BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2220_g1_i1 len=529 path=[507:0-79 587:80-528]

Length=529
                                                                      Score     E

ref|XP_011086209.1|  PREDICTED: ankyrin repeat-containing protein...  79.3    5e-14   
ref|XP_010260927.1|  PREDICTED: uncharacterized protein LOC104599880  69.3    2e-11   
ref|XP_010276201.1|  PREDICTED: uncharacterized protein LOC104611001  67.8    6e-11   
ref|XP_010654862.1|  PREDICTED: uncharacterized protein LOC104880282  60.8    9e-09   
ref|XP_010241719.1|  PREDICTED: uncharacterized protein LOC104586247  60.5    2e-08   
ref|XP_011032497.1|  PREDICTED: uncharacterized protein LOC105131279  58.5    8e-08   
ref|XP_004308693.1|  PREDICTED: uncharacterized protein LOC101313462  58.5    8e-08   
ref|XP_007052364.1|  Uncharacterized protein TCM_005755               58.2    1e-07   
ref|XP_010241720.1|  PREDICTED: uncharacterized protein LOC104586248  56.6    3e-07   
ref|NP_001235831.1|  uncharacterized protein LOC100500285             56.6    4e-07   
emb|CDP09408.1|  unnamed protein product                              58.2    4e-07   
gb|KDP28882.1|  hypothetical protein JCGZ_14653                       55.8    5e-07   
ref|XP_010247943.1|  PREDICTED: uncharacterized protein LOC104590881  55.8    6e-07   
ref|XP_007052372.1|  Uncharacterized protein TCM_005766               55.8    8e-07   
emb|CBI16686.3|  unnamed protein product                              55.5    8e-07   
emb|CDP09409.1|  unnamed protein product                              57.0    1e-06   
ref|XP_010097817.1|  Ankyrin repeat-containing protein                56.6    2e-06   
ref|XP_006375173.1|  hypothetical protein POPTR_0014s04950g           54.7    2e-06   
ref|XP_003552476.1|  PREDICTED: uncharacterized protein LOC100805925  54.3    2e-06   
ref|XP_002270425.2|  PREDICTED: uncharacterized protein LOC100242687  55.8    3e-06   Vitis vinifera
ref|XP_006370503.1|  hypothetical protein POPTR_0001s43430g           53.9    4e-06   
ref|XP_008232384.1|  PREDICTED: uncharacterized protein LOC103331532  53.5    4e-06   
ref|XP_006370511.1|  hypothetical protein POPTR_0001s43480g           53.5    5e-06   
ref|XP_002270460.1|  PREDICTED: uncharacterized protein LOC100264971  52.8    7e-06   Vitis vinifera
ref|XP_008234034.1|  PREDICTED: ankyrin repeat-containing protein...  54.7    7e-06   
ref|XP_007052374.1|  Uncharacterized protein TCM_005768               53.1    8e-06   
ref|XP_010242097.1|  PREDICTED: uncharacterized protein LOC104586527  52.0    1e-05   
ref|XP_007220388.1|  hypothetical protein PRUPE_ppa021699mg           51.2    2e-05   
ref|XP_007052376.1|  Ankyrin repeat family protein                    52.8    2e-05   
ref|XP_007052365.1|  Ankyrin repeat family protein                    51.6    3e-05   
ref|XP_010054567.1|  PREDICTED: uncharacterized protein LOC104442889  50.8    4e-05   
gb|KCW76914.1|  hypothetical protein EUGRSUZ_D01263                   50.8    5e-05   
ref|XP_010052777.1|  PREDICTED: uncharacterized protein LOC104441349  50.4    5e-05   
ref|XP_007025564.1|  Uncharacterized protein TCM_029825               51.2    5e-05   
emb|CAN78752.1|  hypothetical protein VITISV_043005                   50.4    5e-05   Vitis vinifera
ref|XP_007052377.1|  Ankyrin repeat family protein                    51.6    7e-05   
ref|XP_006375176.1|  hypothetical protein POPTR_0014s04980g           50.8    7e-05   
ref|XP_010056381.1|  PREDICTED: uncharacterized protein LOC104444417  49.3    1e-04   
ref|XP_007052366.1|  Ankyrin repeat family protein                    50.8    2e-04   
ref|XP_006375177.1|  hypothetical protein POPTR_0014s04990g           50.4    2e-04   
ref|XP_011085716.1|  PREDICTED: uncharacterized protein LOC105167627  48.1    3e-04   
ref|XP_002526474.1|  hypothetical protein RCOM_0658430                48.1    4e-04   Ricinus communis
ref|XP_010242098.1|  PREDICTED: uncharacterized protein LOC104586528  48.1    5e-04   
ref|XP_006295666.1|  hypothetical protein CARUB_v10024782mg           48.9    5e-04   
ref|XP_007052361.1|  Uncharacterized protein TCM_005751               48.1    6e-04   
ref|XP_008343936.1|  PREDICTED: uncharacterized protein LOC103406722  47.8    6e-04   
ref|XP_006397654.1|  hypothetical protein EUTSA_v10001761mg           48.5    8e-04   
ref|XP_007139677.1|  hypothetical protein PHAVU_008G049700g           47.0    0.001   



>ref|XP_011086209.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Sesamum 
indicum]
Length=474

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 72/136 (53%), Gaps = 31/136 (23%)
 Frame = +2

