHGPCRSIYSTEGNFIYELERGSFYRTNDPREAHVFFLPFSVV  166

Query  1018  AIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
              +V ++Y+    +++    +   V+DY+  ++ +Y +WN SLGADHFML+CHDWGP  +K
Sbjct  167   GLVQYLYEAGSRDRK---AIAGVVADYVQTISFRYPFWNSSLGADHFMLSCHDWGPYSTK  223

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAG  1377
             +VP+LF NSIR LCNANTSEGF P KDVS+PEI L  G M GL+GG  PS+R ILAFFAG
Sbjct  224   SVPKLFSNSIRVLCNANTSEGFNPLKDVSLPEINLNTGDMSGLLGGSPPSQRPILAFFAG  283

Query  1378  GLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEAL  1557
              LHG IR ILL+ W+ KD+DVQV+  LP+ ISY  MLR +KFC+CPSGYEVASPR+VEA+
Sbjct  284   RLHGHIRRILLKQWKGKDHDVQVYDELPRNISYESMLRNSKFCLCPSGYEVASPRVVEAI  343

Query  1558  YTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIA  1737
             Y  CVPVLI   YV P SDVL W+ F+V V  EDIPN+KKIL GI + +Y+R+ +R    
Sbjct  344   YAECVPVLISKGYVPPLSDVLKWEEFAVAVAEEDIPNVKKILMGIPKEKYLRMHKRLREV  403

Query  1738  RRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +RHF +N PPKR+D+ HMILHS WLRRLNVR+
Sbjct  404   QRHFVMNGPPKRFDLFHMILHSIWLRRLNVRI  435



>ref|XP_004305861.1| PREDICTED: probable glycosyltransferase At3g07620-like [Fragaria 
vesca subsp. vesca]
Length=465

 Score =   468 bits (1205),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 223/388 (57%), Positives = 286/388 (74%), Gaps = 8/388 (2%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYLEMEKQFKI  858
             NLER+EA L  AR  IR A   +NQT   +D DYVP G +Y NA  FHRSYL ME  F+ 
Sbjct  82    NLERIEAGLATARELIREAT-TLNQTSPLEDADYVPNGDIYRNAYAFHRSYLLMESLFRT  140

Query  859   FVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVHFV  1035
             FVYEEGEPP+FHNGPCK+IY+ EG F+  MET + FRT DPE+AHV+FLP S+  I+ ++
Sbjct  141   FVYEEGEPPIFHNGPCKNIYSMEGLFLSFMETDTKFRTSDPEEAHVYFLPFSVVMIIEYL  200

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             +   + +K     +++TV DY+ +++ KY +WNRSLGADH ML+CHDWGP  +  V +L+
Sbjct  201   FHPVIRDKA---VLQRTVVDYVRVISNKYPFWNRSLGADHVMLSCHDWGPRATWYVRQLY  257

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
               +IR LCNANTSE F P KD S PEI L  G + GLIGG  PS+RS+LAFFAG +HG I
Sbjct  258   FVAIRVLCNANTSEHFNPKKDASFPEINLVTGEITGLIGGLPPSKRSVLAFFAGRMHGRI  317

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RP+L +HW+ KD ++ V+  LPK  SY +ML+++K+CICPSG+EVASPR+VEA+Y  CVP
Sbjct  318   RPLLFQHWKEKDENLLVYEKLPKNASYQDMLKQSKYCICPSGHEVASPRIVEAIYAECVP  377

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI  HYV PFSDVL+W+SFS++V V +IP LK+IL  I + +Y R+Q R    + HF V
Sbjct  378   VLISQHYVLPFSDVLDWESFSIQVSVSEIPQLKEILMRIPEEKYRRMQERVKQVQMHFVV  437

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
             N PPKRYDV HMI+HS WLRRLNVR++ 
Sbjct  438   NNPPKRYDVFHMIIHSIWLRRLNVRIYS  465



>ref|XP_010107365.1| putative glycosyltransferase [Morus notabilis]
 gb|EXC15616.1| putative glycosyltransferase [Morus notabilis]
Length=468

 Score =   468 bits (1203),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 229/393 (58%), Positives = 283/393 (72%), Gaps = 9/393 (2%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQT-----DDHDYVPTGPVYWNANVFHRSYLE  837
             K +   L +LEA+L  ARA IR A   +NQT     +D DYVP G VY NA  FH SYL 
Sbjct  77    KHRDEKLAKLEADLATARALIREATKKVNQTKKSFLEDADYVPQGEVYKNAYAFHWSYLL  136

Query  838   MEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS-PFRTRDPEKAHVFFLPISI  1014
             ME+ F+IFVYEEGEPP+FHNGPCKSIY++EG F+  MET   FRT DP++AHV+FLP S+
Sbjct  137   MERVFRIFVYEEGEPPIFHNGPCKSIYSTEGMFLSFMETDIHFRTWDPDEAHVYFLPFSV  196

Query  1015  TAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEIS  1194
               +V +++D  + +K     +++TV DY+  ++ KY +WNRSLGADHFML+CHDWGP  +
Sbjct  197   VMMVKYLFDPIIRDKA---VLQRTVVDYVQTISHKYPHWNRSLGADHFMLSCHDWGPRAT  253

Query  1195  KAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFA  1374
               VP+L+ NSIR LCNANTSE F P KD S PEI L  G +  L GG   S R  LAFFA
Sbjct  254   WYVPQLYYNSIRVLCNANTSEHFNPKKDASFPEINLKTGQISSLTGGSPLSDRKTLAFFA  313

Query  1375  GGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
             G  HG IR +L  HW+ KD DV+V+  LPK ISY +MLR ++FC+CPSG+EVASPR+VEA
Sbjct  314   GQRHGRIRQVLFHHWKEKDRDVKVYETLPKEISYEKMLRTSRFCLCPSGHEVASPRVVEA  373

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             +Y  CVPVLI   YV PFSDVLNW+SF+V V VE+IP LK+IL GIS  +Y  L+R   +
Sbjct  374   IYAECVPVLISQQYVPPFSDVLNWESFAVSVSVEEIPKLKEILLGISLVQYENLRRNVKL  433

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              +RHF +N PPK YDV HMILHS WLRRLNVR+
Sbjct  434   VQRHFVLNDPPKGYDVFHMILHSIWLRRLNVRI  466



>ref|XP_009361503.1| PREDICTED: probable glycosyltransferase At3g07620 [Pyrus x bretschneideri]
Length=512

 Score =   468 bits (1205),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 225/396 (57%), Positives = 290/396 (73%), Gaps = 7/396 (2%)
 Frame = +1

Query  658   LQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRS  828
             LQ   ++   NL++LEA L  ARA I  A+   N T    D DY+P G +Y NA  FHRS
Sbjct  120   LQRDWQKGDENLKKLEAGLAAARALIGEAIKNPNHTTPLKDADYIPKGDIYRNAYAFHRS  179

Query  829   YLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLP  1005
             YL MEK FKI+VYEEGE P+FHNGPCK+IY++EG F+  +ET + FRTR+PE AHV+FLP
Sbjct  180   YLLMEKMFKIYVYEEGELPIFHNGPCKNIYSTEGLFLSFIETDTKFRTREPENAHVYFLP  239

Query  1006  ISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGP  1185
              S+  IV +++   + +K     +++TV DY+ +++ +Y YWNRSLGADH ML+CHDWGP
Sbjct  240   FSVVMIVEYLFHPIIRDKA---VLERTVVDYVRIISNRYPYWNRSLGADHVMLSCHDWGP  296

Query  1186  EISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILA  1365
               +  V +L+  +IR LCNANTSE F P KD S PEI L  G + GLIGG  PS+R+ILA
Sbjct  297   RATWYVKQLYFVAIRVLCNANTSEHFNPKKDASFPEINLETGEITGLIGGLHPSKRTILA  356

Query  1366  FFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FFAG +HG IRP L EHW+ KD D+ V+  LP+ +SY++ML+K+K+CICPSG+EVASPR+
Sbjct  357   FFAGRMHGRIRPFLFEHWKGKDRDLLVYEKLPEELSYHDMLKKSKYCICPSGHEVASPRI  416

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             VEA+Y  CVPVLI  HYV PFSDVLNW SFSV+V V +IP LK+IL  I + +Y R+Q R
Sbjct  417   VEAIYAECVPVLISQHYVLPFSDVLNWDSFSVQVSVSEIPKLKEILMEIPEEQYRRMQER  476

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
                 +RHF VN PPKR+D+ HMI+HS WLRRLNV++
Sbjct  477   VKQVQRHFVVNNPPKRFDIFHMIIHSIWLRRLNVQI  512



>ref|XP_011100587.1| PREDICTED: probable glycosyltransferase At3g07620 [Sesamum indicum]
Length=548

 Score =   469 bits (1208),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 223/383 (58%), Positives = 285/383 (74%), Gaps = 9/383 (2%)
 Frame = +1

Query  679   KFRNLERLEANLGKARAAIRAAVHGINQTDDH-----DYVPTGPVYWNANVFHRSYLEME  843
             ++   E++EA L KAR +IR A    N++        DYVP GP+Y+NAN F+RSY EME
Sbjct  157   RYGRSEKVEAILAKARYSIREAARNNNRSFISSSSGSDYVPQGPIYFNANAFYRSYTEME  216

Query  844   KQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITA  1020
             K FKI+VYEEGE P+FH GPC+SIY +EG FI+ ME    +RTRD E+AHV+F+P S+ A
Sbjct  217   KVFKIYVYEEGEAPIFHGGPCRSIYTTEGRFIHEMERGELYRTRDAEEAHVYFMPFSVVA  276

Query  1021  IVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKA  1200
             +V ++Y+    + +    M  T++DY++ +A  + +WNRSLGADHFML+CHDWGP  S  
Sbjct  277   MVQYLYEPGAVDMD---AMGNTLADYVHTIAHNHPFWNRSLGADHFMLSCHDWGPYTSSY  333

Query  1201  VPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGG  1380
             VP LF NSIR LCNANTSEGF P KD ++PEI L  G + GL+GGP PS RSILAFFAGG
Sbjct  334   VPLLFNNSIRVLCNANTSEGFNPIKDATLPEINLKFGEITGLLGGPPPSERSILAFFAGG  393

Query  1381  LHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALY  1560
             LHG IR ILL+HW+ KD D++V+  LP  +SY  ML+ +KFC+CPSGYEVASPR+VEA+Y
Sbjct  394   LHGDIRHILLDHWKEKDPDIRVYEKLPPNVSYEAMLKNSKFCLCPSGYEVASPRIVEAIY  453

Query  1561  TGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIAR  1740
             + CVPVLI DHYV PFSDVLNWK FS+ V VEDIPN+K IL GIS+ +Y+++Q R    +
Sbjct  454   SECVPVLISDHYVPPFSDVLNWKKFSIVVGVEDIPNIKTILMGISRAKYLKMQMRVKQVQ  513

Query  1741  RHFEVNLPPKRYDVTHMILHSAW  1809
             RHF +N  PKR+D+ HMI+HS W
Sbjct  514   RHFVLNGTPKRFDLFHMIVHSVW  536



>ref|XP_008337560.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=390

 Score =   462 bits (1190),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 224/377 (59%), Positives = 274/377 (73%), Gaps = 7/377 (2%)
 Frame = +1

Query  640   NETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNA  810
             N T   +  T  +++  LE+LEANL   R +IR A    N T  H   DYVP GP+Y NA
Sbjct  13    NGTSAIITSTPIKRYSRLEKLEANLAGVRXSIREAARVRNLTSTHEDPDYVPHGPIYRNA  72

Query  811   NVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKA  987
             N FHRSYLEMEK FKIFVY EGEPP+FHNGPCKSIY++EG  I+ ME  + +RTRDP++A
Sbjct  73    NAFHRSYLEMEKHFKIFVYGEGEPPIFHNGPCKSIYSTEGRSIHEMEMENVYRTRDPDEA  132

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
              V+FLP S+  +V ++Y    H+ +   P+ + V DY+N+++ K+ +WNRSLGADHFM +
Sbjct  133   LVYFLPFSVVMLVQYLYVADSHDTZ---PIGRAVIDYVNVISDKHPFWNRSLGADHFMJS  189

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
             CH WGP  S  VP L+ NSIR LCNANTSEGF PSKDVS PEI L  G   GL+GG SPS
Sbjct  190   CHHWGPSTSAYVPNLYHNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGETEGLLGGLSPS  249

Query  1348  RRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
              RSILAFFAG L G IR +LL  W+ KD DVQV+   P G+SY  ML+K +FC+CPSGYE
Sbjct  250   XRSILAFFAGRLSGHIRYLLLNEWKEKDQDVQVYDQFPNGVSYESMLKKNRFCLCPSGYE  309

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA+Y  CVPVLI D YV PFSDVL WKSFSV+V V+DIPN+K+IL GISQ +Y
Sbjct  310   VASPRVVEAIYAECVPVLISDSYVPPFSDVLEWKSFSVQVKVKDIPNIKRILKGISQSQY  369

Query  1708  IRLQRRGLIARRHFEVN  1758
             +R+QR     +RHF VN
Sbjct  370   LRMQRXVKQVQRHFVVN  386



>ref|XP_003555678.1| PREDICTED: probable glycosyltransferase At3g07620-like [Glycine 
max]
Length=493

 Score =   464 bits (1194),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 222/389 (57%), Positives = 283/389 (73%), Gaps = 9/389 (2%)
 Frame = +1

Query  685   RNLERLEANLGKARAAIRAAV-----HGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             R LE++EA+L KARA I+ A+       + Q D  DY+P G +Y NA  FHRSY  MEK 
Sbjct  107   RKLEKVEASLAKARALIKEALLLRTNATVLQDDTSDYIPEGDIYRNAVAFHRSYQLMEKV  166

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISITAIV  1026
             FKIFVYEEGEPP+FH GPCK+IY+ EG FI  +E  S FRT++P++AHV+FLP S+  I+
Sbjct  167   FKIFVYEEGEPPLFHYGPCKNIYSMEGIFINSLEINSQFRTQNPDEAHVYFLPFSVVMIL  226

Query  1027  HFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVP  1206
               ++   + +K     +++T+ DY+++++ KY YWNRS GADHFML+CHDWGP  +  V 
Sbjct  227   EHLFHPVIRDKA---VLERTIGDYVHIISHKYKYWNRSYGADHFMLSCHDWGPRATWYVK  283

Query  1207  ELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLH  1386
             EL+  +IR LCNAN SE F P KD S PEI L  G   GLIGG  P  R+ILAFFAG +H
Sbjct  284   ELYFIAIRVLCNANISEHFNPKKDASFPEINLVNGETRGLIGGYPPCNRTILAFFAGQMH  343

Query  1387  GPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
             G IRP+L +HWE KD DV V+  LP G+ Y+E ++K+K+CICPSG+EVASPR+VEA+Y  
Sbjct  344   GRIRPVLFQHWEGKDKDVLVYEKLPDGVPYHETMKKSKYCICPSGFEVASPRIVEAIYAQ  403

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             CVPV+I   YV PFSDVLNW SFSV++ V D+P LK+IL GIS+ +Y+RLQ      +RH
Sbjct  404   CVPVIISQQYVLPFSDVLNWDSFSVQILVSDVPKLKEILLGISEDKYMRLQEGVKQVQRH  463

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             F VN PPKRYDV HMI+HS WLRRLNVR+
Sbjct  464   FVVNNPPKRYDVFHMIIHSIWLRRLNVRV  492



>gb|KHN15414.1| Putative glycosyltransferase [Glycine soja]
Length=493

 Score =   464 bits (1194),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 222/389 (57%), Positives = 283/389 (73%), Gaps = 9/389 (2%)
 Frame = +1

Query  685   RNLERLEANLGKARAAIRAAV-----HGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             R LE++EA+L KARA I+ A+       + Q D  DY+P G +Y NA  FHRSY  MEK 
Sbjct  107   RKLEKVEASLAKARALIKEALLLRTNATVLQDDTSDYIPEGDIYRNAVAFHRSYQLMEKV  166

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISITAIV  1026
             FKIFVYEEGEPP+FH GPCK+IY+ EG FI  +E  S FRT++P++AHV+FLP S+  I+
Sbjct  167   FKIFVYEEGEPPLFHYGPCKNIYSMEGIFINSLEINSQFRTQNPDEAHVYFLPFSVVMIL  226

Query  1027  HFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVP  1206
               ++   + +K     +++T+ DY+++++ KY YWNRS GADHFML+CHDWGP  +  V 
Sbjct  227   EHLFHPVIRDKA---VLERTIGDYVHIISHKYKYWNRSYGADHFMLSCHDWGPRATWYVK  283

Query  1207  ELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLH  1386
             EL+  +IR LCNAN SE F P KD S PEI L  G   GLIGG  P  R+ILAFFAG +H
Sbjct  284   ELYFIAIRVLCNANISEHFNPKKDASFPEINLVNGETRGLIGGYPPCNRTILAFFAGQMH  343

Query  1387  GPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
             G IRP+L +HWE KD DV V+  LP G+ Y+E ++K+K+CICPSG+EVASPR+VEA+Y  
Sbjct  344   GRIRPVLFQHWEGKDKDVLVYEKLPDGVPYHETMKKSKYCICPSGFEVASPRIVEAIYAQ  403

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             CVPV+I   YV PFSDVLNW SFSV++ V D+P LK+IL GIS+ +Y+RLQ      +RH
Sbjct  404   CVPVIISQQYVLPFSDVLNWDSFSVQILVSDVPKLKEILLGISEDKYMRLQEGVKQVQRH  463

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             F VN PPKRYDV HMI+HS WLRRLNVR+
Sbjct  464   FVVNNPPKRYDVFHMIIHSIWLRRLNVRV  492



>ref|XP_006856555.1| hypothetical protein AMTR_s00046p00174470 [Amborella trichopoda]
 gb|ERN18022.1| hypothetical protein AMTR_s00046p00174470 [Amborella trichopoda]
Length=543

 Score =   461 bits (1185),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 221/394 (56%), Positives = 288/394 (73%), Gaps = 7/394 (2%)
 Frame = +1

Query  640   NETGTPLQVTIKR-KFRNLERLEANLGKARAAIRAAVHGINQT--DDHDYVPTGPVYWNA  810
             N T   L  + KR K R+L+RL+A L +AR++I+ A    N +      +VP G  Y N 
Sbjct  143   NSTDEVLSPSTKREKQRSLQRLDAQLARARSSIKRAARFCNDSCYGGDSFVPKGAAYRNP  202

Query  811   NVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKA  987
               F++SYLEMEK  K+++Y+EGEPP+ H+GPCKSIY+ EG FI+  ++ + F    PE A
Sbjct  203   YAFYQSYLEMEKTLKVWIYKEGEPPLVHDGPCKSIYSMEGQFIHEFDSGNRFVASSPEHA  262

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
             H+ F+P+SIT +VH +Y    + +    P+ + VSDYI++++ KY +WNR+ G+DHF L+
Sbjct  263   HLHFIPLSITKLVHHLYPPKTYGRG---PLHRVVSDYISIISRKYPFWNRTQGSDHFYLS  319

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
             CHDW P+ S+A PEL +NSIR LCNANTSEGF P KDVS+PEI L  G + GLIGGPSPS
Sbjct  320   CHDWAPDASEANPELNRNSIRVLCNANTSEGFDPRKDVSMPEIHLKTGRLDGLIGGPSPS  379

Query  1348  RRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
             RRSILAFFAG  HG IR +LL  W++KD+ VQVH YLPKG SY + +++ KFC+CPSGYE
Sbjct  380   RRSILAFFAGAQHGYIRSLLLRQWKDKDSQVQVHEYLPKGQSYSKQMQRAKFCLCPSGYE  439

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA+Y+GCVPV+I   YV PFSDVL+W+ FSV +PV  IP++K IL  ISQRRY
Sbjct  440   VASPRVVEAIYSGCVPVIISSSYVLPFSDVLDWRKFSVHIPVSKIPDIKTILERISQRRY  499

Query  1708  IRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAW  1809
             ++L RR L  +RHF VN P KR+DV HMILHS W
Sbjct  500   LQLYRRVLQVQRHFVVNRPAKRFDVIHMILHSIW  533



>ref|XP_004502077.1| PREDICTED: probable glycosyltransferase At3g07620-like [Cicer 
arietinum]
Length=465

 Score =   457 bits (1177),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 218/386 (56%), Positives = 284/386 (74%), Gaps = 8/386 (2%)
 Frame = +1

Query  685   RNLERLEANLGKARAAIRAAVHGINQT----DDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             RNLE++EA+L KARA+I+ A+  IN T    D HDY+P G +Y NA  FHRSY  MEK F
Sbjct  80    RNLEKVEASLAKARASIKQALLRINDTLPLEDSHDYIPQGDIYRNAFAFHRSYYLMEKLF  139

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVH  1029
             KIFVYEEGEPP+FH GPCK+IY+ EG FI  +E+ + FRT++P++AHV+FLP S+  I+ 
Sbjct  140   KIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLESNTQFRTQNPDEAHVYFLPFSVVMILE  199

Query  1030  FVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPE  1209
              ++   + +K     + +T+ DY+++++ KY YWNRS GADHFML+CHDWGP  +  V E
Sbjct  200   HLFHPVIRDKA---VLGRTIGDYVHIISHKYTYWNRSYGADHFMLSCHDWGPRATWYVKE  256

Query  1210  LFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHG  1389
             L+  +IR LCNAN SE F P KD S PEI L  G   GLIGG     R+ILAFFAG +HG
Sbjct  257   LYFIAIRVLCNANISEHFNPKKDASFPEINLVTGETTGLIGGYPQWNRTILAFFAGQMHG  316

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
              IRP+L +HW+NKD D+ V+  LP+ +SY+E ++ +K+CICPSGYEVASPR+VEA+Y  C
Sbjct  317   RIRPMLFQHWKNKDKDMLVYEKLPENVSYHETMKMSKYCICPSGYEVASPRIVEAIYAEC  376

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             VPV+I  +YV PFSDVL+W  FSV++ V +IP LK+IL GIS+ +Y+RL       +RHF
Sbjct  377   VPVIISQNYVLPFSDVLDWDCFSVQIQVSEIPKLKEILLGISEEKYVRLYEGVKKVQRHF  436

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNV  1827
              +N PPKRYDV HMI+HS WLRRLNV
Sbjct  437   VMNNPPKRYDVFHMIVHSIWLRRLNV  462



>ref|XP_007213348.1| hypothetical protein PRUPE_ppa1027150mg, partial [Prunus persica]
 gb|EMJ14547.1| hypothetical protein PRUPE_ppa1027150mg, partial [Prunus persica]
Length=389

 Score =   454 bits (1169),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 227/398 (57%), Positives = 280/398 (70%), Gaps = 24/398 (6%)
 Frame = +1

Query  661   QVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDH---DYVPTGPVYWNANVFHRSY  831
             +    R    L+RLEA+LG+AR++IR A    N+T  H   DYVP GP+Y N N FHRSY
Sbjct  10    KTVFMRSSGQLDRLEASLGRARSSIREAAKVRNKTSTHQDADYVPRGPIYRNPNAFHRSY  69

Query  832   LEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPI  1008
             LEMEK FKI+VYEEG+                G FI+ ME  + +RTRDP KA V+FLP 
Sbjct  70    LEMEKLFKIYVYEEGD----------------GRFIHEMEKGNMYRTRDPNKALVYFLPF  113

Query  1009  SITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPE  1188
             S+  +V ++Y   + N      MK  + DY+NL+A K+ +WNRSLGADHFML+CHDW P 
Sbjct  114   SVVRMVQYLY---MPNSNDRHGMKLAIIDYVNLIAQKHPFWNRSLGADHFMLSCHDWAPF  170

Query  1189  ISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAF  1368
              +  VP LF  SIR LCNANTSEGF PSKD S PEI L    M GL GG SPS RS LAF
Sbjct  171   TTSFVPLLFHKSIRVLCNANTSEGFNPSKDASFPEINLKTSEMSGL-GGQSPSTRSTLAF  229

Query  1369  FAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMV  1548
             FAG LHG IR +LL  W+ KD DVQV+  LP+G+SY +ML+ +KFC+CPSGYEVASPR+V
Sbjct  230   FAGRLHGHIRSLLLNEWKGKDQDVQVYDQLPRGVSYEKMLKGSKFCLCPSGYEVASPRVV  289

Query  1549  EALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRG  1728
             EA+Y  C+PVLI D Y+ PFSDVL+WKSFSV+VPV++I ++K IL  IS R+Y+R+QRR 
Sbjct  290   EAIYAECIPVLISDGYIPPFSDVLDWKSFSVQVPVKNISDIKNILMSISSRQYLRMQRRV  349

Query  1729  LIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHGI  1842
                +RHF VN PPKRYDV HMI+HS WLRRLN+R+  +
Sbjct  350   KQVQRHFLVNGPPKRYDVFHMIVHSIWLRRLNIRIQDL  387



>ref|XP_008652150.1| PREDICTED: probable glycosyltransferase At5g03795 [Zea mays]
Length=579

 Score =   461 bits (1186),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 234/418 (56%), Positives = 300/418 (72%), Gaps = 23/418 (6%)
 Frame = +1

Query  652   TPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTD---DHDYVPTGPVYWNANVFH  822
             TP QV  +R    LERLE  L +AR+AI  A+   ++     D DYVP GPVY NA+VFH
Sbjct  165   TPPQVERRRDDVKLERLELGLARARSAIMEAIRKKDKVSPLPDKDYVPMGPVYRNAHVFH  224

Query  823   RSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-------FRTRDPE  981
             RSYLEME+Q K++VYEEGEPPVFH+GPC+SIY++EG FI+ MET          RTRDP 
Sbjct  225   RSYLEMERQLKVYVYEEGEPPVFHDGPCRSIYSTEGRFIHSMETETEAEEGRRLRTRDPA  284

Query  982   KAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFM  1161
             +AHVFFLP S+  +V  +Y+    +     P+K+TV+DY+ +++ KY YWNRSLGADHFM
Sbjct  285   RAHVFFLPFSVVKMVQTIYEPGSRDMA---PLKRTVADYVRVLSSKYPYWNRSLGADHFM  341

Query  1162  LACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPS  1341
             L+CHDWGP +S A  +LF NSIR LCNANTSEGF P++DVS+P++ L    +   +GGPS
Sbjct  342   LSCHDWGPYVSSANAQLFGNSIRVLCNANTSEGFDPARDVSLPQVNLRSDAVERQVGGPS  401

Query  1342  PSRRSILAFFAGGLHGPIRPILLEHW-----ENKDNDVQVHRYLPKG---ISYYEMLRKT  1497
              SRR +LAFFAGG HGP+RP LL HW        D DV+V  YLP+G    SY +M+R++
Sbjct  402   ASRRPVLAFFAGGNHGPVRPALLAHWGPGGRRGGDPDVRVSEYLPRGGGAPSYADMMRRS  461

Query  1498  KFCICPSGYEVASPRMVEALYTGCVPVLIKD-HYVAPFSDVLNWKSFSVEVPVEDIPNLK  1674
             +FC+CP GYEVASPR+ EALY GCVPV++ D  Y  PF+DVL+W +F++ + V DIP LK
Sbjct  462   RFCLCPGGYEVASPRLAEALYLGCVPVVVDDGEYALPFADVLDWDAFALRLRVADIPRLK  521

Query  1675  KILTGISQRRYIRLQRRGLIARRHFEVN-LPPKRYDVTHMILHSAWLRRLNVRLHGIE  1845
             +IL  +S R+YIR+QRR  + RRHF ++  PP+RYD  HMILHS WLRRLNVR+   E
Sbjct  522   EILAAVSPRQYIRMQRRVRMVRRHFMLHGGPPRRYDAFHMILHSVWLRRLNVRIAAAE  579



>ref|XP_002524592.1| catalytic, putative [Ricinus communis]
 gb|EEF37800.1| catalytic, putative [Ricinus communis]
Length=388

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 219/387 (57%), Positives = 282/387 (73%), Gaps = 10/387 (3%)
 Frame = +1

Query  691   LERLEANLGKARAAIRAAVHGINQT-----DDHDYVPTGPVYWNANVFHRSYLEMEKQFK  855
             LERLEA L  ARA I+ A   ++Q       D DYVP G +Y N+  FHRSYL MEK FK
Sbjct  4     LERLEAGLAMARALIKEA-SSLDQNYTSLHKDIDYVPHGDIYRNSCAFHRSYLLMEKLFK  62

Query  856   IFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISITAIVHF  1032
             IFVYEEGEPP+ H GPCK+IY+ EG F+  MET + FRT +P++A VFFLP S+  I+  
Sbjct  63    IFVYEEGEPPLLHYGPCKNIYSMEGLFLSLMETDTKFRTLNPDEAQVFFLPFSVVMIIEH  122

Query  1033  VYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPEL  1212
             ++   + +K     +++TV DY+ +++ KY YWNRSLGADHFML+CHDWGP  +    +L
Sbjct  123   LFHPIIRDKA---VLERTVVDYVRIISHKYTYWNRSLGADHFMLSCHDWGPRATWYERQL  179

Query  1213  FKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGP  1392
             + NSIR LCNANTSE F P KD S PEI L  G +  L GG  PS R+ILAFF+G +HG 
Sbjct  180   YFNSIRVLCNANTSEYFNPKKDASFPEINLITGEIADLTGGLPPSNRTILAFFSGKMHGK  239

Query  1393  IRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCV  1572
             +RP+L +HW+ KD DV V+   P+G+SY EM++K+++CICPSG+EVASPR+VEA+Y  CV
Sbjct  240   LRPLLFQHWKEKDKDVLVYETFPEGLSYQEMMKKSRYCICPSGHEVASPRIVEAIYAECV  299

Query  1573  PVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFE  1752
             PVLI  +YV PFSDVLNW+SFS++V V DI NLK IL GI + +Y+R++ R    ++HF 
Sbjct  300   PVLISQNYVFPFSDVLNWESFSIQVSVSDISNLKNILLGIPEDQYLRMRERVKQVQQHFL  359

Query  1753  VNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +N PPKRYDV HMI+HS WLRRLNV+L
Sbjct  360   INNPPKRYDVFHMIIHSIWLRRLNVKL  386



>tpg|DAA59884.1| TPA: hypothetical protein ZEAMMB73_690759, partial [Zea mays]
Length=577

 Score =   459 bits (1182),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 233/414 (56%), Positives = 299/414 (72%), Gaps = 23/414 (6%)
 Frame = +1

Query  652   TPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTD---DHDYVPTGPVYWNANVFH  822
             TP QV  +R    LERLE  L +AR+AI  A+   ++     D DYVP GPVY NA+VFH
Sbjct  165   TPPQVERRRDDVKLERLELGLARARSAIMEAIRKKDKVSPLPDKDYVPMGPVYRNAHVFH  224

Query  823   RSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-------FRTRDPE  981
             RSYLEME+Q K++VYEEGEPPVFH+GPC+SIY++EG FI+ MET          RTRDP 
Sbjct  225   RSYLEMERQLKVYVYEEGEPPVFHDGPCRSIYSTEGRFIHSMETETEAEEGRRLRTRDPA  284

Query  982   KAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFM  1161
             +AHVFFLP S+  +V  +Y+    +     P+K+TV+DY+ +++ KY YWNRSLGADHFM
Sbjct  285   RAHVFFLPFSVVKMVQTIYEPGSRDMA---PLKRTVADYVRVLSSKYPYWNRSLGADHFM  341

Query  1162  LACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPS  1341
             L+CHDWGP +S A  +LF NSIR LCNANTSEGF P++DVS+P++ L    +   +GGPS
Sbjct  342   LSCHDWGPYVSSANAQLFGNSIRVLCNANTSEGFDPARDVSLPQVNLRSDAVERQVGGPS  401

Query  1342  PSRRSILAFFAGGLHGPIRPILLEHW-----ENKDNDVQVHRYLPKG---ISYYEMLRKT  1497
              SRR +LAFFAGG HGP+RP LL HW        D DV+V  YLP+G    SY +M+R++
Sbjct  402   ASRRPVLAFFAGGNHGPVRPALLAHWGPGGRRGGDPDVRVSEYLPRGGGAPSYADMMRRS  461

Query  1498  KFCICPSGYEVASPRMVEALYTGCVPVLIKD-HYVAPFSDVLNWKSFSVEVPVEDIPNLK  1674
             +FC+CP GYEVASPR+ EALY GCVPV++ D  Y  PF+DVL+W +F++ + V DIP LK
Sbjct  462   RFCLCPGGYEVASPRLAEALYLGCVPVVVDDGEYALPFADVLDWDAFALRLRVADIPRLK  521

Query  1675  KILTGISQRRYIRLQRRGLIARRHFEVN-LPPKRYDVTHMILHSAWLRRLNVRL  1833
             +IL  +S R+YIR+QRR  + RRHF ++  PP+RYD  HMILHS WLRRLNVR+
Sbjct  522   EILAAVSPRQYIRMQRRVRMVRRHFMLHGGPPRRYDAFHMILHSVWLRRLNVRI  575



>ref|XP_010096418.1| T-complex protein 1 subunit beta [Morus notabilis]
 gb|EXB64089.1| T-complex protein 1 subunit beta [Morus notabilis]
Length=1028

 Score =   473 bits (1218),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 230/377 (61%), Positives = 283/377 (75%), Gaps = 13/377 (3%)
 Frame = +1

Query  688   NLERLEANLGKARAAIR-AAVHGINQT-------DDHDYVPTGPVYWNANVFHRSYLEME  843
             +L +LEA L + RA+IR AA+   N T        D D+ P G +Y N N FHRSYLEME
Sbjct  134   SLHKLEARLVEVRASIREAALVARNFTPNSHDSLSDPDFTPKGHIYRNPNAFHRSYLEME  193

Query  844   KQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITA  1020
             K  KI+VYEEGEPPVFH+GPC+SIY+SEG FI+ +E    FRTRDP KA V+FLP S+  
Sbjct  194   KLMKIYVYEEGEPPVFHDGPCRSIYSSEGRFIHEIEKGGLFRTRDPNKALVYFLPFSVVN  253

Query  1021  IVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKA  1200
             +V ++Y    H+ +   PM++ V DY+NL+A K+ +WNRSLGADHFML+CHDWGP  S  
Sbjct  254   MVRYLYVPDSHDTK---PMRRVVVDYMNLIAHKHPFWNRSLGADHFMLSCHDWGPSTSSF  310

Query  1201  VPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGG  1380
             VP L+  SIRALCNANTSEGF+PSKDVS PEI L  G + GL GGPSPS+R+ILAFFAG 
Sbjct  311   VPHLYHRSIRALCNANTSEGFRPSKDVSFPEINLLTGEVRGL-GGPSPSKRTILAFFAGR  369

Query  1381  LHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALY  1560
             LHG IR +LL  W+NKD DVQV+  LP+ +SY +M++K+KFC+CPSGYEVASPR+VEA+Y
Sbjct  370   LHGYIRYLLLNQWKNKDQDVQVYDQLPRRVSYQDMMKKSKFCLCPSGYEVASPRVVEAIY  429

Query  1561  TGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIAR  1740
              GCVPVLI D YV PF+DVLNWKSFSV++ V DIP +K+IL GIS R Y RLQR   + +
Sbjct  430   AGCVPVLISDGYVPPFNDVLNWKSFSVQIKVNDIPKIKEILMGISTRHYSRLQRTLKLVQ  489

Query  1741  RHFEVNLPPKRYDVTHM  1791
             RHF VN  PKRYD+  +
Sbjct  490   RHFLVNATPKRYDIDRI  506



>gb|AES71688.2| exostosin family protein [Medicago truncatula]
Length=445

 Score =   454 bits (1168),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 219/387 (57%), Positives = 281/387 (73%), Gaps = 9/387 (2%)
 Frame = +1

Query  685   RNLERLEANLGKARAAIRAAVHGINQT-----DDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             +NLE++E +L KARA I+ A+   N T     D HDYVP G +Y NA  FHRSY  MEK 
Sbjct  59    KNLEKVEGSLAKARALIKQALLRTNDTVVPLEDSHDYVPQGHIYRNAFAFHRSYQLMEKL  118

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIV  1026
             FKIFVYEEGEPP+FH GPCK+IY+ EG FI  +E +  FRT++P +AHV+FLP S+  I+
Sbjct  119   FKIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLENNTLFRTQNPNEAHVYFLPFSVVMIL  178

Query  1027  HFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVP  1206
               ++   + +K     + +T+ DY+++++ KYAYWNRS GADHFML+CHDWGP  +  V 
Sbjct  179   EHLFHPVIRDKA---VLGRTIGDYVHIISHKYAYWNRSYGADHFMLSCHDWGPRATWYVK  235

Query  1207  ELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLH  1386
             EL+  +IR LCNAN SE F P KD S PEI L  G   GL+GG     R+ILAFFAG ++
Sbjct  236   ELYFIAIRVLCNANISEHFNPKKDASFPEINLVSGETTGLLGGYPTWNRTILAFFAGQMN  295

Query  1387  GPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
             G IRP+L +HW+NKD DV V+  LP+ ISY+E ++ +K+CICPSG+EVASPR+VEA+Y  
Sbjct  296   GRIRPVLFQHWKNKDKDVLVYEKLPEKISYHETMKMSKYCICPSGWEVASPRIVEAIYAE  355

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             CVP+LI   YV PFSDVLNW SFSV++ V +IP LK+IL GIS+ +Y+RLQ      +RH
Sbjct  356   CVPILISQQYVLPFSDVLNWDSFSVQIEVSEIPKLKEILLGISEEKYMRLQEGVKQVQRH  415

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNV  1827
             F VN PPK+YDV HMI+HS WLRRLNV
Sbjct  416   FVVNNPPKKYDVFHMIIHSIWLRRLNV  442



>ref|XP_003601437.1| hypothetical protein MTR_3g080690 [Medicago truncatula]
Length=450

 Score =   454 bits (1167),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 219/387 (57%), Positives = 281/387 (73%), Gaps = 9/387 (2%)
 Frame = +1

Query  685   RNLERLEANLGKARAAIRAAVHGINQT-----DDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             +NLE++E +L KARA I+ A+   N T     D HDYVP G +Y NA  FHRSY  MEK 
Sbjct  64    KNLEKVEGSLAKARALIKQALLRTNDTVVPLEDSHDYVPQGHIYRNAFAFHRSYQLMEKL  123

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIV  1026
             FKIFVYEEGEPP+FH GPCK+IY+ EG FI  +E +  FRT++P +AHV+FLP S+  I+
Sbjct  124   FKIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLENNTLFRTQNPNEAHVYFLPFSVVMIL  183

Query  1027  HFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVP  1206
               ++   + +K     + +T+ DY+++++ KYAYWNRS GADHFML+CHDWGP  +  V 
Sbjct  184   EHLFHPVIRDKA---VLGRTIGDYVHIISHKYAYWNRSYGADHFMLSCHDWGPRATWYVK  240

Query  1207  ELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLH  1386
             EL+  +IR LCNAN SE F P KD S PEI L  G   GL+GG     R+ILAFFAG ++
Sbjct  241   ELYFIAIRVLCNANISEHFNPKKDASFPEINLVSGETTGLLGGYPTWNRTILAFFAGQMN  300

Query  1387  GPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
             G IRP+L +HW+NKD DV V+  LP+ ISY+E ++ +K+CICPSG+EVASPR+VEA+Y  
Sbjct  301   GRIRPVLFQHWKNKDKDVLVYEKLPEKISYHETMKMSKYCICPSGWEVASPRIVEAIYAE  360

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             CVP+LI   YV PFSDVLNW SFSV++ V +IP LK+IL GIS+ +Y+RLQ      +RH
Sbjct  361   CVPILISQQYVLPFSDVLNWDSFSVQIEVSEIPKLKEILLGISEEKYMRLQEGVKQVQRH  420

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNV  1827
             F VN PPK+YDV HMI+HS WLRRLNV
Sbjct  421   FVVNNPPKKYDVFHMIIHSIWLRRLNV  447



>gb|KEH35171.1| exostosin family protein [Medicago truncatula]
Length=447

 Score =   452 bits (1162),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 218/389 (56%), Positives = 279/389 (72%), Gaps = 11/389 (3%)
 Frame = +1

Query  685   RNLERLEANLGKARAAIRAAVHGINQT-------DDHDYVPTGPVYWNANVFHRSYLEME  843
             RNLE++E +L KARA I+ A+   N T       D HD+VP G +Y NA  FHRSY  ME
Sbjct  59    RNLEKVEGSLAKARALIKQALLRTNDTVLALPLEDSHDFVPQGDIYRNAFAFHRSYHLME  118

Query  844   KQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITA  1020
             K FKIFVYEEGEPP+FH GPCK+IY+ EG FI  +E +  FRTR+P +AH +FLP S+  
Sbjct  119   KLFKIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLENNTLFRTRNPNEAHAYFLPFSVVM  178

Query  1021  IVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKA  1200
             I+  ++   + +K     + +T+ DY+++++ KYAYWNRS GADHFML+CHDWGP  +  
Sbjct  179   ILEHLFHPVIRDKA---VLGRTIGDYVHIISHKYAYWNRSYGADHFMLSCHDWGPRATWY  235

Query  1201  VPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGG  1380
             V EL+  +IR LCNAN SE F P KD S PEI L  G   GL+GG     R+ILAFFAG 
Sbjct  236   VKELYFIAIRVLCNANISEHFNPKKDASFPEINLVTGETAGLLGGYPTWNRTILAFFAGK  295

Query  1381  LHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALY  1560
             +HG IRP+L +HW+NKD DV V+  LP+ ISY+E ++ +K+CICPSG+EVASPR+VEA+Y
Sbjct  296   MHGKIRPVLFQHWKNKDKDVLVYEKLPEKISYHETMKMSKYCICPSGWEVASPRIVEAIY  355

Query  1561  TGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIAR  1740
               CVP++I   YV PFSDVL+W SFSV++ V +IP LK IL GIS+ +Y++LQ      +
Sbjct  356   AECVPIIISQQYVLPFSDVLDWDSFSVKIEVSEIPKLKDILLGISEEKYMKLQEGVKQVQ  415

Query  1741  RHFEVNLPPKRYDVTHMILHSAWLRRLNV  1827
             RHF VN PPKRYDV HMI+HS WLRRLNV
Sbjct  416   RHFVVNNPPKRYDVFHMIIHSIWLRRLNV  444



>ref|XP_009759830.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
sylvestris]
Length=483

 Score =   452 bits (1163),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 289/404 (72%), Gaps = 8/404 (2%)
 Frame = +1

Query  643   ETGTPLQVTIKRKFRNLERLEANLGKARAAIRAA--VHGINQT--DDHDYVPTGPVYWNA  810
             +T T L+   K+K  N+E++EA L  ARA IR    ++G N++  +D DYVP G +Y N 
Sbjct  83    KTETMLRREKKKKDENMEKIEAGLSSARALIRETLLINGTNESPYEDADYVPQGNIYRNP  142

Query  811   NVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKA  987
             + FHRSYL MEK FKIFVY+EGEPP+FH GPCK+IY+ EG FI  ME +  F+T +P+KA
Sbjct  143   HAFHRSYLLMEKLFKIFVYKEGEPPLFHYGPCKNIYSMEGMFINLMEANNHFQTLNPDKA  202

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
             HV+FLP S+  I+  ++D  + +K     +++ + DY+  V+ KY YWNRSLGADHFML+
Sbjct  203   HVYFLPFSVVMILEHLFDPIIRDKA---VLERILRDYVRTVSTKYPYWNRSLGADHFMLS  259

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
              HDWGP  +  V +++  SIR LCNANTSE F P KDV +PEI L  G ++GL+     S
Sbjct  260   SHDWGPRATWYVHQMYFTSIRVLCNANTSEFFNPRKDVPLPEINLLTGNINGLVEALPKS  319

Query  1348  RRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
              ++IL FFAG  HG IRPIL  HWE KD D++V+  +P  +SY EM++ +KFC+CPSGYE
Sbjct  320   NKTILGFFAGRSHGRIRPILFRHWEEKDEDIRVYSKIPPELSYDEMMKSSKFCLCPSGYE  379

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA+Y  CVPVLI  +YV PFSDVL+W  FS++V V ++PNLK IL GIS+ RY
Sbjct  380   VASPRIVEAIYANCVPVLISQNYVLPFSDVLDWDKFSIQVSVSELPNLKNILLGISEERY  439

Query  1708  IRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
              ++       +RHF +N PPKRYDV HMI+HS WLRRLNVR+HG
Sbjct  440   EKMVEGVRQVQRHFVINDPPKRYDVFHMIIHSIWLRRLNVRIHG  483



>emb|CDP15735.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   447 bits (1150),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 214/388 (55%), Positives = 287/388 (74%), Gaps = 7/388 (2%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAA-VHGINQTDDH--DYVPTGPVYWNANVFHRSYLEMEKQFKI  858
              +E++EA+L +ARA IR A V+G  Q   H  DY+P G +Y + +VFHRSY  ME  F+I
Sbjct  27    KMEKIEASLARARALIREAIVNGSQQLPLHEADYIPQGEIYRSPSVFHRSYQLMESLFRI  86

Query  859   FVYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISITAIVHFV  1035
             FVYE+GEPP+FH GPC+ IY+ EG F+  +E  + FRT +P++AHV+FLP S+  I+  +
Sbjct  87    FVYEDGEPPLFHYGPCRDIYSLEGIFLGLIEKNTRFRTYNPDEAHVYFLPFSVVKILEHL  146

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             +D    +K     +++ + DY+ +V+ KY YWNRSLGADH ML+CHDWGP  +  V +L+
Sbjct  147   FDPISRDKA---VLERVIGDYVRIVSTKYPYWNRSLGADHLMLSCHDWGPRATWYVHQLY  203

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
               SIRALCNANTSE F P KDVS PEI L  G +  + GG SPS R+ILAFFAGG HG I
Sbjct  204   FTSIRALCNANTSEFFNPRKDVSFPEINLQTGDIAIVTGGLSPSNRTILAFFAGGYHGRI  263

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RP L +HW+NKD+D+QV+  LP  +SY+EM++K+K+C+CPSG+EVASPR+VEA+Y  CVP
Sbjct  264   RPALFQHWKNKDSDIQVYEKLPGNLSYHEMMKKSKYCLCPSGHEVASPRIVEAIYAECVP  323

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI   Y+ PFSDVL+W SFS++V V ++PNLKKIL GIS+ ++ +L       +RHF +
Sbjct  324   VLISQDYILPFSDVLDWNSFSIQVSVSELPNLKKILMGISEGKHRKLHEAVKQVQRHFMI  383

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
             N PPK+YDV HMI+HS WLRRLNV+++G
Sbjct  384   NDPPKKYDVFHMIIHSIWLRRLNVKIYG  411



>ref|XP_010905483.1| PREDICTED: probable glycosyltransferase At5g20260 [Elaeis guineensis]
Length=461

 Score =   449 bits (1154),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 211/382 (55%), Positives = 282/382 (74%), Gaps = 6/382 (2%)
 Frame = +1

Query  700   LEANLGKARAAIRAAVHGINQTDD--HDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEE  873
             +E  L +AR AIR A    N + +    ++P G VY NA  FH+SY+EMEK+FK++ Y+E
Sbjct  80    IEEGLARARNAIRHAAIARNYSSEKVEKFIPRGAVYRNAYAFHQSYIEMEKRFKVWTYKE  139

Query  874   GEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
             GEPP+ H GP  SIYA EG+FI  +E   +PFR   P++AHVFFLP S+  IV +VY  +
Sbjct  140   GEPPIIHEGPGASIYAIEGHFISEIEDEKNPFRAHHPDEAHVFFLPFSVVNIVQYVYKPN  199

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
             V   ++W P+K+ ++DYI +++ KY YWNRSLG DHFM++CHDW P +S A  +L++NSI
Sbjct  200   V--SDYWKPLKRLIADYIGVISEKYPYWNRSLGVDHFMVSCHDWAPHLSDANLQLYRNSI  257

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPIL  1407
             R +CNANTSEGFK  KDV++PE+ LP G +   +   S + R+ILAFF+GG HG IR IL
Sbjct  258   RVICNANTSEGFKLGKDVTLPEVHLPDGLLSQPVRHRSLAERTILAFFSGGSHGYIREIL  317

Query  1408  LEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIK  1587
             L HW+ KD+++  + YLPKG++Y E++RKTKFC+CPSGYEVASPR+VE+++ GCVPV+I 
Sbjct  318   LHHWKGKDHEILAYEYLPKGLNYAELMRKTKFCLCPSGYEVASPRIVESIFMGCVPVIIS  377

Query  1588  DHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPP  1767
              +Y  PF DVL+W  FSV++PVE IP +K +L GIS+RRY  LQ R L  +RHF +N P 
Sbjct  378   VNYPPPFGDVLDWSKFSVQIPVEKIPEIKTLLKGISERRYRILQSRVLQVQRHFVLNRPA  437

Query  1768  KRYDVTHMILHSAWLRRLNVRL  1833
             KR+DV HM+LHS WLRRLNVRL
Sbjct  438   KRFDVIHMVLHSIWLRRLNVRL  459



>ref|XP_010241628.1| PREDICTED: probable glycosyltransferase At5g20260 [Nelumbo nucifera]
Length=482

 Score =   449 bits (1155),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 282/390 (72%), Gaps = 6/390 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQT--DDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             RK  +L R+E +L +ARAAI  A    N T   + ++V  G +Y N   F++S+ EM K+
Sbjct  93    RKKSSLNRVEESLARARAAILQAARSRNNTRPKEDEFVSKGSIYRNPYAFYQSHNEMVKR  152

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPISITAI  1023
             FK++VY EGEPP+ HNGP  +IY+SEG FI  ME+  SPF  R P++AH FFLP SI   
Sbjct  153   FKVWVYREGEPPLVHNGPLNNIYSSEGQFIDEMESGHSPFAARHPDEAHAFFLPFSIANA  212

Query  1024  VHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             V ++Y           P++  V DYI +V+ KY YWNRS GADHFM++CHDW P++S A 
Sbjct  213   VQYLYKPLTSYARD--PLQHVVEDYIGVVSNKYPYWNRSHGADHFMVSCHDWAPDVSTAH  270

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
             PELFK+ IR +CNAN +EGF+P  D ++PE+  P GT+     G +PS+R++LAFFAGG 
Sbjct  271   PELFKHFIRVICNANITEGFRPGIDAALPELNTPFGTLGRPSFGQAPSKRTLLAFFAGGA  330

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HG IR +LLEHW++KD DVQVH YLPKG++Y +++ + KFC+CPSGYEVASPR+VEA+  
Sbjct  331   HGYIRKVLLEHWKDKDKDVQVHEYLPKGMNYAKLMGQAKFCLCPSGYEVASPRIVEAIQA  390

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
             GC+P +I D Y  PFSDVL+W  FSV++PVE IP++KKIL G+SQ RY+++Q++    RR
Sbjct  391   GCIPTIISDGYWLPFSDVLDWSQFSVQIPVERIPDIKKILQGVSQNRYLQMQKKVRQVRR  450

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             HF +N P +R+DV HMILHS WLRRLN+RL
Sbjct  451   HFVLNRPAQRFDVIHMILHSVWLRRLNLRL  480



>ref|XP_004288781.1| PREDICTED: probable glycosyltransferase At5g20260-like [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   448 bits (1153),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 212/387 (55%), Positives = 280/387 (72%), Gaps = 5/387 (1%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDDHD--YVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             +LER+E +L KARA+I  A+   N + + +  ++P G +Y N   FH+S+LEM K+FK++
Sbjct  94    SLERIEEDLAKARASILEAIQSKNYSSEKEESFIPRGSIYKNPYAFHQSHLEMMKRFKMW  153

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPISITAIVHFV  1035
              YEEGE P+ H GP  +IY  EG+FI  +E   SPFR   P++AH+FFLP S+  IV +V
Sbjct  154   SYEEGEQPLVHFGPMNNIYGIEGHFIDEIEREGSPFRATHPDEAHMFFLPFSVANIVQYV  213

Query  1036  YDRSVHNKE-HWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPEL  1212
             Y      ++ H   ++Q   DYI +VA KY YWNRS GADHFM +CHDW PEIS   PEL
Sbjct  214   YLPITKKQDYHRDRLQQIAMDYIGVVAHKYPYWNRSKGADHFMASCHDWAPEISVGKPEL  273

Query  1213  FKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGP  1392
             F+N IR LCNANTSEGF+P +DV +PEI +P G +     G +P+ R ILAFFAG +HGP
Sbjct  274   FRNFIRVLCNANTSEGFQPKRDVPLPEIFVPTGKLGPPNLGQAPNNRQILAFFAGRVHGP  333

Query  1393  IRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCV  1572
             IRPILLEHW++KDN+V+VH  LPKG++Y +++ ++KFC+CPSG+EVASPR+VEALY GCV
Sbjct  334   IRPILLEHWKDKDNEVRVHEKLPKGMNYTKLMGQSKFCLCPSGFEVASPRVVEALYAGCV  393

Query  1573  PVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFE  1752
             PVLI D+Y  PFSDVL+W  FS++VPV  IP +K IL  I    Y+++QRR L  +RHF 
Sbjct  394   PVLISDNYSLPFSDVLDWSQFSIQVPVAKIPEIKTILQAIPNEEYLKMQRRVLKVQRHFV  453

Query  1753  VNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +N P K +DV HM+LHS WLRRLN ++
Sbjct  454   LNKPAKPFDVIHMVLHSVWLRRLNFKI  480



>ref|XP_002285237.2| PREDICTED: probable glycosyltransferase At5g25310 [Vitis vinifera]
 emb|CBI21064.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   448 bits (1152),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 215/401 (54%), Positives = 290/401 (72%), Gaps = 15/401 (4%)
 Frame = +1

Query  667   TIKRKFRNLERL---EANLGKARAAIRAAVHGINQT-----DDHDYVPTGPVYWNANVFH  822
             T+ RK +   R    E  L +ARA+IR A   +N++     +D++ VPTG VY NA  F+
Sbjct  80    TLIRKIKKRTRYQGQEEGLARARASIRKAFSNLNRSSEIGGEDNNEVPTGDVYRNAGAFY  139

Query  823   RSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVF  996
             +SY+EMEK+ K++VYEEGE P+ H+GPCK IY  EG FI+ +E     FRTRD E+AHV+
Sbjct  140   QSYVEMEKRLKVYVYEEGEVPMIHDGPCKDIYTIEGRFIHEIEHGDGKFRTRDAERAHVY  199

Query  997   FLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHD  1176
             F+P S+T +V ++Y    +N     P++Q VSDY+++++ KY +WN + GADHFMLACHD
Sbjct  200   FMPFSVTWMVKYLYKPLTYN---LTPLRQFVSDYVSVISTKYPFWNTTQGADHFMLACHD  256

Query  1177  WGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHG--LIGGPSPSR  1350
             WGP  S+  P L+  SIR LCNANTSEGF P KDVS+PEI L GG ++   L   P  S 
Sbjct  257   WGPHASRGHPVLYNTSIRVLCNANTSEGFNPQKDVSLPEIHLYGGNVNPKLLSPPPPNSP  316

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             R  LAFFAGGLHGPIRPIL++HW  +D D++V+ YLPK + YY ++ ++K+C+CPSG+EV
Sbjct  317   RPFLAFFAGGLHGPIRPILIQHWMGRDTDLRVYEYLPKDMDYYSLMLQSKYCLCPSGHEV  376

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPR+VEA+Y+ CVPV++ DHYV PFSDVL W++FSV+V   +IP LK++L  IS+ +Y 
Sbjct  377   ASPRIVEAIYSECVPVILSDHYVLPFSDVLRWEAFSVKVEASEIPRLKEVLQAISEEKYT  436

Query  1711  RLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             RL+      RRHFE+N P KR+DV HMILHS WLRR+N++L
Sbjct  437   RLKEGVRAVRRHFELNQPAKRFDVFHMILHSVWLRRINLKL  477



>ref|XP_008794982.1| PREDICTED: probable glycosyltransferase At5g20260 [Phoenix dactylifera]
Length=498

 Score =   448 bits (1153),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 213/382 (56%), Positives = 279/382 (73%), Gaps = 6/382 (2%)
 Frame = +1

Query  700   LEANLGKARAAIRAAVHGINQTDD--HDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEE  873
             +E  L +AR +IR A    N T     D++P G VY NA+ FH+SY+EMEK+FK++ Y+E
Sbjct  117   IEEGLARARNSIRHAALARNYTTSKVEDFIPRGAVYRNAHAFHQSYIEMEKRFKVWTYKE  176

Query  874   GEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
             GEPP+ H GP  SI A EG+FI  +E   +PFR R P++AHVFFLP S+  IV +VY   
Sbjct  177   GEPPIIHGGPGASINAIEGHFISEIEDKKNPFRARHPDEAHVFFLPFSVVNIVQYVYKPK  236

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
             V   ++W P+K+ ++DYI +V+ K+ YWNRSLGADHFM++CHDW P +S A  +L++NSI
Sbjct  237   V--SDYWGPLKRLIADYIGVVSEKHPYWNRSLGADHFMVSCHDWAPHLSDANLQLYENSI  294

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPIL  1407
             R +CNANTSEGFK  KDV++PE+ LP G +   +   S + R+ILAFFAGG HG IR IL
Sbjct  295   RVICNANTSEGFKLGKDVTLPEVHLPDGLLSQPVRHRSLTDRTILAFFAGGSHGYIREIL  354

Query  1408  LEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIK  1587
               HW  KD ++ VH YLPKG++Y  ++ KTKFC+CPSGYEVASPR+VE+++ GCVPV+I 
Sbjct  355   FHHWRGKDQEILVHEYLPKGLNYAALMSKTKFCLCPSGYEVASPRIVESIFMGCVPVIIS  414

Query  1588  DHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPP  1767
              +Y  PF DVL+W  FSV++PVE IP +K IL GIS+RRY  LQ R L  +RHF +N P 
Sbjct  415   VNYPPPFGDVLDWSKFSVQIPVEKIPEIKTILRGISERRYRILQMRVLQVQRHFVLNRPA  474

Query  1768  KRYDVTHMILHSAWLRRLNVRL  1833
             KR+DV HM+LHS WLRRLN+RL
Sbjct  475   KRFDVIHMVLHSIWLRRLNLRL  496



>ref|XP_007013571.1| Exostosin family protein [Theobroma cacao]
 gb|EOY31190.1| Exostosin family protein [Theobroma cacao]
Length=476

 Score =   447 bits (1150),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 218/392 (56%), Positives = 278/392 (71%), Gaps = 10/392 (3%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDDHD--YVPTGPVYWNANVFHR-----SYLEMEK  846
             N ER+E +L + RAAI  AV   N T + +  +VP G +Y NAN F++     S+ EM K
Sbjct  83    NSERIEEDLARTRAAILKAVQLQNFTSEKEDIFVPRGSIYRNANAFYQLSTFMSHTEMIK  142

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPISITA  1020
             +FK++ Y EGE P+ HNGP   IYA EG FI  ME+  +PFR R P++AHVFFLPIS+T 
Sbjct  143   RFKVWTYREGEIPLVHNGPLNDIYAIEGQFIDEMESKNNPFRARHPDEAHVFFLPISVTG  202

Query  1021  IVHFVYDRSVHNKEHWLP-MKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
             ++H+VY      KE+    +++ V DYIN VA K+ YWNRS GADHFM++CHDW PE+S+
Sbjct  203   VIHYVYKPITSVKEYSRDRLQRLVLDYINTVASKHPYWNRSNGADHFMVSCHDWAPEVSQ  262

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAG  1377
             A PELFKN IR LCNANTSEGF+P  DVS+PEI LP G +        P+ R ILAFFAG
Sbjct  263   ANPELFKNFIRVLCNANTSEGFRPKIDVSLPEIYLPFGKLGPPNLSQGPNNRPILAFFAG  322

Query  1378  GLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEAL  1557
               HG IR ILLE W++KDN+VQVH  LP G++Y +M+ ++KFC+CPSG+EVASPR +EA+
Sbjct  323   SAHGYIRKILLEQWKDKDNEVQVHSRLPTGVNYTKMMGQSKFCLCPSGFEVASPREIEAI  382

Query  1558  YTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIA  1737
             Y GC+PV+I  +Y  PFSDVL W  FSV++PVE IP +K IL GI  R+Y+ +  R    
Sbjct  383   YAGCIPVVISANYTLPFSDVLKWSQFSVQIPVEKIPEIKTILQGIPNRKYLMMHERVKRV  442

Query  1738  RRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             RRHFE+N P K +DV HM+LHS WLRRLN RL
Sbjct  443   RRHFELNRPAKPFDVIHMVLHSVWLRRLNFRL  474



>ref|XP_002459470.1| hypothetical protein SORBIDRAFT_02g005180 [Sorghum bicolor]
 gb|EER95991.1| hypothetical protein SORBIDRAFT_02g005180 [Sorghum bicolor]
Length=584

 Score =   451 bits (1159),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 227/401 (57%), Positives = 288/401 (72%), Gaps = 22/401 (5%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTD---DHDYVPTGPVYWNANVFHRSYLEMEKQFKI  858
              LERLE  L KAR+AI  A+   ++     D DYVP GP+Y NA+ FHRSYLEMEKQ K+
Sbjct  181   KLERLELGLAKARSAIMEAIRNKDKRSPLPDKDYVPMGPIYRNAHAFHRSYLEMEKQLKV  240

Query  859   FVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP-FRTRDPEKAHVFFLPISITAIVHFV  1035
             +VYEEGEPPVFH+GPC+SIY++EG FI+ MET+   RT DP +AHVFFLP S+  +V  +
Sbjct  241   YVYEEGEPPVFHDGPCRSIYSTEGRFIHAMETATRLRTSDPSQAHVFFLPFSVVKMVKTI  300

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             Y+   H+     P+K+TV+DY+ +++ KY +WNRS GADHFML+CHDWGP +S A  ELF
Sbjct  301   YEPGSHDMA---PLKRTVADYLRVISDKYPFWNRSAGADHFMLSCHDWGPYVSSANAELF  357

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
              NSIR LCNANTSEGF  +KDVS+PEI L    +   +GGPS SRR  LAFFAGG HGP+
Sbjct  358   GNSIRVLCNANTSEGFDLAKDVSLPEINLRSDAVERQVGGPSASRRPFLAFFAGGNHGPV  417

Query  1396  RPILLEHW-----ENKDNDVQVHRYLPK--------GISYYEMLRKTKFCICPSGYEVAS  1536
             RP LL HW        D DV+V  YLP           +Y +M+R+++FC+CP GYEVAS
Sbjct  418   RPALLAHWGPGSGREDDPDVRVSEYLPTRGGRAGASAAAYTDMMRRSRFCLCPGGYEVAS  477

Query  1537  PRMVEALYTGCVPVLIKD-HYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             PR+ EA+Y  CVPV++ D  Y  PF+DVLNW +F+V V V D+P +K+IL+ +S R+YIR
Sbjct  478   PRLAEAVYLECVPVVVDDGEYALPFADVLNWDAFAVRVRVADVPRIKEILSAVSPRQYIR  537

Query  1714  LQRRGLIARRHFEVN-LPPKRYDVTHMILHSAWLRRLNVRL  1833
             +QRR  + RRHF V+  PP+RYD  HMILHS WLRRLNVR+
Sbjct  538   MQRRVRMVRRHFMVHGGPPRRYDAFHMILHSVWLRRLNVRI  578



>ref|XP_006594253.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
isoform X1 [Glycine max]
Length=487

 Score =   447 bits (1149),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 213/394 (54%), Positives = 287/394 (73%), Gaps = 8/394 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTDDHD--YVPTGPVYWNANVF-HRSYLEMEK  846
             +   +LE++E +L +ARA+I+ ++   N T      +VP G +Y N + F HRS++EM K
Sbjct  91    QDLTSLEKIEESLAQARASIQESILSRNYTSQRREIFVPKGSIYRNPHAFLHRSHIEMVK  150

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET----SPFRTRDPEKAHVFFLPISI  1014
             +FK++VY+EGE P+ H+GP  +IYA EG F+  M+     S FR R PE+AHVFFLPISI
Sbjct  151   RFKVWVYQEGEQPLVHDGPVNNIYAIEGQFMDEMDNNGKWSQFRARHPEEAHVFFLPISI  210

Query  1015  TAIVHFVYDRSVHNKEHW-LPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEI  1191
               +VH+VY   +   ++  + ++  V DYI ++  KY YWNRS+GADHF+L+CHDWGP++
Sbjct  211   ANVVHYVYKPILKQSDYEPVRLQHLVEDYIGVIQDKYPYWNRSIGADHFLLSCHDWGPKV  270

Query  1192  SKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFF  1371
             S   PELF+  IRALCNANTSEGF P++DVSIPE+ LP G +     G  P+ R+ LAFF
Sbjct  271   SYGNPELFQTFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPASLGQHPNSRTTLAFF  330

Query  1372  AGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVE  1551
             AGG+HG IR ILL+HW++KDN+V VH YLPKG  Y +++ ++KFC+CPSG+EVASPR+VE
Sbjct  331   AGGVHGEIRKILLKHWKDKDNEVLVHEYLPKGQDYTKLMGQSKFCLCPSGHEVASPRVVE  390

Query  1552  ALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGL  1731
             A++ GCVPV+I D+Y  PFSDVLNW  FSVE+PVE IP +K IL  IS+ +Y+RL    L
Sbjct  391   AIHAGCVPVIICDNYSLPFSDVLNWSQFSVEIPVEKIPEIKSILQSISRNKYLRLHMNVL  450

Query  1732  IARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
               RRHF +N P K +D+ HMILHS WLRRLN++L
Sbjct  451   RVRRHFMINRPTKPFDMMHMILHSIWLRRLNIKL  484



>gb|AAU04753.1| EXO [Cucumis melo]
Length=343

 Score =   441 bits (1134),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 263/343 (77%), Gaps = 4/343 (1%)
 Frame = +1

Query  811   NVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKA  987
             +V  RSYLEME+  KI+VY+EGEPP+FH GPCKSIY++EG FI+ ME  + + T DP++A
Sbjct  3     SVMCRSYLEMERLLKIYVYKEGEPPMFHGGPCKSIYSTEGRFIHEMEKGNLYTTNDPDQA  62

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
              ++FLP S+  +V ++Y   V N      + + ++DYIN+++ K+ +W+RSLGADHFML+
Sbjct  63    LLYFLPFSVVNLVQYLY---VPNSHEVNAIGRAITDYINVISKKHPFWDRSLGADHFMLS  119

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
             CHDWGP  +  VP LF NSIR LCNAN SEGF PSKD S PEI L  G + GLIGG SPS
Sbjct  120   CHDWGPRTTSYVPLLFNNSIRVLCNANVSEGFLPSKDASFPEIHLRTGEIDGLIGGLSPS  179

Query  1348  RRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
             RRS+LAFFAG LHG IR +LL+ W+ KD DV V+  LP GISY  ML+K++FC+CPSGYE
Sbjct  180   RRSVLAFFAGRLHGHIRYLLLQEWKEKDEDVLVYEELPSGISYNSMLKKSRFCLCPSGYE  239

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA+Y  CVPVLI + YV PFSDVLNWKSFSV++ V+DIPN+KKIL GISQ +Y
Sbjct  240   VASPRVVEAIYAECVPVLISESYVPPFSDVLNWKSFSVQIQVKDIPNIKKILKGISQTQY  299

Query  1708  IRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
             +R+QRR    +RHF +N  PKR+D  HMILHS WLRRLN+ + 
Sbjct  300   LRMQRRVKQVQRHFALNGTPKRFDAFHMILHSIWLRRLNIHIQ  342



>gb|KHN47102.1| Xylogalacturonan beta-1,3-xylosyltransferase [Glycine soja]
Length=486

 Score =   446 bits (1148),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 211/393 (54%), Positives = 286/393 (73%), Gaps = 7/393 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTDDHD--YVPTGPVYWNANVFHRSYLEMEKQ  849
             +   +LE++E +L +ARA+I+ ++   N T      +VP G +Y N + F +S++EM K+
Sbjct  91    QDLTSLEKIEESLAQARASIQESILSRNYTSQRREIFVPKGSIYRNPHAFLQSHIEMVKR  150

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET----SPFRTRDPEKAHVFFLPISIT  1017
             FK++VY+EGE P+ H+GP  +IYA EG F+  M+     S FR R PE+AHVFFLPISI 
Sbjct  151   FKVWVYQEGEQPLVHDGPVNNIYAIEGQFMDEMDNNGKWSQFRARHPEEAHVFFLPISIA  210

Query  1018  AIVHFVYDRSVHNKEHW-LPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEIS  1194
              +VH+VY   +   ++  + ++  V DYI ++  KY YWNRS+GADHF+L+CHDWGP++S
Sbjct  211   NVVHYVYKPILKQSDYEPVRLQHLVEDYIGVIQDKYPYWNRSIGADHFLLSCHDWGPKVS  270

Query  1195  KAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFA  1374
                PELF+  IRALCNANTSEGF P++DVSIPE+ LP G +     G  P+ R+ LAFFA
Sbjct  271   YGNPELFQTFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPASLGQHPNSRTTLAFFA  330

Query  1375  GGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
             GG+HG IR ILL+HW++KDN+V VH YLPKG  Y +++ ++KFC+CPSG+EVASPR+VEA
Sbjct  331   GGVHGEIRKILLKHWKDKDNEVLVHEYLPKGQDYTKLMGQSKFCLCPSGHEVASPRVVEA  390

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             ++ GCVPV+I D+Y  PFSDVLNW  FSVE+PVE IP +K IL  IS+ +Y+RL    L 
Sbjct  391   IHAGCVPVIICDNYSLPFSDVLNWSQFSVEIPVEKIPEIKSILQSISRNKYLRLHMNVLR  450

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              RRHF +N P K +D+ HMILHS WLRRLN++L
Sbjct  451   VRRHFMINRPTKPFDMMHMILHSIWLRRLNIKL  483



>ref|XP_008242826.1| PREDICTED: probable glycosyltransferase At5g20260 [Prunus mume]
Length=488

 Score =   446 bits (1148),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 213/392 (54%), Positives = 283/392 (72%), Gaps = 7/392 (2%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYLEME  843
             K+K  NLER+EA+L +AR AIR AV   N +   DD  ++PTG +Y NA+ FH+S++EME
Sbjct  97    KKKMSNLERIEADLARARDAIRKAVQAKNHSKGNDDQGFIPTGSIYRNAHSFHQSHVEME  156

Query  844   KQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPISIT  1017
             K+ K+++Y EGEPP+ H GP  +IY  EG FI  ME+  S F  R P++A++F +PIS+ 
Sbjct  157   KRLKVWIYREGEPPLVHGGPLNNIYGIEGQFIDEMESGKSRFMARHPDEANLFLIPISVV  216

Query  1018  AIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
              IV+ +Y   V      L  ++ V DYI +++ +Y YWNRS GADHF+++CHDW P+IS+
Sbjct  217   NIVNTLYKPLVTYSRDQL--QRVVLDYIGIISERYPYWNRSQGADHFLVSCHDWAPDISE  274

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAG  1377
             A P+L+   IR LCNANTSEGFKP +DVSIPEI +P G +       SP +RSILAFFAG
Sbjct  275   ADPKLYDKFIRVLCNANTSEGFKPRRDVSIPEINIPYGKLGPTPQSTSPDKRSILAFFAG  334

Query  1378  GLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEAL  1557
             G HG IR ILLEHW++KDN+VQVH YL K  +Y++++ K+KFC+CPSGYEVAS R+V A+
Sbjct  335   GAHGNIRHILLEHWKDKDNEVQVHEYLDKKKNYFKLMGKSKFCLCPSGYEVASARVVTAI  394

Query  1558  YTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIA  1737
               GCVPVLI D+Y  PFSDVL+W  FSV +P E IP +K IL GIS +RY++LQ+R    
Sbjct  395   SVGCVPVLISDYYALPFSDVLDWTKFSVYIPSEKIPEIKTILKGISPKRYLKLQKRVTEV  454

Query  1738  RRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              RHF ++ P + YD+ HM+LHS WLRRL+V L
Sbjct  455   HRHFMIHRPAQPYDMIHMLLHSVWLRRLDVLL  486



>ref|XP_006594254.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
isoform X2 [Glycine max]
Length=486

 Score =   446 bits (1148),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 211/393 (54%), Positives = 286/393 (73%), Gaps = 7/393 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTDDHD--YVPTGPVYWNANVFHRSYLEMEKQ  849
             +   +LE++E +L +ARA+I+ ++   N T      +VP G +Y N + F +S++EM K+
Sbjct  91    QDLTSLEKIEESLAQARASIQESILSRNYTSQRREIFVPKGSIYRNPHAFLQSHIEMVKR  150

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET----SPFRTRDPEKAHVFFLPISIT  1017
             FK++VY+EGE P+ H+GP  +IYA EG F+  M+     S FR R PE+AHVFFLPISI 
Sbjct  151   FKVWVYQEGEQPLVHDGPVNNIYAIEGQFMDEMDNNGKWSQFRARHPEEAHVFFLPISIA  210

Query  1018  AIVHFVYDRSVHNKEHW-LPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEIS  1194
              +VH+VY   +   ++  + ++  V DYI ++  KY YWNRS+GADHF+L+CHDWGP++S
Sbjct  211   NVVHYVYKPILKQSDYEPVRLQHLVEDYIGVIQDKYPYWNRSIGADHFLLSCHDWGPKVS  270

Query  1195  KAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFA  1374
                PELF+  IRALCNANTSEGF P++DVSIPE+ LP G +     G  P+ R+ LAFFA
Sbjct  271   YGNPELFQTFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPASLGQHPNSRTTLAFFA  330

Query  1375  GGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
             GG+HG IR ILL+HW++KDN+V VH YLPKG  Y +++ ++KFC+CPSG+EVASPR+VEA
Sbjct  331   GGVHGEIRKILLKHWKDKDNEVLVHEYLPKGQDYTKLMGQSKFCLCPSGHEVASPRVVEA  390

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             ++ GCVPV+I D+Y  PFSDVLNW  FSVE+PVE IP +K IL  IS+ +Y+RL    L 
Sbjct  391   IHAGCVPVIICDNYSLPFSDVLNWSQFSVEIPVEKIPEIKSILQSISRNKYLRLHMNVLR  450

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              RRHF +N P K +D+ HMILHS WLRRLN++L
Sbjct  451   VRRHFMINRPTKPFDMMHMILHSIWLRRLNIKL  483



>ref|XP_007200373.1| hypothetical protein PRUPE_ppa008342mg [Prunus persica]
 gb|EMJ01572.1| hypothetical protein PRUPE_ppa008342mg [Prunus persica]
Length=336

 Score =   441 bits (1133),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 205/334 (61%), Positives = 259/334 (78%), Gaps = 5/334 (1%)
 Frame = +1

Query  838   MEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPIS  1011
             ME+ FKI+VYEEG+PP+FHNGPCKSIY++EG FI+ ME   + ++T DP++A V+FLP S
Sbjct  1     MERLFKIYVYEEGDPPIFHNGPCKSIYSTEGRFIHEMEMDNNIYKTTDPDEALVYFLPFS  60

Query  1012  ITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEI  1191
             +  +V ++Y    HN +    + + V DY+N+++ K+ +WNRSLGADHFML+CHDWGP  
Sbjct  61    VVMLVQYLYAADSHNTD---SIGRAVIDYVNVISDKHPFWNRSLGADHFMLSCHDWGPRT  117

Query  1192  SKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFF  1371
             S  VP L+  SIR LCNANTSEGF PSKD S PEI L  G + GL+GG SPSRRSILAFF
Sbjct  118   SSYVPHLYHKSIRVLCNANTSEGFNPSKDASFPEIHLRTGEIKGLVGGLSPSRRSILAFF  177

Query  1372  AGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVE  1551
             AG LHG IR +LL  W+ KD DVQV+  LP G+SY  ML+K++FC+CPSGYEVASPR+VE
Sbjct  178   AGRLHGHIRYLLLNEWKEKDQDVQVYDQLPHGVSYELMLKKSRFCLCPSGYEVASPRVVE  237

Query  1552  ALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGL  1731
             A+Y  C+PVLI D YV PFSDVL+WKSFSV++ VEDIPN+K IL GISQ +Y+R+ RR  
Sbjct  238   AIYAECIPVLISDSYVPPFSDVLDWKSFSVQIQVEDIPNIKTILMGISQSQYLRMHRRVK  297

Query  1732  IARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
               +RHF VN P KR+DV +MI+HS WLRRLN+R+
Sbjct  298   QVQRHFVVNGPSKRFDVFNMIVHSIWLRRLNIRI  331



>gb|KHN47101.1| Putative glycosyltransferase [Glycine soja]
Length=525

 Score =   447 bits (1150),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 222/405 (55%), Positives = 286/405 (71%), Gaps = 9/405 (2%)
 Frame = +1

Query  640   NETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTD--DHDYVPTGPVYWNAN  813
             N T T L   IK K+ +L+++E  L +ARA+IR +   IN T       VP   +YWNA 
Sbjct  119   NNTSTVLSGVIK-KYPSLDKIEEGLARARASIRESARFINYTSPMREKIVPKRSIYWNAR  177

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET----SPFRTRDPE  981
              FH+S  EM K+FK++VYEEGE P+ H GP  +IY+ EG FI  M+     S FR R+P 
Sbjct  178   AFHQSQKEMLKRFKVWVYEEGEQPLVHYGPVNNIYSIEGQFIDEMDNYHKWSHFRARNPN  237

Query  982   KAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFM  1161
             +AHVF +P SI  IV +VY+R++        ++  V DYI ++A KY YWNR+ GADHF+
Sbjct  238   QAHVFLIPFSIVNIVQYVYNRNLRQPGSQ-SIQLLVEDYIRVIAHKYPYWNRTEGADHFL  296

Query  1162  LACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEI-LLPGGTMHGLIGGP  1338
             L+CHDWGP IS A P+LFKN IR LCNANTSEGF+P+KDVSIPE+ LLP GT+     G 
Sbjct  297   LSCHDWGPTISYANPKLFKNFIRVLCNANTSEGFRPNKDVSIPEVNLLPRGTLGSPNRGQ  356

Query  1339  SPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPS  1518
              P+ R+ILAFFAG  HG IR ILL HW++KDNDVQ++  LPKG  Y +++ ++KFC+CPS
Sbjct  357   HPNDRTILAFFAGREHGAIRTILLNHWKDKDNDVQIYESLPKGKVYTKLMGQSKFCLCPS  416

Query  1519  GYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQ  1698
             GYEVASPR+VEA+Y GCVPVLI   Y  PF+DVLNW  FSVE+PVE IP +K IL  +S 
Sbjct  417   GYEVASPRVVEAIYAGCVPVLISSSYSPPFTDVLNWSQFSVEIPVEKIPEIKTILQSVSP  476

Query  1699  RRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             ++Y++LQ   L  +RHF +N P K +D+ HMILHS WLRRLN++L
Sbjct  477   KKYLKLQMNVLRVQRHFTINRPAKPFDLMHMILHSIWLRRLNLKL  521



>ref|XP_003542647.2| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
[Glycine max]
Length=525

 Score =   447 bits (1150),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 222/405 (55%), Positives = 286/405 (71%), Gaps = 9/405 (2%)
 Frame = +1

Query  640   NETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTD--DHDYVPTGPVYWNAN  813
             N T T L   IK K+ +L+++E  L +ARA+IR +   IN T       VP   +YWNA 
Sbjct  119   NNTSTVLSGVIK-KYPSLDKIEEGLARARASIRESARFINYTSPTREKIVPKRSIYWNAR  177

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET----SPFRTRDPE  981
              FH+S  EM K+FK++VYEEGE P+ H GP  +IY+ EG FI  M+     S FR R+P 
Sbjct  178   AFHQSQKEMLKRFKVWVYEEGEQPLVHYGPVNNIYSIEGQFIDEMDNYHKWSHFRARNPN  237

Query  982   KAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFM  1161
             +AHVF +P SI  IV +VY+R++        ++  V DYI ++A KY YWNR+ GADHF+
Sbjct  238   QAHVFLIPFSIVNIVQYVYNRNLRQPGSQ-SIQLLVEDYIRVIAHKYPYWNRTEGADHFL  296

Query  1162  LACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEI-LLPGGTMHGLIGGP  1338
             L+CHDWGP IS A P+LFKN IR LCNANTSEGF+P+KDVSIPE+ LLP GT+     G 
Sbjct  297   LSCHDWGPTISYANPKLFKNFIRVLCNANTSEGFRPNKDVSIPEVNLLPRGTLGSPNRGQ  356

Query  1339  SPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPS  1518
              P+ R+ILAFFAG  HG IR ILL HW++KDNDVQ++  LPKG  Y +++ ++KFC+CPS
Sbjct  357   HPNDRTILAFFAGREHGAIRTILLNHWKDKDNDVQIYESLPKGKVYTKLMGQSKFCLCPS  416

Query  1519  GYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQ  1698
             GYEVASPR+VEA+Y GCVPVLI   Y  PF+DVLNW  FSVE+PVE IP +K IL  +S 
Sbjct  417   GYEVASPRVVEAIYAGCVPVLISSSYSPPFTDVLNWSQFSVEIPVEKIPEIKTILQSVSP  476

Query  1699  RRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             ++Y++LQ   L  +RHF +N P K +D+ HMILHS WLRRLN++L
Sbjct  477   KKYLKLQMNVLRVQRHFTINRPAKPFDLMHMILHSIWLRRLNLKL  521



>ref|XP_007202437.1| hypothetical protein PRUPE_ppa014750mg, partial [Prunus persica]
 gb|EMJ03636.1| hypothetical protein PRUPE_ppa014750mg, partial [Prunus persica]
Length=390

 Score =   441 bits (1134),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 283/390 (73%), Gaps = 7/390 (2%)
 Frame = +1

Query  679   KFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYLEMEKQ  849
             K  NLER+EA+L +AR AIR AV   N +   DD  ++PTG +Y NA+ FH+S++EME++
Sbjct  1     KMSNLERIEADLARARDAIRKAVQAKNHSKGNDDEGFIPTGSIYRNAHSFHQSHVEMEER  60

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPISITAI  1023
              K+++Y EGEPP+ H+GP  +IY  EG FI  ME+  S F  R P++A++F +PIS+  I
Sbjct  61    LKVWIYREGEPPLVHDGPLNNIYGIEGQFIDEMESGKSRFMARHPDEANLFLIPISVVNI  120

Query  1024  VHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             V+ +Y+  V      L  ++ V DYI +++ +Y YWNRS GADHF+++CHDW P+IS+A 
Sbjct  121   VNTLYNPLVTYSRDQL--QRVVLDYIGIISERYPYWNRSQGADHFLVSCHDWAPDISEAN  178

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
             P+L+   IR LCNANTSEGFKP +DVSIPEI +P G +       SP +RSILAFFAGG 
Sbjct  179   PKLYDKFIRVLCNANTSEGFKPQRDVSIPEINIPYGKLGPTPQRASPDKRSILAFFAGGA  238

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HG IR ILLEHW++KD +VQVH YL K  +Y++++ K+KFC+CPSGYEVASPR+V A+  
Sbjct  239   HGNIRHILLEHWKDKDKEVQVHEYLDKKKNYFKLMGKSKFCLCPSGYEVASPRVVTAISV  298

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
             GCVPVLI D+Y  PFSDVL+W  FSV +P E IP +K IL GIS +RY++LQ+R     R
Sbjct  299   GCVPVLISDYYALPFSDVLDWTKFSVYIPSEKIPEIKTILKGISPKRYLKLQKRVTEVHR  358

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             HF ++ P + YD+ HM+LHS WLRRL+V L
Sbjct  359   HFMIHRPAQPYDMIHMLLHSVWLRRLDVLL  388



>ref|XP_006600735.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
[Glycine max]
Length=499

 Score =   444 bits (1142),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 220/403 (55%), Positives = 285/403 (71%), Gaps = 8/403 (2%)
 Frame = +1

Query  652   TPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDH--DYVPTGPVYWNANVFHR  825
             T L  TI  K+ +LE++E  L +ARA+I+ ++   N T  +  ++VP G +Y N + FH+
Sbjct  94    TVLSSTIM-KYPSLEKIEEGLARARASIQESIRSRNYTSANRVNFVPKGSIYLNPHAFHQ  152

Query  826   SYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET----SPFRTRDPEKAHV  993
             S+ EM K+FK++VYEEGE P+ H+GP   IY+ EG FI  ++     S FR   P++A V
Sbjct  153   SHEEMLKRFKVWVYEEGEQPLVHDGPANDIYSIEGQFIDEIDNDAKWSHFRAEHPDQAQV  212

Query  994   FFLPISITAIVHFVYDR-SVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLAC  1170
             FFLP SI  +VH+VY     H+    + +++ V DYI ++A KY YWNRS GADHF+L+C
Sbjct  213   FFLPFSIANVVHYVYKPIRKHSDYEPIRLQRLVEDYIGVIANKYPYWNRSEGADHFLLSC  272

Query  1171  HDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR  1350
             HDWGP++S   P+LFKN IR LCNANTSEGF P+KDVSIPE+ LP G +     G  P+ 
Sbjct  273   HDWGPKVSYGNPKLFKNFIRVLCNANTSEGFLPNKDVSIPEVYLPKGKLGPPNLGQRPND  332

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             RSILAFFAG  HG IR ILL HW+ KDND+QVH YLPKG +Y +++ ++KFC+CPSGYEV
Sbjct  333   RSILAFFAGREHGDIRKILLNHWKGKDNDIQVHEYLPKGKNYTQLMGQSKFCLCPSGYEV  392

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPR+VEA++ GCVPVLI   Y  PF+DVLNW  FSVE+PVE I  +K IL  IS+ RY+
Sbjct  393   ASPRVVEAIHAGCVPVLISSSYSPPFTDVLNWSQFSVEIPVEKISEIKTILQSISRNRYL  452

Query  1711  RLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
             RL    L  RRHF +N P K +D+ HMILHS WLRRLN+RL G
Sbjct  453   RLHMNVLRVRRHFMLNRPAKPFDLMHMILHSIWLRRLNLRLIG  495



>gb|KHG09514.1| hypothetical protein F383_01906 [Gossypium arboreum]
Length=484

 Score =   442 bits (1137),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 214/394 (54%), Positives = 285/394 (72%), Gaps = 13/394 (3%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIR-AAVHGINQT----DDHDYVPTGPVYWNANVFHRSYLEM  840
             +K    + LE  L +ARA+IR AA+  I +T    +D+D VP G VY N + F++SY+EM
Sbjct  89    KKLSKEQVLEQGLARARASIRSAAIARIVRTAFFMNDND-VPVGDVYRNPSTFYQSYVEM  147

Query  841   EKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISI  1014
             E++FK++VY EGE P+ H+GPCK++Y  EG FI+ ME     FRT DP++AHV+F+P S+
Sbjct  148   ERRFKVYVYSEGELPIVHDGPCKNLYTIEGRFIHEMEHGAKRFRTNDPQRAHVYFMPFSV  207

Query  1015  TAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEIS  1194
               +V ++Y     +     P+K  VSDY+ +++ KY +WNR+ GADHFMLACHDWGP  S
Sbjct  208   AWMVKYIYTPLSFD---ITPLKHFVSDYVKVISIKYPFWNRTHGADHFMLACHDWGPHAS  264

Query  1195  KAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTM-HGLIGGPSP-SRRSILAF  1368
             +    L+ NSIR LCNAN SEGF P KDVS+PEI L GG + H LI  P P + R   AF
Sbjct  265   QGNSLLYNNSIRVLCNANISEGFNPQKDVSLPEISLIGGYLSHKLIHPPPPNTSRPYFAF  324

Query  1369  FAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMV  1548
             FAGGLHGPIRP LL+HW+ +DND+QV+ YLPK   YY  + ++KFC+CPSGYEVASPR+V
Sbjct  325   FAGGLHGPIRPYLLQHWKGRDNDMQVYEYLPKNKDYYSYMLESKFCLCPSGYEVASPRIV  384

Query  1549  EALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRG  1728
             EA+Y+GCVPV++ D+YV PFSDVL W++FSV+V    IP LK+IL+ I + +Y +LQ   
Sbjct  385   EAIYSGCVPVILSDNYVLPFSDVLQWEAFSVQVETTKIPRLKEILSAIPEEKYRKLQEGV  444

Query  1729  LIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVR  1830
             ++ RRHF +N PPKR+DV HMILHS W+RR+N R
Sbjct  445   IVVRRHFMLNRPPKRFDVFHMILHSIWVRRINAR  478



>ref|XP_006400593.1| hypothetical protein EUTSA_v10015371mg [Eutrema salsugineum]
 gb|ESQ42046.1| hypothetical protein EUTSA_v10015371mg [Eutrema salsugineum]
Length=460

 Score =   441 bits (1135),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 220/396 (56%), Positives = 274/396 (69%), Gaps = 17/396 (4%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHD--YVPTGPVYWNANVFHRSYLEMEK  846
             K K RN  R+E  L K+RAAIR AV       + +  +VP G VY NA  FH+S++EMEK
Sbjct  71    KEKKRN--RIEEGLAKSRAAIREAVRSKKYASEKEETFVPRGAVYRNAYAFHQSHIEMEK  128

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISITA  1020
             +FK++VY EGEPP+ H GP K IY+ EG F+  ME   SPF    PE+AHVF LP+SIT 
Sbjct  129   KFKVWVYREGEPPLVHMGPVKGIYSIEGQFVDEMEREMSPFAASHPEEAHVFLLPVSITN  188

Query  1021  IVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKA  1200
             IVH+VY   V      L   Q   DY+N+VA KY YWN SLGADHF ++CHDW P++S+A
Sbjct  189   IVHYVYRPLVTYSRKQL--HQVFLDYVNVVAHKYPYWNSSLGADHFFVSCHDWAPDVSEA  246

Query  1201  VPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR-----RSILA  1365
              PE+ KN IR LCNAN SEGF P +DVSIPEI +PGG +    G P  SR     R ILA
Sbjct  247   NPEMLKNMIRVLCNANISEGFLPQRDVSIPEINIPGGHL----GPPRLSRSSGHDRPILA  302

Query  1366  FFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FFAGG HGPIR +LL HW++KD +VQVH YL     Y++++ K KFC+CPSGYEVASPR+
Sbjct  303   FFAGGSHGPIRKVLLTHWKDKDEEVQVHEYLAHKKDYFKLMAKAKFCLCPSGYEVASPRV  362

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             V A+  GCVPV+I DHY  PFSDVL+W  F++ VP + IP +K IL  +S RRY+ LQRR
Sbjct  363   VSAINLGCVPVIISDHYALPFSDVLDWSKFTIHVPSDKIPEIKTILKSVSWRRYLVLQRR  422

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              L  +RHF +N P + +D+  M+LHS WLRRLN+RL
Sbjct  423   VLQVQRHFVINRPSQPFDMLRMLLHSVWLRRLNLRL  458



>ref|XP_009151056.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Brassica rapa]
 emb|CDX88169.1| BnaA06g27600D [Brassica napus]
Length=480

 Score =   441 bits (1135),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 212/388 (55%), Positives = 278/388 (72%), Gaps = 18/388 (5%)
 Frame = +1

Query  700   LEANLGKARAAIR-AAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEG  876
             +E  L KARA+IR AA    N T     +P   VY N +   +SYLEMEK+FK++VYEEG
Sbjct  100   VEVGLSKARASIREAASSNRNATLFSVDLPNAQVYRNPSALSQSYLEMEKRFKVYVYEEG  159

Query  877   EPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFVYDRSV  1050
             EPP+ H+GPCKS+YA EG FI  ME S   FRT DP++AHV+FLP S+T +V ++Y  + 
Sbjct  160   EPPLVHDGPCKSVYAVEGRFIMEMEKSRTKFRTYDPDQAHVYFLPFSVTWLVTYLYQYNY  219

Query  1051  HNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIR  1230
               +    P++   SDY+ L++ K+ +WNR+ GADHFMLACHDWGP  SKA  +LF  SIR
Sbjct  220   DAE----PLRTFASDYVRLISSKHPFWNRTSGADHFMLACHDWGPLTSKANEDLFHKSIR  275

Query  1231  ALCNANTSEGFKPSKDVSIPEILLPGGTMHG-------LIGGPSPSRRSILAFFAGGLHG  1389
              +CNAN+SEGF P+KD ++PEI L GG +H        L+  P P     LAFFAGG+HG
Sbjct  276   VMCNANSSEGFNPAKDATLPEIKLYGGEVHPQLRLSKILMTSPRPH----LAFFAGGVHG  331

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             P+RPILL+HW+ +D D+ V  YLPK ++YY+ +R +KFC CPSGYEVASPR++EA+Y+ C
Sbjct  332   PVRPILLDHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRLIEAIYSEC  391

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             +PV++  ++V PFSD+L W++FSV+V V +IP LK+ILT IS  +Y  L+R     RRHF
Sbjct  392   IPVILSVNFVLPFSDILRWETFSVQVDVSEIPRLKEILTSISDEKYQSLKRNLRYVRRHF  451

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             E+N PPKRYD  HMILHS WLRRLN+RL
Sbjct  452   ELNDPPKRYDAFHMILHSIWLRRLNLRL  479



>gb|EYU42789.1| hypothetical protein MIMGU_mgv1a009597mg [Erythranthe guttata]
Length=337

 Score =   436 bits (1121),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 204/338 (60%), Positives = 259/338 (77%), Gaps = 7/338 (2%)
 Frame = +1

Query  838   MEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPIS  1011
             MEK FKI+VY+EGE P+FHNGPC+SIY+SEG FI  ME   + +RT DP++AHV+F+P S
Sbjct  1     MEKVFKIYVYKEGEAPIFHNGPCRSIYSSEGRFINEMEKHGNHYRTNDPDEAHVYFMPFS  60

Query  1012  ITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEI  1191
             +  +V ++Y+    +     P+  T++DY+  ++ K+ +WNRSLGADHFML+CHDWGP  
Sbjct  61    VVVMVQYLYEPGALDMN---PIGNTLADYVRTISHKHPFWNRSLGADHFMLSCHDWGPHT  117

Query  1192  SKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFF  1371
             S  VP LFKNSIR LCNANTSEGF P KD ++PEI L  G + GL+GGP PS+R  LAFF
Sbjct  118   SSYVPLLFKNSIRVLCNANTSEGFNPLKDATLPEINLKTGEITGLLGGPPPSQRKTLAFF  177

Query  1372  AGGLHGPIRPILLEHW--ENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             AGGLHG IR +LL HW  +N+D D+QV+  LP  +SY +ML+ +KFC+CPSGYEVASPR+
Sbjct  178   AGGLHGHIRHLLLHHWRDQNQDKDIQVYEKLPSNMSYEKMLKTSKFCLCPSGYEVASPRV  237

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             VEA+Y  CVPVLI D YV PFSDVLNWK F+V V VEDIPN+K IL GIS+ RY+++Q+R
Sbjct  238   VEAIYAECVPVLISDSYVPPFSDVLNWKKFAVVVAVEDIPNIKNILMGISEGRYLKMQKR  297

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
                 +RHF VN  PKR+D+ HMI+HS WLRRLN+RLH 
Sbjct  298   VRQVQRHFVVNGNPKRFDLFHMIVHSVWLRRLNLRLHA  335



>ref|XP_009151057.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X2 
[Brassica rapa]
Length=478

 Score =   441 bits (1134),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 212/388 (55%), Positives = 278/388 (72%), Gaps = 18/388 (5%)
 Frame = +1

Query  700   LEANLGKARAAIR-AAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEG  876
             +E  L KARA+IR AA    N T     +P   VY N +   +SYLEMEK+FK++VYEEG
Sbjct  98    VEVGLSKARASIREAASSNRNATLFSVDLPNAQVYRNPSALSQSYLEMEKRFKVYVYEEG  157

Query  877   EPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFVYDRSV  1050
             EPP+ H+GPCKS+YA EG FI  ME S   FRT DP++AHV+FLP S+T +V ++Y  + 
Sbjct  158   EPPLVHDGPCKSVYAVEGRFIMEMEKSRTKFRTYDPDQAHVYFLPFSVTWLVTYLYQYNY  217

Query  1051  HNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIR  1230
               +    P++   SDY+ L++ K+ +WNR+ GADHFMLACHDWGP  SKA  +LF  SIR
Sbjct  218   DAE----PLRTFASDYVRLISSKHPFWNRTSGADHFMLACHDWGPLTSKANEDLFHKSIR  273

Query  1231  ALCNANTSEGFKPSKDVSIPEILLPGGTMHG-------LIGGPSPSRRSILAFFAGGLHG  1389
              +CNAN+SEGF P+KD ++PEI L GG +H        L+  P P     LAFFAGG+HG
Sbjct  274   VMCNANSSEGFNPAKDATLPEIKLYGGEVHPQLRLSKILMTSPRPH----LAFFAGGVHG  329

Query  1390  PIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGC  1569
             P+RPILL+HW+ +D D+ V  YLPK ++YY+ +R +KFC CPSGYEVASPR++EA+Y+ C
Sbjct  330   PVRPILLDHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRLIEAIYSEC  389

Query  1570  VPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHF  1749
             +PV++  ++V PFSD+L W++FSV+V V +IP LK+ILT IS  +Y  L+R     RRHF
Sbjct  390   IPVILSVNFVLPFSDILRWETFSVQVDVSEIPRLKEILTSISDEKYQSLKRNLRYVRRHF  449

Query  1750  EVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             E+N PPKRYD  HMILHS WLRRLN+RL
Sbjct  450   ELNDPPKRYDAFHMILHSIWLRRLNLRL  477



>ref|XP_008457132.1| PREDICTED: probable glycosyltransferase At3g42180 [Cucumis melo]
Length=459

 Score =   440 bits (1132),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 214/404 (53%), Positives = 292/404 (72%), Gaps = 8/404 (2%)
 Frame = +1

Query  643   ETGTPLQ-VTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDD--HDYVPTGPVYWNAN  813
             E   P++ + I++K  NL+ +EA+L +ARA+IR AV   N T +    Y+P GP+Y N  
Sbjct  55    EGNKPMKAIIIRKKKMNLKMIEASLAEARASIRKAVLWKNFTSEKKETYIPRGPIYRNPY  114

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKA  987
              FH+S++EM K+FK++ Y EGE P+FH+GP  SIYA EG FI  ++ S  PFR   P++A
Sbjct  115   AFHQSHIEMVKRFKVWSYREGEQPLFHDGPLNSIYAIEGQFIDELDCSKSPFRASHPDQA  174

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLP--MKQTVSDYINLVAGKYAYWNRSLGADHFM  1161
             HVF LP+SIT I+HF+Y R + +   +    M +  +DYI +VA +Y YWNRS GADHF+
Sbjct  175   HVFLLPLSITNIIHFIY-RPITSPTDYSRDRMHRVTTDYIRVVANRYPYWNRSHGADHFV  233

Query  1162  LACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPS  1341
             ++CHDW PEIS A P+LFKN IR +CNAN +EGF+P+ D+ +PEI +  GT+     G  
Sbjct  234   VSCHDWAPEISDANPQLFKNFIRVVCNANITEGFRPNIDIPLPEINIHPGTLGPPDLGQP  293

Query  1342  PSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSG  1521
             P RR ILAFFAGG HG IR IL++HW+ KDN+VQVH YLPK  +Y +++ ++KFC+CPSG
Sbjct  294   PERRPILAFFAGGAHGYIRKILIKHWKEKDNEVQVHEYLPKTQNYTKLIGESKFCLCPSG  353

Query  1522  YEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQR  1701
             YEVASPR+VEA+Y GCVPV+I D+Y  PFSDVL+W  FSVE+PV+ IP +K IL  IS+ 
Sbjct  354   YEVASPRVVEAIYGGCVPVIISDNYSLPFSDVLDWSRFSVEIPVQRIPEIKTILKAISEE  413

Query  1702  RYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +Y+++ +  +  +RHF++N P K +DV HM+LHS WLRRLN  L
Sbjct  414   KYLKMYKGVIKVKRHFKINRPAKPFDVMHMLLHSLWLRRLNFGL  457



>ref|XP_007155060.1| hypothetical protein PHAVU_003G169700g [Phaseolus vulgaris]
 gb|ESW27054.1| hypothetical protein PHAVU_003G169700g [Phaseolus vulgaris]
Length=497

 Score =   441 bits (1133),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 214/394 (54%), Positives = 282/394 (72%), Gaps = 9/394 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTDDH--DYVPTGPVYWNANVFHRSYLEMEKQ  849
             +KF +LE+ E  L +ARA+I+  +   N T D+  ++VP G +YWN + F++S++EM K+
Sbjct  99    KKFPDLEKTEKGLAQARASIQEFIRSRNYTSDNRQNFVPKGSIYWNPHAFYQSHMEMVKR  158

Query  850   FKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET----SPFRTRDPEKAHVFFLPISIT  1017
             FK++VYEEGE P+ H+GP   IYA EG F+  ++     S FR + PE+AHVF+LP SI 
Sbjct  159   FKVWVYEEGEQPLVHDGPVNDIYAIEGQFMDEIDNYDKWSNFRAKHPEEAHVFYLPFSIA  218

Query  1018  AIVHFVYDRSVHNKEHWLP--MKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEI  1191
              IVH+VY + +     + P  +++ V DYI++VA KY YWNRS GADHF+L+CHDWGP++
Sbjct  219   NIVHYVY-KPIRKHSDYEPVRLQRLVEDYISVVAEKYPYWNRSEGADHFLLSCHDWGPKV  277

Query  1192  SKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFF  1371
             S   P+LFK+ IR LCNANTSEGF P+KDVSIPE+ LP G +     G  P+ R+IL FF
Sbjct  278   SFGNPKLFKSFIRVLCNANTSEGFIPNKDVSIPEVYLPKGKLGPPNLGQRPNERTILGFF  337

Query  1372  AGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVE  1551
             AG  HG IR ILL +W+ KDNDVQV+  LPKG  Y  M+ ++KFC+CPSGYEVASPR+VE
Sbjct  338   AGREHGDIRKILLNYWKGKDNDVQVYESLPKGKDYTRMMGQSKFCLCPSGYEVASPRVVE  397

Query  1552  ALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGL  1731
             AL  GCVPVLI  +Y  PF+DVLNW  FSVE+ VE IP +K IL  +S+ RY++L    +
Sbjct  398   ALNAGCVPVLISSNYSPPFTDVLNWSQFSVEISVEKIPEIKTILQSVSRNRYMKLHMNVM  457

Query  1732  IARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
               RRHF +N P K +D+ HMILHS WLRRLN+RL
Sbjct  458   RVRRHFMINRPAKPFDLMHMILHSIWLRRLNLRL  491



>ref|XP_008242868.1| PREDICTED: probable glycosyltransferase At3g42180 [Prunus mume]
Length=404

 Score =   437 bits (1124),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 207/387 (53%), Positives = 277/387 (72%), Gaps = 5/387 (1%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDD--HDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             +LE++E +L KARAAI  A+   N T +    +VP G +Y N   FH+S++EM K+FK++
Sbjct  16    SLEKIEEDLAKARAAILEAIRFKNYTSEKTETFVPRGTIYKNPYAFHQSHIEMVKRFKVW  75

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISITAIVHFV  1035
              Y+EGE P+ H GP  +IY  EG FI  +E   SPFR   P++AH FFLP+S+  IVH+V
Sbjct  76    SYKEGEQPLVHFGPVNNIYGIEGQFIDEIEREESPFRATHPDEAHTFFLPVSVANIVHYV  135

Query  1036  YDRSVHNKEHWLP-MKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPEL  1212
             Y      ++++   +++ V DYI +VA KY YWNRS GADHFM +CHDW PE+S   PEL
Sbjct  136   YMPITRKQDYYRDRLQRVVMDYIGVVANKYPYWNRSNGADHFMASCHDWAPEVSVGKPEL  195

Query  1213  FKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGP  1392
             F N IR LCNANTSEGF+P +DVS+PEI LP G +     G +P+ R ILAFFAG +HGP
Sbjct  196   FTNFIRVLCNANTSEGFQPKRDVSLPEIYLPYGRLGPPSLGQAPNNRPILAFFAGRVHGP  255

Query  1393  IRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCV  1572
             IRP+LL++W+ KD++VQVH  LPKG++Y +++ ++K+C+CPSG+EVASPR+VEA Y GCV
Sbjct  256   IRPMLLDYWKGKDDEVQVHEKLPKGLNYTKLMGQSKYCLCPSGFEVASPRVVEAFYAGCV  315

Query  1573  PVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFE  1752
             PVLI D+Y  PF DVLNW  FSV++PV  IP +K IL  I   +Y+++Q+R     RHF 
Sbjct  316   PVLISDNYALPFGDVLNWSQFSVQIPVARIPEIKTILESIPYEKYLKMQKRVSRVHRHFV  375

Query  1753  VNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +N P K +DV HM+LHS WLRRLN +L
Sbjct  376   LNRPSKSFDVIHMVLHSVWLRRLNFKL  402



>gb|KHN15048.1| Xylogalacturonan beta-1,3-xylosyltransferase, partial [Glycine 
soja]
Length=605

 Score =   444 bits (1142),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 286/404 (71%), Gaps = 10/404 (2%)
 Frame = +1

Query  652   TPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDH--DYVPTGPVYWNANVFHR  825
             T L  TI  K+ +LE++E  L +ARA+I+ ++   N T  +  ++VP G +Y N + FH+
Sbjct  200   TVLSSTIM-KYPSLEKIEEGLARARASIQESIRSRNYTSANRVNFVPKGSIYLNPHAFHQ  258

Query  826   SYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET----SPFRTRDPEKAHV  993
             S+ EM K+FK++VYEEGE P+ H+GP   IY+ EG FI  ++     S FR   P++A V
Sbjct  259   SHEEMLKRFKVWVYEEGEQPLVHDGPANDIYSIEGQFIDEIDNDAKWSHFRAEHPDQAQV  318

Query  994   FFLPISITAIVHFVYDRSVHNKEHWLP--MKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
             FFLP SI  +VH+VY + +     + P  +++ V DYI ++A KY YWNRS GADHF+L+
Sbjct  319   FFLPFSIANVVHYVY-KPIRKHSDYEPIRLQRLVEDYIGVIANKYPYWNRSEGADHFLLS  377

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
             CHDWGP++S   P+LFKN IR LCNANTSEGF P+KDVSIPE+ LP G +     G  P+
Sbjct  378   CHDWGPKVSYGNPKLFKNFIRVLCNANTSEGFLPNKDVSIPEVYLPKGKLGPPNLGQRPN  437

Query  1348  RRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE  1527
              RSILAFFAG  HG IR ILL HW+ KDND+QVH YLPKG +Y +++ ++KFC+CPSGYE
Sbjct  438   DRSILAFFAGREHGDIRKILLNHWKGKDNDIQVHEYLPKGKNYTQLMGQSKFCLCPSGYE  497

Query  1528  VASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRY  1707
             VASPR+VEA++ GCVPVLI   Y  PF+DVLNW  FSVE+PVE I  +K IL  IS+ RY
Sbjct  498   VASPRVVEAIHAGCVPVLISSSYSPPFTDVLNWSQFSVEIPVEKISEIKTILQSISRNRY  557

Query  1708  IRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
             +RL    L  RRHF +N P K +D+ HMILHS WLRRLN+RL G
Sbjct  558   LRLHMNVLRVRRHFMLNRPAKPFDLMHMILHSIWLRRLNLRLIG  601


 Score =   195 bits (495),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 127/172 (74%), Gaps = 7/172 (4%)
 Frame = +1

Query  820   HRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET----SPFRTRDPEKA  987
             +RS++EM K+FK++VY+EGE P+ H+GP  +IYA EG F+  ++     S FR R PE+A
Sbjct  1     NRSHIEMVKRFKVWVYQEGEQPLVHDGPVNNIYAIEGQFMDEIDNNDKWSQFRARHPEEA  60

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLP--MKQTVSDYINLVAGKYAYWNRSLGADHFM  1161
             HVFFLP SI  +VH+VY + +  +  + P  ++  V DYI+++  KY YWNRS GADHF+
Sbjct  61    HVFFLPFSIANVVHYVY-KPILKQSDYEPVRLQLLVEDYISVIEDKYPYWNRSKGADHFL  119

Query  1162  LACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTM  1317
             L+CHDW P++S   PELF++ IRALCNANTSEGF P++DVSIPE+ LP G +
Sbjct  120   LSCHDWAPKVSNGNPELFQSFIRALCNANTSEGFHPNRDVSIPEVYLPVGKL  171



>ref|XP_007011817.1| Exostosin family protein [Theobroma cacao]
 gb|EOY29436.1| Exostosin family protein [Theobroma cacao]
Length=479

 Score =   439 bits (1128),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 217/400 (54%), Positives = 281/400 (70%), Gaps = 13/400 (3%)
 Frame = +1

Query  664   VTIKRKFRNLER---LEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHR  825
             V  +RK +   R   LE  L +ARA+IR+A    N T   ++ D VP G VY N + F+ 
Sbjct  82    VIFQRKRKKPSREQVLEQGLARARASIRSAATARNVTVTFENDDDVPVGDVYRNPSAFYD  141

Query  826   SYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFF  999
             SY+EME++FK++VY EGE P+ H+GPCK IY  EG FI+ ME     FRT DP  AHV+F
Sbjct  142   SYVEMERRFKVYVYTEGELPIVHDGPCKEIYTIEGRFIHEMEHGAKRFRTNDPGHAHVYF  201

Query  1000  LPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDW  1179
             +P S+T +V ++Y    +N     P+KQ VSDY+ +V+ KY +WNR+ GADHFMLACHDW
Sbjct  202   MPFSVTWMVKYIYKPLSYNVS---PLKQFVSDYVKVVSTKYPFWNRTHGADHFMLACHDW  258

Query  1180  GPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMH-GLIGGPSPS-RR  1353
             GP  S+    L+ NSIR LCNANTSEGF P KDVS+PEI L GG +   L+  P P+  R
Sbjct  259   GPHASQGNSHLYTNSIRVLCNANTSEGFNPQKDVSLPEIHLNGGFLSPKLLHPPLPNVSR  318

Query  1354  SILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVA  1533
               L+FFAGGLHGPIRP LL+HW+ +D+++QV  YLPK   YY  + ++KFC+CPSGYEVA
Sbjct  319   PHLSFFAGGLHGPIRPFLLQHWKGRDDEMQVFEYLPKDKDYYSYMLQSKFCLCPSGYEVA  378

Query  1534  SPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             SPR+VEA+Y+ CVPV++ +HYV PFSDVL W++FSV+V    IP LK+IL GI + +Y +
Sbjct  379   SPRIVEAIYSECVPVILSEHYVLPFSDVLRWEAFSVQVETTAIPRLKEILLGIPEEKYRK  438

Query  1714  LQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             LQ      RRHF +N P KR+D+ HMILHS WLRR+N RL
Sbjct  439   LQEGVRAVRRHFMLNQPSKRFDMFHMILHSIWLRRINARL  478



>emb|CDX80499.1| BnaC07g29450D [Brassica napus]
Length=482

 Score =   439 bits (1128),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 212/389 (54%), Positives = 275/389 (71%), Gaps = 19/389 (5%)
 Frame = +1

Query  700   LEANLGKARAAIR--AAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEE  873
             +E  L KARA+IR   A    N T  +  +P   VY N +  H+SYLEMEK+FK++VYEE
Sbjct  101   VEVGLSKARASIREAGASSNRNATLFNVDLPNAQVYRNPSALHQSYLEMEKRFKVYVYEE  160

Query  874   GEPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
             GEPP+ H+GPCKS+YA EG FI  ME S   FRT DP+KAHV+FLP S+T +V  +YD  
Sbjct  161   GEPPLVHDGPCKSVYAVEGRFIMEMEKSRTKFRTHDPDKAHVYFLPFSVTWLVTNLYD--  218

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
               N     P++   SDY+ L++ K+ +WNR+ GADHFMLACHDWGP  SKA  +LF  SI
Sbjct  219   --NNFDVEPLRTFASDYVRLISSKHPFWNRTSGADHFMLACHDWGPLTSKANEDLFSKSI  276

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGGTMH-------GLIGGPSPSRRSILAFFAGGLH  1386
             R +CNAN+SEGF P+KD ++PEI L GG +H        L+  P P     LAFFAGG+H
Sbjct  277   RVMCNANSSEGFNPAKDATLPEIKLYGGEVHPQLRLSKTLMTSPRPH----LAFFAGGVH  332

Query  1387  GPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTG  1566
             GP+RPILL+HW+ +D D+ V  YLPK ++YY+ +R +KFC CPSGYEVASPR++EA+Y+ 
Sbjct  333   GPVRPILLDHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVASPRLIEAIYSE  392

Query  1567  CVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRH  1746
             C+PV++  ++V PFSD+L  ++FSV+V V +IP LK+IL  IS  +Y  L+R     RRH
Sbjct  393   CIPVILSVNFVLPFSDILRLETFSVQVDVSEIPRLKEILMSISDEKYQSLKRNLRYVRRH  452

Query  1747  FEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             FE+N PPKRYD  HM LHS WLRRLN+RL
Sbjct  453   FELNDPPKRYDAFHMTLHSIWLRRLNLRL  481



>ref|XP_009393729.1| PREDICTED: probable glycosyltransferase At5g20260 [Musa acuminata 
subsp. malaccensis]
Length=464

 Score =   437 bits (1125),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 203/359 (57%), Positives = 269/359 (75%), Gaps = 4/359 (1%)
 Frame = +1

Query  763   TDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIY  942
             ++  D++P G VY NA  FH+SY+EMEK+FK+++Y+EGEPP+ H+GP K+IYA EG+FI 
Sbjct  106   SEAQDWIPRGAVYRNAYAFHQSYIEMEKRFKVWIYKEGEPPIAHDGPSKNIYAIEGHFII  165

Query  943   HMET--SPFRTRDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAG  1116
              ME   +PF  R P  AHVFFLP S+  IVHF+Y  +V   ++  P+K+ ++DY+ +VA 
Sbjct  166   EMERERNPFVARHPADAHVFFLPFSVVNIVHFLYKPNV--TDYRGPLKRLIADYVAVVAD  223

Query  1117  KYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEI  1296
             +Y YWNRSLGADHFM++CHDW P +S A  +L++NSIR +CNANTSEGFK  KDV++PE+
Sbjct  224   RYPYWNRSLGADHFMVSCHDWAPHLSDANSDLYENSIRVICNANTSEGFKLGKDVTLPEV  283

Query  1297  LLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISY  1476
              LPGG +         + ++ILAFFAGG HG IR +LL HWE KD +V VH YLP+G++Y
Sbjct  284   HLPGGELSQPAANQLHNEKTILAFFAGGSHGYIREMLLHHWEGKDEEVVVHEYLPEGVNY  343

Query  1477  YEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVE  1656
              E++ K+KFC+CPSGYEVASPR+VE+++ GCVPV I   Y  PFSDVL+W+ FSV++PVE
Sbjct  344   DELMSKSKFCLCPSGYEVASPRIVESIFVGCVPVTISVDYPLPFSDVLDWRKFSVQIPVE  403

Query  1657  DIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              I  +K IL  I + RY +LQ+R    +RHF VN P KRYD+ HM+LHS WLRRLNVRL
Sbjct  404   KIAEIKAILRAIPESRYKKLQKRVTQVQRHFVVNQPAKRYDMIHMVLHSIWLRRLNVRL  462



>ref|XP_008337219.1| PREDICTED: probable glycosyltransferase At5g20260 [Malus domestica]
Length=391

 Score =   434 bits (1117),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 214/395 (54%), Positives = 279/395 (71%), Gaps = 21/395 (5%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQT-----DDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             NLER+EA+LG+AR AIR AVH  NQT     +D   +P G VY NA  FH+SY+EMEK+ 
Sbjct  3     NLERIEADLGRAREAIRKAVHEKNQTSNYKGNDDVIIPKGSVYRNAQSFHQSYVEMEKRL  62

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPISITAIV  1026
             K++VY EGE P+ H GP   IYA EG FI  ME+  S F  R P++AH+F +PIS+  I+
Sbjct  63    KVWVYREGEHPLVHTGPLNDIYAIEGQFIDEMESGKSRFMARHPDEAHLFLIPISVANII  122

Query  1027  HFVYDRSV-HNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             + +Y   V +N++    +++ V DYI ++A KY +WNRS GADHF+++CHDW P+IS+  
Sbjct  123   NTLYKPLVTYNRDQ---LQRVVMDYIGVIAEKYPHWNRSRGADHFLVSCHDWAPDISQVN  179

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS-----RRSILAF  1368
             P+L+++ IR LCNAN SEGFKP +DVSIPEI +P G       GP+P      +RSILAF
Sbjct  180   PKLYRBFIRVLCNANISEGFKPQRDVSIPEINIPYGKF-----GPTPQNTSLDKRSILAF  234

Query  1369  FAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMV  1548
             FAGG HG IR ILLEHW++KDN+VQVH YL     Y++++ K KFC+CPSGYEVAS R+V
Sbjct  235   FAGGSHGXIRKILLEHWKDKDNEVQVHEYLKNKKDYFKLMGKAKFCLCPSGYEVASARVV  294

Query  1549  EALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRG  1728
              A+  GCVPVLI D YV PFSDVL+W  FSV +P + IP +K IL GIS  RY+ LQ+  
Sbjct  295   TAISVGCVPVLISDDYVLPFSDVLDWSKFSVYIPSKKIPEIKTILRGISPSRYLELQKSV  354

Query  1729  LIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +   RHF ++ P + YD+ HM+LHS WLRRL+V L
Sbjct  355   MEVHRHFTIHRPAQPYDMLHMVLHSVWLRRLDVSL  389



>ref|XP_010683539.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=496

 Score =   438 bits (1127),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 217/396 (55%), Positives = 289/396 (73%), Gaps = 10/396 (3%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQT-----DDHDYVPTGPVYWNANVFHRSYLE  837
             ++K + +E +E  LG+AR+ I+ A+   N +     D  DYVP G +Y NA  FHRSYL 
Sbjct  103   RKKDQKVEIIEVTLGRARSLIKEAIQSRNTSNLFVEDQVDYVPHGNIYKNAFAFHRSYLL  162

Query  838   MEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME-TSPFRTRDPEKAHVFFLPISI  1014
             MEK FKI++YEEGEPP+FH GPCK+IY+ EG FI  +E  + FR +DP++A V+FLP S+
Sbjct  163   MEKMFKIYIYEEGEPPLFHYGPCKNIYSMEGIFINLLEKNNQFRAKDPDEAQVYFLPFSV  222

Query  1015  TAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEIS  1194
               I+  ++D  + +K     +++T+ DY+++++ KY YWNRSLGADHFML+CHDWGP  +
Sbjct  223   VMILQHLFDPIIRDKA---VLERTILDYVSVISHKYPYWNRSLGADHFMLSCHDWGPRAT  279

Query  1195  KAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLI-GGPSPSRRSILAFF  1371
                P L+ +SIRALCNANTSE F P KD SIPEI L  G    L+ G   PS R+ILAFF
Sbjct  280   WYHPLLYFHSIRALCNANTSENFNPRKDASIPEINLKTGEFAALLHGSLPPSERTILAFF  339

Query  1372  AGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVE  1551
             AG +HG IRP LL +W++KD D+QV+  LPK ISY EM++++K+C+CPSG+EVASPR+VE
Sbjct  340   AGRMHGHIRPALLTYWKDKDKDLQVYEELPKEISYGEMMKRSKYCLCPSGFEVASPRIVE  399

Query  1552  ALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGL  1731
             A+Y  CVPVLI  +Y+ PFSDVL+W SFSV+V V +IPNLKKIL  I   +Y+++Q    
Sbjct  400   AIYAECVPVLISQNYILPFSDVLDWSSFSVQVSVSEIPNLKKILMEIPYDKYLQMQEGVK  459

Query  1732  IARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
               +RHF +N PPKR+DV HMI+HS WLRRLNVR+H 
Sbjct  460   QVQRHFVMNDPPKRFDVFHMIIHSIWLRRLNVRIHS  495



>ref|XP_010418150.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=423

 Score =   436 bits (1120),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 214/386 (55%), Positives = 270/386 (70%), Gaps = 10/386 (3%)
 Frame = +1

Query  697   RLEANLGKARAAIRAAVHGINQTD-----DHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             ++EA L  ARA IR A    N T      D DY+P G +Y N   FHRSYL MEK FKI+
Sbjct  40    KVEAELATARALIREAQLNSNATSSSPLGDKDYIPHGDIYRNPYAFHRSYLLMEKIFKIY  99

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFV  1035
             VYEEG+PP+FH G CK IY+ EG F+  ME     +RTRDP+KAHV+FLP S+  I+H +
Sbjct  100   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  159

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             +D  V +K     +++ ++DYI +++ KY YWN S G DHFML+CHDWG   +  V +LF
Sbjct  160   FDPVVRDKA---VLERVIADYIQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLF  216

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
              NSIR LCNAN SE F P KD   PEI L  G ++ L GG  P+ R+ LAFFAG  HG I
Sbjct  217   FNSIRVLCNANISEYFNPEKDAPFPEINLLTGEINNLTGGLDPTSRTTLAFFAGKSHGKI  276

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RP+LL HW+ KD D+ V+  LP G+ Y EM+RK++FCICPSG+EVASPR+ EA+Y+GCVP
Sbjct  277   RPVLLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEAIYSGCVP  336

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI ++YV PFSDVLNW+ FSV V V++IP LK+IL  I + RY+RL       +RH  V
Sbjct  337   VLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYMRLYEGVKKVKRHILV  396

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRL  1833
             N PPKRYDV +MI+HS WLRRLNV+L
Sbjct  397   NDPPKRYDVFNMIIHSIWLRRLNVKL  422



>ref|XP_011020204.1| PREDICTED: probable glycosyltransferase At5g20260 [Populus euphratica]
Length=469

 Score =   437 bits (1123),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 207/396 (52%), Positives = 281/396 (71%), Gaps = 9/396 (2%)
 Frame = +1

Query  664   VTIKRKFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYL  834
             V+  +K  ++ER+EA+L  AR AI+ A+   N T    +  ++P G +Y NA  FH+SY 
Sbjct  75    VSHTKKKSSIERIEADLVNARVAIQEAIRRKNYTLTEKEDTFIPRGSMYRNAYAFHQSYS  134

Query  835   EMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPI  1008
             EM K FKI+VY EGE P+ H GP K IY+ EG FI  ME+  SPF  R+ ++AH FFLPI
Sbjct  135   EMVKTFKIWVYREGETPMVHKGPMKHIYSIEGQFIDEMESGKSPFLARNHDEAHAFFLPI  194

Query  1009  SITAIVHFVY-DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGP  1185
             S+  IV FVY   + +++E  +   +   DY+ +VA KY YWNRS G DHFM++CHDW P
Sbjct  195   SVAYIVEFVYLPITTYHRERLV---RIFKDYVTVVANKYPYWNRSRGGDHFMVSCHDWAP  251

Query  1186  EISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILA  1365
             ++S+  PEL+KN IR +CNANTSEGF+P +D ++PE+  P   +     G +P  R I A
Sbjct  252   QVSRDDPELYKNLIRVMCNANTSEGFRPRRDATLPELNCPPLKLTPACSGLAPHERKIFA  311

Query  1366  FFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FFAGG HG IR ILL+HW+ KD+++QVH YLPK  +Y E++ ++KFC+CPSG+EVASPR+
Sbjct  312   FFAGGEHGDIRKILLKHWKEKDDEIQVHEYLPKDQNYTELMGQSKFCLCPSGFEVASPRV  371

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
              E++Y+GCVPV+I DHY  PFSDVL+W  FSV++PVE IP +K IL GIS   Y+++Q+R
Sbjct  372   AESIYSGCVPVIISDHYNLPFSDVLDWSQFSVQIPVEKIPEIKTILRGISYDEYLKMQKR  431

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              +  +RHF +N P K YDV HM+LHS WLRRLN+R+
Sbjct  432   VMKVQRHFVLNRPAKPYDVLHMVLHSVWLRRLNIRV  467



>ref|XP_007204886.1| hypothetical protein PRUPE_ppa017740mg, partial [Prunus persica]
 gb|EMJ06085.1| hypothetical protein PRUPE_ppa017740mg, partial [Prunus persica]
Length=392

 Score =   434 bits (1115),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 206/387 (53%), Positives = 277/387 (72%), Gaps = 5/387 (1%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDD--HDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             +LE++E +L KARAAI  A+     T +    +VP G +Y N   FH+S++EM K+FK++
Sbjct  4     SLEKIEEDLAKARAAILEAIRFKKYTSEKTETFVPRGTIYKNPYAFHQSHIEMVKRFKVW  63

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISITAIVHFV  1035
              Y+EGE P+ H GP  +IY  EG FI  +E   SPFR   P++AH FFLP+S+  IVH+V
Sbjct  64    SYKEGEQPLVHFGPVNNIYGIEGQFIDEIEREESPFRATHPDEAHTFFLPVSVANIVHYV  123

Query  1036  YDRSVHNKEHWLP-MKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPEL  1212
             Y      ++++   +++ V DYI +VA KY YWNRS GADHFM +CHDW PE+S   PEL
Sbjct  124   YMPITRKQDYYRDRLQRVVMDYIGVVANKYPYWNRSNGADHFMASCHDWAPEVSVGKPEL  183

Query  1213  FKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGP  1392
             F N IR LCNANTSEGF+P +DVS+PEI LP G +     G +P+ R ILAFFAG +HGP
Sbjct  184   FTNFIRVLCNANTSEGFQPKRDVSLPEIYLPYGRLGPPSLGQAPNNRPILAFFAGRVHGP  243

Query  1393  IRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCV  1572
             IRP+LL++W+ KD++VQVH  LPKG++Y +++ ++K+C+CPSG+EVASPR+VEA Y GCV
Sbjct  244   IRPMLLDYWKGKDDEVQVHEKLPKGLNYTKLMGQSKYCLCPSGFEVASPRVVEAFYAGCV  303

Query  1573  PVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFE  1752
             PVLI D+Y  PFSDVLNW  FSV++PV  IP +K IL  I   +Y+++Q+R     RHF 
Sbjct  304   PVLISDNYTLPFSDVLNWSQFSVQIPVARIPEIKTILQSIPYEKYLKMQKRVSRVHRHFV  363

Query  1753  VNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +N P K +DV HM+LHS WLRRL+ +L
Sbjct  364   LNRPSKPFDVIHMVLHSVWLRRLDYKL  390



>ref|XP_007013568.1| Exostosin family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY31187.1| Exostosin family protein, putative isoform 1 [Theobroma cacao]
Length=484

 Score =   437 bits (1124),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 206/400 (52%), Positives = 278/400 (70%), Gaps = 6/400 (2%)
 Frame = +1

Query  646   TGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTD--DHDYVPTGPVYWNANVF  819
             TG  +    K+K  +LER+E  L KAR AIR A+   N T   +  Y+P G +Y N   F
Sbjct  84    TGEDVVSRPKKKKSSLERVEDGLTKAREAIREAIRSQNYTSYKEETYIPRGTIYRNPYAF  143

Query  820   HRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETSP--FRTRDPEKAHV  993
             H+S++EMEK+FK++VY EGEPP+ H GP  +IY  EG FI  ME+    F  R P++AH 
Sbjct  144   HQSHIEMEKRFKVWVYREGEPPLVHGGPVNNIYGIEGQFIEEMESEKNHFLARHPDEAHA  203

Query  994   FFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACH  1173
             F +P+S+  I+  +Y   +      L  ++ V+DY+ ++A KY YWNRS GADHF+++CH
Sbjct  204   FLIPVSVAKIIKLLYMPLITYSRDQL--QRVVTDYVGVIADKYPYWNRSNGADHFLVSCH  261

Query  1174  DWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRR  1353
             DW P+I  A PELFKN IR LCNANTSE ++P +DVS+PEI++P G +   +   SP  R
Sbjct  262   DWAPDIGDANPELFKNFIRVLCNANTSEKYRPQRDVSMPEIIIPKGELGPPLLDLSPRER  321

Query  1354  SILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVA  1533
             SILAFFAGG HG IR +LLEHW++KDN+V+VH YLP    Y++++ ++KFC+CPSGYEVA
Sbjct  322   SILAFFAGGAHGSIRKVLLEHWKDKDNEVRVHEYLPSNTDYFKLMGESKFCLCPSGYEVA  381

Query  1534  SPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             SPR+  A+  GCVPV+I D+Y  PFSDVL+W  FSV +P + IP +K IL GIS R+Y++
Sbjct  382   SPRVATAISVGCVPVIISDYYALPFSDVLDWSKFSVYIPSKRIPEIKTILKGISDRKYLK  441

Query  1714  LQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +Q+R    +RHF +N P   +DV HM+LHS WLRRLN RL
Sbjct  442   MQKRVRQVQRHFVLNRPALPFDVIHMLLHSVWLRRLNFRL  481



>ref|XP_006381108.1| hypothetical protein POPTR_0006s06330g [Populus trichocarpa]
 gb|ERP58905.1| hypothetical protein POPTR_0006s06330g [Populus trichocarpa]
Length=487

 Score =   437 bits (1123),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/396 (53%), Positives = 280/396 (71%), Gaps = 9/396 (2%)
 Frame = +1

Query  664   VTIKRKFRNLERLEANLGKARAAIRAAVHGINQT---DDHDYVPTGPVYWNANVFHRSYL  834
             V+ K+K   +ER+EA+L  AR AI+ A+   N T    +  ++P G +Y NA  FH+SY 
Sbjct  93    VSHKKKKSGIERIEADLVNARVAIQEAIRRKNYTLTEKEDAFIPRGSMYRNAYAFHQSYS  152

Query  835   EMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPI  1008
             EM K+FKI+VY EGE P+ HNGP K IY+ EG FI  ME+  SPF  R+ ++AH FFLPI
Sbjct  153   EMVKRFKIWVYREGETPMVHNGPMKHIYSIEGQFIDEMESGKSPFLARNHDEAHAFFLPI  212

Query  1009  SITAIVHFVY-DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGP  1185
             S+  IV FVY   + +++E  +   +   DY+ +VA KY YWNRS G DHFM++CHDW P
Sbjct  213   SVAYIVEFVYLPITTYHRERLV---RIFKDYVTVVANKYPYWNRSRGGDHFMVSCHDWAP  269

Query  1186  EISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILA  1365
             ++S+  PEL+KN IR +CNANTSEGF+P +D ++PE+  P   +     G +P  R I A
Sbjct  270   QVSRDDPELYKNLIRVMCNANTSEGFRPRRDATLPELNCPPLKLTPACRGLAPHERKIFA  329

Query  1366  FFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FFAGG HG IR ILL HW+ KD+++QVH YLPK   Y E++ ++KFC+CPSG+EVASPR+
Sbjct  330   FFAGGAHGDIRKILLRHWKEKDDEIQVHEYLPKDQDYMELMGQSKFCLCPSGFEVASPRV  389

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
              E++Y+GCVPV+I DHY  PFSDVL+W  FSV++PVE IP +K IL GIS   Y+++Q+ 
Sbjct  390   AESIYSGCVPVIISDHYNLPFSDVLDWSQFSVQIPVEKIPEIKTILRGISYDEYLKMQKG  449

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              +  +RHF +N P K YDV HM+LHS WLRRLN+R+
Sbjct  450   VMKVQRHFVLNRPAKPYDVLHMVLHSVWLRRLNIRV  485



>ref|XP_009340668.1| PREDICTED: probable glycosyltransferase At5g20260 [Pyrus x bretschneideri]
 ref|XP_009340669.1| PREDICTED: probable glycosyltransferase At5g20260 [Pyrus x bretschneideri]
Length=615

 Score =   441 bits (1135),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 217/395 (55%), Positives = 280/395 (71%), Gaps = 11/395 (3%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQT-----DDHDYVPTGPVYWNANVFHRSYLE  837
             KRK  NLER+EA+LG+AR AIR AVH  NQT     +D   +P G VY NA  F++SY+E
Sbjct  222   KRKMSNLERIEADLGRAREAIRKAVHEKNQTSNYKENDDVIIPKGSVYRNAQSFNQSYVE  281

Query  838   MEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPIS  1011
             MEK+ K++VY EGE P+ H GP   IYA EG FI  ME+  S F  R P++AH+F +PIS
Sbjct  282   MEKRLKVWVYREGEHPLVHTGPLNDIYAIEGQFIDEMESGKSRFMARHPDEAHLFLIPIS  341

Query  1012  ITAIVHFVYDRSV-HNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPE  1188
             +  IV+ +Y   V +N++    +++ V DYI ++A KY +WNRS GADHF+++CHDW P+
Sbjct  342   VANIVNTLYKPLVTYNRDQ---LQRVVMDYIGVIAEKYPHWNRSRGADHFLVSCHDWAPD  398

Query  1189  ISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAF  1368
             IS+  P+L++N IR LCNAN SEGFKP +DVSIPEI +P G         S  +RSILAF
Sbjct  399   ISQVNPKLYQNFIRVLCNANISEGFKPQRDVSIPEINIPYGKFGPTPQNTSLDKRSILAF  458

Query  1369  FAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMV  1548
             FAGG HG IR ILLEHW++KDN+VQVH YL     Y++++ K KFC+CPSGYEVAS R+V
Sbjct  459   FAGGSHGHIRKILLEHWKDKDNEVQVHEYLKNKKDYFKLMGKAKFCLCPSGYEVASARVV  518

Query  1549  EALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRG  1728
              A+  GCVPVLI D YV PFSDVL+W  FSV +P + IP +K IL GIS  RY+ LQ+R 
Sbjct  519   TAISVGCVPVLISDDYVLPFSDVLDWSKFSVNIPSKKIPEIKTILRGISPSRYLELQKRV  578

Query  1729  LIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +   RHF ++ P + YD+ HM+LHS WLRRL+V L
Sbjct  579   MDVHRHFTIHRPAQPYDMLHMVLHSVWLRRLDVSL  613


 Score =   135 bits (339),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 93/137 (68%), Gaps = 10/137 (7%)
 Frame = +1

Query  838   MEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPIS  1011
             M K+FK++ Y+EGE P+ H GP   IY  EG FI  +E   SPF T  P++AH FFLP S
Sbjct  1     MMKRFKVWSYKEGEHPLIHFGPMNDIYGIEGQFIDEIEREGSPFPTH-PDEAHTFFLPFS  59

Query  1012  ITAIVHFVY----DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDW  1179
             +  +VH+VY     +  +++EH   +++ VSDYI++VAGKY YWNRS GADHFM +CHDW
Sbjct  60    VANVVHYVYMPITRKQDYHREH---LQRIVSDYISVVAGKYPYWNRSNGADHFMASCHDW  116

Query  1180  GPEISKAVPELFKNSIR  1230
              PE+S    E FKN I+
Sbjct  117   APEVSIENLEPFKNFIK  133


 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 72/121 (60%), Gaps = 17/121 (14%)
 Frame = +1

Query  1420  ENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYE---VASPRMVEALYTGCVPVLIKD  1590
             ++KD++VQV+  L KG+ Y              G E   +ASPR+VEA+Y  CVPVLI D
Sbjct  133   KDKDDEVQVYEKLSKGLIY--------------GAEQILLASPRIVEAIYAECVPVLISD  178

Query  1591  HYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNLPPK  1770
             +Y  PFSDVL+W  FSV++PV+ I  +K IL  I   +Y+++Q+R +      E +L   
Sbjct  179   NYTLPFSDVLDWSKFSVQIPVDKILEIKTILQAIPFDKYLKMQKRKMSNLERIEADLGRA  238

Query  1771  R  1773
             R
Sbjct  239   R  239



>ref|XP_003550810.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
isoform X1 [Glycine max]
Length=496

 Score =   437 bits (1123),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/404 (52%), Positives = 290/404 (72%), Gaps = 9/404 (2%)
 Frame = +1

Query  646   TGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDD--HDYVPTGPVYWNANVF  819
              GT     I++   +LE++E  L +ARA+I+  +   N T      +VP G +Y N + F
Sbjct  91    NGTVQSSVIQKDLTSLEKIEEGLAQARASIQEYILSRNYTSQRRESFVPKGSIYRNPHAF  150

Query  820   HRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET----SPFRTRDPEKA  987
              +S++EM K+FK++VY+EGE P+ H+GP  +IYA EG F+  ++     S FR R PE+A
Sbjct  151   LQSHIEMVKRFKVWVYQEGEQPLVHDGPVNNIYAIEGQFMDEIDNNDKWSQFRARHPEEA  210

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLP--MKQTVSDYINLVAGKYAYWNRSLGADHFM  1161
             HVFFLP SI  +VH+VY + +  +  + P  ++  V DYI+++  KY YWNRS GADHF+
Sbjct  211   HVFFLPFSIANVVHYVY-KPILKQSDYEPVRLQLLVEDYISVIEDKYPYWNRSKGADHFL  269

Query  1162  LACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPS  1341
             L+CHDW P++S   PELF++ IRALCNANTSEGF P++DVSIPE+ LP G +     G  
Sbjct  270   LSCHDWAPKVSNGNPELFQSFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPPSLGQH  329

Query  1342  PSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSG  1521
             P+ R+ILAFFAGG+HG IR ILL+HW++KDN+V+VH YLPK  +Y +++ ++KFC+CPSG
Sbjct  330   PNSRTILAFFAGGVHGEIRKILLKHWKDKDNEVRVHEYLPKSQNYTKLMGQSKFCLCPSG  389

Query  1522  YEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQR  1701
             +EVASPR+VEA++ GCVPV+I D+Y  PFSDVL+W  FSV+V V+ IP +K IL  IS++
Sbjct  390   HEVASPRVVEAIHAGCVPVIICDNYSLPFSDVLHWSQFSVKVSVQKIPEIKSILQSISRK  449

Query  1702  RYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +Y+RL    L  RRHF +N P K +D+ HMILHS WLRRLN++L
Sbjct  450   KYLRLHMNVLRVRRHFMINRPAKPFDMMHMILHSIWLRRLNIKL  493



>ref|XP_010489710.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=459

 Score =   435 bits (1119),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/386 (55%), Positives = 268/386 (69%), Gaps = 10/386 (3%)
 Frame = +1

Query  697   RLEANLGKARAAIRAAVHGINQTD-----DHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             R+EA L  ARA IR A    N T      D +Y+P G +Y N   FHRSYL MEK FKI+
Sbjct  76    RVEAELATARALIREAQLNSNSTSSSPLGDEEYIPHGDIYRNPYAFHRSYLLMEKIFKIY  135

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFV  1035
             VYEEG+PP+FH G CK IY+ EG F+  ME     +RTRDP+KAHVFFLP S+  I+H +
Sbjct  136   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVFFLPFSVVMILHHL  195

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             +D  V +K     +++ ++DY+ +++ KY YWN S G DHFML+CHDWG   +  V +LF
Sbjct  196   FDPVVRDKA---VLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLF  252

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
              NSIR LCNAN SE F P KD   PEI L  G +  L GG  P  R+ LAFFAG  HG I
Sbjct  253   FNSIRVLCNANISEYFNPEKDAPFPEINLLTGEIKNLTGGLDPISRTTLAFFAGKSHGKI  312

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RP+LL HW+ KD D+ V+  LP G+ Y EM+RK++FCICPSG+EVASPR+ EA+Y+GCVP
Sbjct  313   RPVLLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEAIYSGCVP  372

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI ++YV PFSDVLNW+ FSV V V++IP LK+IL  I + RY+RL       +RH  V
Sbjct  373   VLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYLRLYEGVKKVKRHILV  432

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRL  1833
             N PPKRYDV +MI+HS WLRRLNV+L
Sbjct  433   NDPPKRYDVFNMIIHSIWLRRLNVKL  458



>ref|XP_007013570.1| Exostosin family protein [Theobroma cacao]
 gb|EOY31189.1| Exostosin family protein [Theobroma cacao]
Length=470

 Score =   436 bits (1120),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/395 (53%), Positives = 285/395 (72%), Gaps = 9/395 (2%)
 Frame = +1

Query  667   TIKRKFRNLERLEANLGKARAAIRAAVHGINQTD--DHDYVPTGPVYWNANVFHRSYLEM  840
              I++K R+ ER+EA+L  ARAAIR A+   N T   +  ++P G +Y N   FH+S++EM
Sbjct  79    CIRKKGRS-ERVEADLASARAAIREAIRTRNYTSYKEEKFIPRGCMYRNEYAFHQSHIEM  137

Query  841   EKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISI  1014
              ++FKI+ Y+EGE P+ H GP K IYA EG FI  +E   SPF+ + P++AHVFFLP+S+
Sbjct  138   VERFKIWTYKEGERPLVHTGPMKHIYAIEGQFIEEIEGGKSPFKAQHPDEAHVFFLPVSV  197

Query  1015  TAIVHFVY-DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEI  1191
               IV+++Y   + ++++    + +  +DYI +VA KY YW+R+ GADHFM++CHDW PE+
Sbjct  198   AYIVNYIYLPITTYSRDR---LVRIFTDYIKVVAKKYPYWSRTKGADHFMVSCHDWAPEV  254

Query  1192  SKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFF  1371
             +   PEL+KN IR LCNAN+SEGF P +DV++PE+ LP            P +R+ILAFF
Sbjct  255   AGQDPELYKNLIRVLCNANSSEGFHPKRDVALPELNLPPRGFSPRRFAQPPDKRTILAFF  314

Query  1372  AGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVE  1551
             AGG HG IR ILL HW++KDN+VQVH YL KG  Y +++ ++KFC+CPSG+EVASPR+VE
Sbjct  315   AGGAHGNIRKILLHHWKDKDNEVQVHEYLSKGQDYSKLMGRSKFCLCPSGFEVASPRVVE  374

Query  1552  ALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGL  1731
             + Y GCVPV+I D+YV PFSDVL+W  FSV++PVE IP +K IL  I   +Y+ +QRR L
Sbjct  375   SFYAGCVPVIISDNYVLPFSDVLDWSKFSVQIPVEKIPQIKTILQSIPGNKYLEMQRRVL  434

Query  1732  IARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLH  1836
               RRHFE+N P K +D+ HM+LHS WLRRLN+RL 
Sbjct  435   KLRRHFELNRPAKPFDIIHMVLHSIWLRRLNLRLQ  469



>ref|XP_003550809.2| PREDICTED: probable glycosyltransferase At3g42180-like [Glycine 
max]
Length=460

 Score =   434 bits (1117),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/393 (52%), Positives = 281/393 (72%), Gaps = 7/393 (2%)
 Frame = +1

Query  676   RKFRNLERLEANLGKARAAIRAAVHGINQTD---DHDYVPTGPVYWNANVFHRSYLEMEK  846
             +K  + + +E  L KARA+IR A+   N ++      ++P G +Y N + FH+S++EM K
Sbjct  64    KKRTSFDVVEEGLAKARASIREAILYRNHSNSGKQEHFIPKGSIYRNPHAFHQSHMEMVK  123

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS---PFRTRDPEKAHVFFLPISIT  1017
             +FK++VYEEGE P+ H GP   IYA EG FI  ++ S   PF+ R+P++AH FFLP+S+ 
Sbjct  124   RFKVWVYEEGEQPLVHYGPVNDIYAIEGQFIDEIDNSKRSPFKARNPDEAHAFFLPLSVV  183

Query  1018  AIVHFVYDRSVHNKEHWLP-MKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEIS  1194
              +VH+VY   +   ++    +++ V DYI +VA KY YWNRS GADHF+L+CHDW PEIS
Sbjct  184   NVVHYVYKPYMSQNDYSRDRLQRLVEDYIGVVADKYPYWNRSNGADHFLLSCHDWAPEIS  243

Query  1195  KAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFA  1374
              A P+LFKN IR LCNAN SEGF+P +DVSIPE+ LP G +     G  P  R+ILAFF+
Sbjct  244   HANPDLFKNFIRVLCNANNSEGFQPKRDVSIPEVYLPVGKLGPPNLGQHPMNRTILAFFS  303

Query  1375  GGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
             GG HG IR +LL+HW++KDN VQVH YLPKG +Y E++  +KFC+CPSGYEVASPR+VEA
Sbjct  304   GGAHGDIRKLLLKHWKDKDNHVQVHEYLPKGQNYTELMGLSKFCLCPSGYEVASPRVVEA  363

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             +  GCVPV+I ++Y  PFSDVLNW  FS+++ VE+I ++K IL  ++Q++Y +L R    
Sbjct  364   INAGCVPVIISENYSLPFSDVLNWSQFSIQISVENISDIKTILQNVTQKKYKKLHRNVRR  423

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              +RHF +N P K +D+ HMILHS WLRRLN R+
Sbjct  424   VQRHFVMNRPAKPFDLMHMILHSIWLRRLNFRV  456



>gb|KCW74795.1| hypothetical protein EUGRSUZ_E03530 [Eucalyptus grandis]
Length=470

 Score =   435 bits (1118),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/396 (53%), Positives = 285/396 (72%), Gaps = 12/396 (3%)
 Frame = +1

Query  670   IKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHD--YVPTGPVYWNANVFHRSYLEME  843
             IK+K  +L+R+E +L +ARAAIR A+   +   + +  ++P G VY N   FH+S++EM 
Sbjct  78    IKKK-SSLDRIEDDLAQARAAIRKAIRSRSYVSNKEETFIPRGNVYRNHYAFHQSHIEMM  136

Query  844   KQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISIT  1017
             K+FKI+ Y EG+ P+ H GP + +Y  EG FI  ME   +PFR R P++AH FFLP S+ 
Sbjct  137   KRFKIWTYREGDLPLVHYGPMRGLYGIEGQFIDEMEDKQNPFRARRPDEAHAFFLPFSVA  196

Query  1018  AIVHFVY----DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGP  1185
              ++++VY      S +++E    +++   DYI++VA +Y YWNRS GADHFM +CHDWGP
Sbjct  197   NVINYVYKPILSMSDYSRER---LQRFAGDYISVVADRYRYWNRSGGADHFMASCHDWGP  253

Query  1186  EISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILA  1365
             +IS A  ELFKN IR LCNANTSEGF+P  DVS+ E+ L  G +     G  PS R+ILA
Sbjct  254   DISSANRELFKNFIRVLCNANTSEGFRPEIDVSMAEVYLTRGKLGPPRLGLDPSNRTILA  313

Query  1366  FFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FFAGG HG IR +LLEHW++KD DVQVH YLPKG  Y +++ K+KFC+CPSG+EVASPR+
Sbjct  314   FFAGGAHGFIRELLLEHWKDKDADVQVHEYLPKGQHYTQLMGKSKFCLCPSGFEVASPRI  373

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             VE++Y GCVPV+IKD Y  PFSDVLNW  FS+++PV+ I ++K IL  I  ++Y++LQ+R
Sbjct  374   VESIYAGCVPVIIKDDYWLPFSDVLNWSKFSIQIPVKKIKDIKTILQAIPNQKYVKLQKR  433

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              +   RHFE++ P K +DV HMILHS WLRRLN++L
Sbjct  434   VVKVTRHFELHRPAKPFDVIHMILHSVWLRRLNLKL  469



>ref|XP_010519637.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X2 
[Tarenaya hassleriana]
Length=465

 Score =   434 bits (1116),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 207/392 (53%), Positives = 276/392 (70%), Gaps = 9/392 (2%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             +RK    E LE  L KARA+I  A    N T+   ++P   VY N   F+RSY+EMEK+F
Sbjct  77    QRKLTKEEELERGLAKARASILRAASDRNTTEYESHLPNAEVYHNPAAFYRSYVEMEKRF  136

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISITAIV  1026
             +++VYEEG  P+ H+GPCK +YA EG FI+ +E   + FRTRDP KAHV+F+P S+T +V
Sbjct  137   RVYVYEEGVLPLVHDGPCKDVYAVEGRFIHEIERGKTRFRTRDPLKAHVYFMPFSVTFLV  196

Query  1027  HFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVP  1206
              ++Y      K    P+K+ VSDY+  ++ KY +WNRS GADHFMLACHDWGP +SK+ P
Sbjct  197   KYLYQGHGDAK----PLKRFVSDYVTTISSKYPFWNRSSGADHFMLACHDWGPLVSKSNP  252

Query  1207  ELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMH---GLIGGPSPSRRSILAFFAG  1377
              LF  SIR LCNAN+SEGF P KD S+PEI L G  ++    L      S+R  LAFFAG
Sbjct  253   HLFNTSIRVLCNANSSEGFNPKKDASLPEIKLYGSEINPKLTLSKTGDYSQRPYLAFFAG  312

Query  1378  GLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEAL  1557
             GLHGPIRPILLEHW+++D D+ VH YLPK +++Y+ + ++KFC+CPSGYEVASPR++E++
Sbjct  313   GLHGPIRPILLEHWKHRDPDMPVHEYLPKNLNFYDFMLQSKFCLCPSGYEVASPRVIESI  372

Query  1558  YTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIA  1737
             Y  CVPV++  ++V P SDVL W++FSV+V V +IP LK+IL  +S+ +Y  L+R     
Sbjct  373   YAECVPVILSKNFVLPLSDVLRWETFSVQVDVSEIPRLKEILMSVSEEKYRWLRRNLQYV  432

Query  1738  RRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             RRHF +N PP+R+D  H  LHS WLRR+N  L
Sbjct  433   RRHFVLNQPPERFDAFHTTLHSIWLRRINFAL  464



>ref|XP_010519636.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Tarenaya hassleriana]
Length=469

 Score =   434 bits (1116),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 207/392 (53%), Positives = 276/392 (70%), Gaps = 9/392 (2%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQF  852
             +RK    E LE  L KARA+I  A    N T+   ++P   VY N   F+RSY+EMEK+F
Sbjct  81    QRKLTKEEELERGLAKARASILRAASDRNTTEYESHLPNAEVYHNPAAFYRSYVEMEKRF  140

Query  853   KIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISITAIV  1026
             +++VYEEG  P+ H+GPCK +YA EG FI+ +E   + FRTRDP KAHV+F+P S+T +V
Sbjct  141   RVYVYEEGVLPLVHDGPCKDVYAVEGRFIHEIERGKTRFRTRDPLKAHVYFMPFSVTFLV  200

Query  1027  HFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVP  1206
              ++Y      K    P+K+ VSDY+  ++ KY +WNRS GADHFMLACHDWGP +SK+ P
Sbjct  201   KYLYQGHGDAK----PLKRFVSDYVTTISSKYPFWNRSSGADHFMLACHDWGPLVSKSNP  256

Query  1207  ELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMH---GLIGGPSPSRRSILAFFAG  1377
              LF  SIR LCNAN+SEGF P KD S+PEI L G  ++    L      S+R  LAFFAG
Sbjct  257   HLFNTSIRVLCNANSSEGFNPKKDASLPEIKLYGSEINPKLTLSKTGDYSQRPYLAFFAG  316

Query  1378  GLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEAL  1557
             GLHGPIRPILLEHW+++D D+ VH YLPK +++Y+ + ++KFC+CPSGYEVASPR++E++
Sbjct  317   GLHGPIRPILLEHWKHRDPDMPVHEYLPKNLNFYDFMLQSKFCLCPSGYEVASPRVIESI  376

Query  1558  YTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIA  1737
             Y  CVPV++  ++V P SDVL W++FSV+V V +IP LK+IL  +S+ +Y  L+R     
Sbjct  377   YAECVPVILSKNFVLPLSDVLRWETFSVQVDVSEIPRLKEILMSVSEEKYRWLRRNLQYV  436

Query  1738  RRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             RRHF +N PP+R+D  H  LHS WLRR+N  L
Sbjct  437   RRHFVLNQPPERFDAFHTTLHSIWLRRINFAL  468



>ref|XP_004501350.1| PREDICTED: probable glycosyltransferase At5g25310-like [Cicer 
arietinum]
Length=476

 Score =   434 bits (1116),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/408 (51%), Positives = 286/408 (70%), Gaps = 19/408 (5%)
 Frame = +1

Query  661   QVTIKRKFRNL----ERLEANLGKARAAIRAAVHGINQTD---------DHDYVPTGPVY  801
               T+ R+ R +    E+ E  L +AR +IR A  G ++++         +  Y+P G VY
Sbjct  70    NATVTREVRKVKSKEEKREEGLARARGSIRKAALGDDRSNLSLSKSPHNNDGYIPAGAVY  129

Query  802   WNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRD  975
              N  +F++SYLEMEK FK++VY +G+ P+ H+GPCK IY+ EG F++ ME     FRT D
Sbjct  130   HNPRLFYQSYLEMEKIFKVYVYPDGDLPIVHDGPCKDIYSIEGRFLHEMEHGVGRFRTND  189

Query  976   PEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADH  1155
             P  AHV+FLP S+T +V ++Y  S  +     P+KQ VSDY+ +V+ +Y +WN++ GADH
Sbjct  190   PNAAHVYFLPFSVTWMVKYLYTPS--SNYDITPLKQFVSDYVRMVSMRYPFWNKTRGADH  247

Query  1156  FMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGG  1335
             FMLACHDWGP  SK  P L+  SIR LCNANTSEGF P KDV++PEI L GG +   +  
Sbjct  248   FMLACHDWGPHASKGNPFLYNTSIRVLCNANTSEGFNPLKDVTLPEIHLYGGEVSPKLLS  307

Query  1336  --PSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCI  1509
               P  + R  LAFFAGG+HGPIRPILL HW+N+D+D+ V+ YLPKG+ YY ++  +KFC+
Sbjct  308   LPPENAPRRYLAFFAGGMHGPIRPILLHHWKNRDSDINVYEYLPKGLDYYSLMLNSKFCL  367

Query  1510  CPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTG  1689
             CPSG+EVASPR+VE++Y  CVPV++ ++YV PFSDVL W++FSV+V V +IP LK++L  
Sbjct  368   CPSGHEVASPRIVESIYAECVPVILSNYYVLPFSDVLRWEAFSVQVDVSNIPRLKEVLNA  427

Query  1690  ISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             I + +Y +L++     RRHF +N P KR+DV HMILHS WLRRLN++L
Sbjct  428   IPESKYRKLKQGVRAVRRHFTLNQPAKRFDVFHMILHSIWLRRLNMKL  475



>gb|KGN60712.1| hypothetical protein Csa_2G008045 [Cucumis sativus]
Length=460

 Score =   434 bits (1115),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 209/390 (54%), Positives = 284/390 (73%), Gaps = 11/390 (3%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDD--HDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             +L+ +EA+L +ARA+IR AV   N T +    Y+P GP+Y N   FH+S++EM K+FK++
Sbjct  72    SLKMIEASLAEARASIRKAVLWKNFTSEKKETYIPRGPIYRNPYAFHQSHIEMVKRFKVW  131

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFV  1035
              Y EGE P+FH+GP  SIYA EG FI  ++ S  PFR   P++AHVF LP+SIT I+HF+
Sbjct  132   SYREGEQPLFHDGPLNSIYAIEGQFIDELDCSKSPFRASHPDEAHVFLLPLSITNIIHFI  191

Query  1036  Y----DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAV  1203
             Y      + +N++    M +  +DYI +VA +Y YWNRS GADHF+++CHDW PEIS A 
Sbjct  192   YRPITSPADYNRDR---MHRVTTDYIRVVANRYPYWNRSNGADHFVVSCHDWAPEISDAN  248

Query  1204  PELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGL  1383
             P+LFKN IR +CNAN +EGF+P+ D+ +PEI +  GT+     G  P RR ILAFFAGG 
Sbjct  249   PQLFKNFIRVVCNANITEGFRPNIDIPLPEINIHPGTLGPPDLGQPPERRPILAFFAGGA  308

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HG IR IL++HW+ KDN+VQVH YLPK  +Y +++ ++KFC+CPSGYEVASPR+VEA+Y 
Sbjct  309   HGYIRKILIKHWKEKDNEVQVHEYLPKTQNYTKLIGESKFCLCPSGYEVASPRVVEAIYG  368

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
             GCVPV+I D+Y  PFSDVL+W  FSV++PV+ IP +K IL  IS+ +Y++L +  +  +R
Sbjct  369   GCVPVIISDNYSLPFSDVLDWSRFSVQIPVQRIPEIKTILKAISEEKYLKLYKGVIKVKR  428

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             HF++N P K +DV HM+LHS WLRRLN  L
Sbjct  429   HFKINRPAKPFDVIHMLLHSLWLRRLNFGL  458



>ref|XP_010250234.1| PREDICTED: probable glycosyltransferase At5g20260 isoform X2 
[Nelumbo nucifera]
Length=483

 Score =   434 bits (1116),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 203/391 (52%), Positives = 279/391 (71%), Gaps = 7/391 (2%)
 Frame = +1

Query  652   TPLQVTIKR-KFRNLERLEANLGKARAAIRAAV--HGINQTDDHDYVPTGPVYWNANVFH  822
             +P  VT  R K  +L+++E  L +ARAAI  AV  H      + +++P G +Y N   FH
Sbjct  82    SPTTVTDTRIKKGSLDKIEEGLARARAAILQAVRSHNCTTLTEDEFIPRGSIYRNPFAFH  141

Query  823   RSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVF  996
             +S++EMEK+FK++VY+EGEPP+ H+GP  +IY++EG FI  M+   SPF  R P++AH F
Sbjct  142   QSHIEMEKRFKVWVYKEGEPPLVHDGPLNNIYSTEGQFIDEMDNGHSPFLARHPDEAHAF  201

Query  997   FLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHD  1176
             FLP+S+  +V F+Y          L  +  V DYI +++ KY YWN S GADHFM++CHD
Sbjct  202   FLPLSVVNVVRFIYKPVTSYARDRL--QHVVEDYIGVISSKYPYWNISQGADHFMVSCHD  259

Query  1177  WGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRS  1356
             W P++S A PELFK+ IR LCNAN +EGF+P  D S+PEI  P GT+     G +P +R+
Sbjct  260   WAPDVSDANPELFKHFIRVLCNANITEGFRPGIDASLPEINTPFGTLGQPNFGQAPHKRT  319

Query  1357  ILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVAS  1536
             +LAFFAGG HG IR +LL+ W++KD DVQVH YLPKG++Y  ++ ++KFC+CPSGYEVAS
Sbjct  320   LLAFFAGGAHGYIRRVLLQQWKDKDKDVQVHEYLPKGMNYTRLMGQSKFCLCPSGYEVAS  379

Query  1537  PRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRL  1716
             PR+VEA+Y GCVP +I D+Y  PFSDVL+W  FSV++PVE IP +K IL GISQ +Y+++
Sbjct  380   PRIVEAIYAGCVPAIISDNYWLPFSDVLDWSQFSVQIPVEKIPEIKTILQGISQDKYLKM  439

Query  1717  QRRGLIARRHFEVNLPPKRYDVTHMILHSAW  1809
             Q++    +RHF +N P +R+DV HMILHS W
Sbjct  440   QKKVRRVQRHFVLNRPAQRFDVIHMILHSVW  470



>ref|XP_006600734.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
isoform X2 [Glycine max]
Length=495

 Score =   434 bits (1117),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 207/400 (52%), Positives = 290/400 (73%), Gaps = 9/400 (2%)
 Frame = +1

Query  658   LQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTDD--HDYVPTGPVYWNANVFHRSY  831
             +Q ++ +   +LE++E  L +ARA+I+  +   N T      +VP G +Y N + F +S+
Sbjct  94    VQSSVIQDLTSLEKIEEGLAQARASIQEYILSRNYTSQRRESFVPKGSIYRNPHAFLQSH  153

Query  832   LEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET----SPFRTRDPEKAHVFF  999
             +EM K+FK++VY+EGE P+ H+GP  +IYA EG F+  ++     S FR R PE+AHVFF
Sbjct  154   IEMVKRFKVWVYQEGEQPLVHDGPVNNIYAIEGQFMDEIDNNDKWSQFRARHPEEAHVFF  213

Query  1000  LPISITAIVHFVYDRSVHNKEHWLP--MKQTVSDYINLVAGKYAYWNRSLGADHFMLACH  1173
             LP SI  +VH+VY + +  +  + P  ++  V DYI+++  KY YWNRS GADHF+L+CH
Sbjct  214   LPFSIANVVHYVY-KPILKQSDYEPVRLQLLVEDYISVIEDKYPYWNRSKGADHFLLSCH  272

Query  1174  DWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRR  1353
             DW P++S   PELF++ IRALCNANTSEGF P++DVSIPE+ LP G +     G  P+ R
Sbjct  273   DWAPKVSNGNPELFQSFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPPSLGQHPNSR  332

Query  1354  SILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVA  1533
             +ILAFFAGG+HG IR ILL+HW++KDN+V+VH YLPK  +Y +++ ++KFC+CPSG+EVA
Sbjct  333   TILAFFAGGVHGEIRKILLKHWKDKDNEVRVHEYLPKSQNYTKLMGQSKFCLCPSGHEVA  392

Query  1534  SPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             SPR+VEA++ GCVPV+I D+Y  PFSDVL+W  FSV+V V+ IP +K IL  IS+++Y+R
Sbjct  393   SPRVVEAIHAGCVPVIICDNYSLPFSDVLHWSQFSVKVSVQKIPEIKSILQSISRKKYLR  452

Query  1714  LQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             L    L  RRHF +N P K +D+ HMILHS WLRRLN++L
Sbjct  453   LHMNVLRVRRHFMINRPAKPFDMMHMILHSIWLRRLNIKL  492



>ref|XP_010250233.1| PREDICTED: probable glycosyltransferase At5g20260 isoform X1 
[Nelumbo nucifera]
Length=484

 Score =   434 bits (1115),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 203/392 (52%), Positives = 279/392 (71%), Gaps = 8/392 (2%)
 Frame = +1

Query  652   TPLQVTIKR--KFRNLERLEANLGKARAAIRAAV--HGINQTDDHDYVPTGPVYWNANVF  819
             +P  VT  R  K  +L+++E  L +ARAAI  AV  H      + +++P G +Y N   F
Sbjct  82    SPTTVTDTRIKKKGSLDKIEEGLARARAAILQAVRSHNCTTLTEDEFIPRGSIYRNPFAF  141

Query  820   HRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHV  993
             H+S++EMEK+FK++VY+EGEPP+ H+GP  +IY++EG FI  M+   SPF  R P++AH 
Sbjct  142   HQSHIEMEKRFKVWVYKEGEPPLVHDGPLNNIYSTEGQFIDEMDNGHSPFLARHPDEAHA  201

Query  994   FFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACH  1173
             FFLP+S+  +V F+Y          L  +  V DYI +++ KY YWN S GADHFM++CH
Sbjct  202   FFLPLSVVNVVRFIYKPVTSYARDRL--QHVVEDYIGVISSKYPYWNISQGADHFMVSCH  259

Query  1174  DWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRR  1353
             DW P++S A PELFK+ IR LCNAN +EGF+P  D S+PEI  P GT+     G +P +R
Sbjct  260   DWAPDVSDANPELFKHFIRVLCNANITEGFRPGIDASLPEINTPFGTLGQPNFGQAPHKR  319

Query  1354  SILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVA  1533
             ++LAFFAGG HG IR +LL+ W++KD DVQVH YLPKG++Y  ++ ++KFC+CPSGYEVA
Sbjct  320   TLLAFFAGGAHGYIRRVLLQQWKDKDKDVQVHEYLPKGMNYTRLMGQSKFCLCPSGYEVA  379

Query  1534  SPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIR  1713
             SPR+VEA+Y GCVP +I D+Y  PFSDVL+W  FSV++PVE IP +K IL GISQ +Y++
Sbjct  380   SPRIVEAIYAGCVPAIISDNYWLPFSDVLDWSQFSVQIPVEKIPEIKTILQGISQDKYLK  439

Query  1714  LQRRGLIARRHFEVNLPPKRYDVTHMILHSAW  1809
             +Q++    +RHF +N P +R+DV HMILHS W
Sbjct  440   MQKKVRRVQRHFVLNRPAQRFDVIHMILHSVW  471



>ref|XP_006299448.1| hypothetical protein CARUB_v10015613mg [Capsella rubella]
 gb|EOA32346.1| hypothetical protein CARUB_v10015613mg [Capsella rubella]
Length=462

 Score =   433 bits (1113),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/386 (55%), Positives = 270/386 (70%), Gaps = 10/386 (3%)
 Frame = +1

Query  697   RLEANLGKARAAIRAAVHGINQTD-----DHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             ++EA L  ARA IR A    N T      D DYVP G +Y N   FHRSYL MEK FKI+
Sbjct  79    KVEAELAMARALIREAQVNSNSTSSSPLGDEDYVPHGDIYRNPYAFHRSYLLMEKIFKIY  138

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFV  1035
             VYEEG+PP+FH G CK IY+ EG F+  ME     +RTRDP+KAHV+FLP S+  I+H +
Sbjct  139   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  198

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             +D  V +K     +++ ++DY+ +++ KY YWN S G DHFML+CHDWG   +  V +LF
Sbjct  199   FDPVVRDKA---VLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLF  255

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
              NSIR LCNAN SE F P KD   PEI L  G ++ L GG  P+ R+ LAFFAG  HG I
Sbjct  256   FNSIRVLCNANISEYFNPEKDAPFPEINLVTGEINNLTGGLDPTSRTTLAFFAGKSHGKI  315

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RP+LL +W+ KD D+ V+  LP G+ Y EM+RK++FCICPSG+EVASPR+ EA+Y+GCVP
Sbjct  316   RPVLLNNWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEAIYSGCVP  375

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI ++YV PFSDVLNW+ FSV V V++IP +K+IL  I + RY+RL       +RH  V
Sbjct  376   VLISENYVLPFSDVLNWEKFSVSVSVKEIPEMKRILMNIPEDRYMRLYEGVKKVKRHILV  435

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRL  1833
             N PPKRYDV +MI+HS WLRRLNV+L
Sbjct  436   NDPPKRYDVFNMIIHSIWLRRLNVKL  461



>ref|NP_187419.1| putative glycosyltransferase [Arabidopsis thaliana]
 sp|Q9SSE8.1|GLYT1_ARATH RecName: Full=Probable glycosyltransferase At3g07620 [Arabidopsis 
thaliana]
 gb|AAF13080.1|AC009176_7 hypothetical protein [Arabidopsis thaliana]
 gb|AEE74576.1| putative glycosyltransferase [Arabidopsis thaliana]
Length=470

 Score =   433 bits (1114),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/386 (55%), Positives = 268/386 (69%), Gaps = 10/386 (3%)
 Frame = +1

Query  697   RLEANLGKARAAIRAAVHGINQTD-----DHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             ++EA L  AR  IR A    + T      D DYVP G +Y N   FHRSYL MEK FKI+
Sbjct  87    KVEAELATARVLIREAQLNYSSTTSSPLGDEDYVPHGDIYRNPYAFHRSYLLMEKMFKIY  146

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFV  1035
             VYEEG+PP+FH G CK IY+ EG F+  ME     +RTRDP+KAHV+FLP S+  I+H +
Sbjct  147   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  206

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             +D  V +K     +++ ++DY+ +++ KY YWN S G DHFML+CHDWG   +  V +LF
Sbjct  207   FDPVVRDKA---VLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLF  263

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
              NSIR LCNAN SE F P KD   PEI L  G ++ L GG  P  R+ LAFFAG  HG I
Sbjct  264   FNSIRVLCNANISEYFNPEKDAPFPEINLLTGDINNLTGGLDPISRTTLAFFAGKSHGKI  323

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RP+LL HW+ KD D+ V+  LP G+ Y EM+RK++FCICPSG+EVASPR+ EA+Y+GCVP
Sbjct  324   RPVLLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRVPEAIYSGCVP  383

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI ++YV PFSDVLNW+ FSV V V++IP LK+IL  I + RY+RL       +RH  V
Sbjct  384   VLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEERYMRLYEGVKKVKRHILV  443

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRL  1833
             N PPKRYDV +MI+HS WLRRLNV+L
Sbjct  444   NDPPKRYDVFNMIIHSIWLRRLNVKL  469



>ref|XP_006856564.1| hypothetical protein AMTR_s00046p00183980 [Amborella trichopoda]
 gb|ERN18031.1| hypothetical protein AMTR_s00046p00183980 [Amborella trichopoda]
Length=462

 Score =   433 bits (1113),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/384 (53%), Positives = 284/384 (74%), Gaps = 9/384 (2%)
 Frame = +1

Query  700   LEANLGKARAAIRAAVHGINQT--DDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVYEE  873
             +EA L +AR AI+ A    N +  +D  + P   ++ N   FHRSYLEME + KIFVY+E
Sbjct  81    IEAGLARARKAIKDAASNPNSSLINDPLFSPDPQIFRNPAAFHRSYLEMENRLKIFVYKE  140

Query  874   GEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISITAIVHFVYDRS  1047
             GEPP+ H+GPCK+IY  EG FI+ +E  TS F T+ PE+AH++FLP+S+T +V ++Y   
Sbjct  141   GEPPLVHDGPCKNIYTIEGRFIHELELGTSSFLTKKPEQAHLYFLPLSVTQMVTYLYKPL  200

Query  1048  VHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFKNSI  1227
              ++     P+K+ VSDY++L++ ++ +WN SLGADHF L+CHDW P +S++   L+  SI
Sbjct  201   SYD---LTPLKRFVSDYVSLISSRHPFWNASLGADHFFLSCHDWAPHVSRSNHNLYNTSI  257

Query  1228  RALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR--RSILAFFAGGLHGPIRP  1401
             R LCNANTSEGF PSKD+S+PEI L  G +   +  P+  R  R ILAFFAGGLHGPIRP
Sbjct  258   RVLCNANTSEGFNPSKDISLPEINLRTGELPAQLLTPADPRHPRPILAFFAGGLHGPIRP  317

Query  1402  ILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVPVL  1581
             +LL+ W++KD D++V++YLPKG++YY+++ K+K+C+CPSGYEVASPR+VEA+++GCVPVL
Sbjct  318   LLLQQWQSKDPDIKVYQYLPKGLNYYDLMSKSKYCLCPSGYEVASPRVVEAIHSGCVPVL  377

Query  1582  IKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEVNL  1761
             I + YV PFSDVL W++F+V + + +IP +K+IL GI +  Y RL+      RRHF +N 
Sbjct  378   ISNSYVLPFSDVLRWEAFTVSLSLSEIPRVKEILEGIPEGEYQRLRENLGRVRRHFVLNQ  437

Query  1762  PPKRYDVTHMILHSAWLRRLNVRL  1833
             P +R DV HM++HS WLRRLN+R+
Sbjct  438   PAQRLDVFHMVMHSLWLRRLNLRM  461



>ref|XP_010454331.1| PREDICTED: probable glycosyltransferase At5g20260 isoform X2 
[Camelina sativa]
Length=461

 Score =   432 bits (1112),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 215/393 (55%), Positives = 276/393 (70%), Gaps = 11/393 (3%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDD--HDYVPTGPVYWNANVFHRSYLEMEK  846
             K K RN  R+E +L K+RAAIR AV   N + D    ++P G VY NA  FH+S++EMEK
Sbjct  72    KGKERN--RIEEDLAKSRAAIREAVMLKNFSSDKKETFIPRGAVYRNAYAFHQSHIEMEK  129

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISITA  1020
             +FK++VY EGE P+ H GP  +IY+ EG F+  +E   SPF    PE+AH F LP+SI  
Sbjct  130   KFKVWVYREGETPLVHMGPMNNIYSIEGQFVDEIERGMSPFAASHPEEAHAFLLPVSIAN  189

Query  1021  IVHFVYDRSV-HNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
             +VH++Y   V +++E    + +   DY+N+VA KY YWNRSLGADHF ++CHDW P++S 
Sbjct  190   VVHYLYRPLVTYSREQ---LHKVFLDYVNVVAHKYPYWNRSLGADHFFVSCHDWAPDVSG  246

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHG-LIGGPSPSRRSILAFFA  1374
             A PEL KN IR LCNANTSEGFKP +DVSIPEI +P G +    +   S   R ILAFFA
Sbjct  247   ANPELLKNMIRVLCNANTSEGFKPQRDVSIPEINIPSGKLGPPQLSNSSGHDRPILAFFA  306

Query  1375  GGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
             GG HG IR ILL+HW++KD +VQVH YL K   Y++++ K +FC+CPSGYEVASPR+V A
Sbjct  307   GGSHGYIRKILLQHWKDKDEEVQVHEYLSKNKDYFKLMSKARFCLCPSGYEVASPRVVAA  366

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             +  GCVPV+I DHY  PFSDVL+W  F++ VP E IP +K IL  +S RRY  LQRR L 
Sbjct  367   INLGCVPVIISDHYALPFSDVLDWTKFTIHVPSEKIPEIKTILKNVSWRRYRVLQRRVLQ  426

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              +RHF +N P + +D+  M+LHS WLRRLNVRL
Sbjct  427   VQRHFVLNRPSQPFDMLQMLLHSVWLRRLNVRL  459



>gb|AHL38775.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=459

 Score =   432 bits (1112),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/386 (55%), Positives = 268/386 (69%), Gaps = 10/386 (3%)
 Frame = +1

Query  697   RLEANLGKARAAIRAAVHGINQTD-----DHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             ++EA L  AR  IR A    + T      D DYVP G +Y N   FHRSYL MEK FKI+
Sbjct  76    KVEAELATARVLIREAQLNYSSTTSSPLGDEDYVPHGDIYRNPYAFHRSYLLMEKMFKIY  135

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFV  1035
             VYEEG+PP+FH G CK IY+ EG F+  ME     +RTRDP+KAHV+FLP S+  I+H +
Sbjct  136   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  195

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             +D  V +K     +++ ++DY+ +++ KY YWN S G DHFML+CHDWG   +  V +LF
Sbjct  196   FDPVVRDKA---VLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLF  252

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
              NSIR LCNAN SE F P KD   PEI L  G ++ L GG  P  R+ LAFFAG  HG I
Sbjct  253   FNSIRVLCNANISEYFNPEKDAPFPEINLLTGDINNLTGGLDPISRTTLAFFAGKSHGKI  312

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RP+LL HW+ KD D+ V+  LP G+ Y EM+RK++FCICPSG+EVASPR+ EA+Y+GCVP
Sbjct  313   RPVLLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRVPEAIYSGCVP  372

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI ++YV PFSDVLNW+ FSV V V++IP LK+IL  I + RY+RL       +RH  V
Sbjct  373   VLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEERYMRLYEGVKKVKRHILV  432

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRL  1833
             N PPKRYDV +MI+HS WLRRLNV+L
Sbjct  433   NDPPKRYDVFNMIIHSIWLRRLNVKL  458



>gb|KHN47103.1| Putative glycosyltransferase [Glycine soja]
Length=468

 Score =   433 bits (1113),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/405 (51%), Positives = 285/405 (70%), Gaps = 8/405 (2%)
 Frame = +1

Query  640   NETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTD---DHDYVPTGPVYWNA  810
             N     L+  IK++  + + +E  L KARA+IR A+   N ++     D++P G +Y N 
Sbjct  61    NSAYRSLEHRIKKR-TSFDVVEEGLAKARASIREAILSRNHSNSGKQEDFIPKGSIYRNP  119

Query  811   NVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS---PFRTRDPE  981
             + FH+S++EM K+FK++VYEEG+ P+ H GP   IYA EG FI  M+ S   PF+ ++P+
Sbjct  120   HAFHQSHIEMVKRFKVWVYEEGDQPLVHYGPVNDIYAIEGQFIDEMDNSKRSPFKAKNPD  179

Query  982   KAHVFFLPISITAIVHFVYDRSVHNKEHWLP-MKQTVSDYINLVAGKYAYWNRSLGADHF  1158
             +AH FFLP S+  +VH+VY   +   ++    +++ V DYI +VA KY YWNRS GADHF
Sbjct  180   EAHAFFLPFSVVNVVHYVYKPYMSQNDYRRDRLQRLVEDYIVVVADKYPYWNRSNGADHF  239

Query  1159  MLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGP  1338
             +L+CHDW PEIS A P+LFKN IR LCNAN SEGF+P +DVSIPE+ L  G +     G 
Sbjct  240   LLSCHDWAPEISHANPDLFKNFIRVLCNANNSEGFQPKRDVSIPEVYLSVGKLGPPNLGQ  299

Query  1339  SPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPS  1518
              P  R+ILAFF+GG HG IR +LL+HW++KDN VQVH YLPKG +Y E++  +KFC+CPS
Sbjct  300   HPMNRTILAFFSGGAHGDIRKLLLKHWKDKDNQVQVHEYLPKGQNYTELMGLSKFCLCPS  359

Query  1519  GYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQ  1698
             GYEVASPR+VEA+   CVPV+I ++Y  PFSDVLNW  FS+++ VE+IP++K IL  ++Q
Sbjct  360   GYEVASPRVVEAINAVCVPVIISENYSLPFSDVLNWSQFSIQISVENIPDIKTILQNVTQ  419

Query  1699  RRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             ++Y +L R     RRHF ++ P K +D+ HMI+HS WLRRLN RL
Sbjct  420   KKYKKLYRNVRRVRRHFVMHRPAKPFDLMHMIIHSIWLRRLNFRL  464



>ref|XP_006856554.1| hypothetical protein AMTR_s00046p00173940 [Amborella trichopoda]
 gb|ERN18021.1| hypothetical protein AMTR_s00046p00173940 [Amborella trichopoda]
Length=505

 Score =   434 bits (1115),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/384 (54%), Positives = 279/384 (73%), Gaps = 6/384 (2%)
 Frame = +1

Query  667   TIKRKFRNLERLEANLGKARAAIRAAVHGINQT--DDHDYVPTGPVYWNANVFHRSYLEM  840
             T++ K    ER+EA L +ARA+I+ A    N +   D   VP G VY N + F++SY++M
Sbjct  115   TMREKQGGFERVEAQLVRARASIKRAAKFCNDSCYGDDPLVPKGAVYRNPHAFYQSYIDM  174

Query  841   EKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISIT  1017
             EK  KI++Y+EGEPP+ H GP K IY+ EG FI+  E+ + F T DPE AH+ F+P+S+T
Sbjct  175   EKTLKIWIYKEGEPPLAHYGPLKYIYSIEGQFIHEFESRNQFITSDPEIAHLHFIPLSVT  234

Query  1018  AIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
              +V  +Y  + +      P+ +TVSDY+ +++ KY +WNR+ GADHF+L+CHDW P+  K
Sbjct  235   KMVQTLYPPNGYGSG---PLHRTVSDYVKVISCKYPFWNRTRGADHFILSCHDWAPDALK  291

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAG  1377
                +L  NSIR  CNANTSEGF   +DVS+PEI L G  +  LIGGPSPSRR++LAFFAG
Sbjct  292   GNRDLQHNSIRVFCNANTSEGFDRRRDVSMPEIHLKGWEIDDLIGGPSPSRRTVLAFFAG  351

Query  1378  GLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEAL  1557
             G HG IR +LLEHW++KD++V+VH YLPKG SY +++++ KFC+CPSG+EVASPR+VEA+
Sbjct  352   GEHGYIRSVLLEHWKDKDSEVRVHEYLPKGKSYSKLMKQAKFCLCPSGWEVASPRIVEAI  411

Query  1558  YTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIA  1737
             Y+GCVPV I   Y+ PFSDVL+W  FSV +PV  IP +K IL GISQRRY++LQRR L  
Sbjct  412   YSGCVPVTISASYILPFSDVLDWSKFSVNIPVSRIPEIKTILKGISQRRYLQLQRRVLQV  471

Query  1738  RRHFEVNLPPKRYDVTHMILHSAW  1809
             + HF +N P KR+DV HMILHS W
Sbjct  472   QHHFVLNRPAKRFDVIHMILHSIW  495



>ref|XP_006453093.1| hypothetical protein CICLE_v10010441mg [Citrus clementina]
 gb|ESR66333.1| hypothetical protein CICLE_v10010441mg [Citrus clementina]
Length=462

 Score =   432 bits (1111),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/393 (52%), Positives = 281/393 (72%), Gaps = 7/393 (2%)
 Frame = +1

Query  670   IKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHD--YVPTGPVYWNANVFHRSYLEME  843
             IK+K  NL R+EA+L +ARAAIR A+     + D +  ++P G +Y NA  FH+S++EM 
Sbjct  70    IKKKKSNLARIEADLVRARAAIREAIRTRKYSSDKNGSFIPRGSIYRNAYAFHQSHVEML  129

Query  844   KQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPISIT  1017
             K+FKI+ Y EGE P+ H GP K IYA EG+FI  ME+  SPF  R P++AH FF+PIS+T
Sbjct  130   KRFKIWAYTEGELPIAHVGPTKHIYAIEGHFIDEMESGLSPFMARHPDEAHAFFVPISVT  189

Query  1018  AIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
              IV +VY R + +  H   + +  +DY+ +VA +Y YWNRS GADHFM++CHDW P+IS 
Sbjct  190   YIVEYVY-RPITDY-HRDRLVRIFNDYLRVVADRYPYWNRSAGADHFMVSCHDWAPQISH  247

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMH-GLIGGPSPSRRSILAFFA  1374
               PE++KN IR LCNANTSEGF P +DV +PE  LP G +    I   +    S+ AFFA
Sbjct  248   DNPEIYKNFIRVLCNANTSEGFNPIRDVPLPEFNLPPGYLTPTRIRKRTAQGASVFAFFA  307

Query  1375  GGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
             GG HG +R +L +HW++KD+++QVH YLPKG  Y + +R++KFC+CPSG+EVASPR+VEA
Sbjct  308   GGAHGDVRKLLFQHWKDKDDEIQVHEYLPKGQDYMKTMRRSKFCLCPSGFEVASPRLVEA  367

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             +Y GCVPV+I DHY  PFSDVL+W  FS+++PV+ I  +K IL G+S  +Y+ LQ+  + 
Sbjct  368   IYVGCVPVIISDHYALPFSDVLDWSQFSIQIPVDKILEIKTILKGVSDDKYLELQKNVVQ  427

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              +RHF +N P K +D  HM++HS WL+RLNVR+
Sbjct  428   VQRHFVLNRPAKPFDALHMVIHSVWLKRLNVRM  460



>ref|XP_008242869.1| PREDICTED: probable glycosyltransferase At3g42180 [Prunus mume]
Length=407

 Score =   430 bits (1105),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 206/392 (53%), Positives = 276/392 (70%), Gaps = 5/392 (1%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDD--HDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             +LER+E +L +ARAAIR A+   N   +    ++P G +Y N   FH+S++EM K FK++
Sbjct  13    SLERIEEDLAQARAAIREAIQSRNYKSERTETFIPRGSIYKNPYAFHQSHIEMRKMFKVW  72

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISITAIVHFV  1035
              Y+EGE P+ H GP  +IY  EG+FI  +E   SPFR   P++AH FFLP+S+  IV +V
Sbjct  73    SYKEGELPLVHIGPMTNIYGIEGHFIDEIEREESPFRATHPDQAHTFFLPVSVANIVEYV  132

Query  1036  YDRSVHNKEHWLP-MKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPEL  1212
             Y      ++++   +++ V DYI +VA KY YWNRS GADHFM +CHDWGPEIS   PEL
Sbjct  133   YLPITRKQDYYRDRLQRIVVDYIGVVARKYPYWNRSHGADHFMASCHDWGPEISVGQPEL  192

Query  1213  FKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGP  1392
             FKN IR LCNANTSEGF+P +DV +PEI +P   +     G  P+ R ILAFFAG +HG 
Sbjct  193   FKNFIRVLCNANTSEGFQPRRDVPLPEIYVPSRKLGPPYFGQPPNNRPILAFFAGRVHGS  252

Query  1393  IRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCV  1572
             IRPILL++W++KD++VQVH  LP   +Y +++ K+K+C+CPSG+EVASPR+VEA Y GCV
Sbjct  253   IRPILLDNWKDKDDEVQVHEKLPLDQNYTKLMGKSKYCLCPSGFEVASPRVVEAFYAGCV  312

Query  1573  PVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFE  1752
             PVLI D+Y  PFSDVLNW  FS+++PV  IP +K IL GI   +Y+R+Q+R    +RHF 
Sbjct  313   PVLISDNYTLPFSDVLNWSQFSIQIPVAKIPEIKTILQGIPYEKYLRMQKRVSKVKRHFV  372

Query  1753  VNLPPKRYDVTHMILHSAWLRRLNVRLHGIED  1848
             +N P + +DV HM+LHS WLRRLN +L    D
Sbjct  373   LNRPSQPFDVIHMVLHSVWLRRLNSKLDTRHD  404



>ref|XP_006407816.1| hypothetical protein EUTSA_v10020696mg [Eutrema salsugineum]
 gb|ESQ49269.1| hypothetical protein EUTSA_v10020696mg [Eutrema salsugineum]
Length=459

 Score =   432 bits (1110),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 211/386 (55%), Positives = 268/386 (69%), Gaps = 10/386 (3%)
 Frame = +1

Query  697   RLEANLGKARAAIRAAVHGINQTD-----DHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             ++EA L  ARA IR A    N T      D DYVP G +Y N   FHRSYL MEK FKI+
Sbjct  76    KVEAELATARALIREAQLNPNSTTSSPLRDEDYVPHGDIYRNPYAFHRSYLLMEKMFKIY  135

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFV  1035
             VYEEG+PP+FH G CK IY+ EG F+  ME     +RTRDP++AHV+FLP S+  I+H +
Sbjct  136   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDILNYRTRDPDRAHVYFLPFSVVMILHHL  195

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             +D  V +K     +++ + DY+ +++ KY YWN S G DHFML+CHDWG   +  V +LF
Sbjct  196   FDPVVRDKA---VLERVIVDYVRIISNKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLF  252

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
              NSIR LCNAN SE F P KD   PEI LP G ++ L GG  P  R+ LAFFAG  HG I
Sbjct  253   FNSIRVLCNANISEYFNPEKDAPFPEINLPTGEINNLTGGLDPISRTTLAFFAGKSHGKI  312

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RP+LL HW+ KD D+ V+  LP G+ Y +++R+++FCICPSG+EVASPR+ EA+Y+ CVP
Sbjct  313   RPVLLNHWKEKDKDILVYENLPDGLDYKDLMRRSRFCICPSGHEVASPRIPEAIYSECVP  372

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI ++YV PFSDVLNW+ FSV V V++IP LK+IL  I + RYIRL       +RH  V
Sbjct  373   VLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYIRLHEGVKKVKRHILV  432

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRL  1833
             N PPKRYDV +MI+HS WLRRLNV+L
Sbjct  433   NDPPKRYDVFNMIIHSIWLRRLNVKL  458



>ref|XP_006289990.1| hypothetical protein CARUB_v10003620mg [Capsella rubella]
 gb|EOA22888.1| hypothetical protein CARUB_v10003620mg [Capsella rubella]
Length=491

 Score =   432 bits (1112),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 214/408 (52%), Positives = 274/408 (67%), Gaps = 12/408 (3%)
 Frame = +1

Query  640   NETGTPLQVTIKRKF-RNLERLEANLGKARAAIRAAVHGINQTD-------DHDYVPTGP  795
             N T T   V +K      +ER+E  L  ARAAIR A     + D       D  +V  G 
Sbjct  82    NLTATSEVVVVKELVDEAVERIEEGLAMARAAIRKAGEESLRRDRDRTNNSDTGFVSNGS  141

Query  796   VYWNANVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRT  969
             VY NA  FH+S+ EMEK+FKI+ Y EGE P+FH GP  +IYA EG F+  +E   S F+ 
Sbjct  142   VYLNAFTFHQSHREMEKRFKIWTYREGEAPLFHKGPLNNIYAIEGQFMDEIENGDSRFKA  201

Query  970   RDPEKAHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGA  1149
               PE+A VF++P+ I  I+ FVY          L  +  V DYI+LV+ +Y YWNRS GA
Sbjct  202   ASPEEATVFYIPVGIVNIIRFVYRPYTSYARDRL--QNVVKDYISLVSNRYPYWNRSHGA  259

Query  1150  DHFMLACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLI  1329
             DHF L+CHDW P++S A PEL+++ IRALCNAN SEGF P +DVS+PEI +P   +  + 
Sbjct  260   DHFFLSCHDWAPDVSAADPELYRHFIRALCNANASEGFTPMRDVSLPEINIPQSQLGYVH  319

Query  1330  GGPSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCI  1509
              G  P  R +LAFFAGG HG +R IL + W+ KD DVQV+ YLPK I+Y +M+ K KFC+
Sbjct  320   TGEQPQNRKLLAFFAGGSHGEVRKILFDQWKEKDKDVQVYEYLPKTINYTKMMDKAKFCL  379

Query  1510  CPSGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTG  1689
             CPSG+EVASPR+VE+LY+GCVPV+I D YV PFSDVLNWK+FS+ +P+  IP +KKIL  
Sbjct  380   CPSGWEVASPRIVESLYSGCVPVIIADSYVLPFSDVLNWKAFSIHIPISKIPEIKKILEA  439

Query  1690  ISQRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             I +  Y+ LQR+ L  R+HF VN P K YD+ HMI+HS WLRRLNVR+
Sbjct  440   IPEEEYLELQRKVLEVRKHFVVNRPSKPYDMLHMIMHSIWLRRLNVRI  487



>ref|XP_010464397.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=474

 Score =   432 bits (1111),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 212/386 (55%), Positives = 269/386 (70%), Gaps = 10/386 (3%)
 Frame = +1

Query  697   RLEANLGKARAAIRAAVHGINQTD-----DHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             ++EA L  ARA IR A    + T      D DY+P G +Y N   FHRSYL MEK FKI+
Sbjct  91    KVEAELATARALIREAQLNSHATSSSPLGDEDYIPHGDIYRNPYAFHRSYLLMEKIFKIY  150

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFV  1035
             VYEEG+PP+FH G CK IY+ EG F+  ME     +RTRDP+KAHV+FLP S+  I+H +
Sbjct  151   VYEEGDPPIFHYGICKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  210

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             +D  V +K     +++ ++DY+ +++ KY YWN S G DHFML+CHDWG   +  V +LF
Sbjct  211   FDPVVRDKA---VLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLF  267

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
              NSIR LCNAN SE F P KD   PEI L  G ++ L GG  P  R+ LAFFAG  HG I
Sbjct  268   FNSIRVLCNANISEYFNPEKDAPFPEINLMTGEINNLTGGLDPISRTTLAFFAGKSHGKI  327

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RP+LL HW+ KD D+ V+  LP G+ Y EM+RK++FCICPSG+EVASPR+ EA+Y+GCVP
Sbjct  328   RPVLLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEAIYSGCVP  387

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI ++YV PFSDVLNW+ FSV V V++IP LK+IL  I + RY+RL       +RH  V
Sbjct  388   VLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYMRLYEGVKKVKRHILV  447

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRL  1833
             N PPKRYDV +MI+HS WLRRLNV+L
Sbjct  448   NDPPKRYDVFNMIIHSIWLRRLNVKL  473



>ref|XP_002884661.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60920.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=470

 Score =   432 bits (1110),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 212/386 (55%), Positives = 267/386 (69%), Gaps = 10/386 (3%)
 Frame = +1

Query  697   RLEANLGKARAAIRAAVHGINQT-----DDHDYVPTGPVYWNANVFHRSYLEMEKQFKIF  861
             ++EA L  ARA IR A    N T      D DYVP G +Y N   FHRSYL ME+ FKI+
Sbjct  87    KVEAELATARALIREAQLNSNSTASSPLGDEDYVPHGDIYRNPYAFHRSYLLMERMFKIY  146

Query  862   VYEEGEPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFV  1035
             VYEEG+PP+FH G CK IY+ EG F+  ME     +RTRDP+KAHV+FLP S+  I+H +
Sbjct  147   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  206

Query  1036  YDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELF  1215
             +D  V +K     ++  ++DY+ +++ KY YWN S G DHFML+CHDWG   +  V +LF
Sbjct  207   FDPVVRDKA---VLESVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLF  263

Query  1216  KNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAGGLHGPI  1395
              NSIR LCNAN SE F P KD   PEI L  G ++ L GG  P  R  LAFFAG  HG I
Sbjct  264   FNSIRVLCNANISEYFNPEKDAPFPEINLLTGEINNLTGGLDPISRKTLAFFAGKSHGKI  323

Query  1396  RPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCVP  1575
             RP+LL HW+ KD D+ V+  LP+ ++Y EM+RKT+FCICPSG+EVASPR+ EA+Y+GCVP
Sbjct  324   RPVLLNHWKEKDKDILVYENLPEDLNYTEMMRKTRFCICPSGHEVASPRIPEAIYSGCVP  383

Query  1576  VLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFEV  1755
             VLI ++YV PFSDVLNW+ FSV V V++IP LK+IL  I + RY+RL       + H  V
Sbjct  384   VLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEERYMRLYEGVKKVKMHILV  443

Query  1756  NLPPKRYDVTHMILHSAWLRRLNVRL  1833
             N PPKRYDV +MI+HS WLRRLNV+L
Sbjct  444   NDPPKRYDVFNMIIHSIWLRRLNVKL  469



>ref|XP_011085421.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Sesamum indicum]
Length=410

 Score =   429 bits (1104),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 211/396 (53%), Positives = 281/396 (71%), Gaps = 12/396 (3%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQT----DDHDYVPTGPVYWNANVFHRSYLEM  840
             +R  + +ER+EA L KARA I+ A+     +     D DYVP G +Y NA VF RSY+ M
Sbjct  20    RRDDKKMERIEAGLSKARAFIKDAILKSRYSPPLAQDTDYVPRGDIYRNAYVFQRSYMLM  79

Query  841   EKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET-SPFRTRDPEKAHVFFLPISIT  1017
             EK FKI+VYEEGE P+FH GP K IY++EG F+  +E+ + FRT D ++AHV+FLP S+ 
Sbjct  80    EKMFKIYVYEEGEAPLFHYGPSKDIYSTEGIFLGLIESNTQFRTYDADEAHVYFLPFSVV  139

Query  1018  AIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
              I+  ++D    +K     +++ V DY+++V+ KY YWNRSLGADHFML+CHDWGP  + 
Sbjct  140   MILQHLFDPVTRDKG---VLERVVGDYVHIVSTKYPYWNRSLGADHFMLSCHDWGPRATW  196

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILAFFAG  1377
                 L+  S+R LCNANTSE F P KD+S PEI L  G + GL  G S   R+ILAFFAG
Sbjct  197   YEHHLYFTSMRVLCNANTSEFFNPRKDISFPEINLRTGDLTGLTSGSS--NRTILAFFAG  254

Query  1378  GLHGPIRPILLEHWENKDNDVQVHRYLPKG--ISYYEMLRKTKFCICPSGYEVASPRMVE  1551
              LHG IRP+L +HW++KD+DV+V+  LP+   +SY EM+ ++K+C+CPSGYEVASPR+VE
Sbjct  255   RLHGRIRPVLFQHWKDKDSDVKVYERLPENSPLSYKEMMERSKYCLCPSGYEVASPRIVE  314

Query  1552  ALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGL  1731
             A+Y  CVPVLI ++YV PFSDVL+W  FS++V V ++P LK+IL GI +  Y  L R   
Sbjct  315   AIYAECVPVLISENYVLPFSDVLDWDKFSIKVSVRELPELKRILMGIGEDEYKALHRGVR  374

Query  1732  IARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRLHG  1839
               +RHF VN PPKRYDV HM++HS WLRRLN+R++ 
Sbjct  375   QVQRHFVVNDPPKRYDVFHMMIHSLWLRRLNLRINA  410



>ref|XP_011081538.1| PREDICTED: probable glycosyltransferase At5g25310 [Sesamum indicum]
Length=485

 Score =   432 bits (1111),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 204/404 (50%), Positives = 288/404 (71%), Gaps = 11/404 (3%)
 Frame = +1

Query  640   NETGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGINQTD--DHDYVPTGPVYWNAN  813
             +E  +  +  + R+  N  +LE  L +ARAAI  A    N +    ++ + +  +YWN +
Sbjct  86    SEFPSKFKPAVTRRAEN--KLEQGLARARAAILDAASATNPSIIIKNNNILSPAIYWNPS  143

Query  814   VFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKA  987
              F++SY EME++FK++VY+EGE P+ H+GPCK IY+SEG FI+ ME   + F+T + + A
Sbjct  144   AFYQSYKEMERRFKVYVYQEGELPIVHDGPCKDIYSSEGRFIHEMEHGNNRFKTSNAQAA  203

Query  988   HVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLA  1167
             HV+F+P S+T +V ++Y  + +N     P+K  VSDY+ L++ K+ +WNR+ GADHFML+
Sbjct  204   HVYFMPFSVTWMVKYLYKPNTYNVT---PLKAFVSDYVKLISTKHPFWNRTQGADHFMLS  260

Query  1168  CHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPS  1347
             CHDWGP+ S+    L+  SIR LCNAN+SEGF P+KDVS+PEI L GG ++  +  P PS
Sbjct  261   CHDWGPKASQGNGLLYNTSIRVLCNANSSEGFDPTKDVSLPEIHLYGGIVNPKLISPPPS  320

Query  1348  R--RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSG  1521
                R  LAFFAGG+HGPIRPILL+HW  KD D+ V+ YLPK   YY+ + ++KFC+CPSG
Sbjct  321   NISRPDLAFFAGGIHGPIRPILLKHWRGKDTDLHVYEYLPKDQDYYDSMLRSKFCLCPSG  380

Query  1522  YEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQR  1701
             YEVASPR+VEA+Y  C+PV++ DHYV PFSDVL W++FS++V + +IP LK+IL  +S+ 
Sbjct  381   YEVASPRIVEAIYAECIPVILSDHYVLPFSDVLRWEAFSIQVDISEIPRLKEILVAVSED  440

Query  1702  RYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              Y+RL+      RRHF +N P KR+D+ HMILHS WLRRLN+R+
Sbjct  441   EYLRLKEGLRAVRRHFLLNQPVKRFDMFHMILHSVWLRRLNLRV  484



>ref|XP_008443936.1| PREDICTED: probable glycosyltransferase At5g20260 [Cucumis melo]
Length=480

 Score =   432 bits (1110),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 206/387 (53%), Positives = 282/387 (73%), Gaps = 11/387 (3%)
 Frame = +1

Query  694   ERLEANLGKARAAIRAAVHGINQTDDHD--YVPTGPVYWNANVFHRSYLEMEKQFKIFVY  867
             E +E  L +ARAAIR A+   N T + +  ++P G VY NA  FH+S++EM+K+ KI+ Y
Sbjct  96    EMIEEGLAEARAAIRQAIVTRNYTSEKEESFIPRGRVYRNAYAFHQSHIEMKKRLKIWTY  155

Query  868   EEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPISITAIVHFVYD  1041
             +EGE P+ H+GP K IY+ EG+FI  M++  SPF   DPE+AHVFFLPISI  IV ++Y 
Sbjct  156   KEGEQPLVHDGPMKHIYSIEGHFIDEMDSGKSPFSAHDPEEAHVFFLPISIVYIVDYIYK  215

Query  1042  R-SVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFK  1218
               + + ++  +   +  +DY+ +VA KY YWNR+ GADHFM++CHDW PE++K  P LFK
Sbjct  216   PITTYARDRLV---RIFTDYVRVVANKYPYWNRTRGADHFMVSCHDWAPEVTKEDPNLFK  272

Query  1219  NSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLI--GGPSPSRRSILAFFAGGLHGP  1392
               IR LCNANTSEGF P +D S+PEI LP  T H  +   G  P  RSILAFFAGG HG 
Sbjct  273   YFIRVLCNANTSEGFNPMRDASLPEINLPP-TFHLNLPRSGQPPQNRSILAFFAGGAHGF  331

Query  1393  IRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYTGCV  1572
             IR +L++HW++KD+++QVH YLP   +Y E++ ++KFC+CPSGYEVASPR+VEA++ GCV
Sbjct  332   IRHVLMQHWKDKDDEIQVHEYLPPAKNYTELIDRSKFCLCPSGYEVASPRLVEAIHGGCV  391

Query  1573  PVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARRHFE  1752
             PV+I D+Y  PF DVL+W  FS+ +P E IP +KKIL G+S ++Y++LQR  +  +RHFE
Sbjct  392   PVIISDYYSLPFDDVLDWSKFSMRIPSERIPEIKKILRGVSMKKYLKLQRGVMKVQRHFE  451

Query  1753  VNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             ++ P K +D+ HM+LHS WLRRLNV+L
Sbjct  452   IHRPAKAFDMFHMVLHSVWLRRLNVKL  478



>ref|XP_006394779.1| hypothetical protein EUTSA_v10004121mg [Eutrema salsugineum]
 gb|ESQ32065.1| hypothetical protein EUTSA_v10004121mg [Eutrema salsugineum]
Length=477

 Score =   431 bits (1109),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 211/399 (53%), Positives = 281/399 (70%), Gaps = 20/399 (5%)
 Frame = +1

Query  673   KRKFRNLER---LEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEME  843
             +RK + L R   +E  LGKARA+I  A    + T  +  +P   VY N +  +RSYLEME
Sbjct  86    QRKPKKLSRRKMVEQGLGKARASILEAASNRDATLFNIDLPNPQVYRNPSALYRSYLEME  145

Query  844   KQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMET--SPFRTRDPEKAHVFFLPISIT  1017
             K+FK++VYEEGE P+ H+GPCKS+YA EG FI  ME   + FRT DP++AHV+FLP S+T
Sbjct  146   KRFKVYVYEEGERPLAHDGPCKSVYAVEGRFITEMEKRKTKFRTYDPDQAHVYFLPFSVT  205

Query  1018  AIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
              +V ++Y+ +   K    P++   SDYI L++  + +WNR+ GADHFMLACHDWGP  SK
Sbjct  206   WLVRYLYEGNHDAK----PLRTFASDYIRLISINHPFWNRTSGADHFMLACHDWGPLTSK  261

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMH-------GLIGGPSPSRRS  1356
             A  +LF  SIR LCNAN+SEGF P+KDV++PE+ L GG +H        L+  P P    
Sbjct  262   ANKDLFNKSIRVLCNANSSEGFNPTKDVTLPEVSLHGGEVHPQLRFSKTLMASPRPH---  318

Query  1357  ILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVAS  1536
              LAFFAGG+HGP+RPILL+HW+ +D D+ V  YLPK ++YY+ +R +KFC CPSGYEVAS
Sbjct  319   -LAFFAGGVHGPVRPILLKHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVAS  377

Query  1537  PRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRL  1716
             PR+ EA+++ C+PV++  ++V PFSDVL W +FSV+V V +IP LK+IL  IS  +Y  L
Sbjct  378   PRVTEAIFSECIPVILSVNFVLPFSDVLRWDTFSVQVDVSEIPRLKEILMSISDEKYEWL  437

Query  1717  QRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +R     RRHFE+N PPKR+D  HM LHS WLRRLN++L
Sbjct  438   KRNLRYVRRHFELNDPPKRFDAFHMTLHSIWLRRLNLKL  476



>ref|XP_006287596.1| hypothetical protein CARUB_v10000808mg [Capsella rubella]
 gb|EOA20494.1| hypothetical protein CARUB_v10000808mg [Capsella rubella]
Length=493

 Score =   432 bits (1110),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 212/406 (52%), Positives = 281/406 (69%), Gaps = 14/406 (3%)
 Frame = +1

Query  646   TGTPLQVTIKRKFRNLERLEANLGKARAAIRAAVHGI-----NQTDDHDYVPTGPVYWNA  810
             T + LQ +   K   +  +E  L KARA+I  A         N T     +P   +Y N 
Sbjct  91    TNSSLQQSKPEKLNRINSVERGLAKARASILEASSSSPSSHRNTTLFSIDLPNPEIYRNP  150

Query  811   NVFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEK  984
             +  HRSYLEMEK+FK++VYEEGEPP+ H+GPCKS+YA EG FIY ME   + FRT DP +
Sbjct  151   SALHRSYLEMEKRFKVYVYEEGEPPLVHDGPCKSVYAVEGRFIYEMERRKARFRTYDPNQ  210

Query  985   AHVFFLPISITAIVHFVYDRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFML  1164
             A+V+FLP S+T +V ++Y+ +   K    P++  VSDY+ LV+  + +WNR+ GADHFML
Sbjct  211   AYVYFLPFSVTWLVRYLYEGNSDAK----PLRTFVSDYVRLVSTNHPFWNRTNGADHFML  266

Query  1165  ACHDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMH---GLIGG  1335
             ACHDWGP  S+A   LF  SIR LCNAN+SEGF P+KDV++PEI L GG +     L   
Sbjct  267   ACHDWGPLTSRANKHLFNTSIRVLCNANSSEGFNPTKDVTLPEIKLVGGEVDPKLRLSAT  326

Query  1336  PSPSRRSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICP  1515
              S S R  LAFFAGG+HGP+RPILL+HW+ +D D+ V  YLPK ++YY+ +R +KFC CP
Sbjct  327   LSASPRPYLAFFAGGVHGPVRPILLKHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCP  386

Query  1516  SGYEVASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGIS  1695
             SGYEVASPR++E++Y+ C+PV++  ++V PF+DVL W++FSV V V +IP LK+IL  IS
Sbjct  387   SGYEVASPRVIESIYSECIPVILSVNFVLPFTDVLRWETFSVLVDVSEIPRLKEILMSIS  446

Query  1696  QRRYIRLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
               +Y  L+R     RRHFE+N PPKRYD  H+ LHS WLRRLN++L
Sbjct  447   DEKYEWLKRNLRSVRRHFELNDPPKRYDAFHLTLHSIWLRRLNLKL  492



>ref|XP_010059401.1| PREDICTED: probable glycosyltransferase At3g42180 [Eucalyptus 
grandis]
Length=475

 Score =   431 bits (1107),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/401 (53%), Positives = 285/401 (71%), Gaps = 17/401 (4%)
 Frame = +1

Query  670   IKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHD--YVPTGPVYWNANVFH-----RS  828
             IK+K  +L+R+E +L +ARAAIR A+   +   + +  ++P G VY N   FH     RS
Sbjct  78    IKKK-SSLDRIEDDLAQARAAIRKAIRSRSYVSNKEETFIPRGNVYRNHYAFHQLKVFRS  136

Query  829   YLEMEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFL  1002
             ++EM K+FKI+ Y EG+ P+ H GP + +Y  EG FI  ME   +PFR R P++AH FFL
Sbjct  137   HIEMMKRFKIWTYREGDLPLVHYGPMRGLYGIEGQFIDEMEDKQNPFRARRPDEAHAFFL  196

Query  1003  PISITAIVHFVY----DRSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLAC  1170
             P S+  ++++VY      S +++E    +++   DYI++VA +Y YWNRS GADHFM +C
Sbjct  197   PFSVANVINYVYKPILSMSDYSRER---LQRFAGDYISVVADRYRYWNRSGGADHFMASC  253

Query  1171  HDWGPEISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSR  1350
             HDWGP+IS A  ELFKN IR LCNANTSEGF+P  DVS+ E+ L  G +     G  PS 
Sbjct  254   HDWGPDISSANRELFKNFIRVLCNANTSEGFRPEIDVSMAEVYLTRGKLGPPRLGLDPSN  313

Query  1351  RSILAFFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEV  1530
             R+ILAFFAGG HG IR +LLEHW++KD DVQVH YLPKG  Y +++ K+KFC+CPSG+EV
Sbjct  314   RTILAFFAGGAHGFIRELLLEHWKDKDADVQVHEYLPKGQHYTQLMGKSKFCLCPSGFEV  373

Query  1531  ASPRMVEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYI  1710
             ASPR+VE++Y GCVPV+IKD Y  PFSDVLNW  FS+++PV+ I ++K IL  I  ++Y+
Sbjct  374   ASPRIVESIYAGCVPVIIKDDYWLPFSDVLNWSKFSIQIPVKKIKDIKTILQAIPNQKYV  433

Query  1711  RLQRRGLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             +LQ+R +   RHFE++ P K +DV HMILHS WLRRLN++L
Sbjct  434   KLQKRVVKVTRHFELHRPAKPFDVIHMILHSVWLRRLNLKL  474



>gb|EYU20246.1| hypothetical protein MIMGU_mgv1a006806mg [Erythranthe guttata]
Length=430

 Score =   429 bits (1103),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/390 (53%), Positives = 277/390 (71%), Gaps = 20/390 (5%)
 Frame = +1

Query  688   NLERLEANLGKARAAIRAAVHGINQTDDHDYVPTGPVYWNANVFHRSYLEMEKQFKIFVY  867
             NLE+LE  L +ARAAI  A        +  ++P+G +Y N   FH+SY EME++FK++ Y
Sbjct  51    NLEKLEQGLARARAAINKA-----GRKNASFIPSGSIYRNPYAFHQSYTEMERRFKVWTY  105

Query  868   EEGEPPVFHNGPCKSIYASEGNFIYHMETS--PFRTRDPEKAHVFFLPISITAIVHFVYD  1041
             +EGEPP+FH G  K IY+ EG+ I  +E S   F   DP +AH FFLP+ +  I+HF+Y 
Sbjct  106   KEGEPPLFHMGRMKGIYSMEGHMIDALEDSHNQFVAADPAEAHAFFLPVGVAEIIHFLYT  165

Query  1042  -RSVHNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISKAVPELFK  1218
              R  +N+ H   + + V+DY+ +VA KY +WNRS GADHF LACHDWGP++S A PEL+K
Sbjct  166   PRINYNRNH---LHRVVADYVTVVANKYPFWNRSSGADHFFLACHDWGPDVSSANPELYK  222

Query  1219  NSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGP-----SPSRRSILAFFAGGL  1383
             N IR LCNAN SEGF+P++DVS+PEI +P G    L  GP     SP+ R+ILAFF+GG 
Sbjct  223   NFIRGLCNANVSEGFRPNRDVSLPEINVPPG----LALGPPDLNKSPNNRTILAFFSGGA  278

Query  1384  HGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEALYT  1563
             HG +R  L  HW+ +D+++QVH YLPK  +Y+E++ ++K+C+CPSGYEVASPR++E+++ 
Sbjct  279   HGHVREKLFRHWKERDDEIQVHEYLPKNENYFELMSRSKYCLCPSGYEVASPRLIESMHA  338

Query  1564  GCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLIARR  1743
             GCVPV++ D Y  PFSDVL+W+ FSV VPVE I  +KKIL GI    Y+R Q++ L  +R
Sbjct  339   GCVPVIVSDGYALPFSDVLDWRRFSVHVPVERIAEIKKILKGIPMDVYLRKQKQVLKVKR  398

Query  1744  HFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
             HF  N P + YD+ HMILHS WLRRLNVRL
Sbjct  399   HFVFNRPSQPYDLMHMILHSLWLRRLNVRL  428



>gb|AES91622.2| glycosyltransferase [Medicago truncatula]
Length=628

 Score =   436 bits (1121),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 209/396 (53%), Positives = 279/396 (70%), Gaps = 7/396 (2%)
 Frame = +1

Query  667   TIKRKFRNLERLEANLGKARAAIRAAVHGINQTDDHD---YVPTGPVYWNANVFHRSYLE  837
             +IK+   +L+R+E +L +ARA+IR A+   N +       +VP G +Y N   FH+S++E
Sbjct  229   SIKKIMSSLDRVEGSLSEARASIREAILSRNYSTSRRRDVFVPRGSIYRNPYAFHQSHME  288

Query  838   MEKQFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHMETS---PFRTRDPEKAHVFFLPI  1008
             M K+ KI+VY+EGE P+ H+GP  +IYA EG FI  ++ S   PF+ + P +AH+FFLP 
Sbjct  289   MVKRLKIWVYQEGEQPIVHDGPVNNIYAIEGQFIDEIDNSKMSPFKAKHPNEAHIFFLPF  348

Query  1009  SITAIVHFVYDRSVHNKE-HWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGP  1185
             S+  +V +VY   +  K+ +   + + V DY+N+VA KY YWNRS GADHF+L+CHDW P
Sbjct  349   SVANVVQYVYKPIMSKKDFNRDRLHRMVEDYVNVVAHKYPYWNRSNGADHFLLSCHDWAP  408

Query  1186  EISKAVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHGLIGGPSPSRRSILA  1365
             EIS A P LFKN  R LCNANTSEGF+P +DVSIPE+ LP G +     G SP  R+ILA
Sbjct  409   EISDANPNLFKNFTRVLCNANTSEGFQPKRDVSIPEVYLPVGKLGPPNLGQSPLNRTILA  468

Query  1366  FFAGGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRM  1545
             FF+GG HG IR +LL HW+NKD  VQVH YLPKG +Y E++  +KFC+CPSGYEVASPR+
Sbjct  469   FFSGGAHGDIRKLLLNHWKNKDAQVQVHEYLPKGQNYTELMGLSKFCLCPSGYEVASPRI  528

Query  1546  VEALYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRR  1725
             VEA+  GCVPV+I  +Y  PF+DVLNW  FSVE+PVE I  +K IL  +++ +Y++L   
Sbjct  529   VEAINAGCVPVIISQNYSLPFNDVLNWSEFSVEIPVEKIVEIKNILQNVTKDKYMKLHMN  588

Query  1726  GLIARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              +  ++HF +N P K +DV HMILHS WLRRLN RL
Sbjct  589   VMKVQKHFVMNRPAKPFDVMHMILHSIWLRRLNFRL  624



>ref|XP_010454330.1| PREDICTED: probable glycosyltransferase At5g20260 isoform X1 
[Camelina sativa]
Length=461

 Score =   430 bits (1106),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 214/393 (54%), Positives = 275/393 (70%), Gaps = 11/393 (3%)
 Frame = +1

Query  673   KRKFRNLERLEANLGKARAAIRAAVHGINQTDD--HDYVPTGPVYWNANVFHRSYLEMEK  846
             K K RN  R+E +L K+RAAIR AV   N + D    ++P G VY NA  FH+S++EMEK
Sbjct  72    KGKERN--RIEEDLAKSRAAIREAVMLKNFSSDKKETFIPRGAVYRNAYAFHQSHIEMEK  129

Query  847   QFKIFVYEEGEPPVFHNGPCKSIYASEGNFIYHME--TSPFRTRDPEKAHVFFLPISITA  1020
             +FK++VY EGE P+ H G   +IY+ EG F+  +E   SPF    PE+AH F LP+SI  
Sbjct  130   KFKVWVYREGETPLVHMGSMNNIYSIEGQFVDEIERGMSPFAASHPEEAHAFLLPVSIAN  189

Query  1021  IVHFVYDRSV-HNKEHWLPMKQTVSDYINLVAGKYAYWNRSLGADHFMLACHDWGPEISK  1197
             +VH++Y   V +++E    + +   DY+N+VA KY YWNRSLGADHF ++CHDW P++S 
Sbjct  190   VVHYLYRPLVTYSREQ---LHKVFLDYVNVVAHKYPYWNRSLGADHFFVSCHDWAPDVSG  246

Query  1198  AVPELFKNSIRALCNANTSEGFKPSKDVSIPEILLPGGTMHG-LIGGPSPSRRSILAFFA  1374
             A PEL KN IR LCNANTSEGFKP +DVSIPEI +P G +    +   S   R ILAFFA
Sbjct  247   ANPELLKNMIRVLCNANTSEGFKPQRDVSIPEINIPSGKLGPPQLSNSSGHDRPILAFFA  306

Query  1375  GGLHGPIRPILLEHWENKDNDVQVHRYLPKGISYYEMLRKTKFCICPSGYEVASPRMVEA  1554
             GG HG IR ILL+HW++KD +VQVH YL K   Y++++ K +FC+CPSGYEVASPR+V A
Sbjct  307   GGSHGYIRKILLQHWKDKDEEVQVHEYLSKNKDYFKLMSKARFCLCPSGYEVASPRVVAA  366

Query  1555  LYTGCVPVLIKDHYVAPFSDVLNWKSFSVEVPVEDIPNLKKILTGISQRRYIRLQRRGLI  1734
             +  GCVPV+I DHY  PFSDVL+W  F++ VP E IP +K IL  +S RRY  LQRR L 
Sbjct  367   INLGCVPVIISDHYALPFSDVLDWTKFTIHVPSEKIPEIKTILKNVSWRRYRVLQRRVLQ  426

Query  1735  ARRHFEVNLPPKRYDVTHMILHSAWLRRLNVRL  1833
              +RHF +N P + +D+  M+LHS WLRRLNVRL
Sbjct  427   VQRHFVLNRPSQPFDMLQMLLHSVWLRRLNVRL  459



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6574769445576