Query  2    VTYQAGINPPAYIYK--NDA-------------------GKD----------SPVYIIFF  88
            VT++AGINPP+Y+++  N+A                   G +          S   II F
Sbjct  312  VTFEAGINPPSYLFEPSNEAIITVSSNGTALLNPNISSNGTELMQRSSAEMASMASIIIF  371

Query  89   LMVNTLSFSAAMTMIEYLTANMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVS  268
            L+ N+++ ++A ++I+YLT  +P+QRE R+++  M F Y W+   + P    K  ++IV+
Sbjct  372  LVANSVALTSATSIIDYLTQGLPFQRELRVAMSAMIFAYGWSLGNTKPTGTLKDVLLIVA  431

Query  269  SAVPYLVRSLPYLYKK  316
             +VP  +R LP +  K
Sbjct  432  LSVPLFLRVLPNMISK  447



>ref|XP_010260927.1| PREDICTED: uncharacterized protein LOC104599880 [Nelumbo nucifera]
Length=214

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 57/106 (54%), Gaps = 9/106 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGK---------DSPVYIIFFLMVNTLSFSAAMTMIEYLTANM  154
            V++QAG+NPP  ++++D G          D PV    FL  NTL  SA++ +I YLT   
Sbjct  53   VSFQAGVNPPGGVWQDDDGGHKAGRSIYADHPVAFSLFLTANTLGLSASINIIAYLTYGF  112

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVR  292
            P   E  I+IY M   Y+ A     P  + K   I++++A+PY +R
Sbjct  113  PLYMEVLIAIYSMIGTYASAVVAVTPKGSVKFRYILIAAAIPYALR  158



>ref|XP_010276201.1| PREDICTED: uncharacterized protein LOC104611001 [Nelumbo nucifera]
Length=208

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 57/106 (54%), Gaps = 9/106 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDS---------PVYIIFFLMVNTLSFSAAMTMIEYLTANM  154
            VT+QAG+NPP  ++++D G            PV    FL  NTL  SA++++I YLT   
Sbjct  51   VTFQAGVNPPGGVWQDDDGHHKAGRSIYAAHPVAFSLFLFYNTLGLSASISIIAYLTYGF  110

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVR  292
            P   E  I+IY M   Y+ A     P  + K   I++++A+PY +R
Sbjct  111  PLYMEVLIAIYSMICTYASAVVAITPKGSVKFRYILIAAAIPYALR  156



>ref|XP_010654862.1| PREDICTED: uncharacterized protein LOC104880282 [Vitis vinifera]
 emb|CAN65074.1| hypothetical protein VITISV_032900 [Vitis vinifera]
Length=169

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 60/117 (51%), Gaps = 15/117 (13%)
 Frame = +2

Query  5    TYQAGINPPAYIYKNDA--------------GKDSPVYIIFFLMVNTLSFSAAMTMIEYL  142
            T+QAGINPP  ++++                G +   + +F L  NTL+FS+++ MI YL
Sbjct  46   TFQAGINPPGGVWQDKTIVDGVPTHPGKAILGSEKAAFTVF-LFFNTLAFSSSLQMIHYL  104

Query  143  TANMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYK  313
              + P+  E   +IY M+  Y ++ A   P  A K   I+++  +PY VR    ++K
Sbjct  105  IIDCPFSFEVLTAIYSMSGTYGFSIAAVEPPGAVKFWYIMIAFLLPYAVRLSQQIFK  161



>ref|XP_010241719.1| PREDICTED: uncharacterized protein LOC104586247 [Nelumbo nucifera]
Length=179

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 62/119 (52%), Gaps = 15/119 (13%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKN--DAGKD------------SPVYIIFFLMVNTLSFSAAMTMIEY  139
            VT+QAGI PP  ++++  + GKD             P     FLM NTL  SA++++I Y
Sbjct  47   VTFQAGITPPGGVWQDVDENGKDPHHVAGRSIYAAQPTPFFIFLMANTLGLSASISIITY  106

Query  140  LTANMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKK  316
            LT   P   E  I+ Y +   Y+ A     P + +   I+I ++AVPYLVR +   ++K
Sbjct  107  LTIGFPLYMEVVIASYSLLLTYASAIIAITPEDVSFRYILI-AAAVPYLVRFIMQTFRK  164



>ref|XP_011032497.1| PREDICTED: uncharacterized protein LOC105131279 [Populus euphratica]
Length=185

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 59/115 (51%), Gaps = 10/115 (9%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKND--------AGKDSPVYIIFFLMVNTLSFSAAMTMIEYLTANMP  157
            VT+QAG+NPP  +++          A K    Y+  FL+ NTL+ S  + +I  LT   P
Sbjct  45   VTFQAGVNPPGGVWQEGDRAGRAIYASKTGAYYV--FLLSNTLALSTCILVITSLTYRFP  102

Query  158  YQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKKCC  322
            +  E  ++   M   Y+ A     P  + +   ++++++VP+++R   Y +KK C
Sbjct  103  FHFEIWVATASMMITYASAVFAVTPHESVRFRYLLIAASVPFVMRCFGYFFKKYC  157



>ref|XP_004308693.1| PREDICTED: uncharacterized protein LOC101313462 [Fragaria vesca 
subsp. vesca]
Length=182

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 16/117 (14%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKND-----AGK------DSPVYIIFFLMVNTLSFSAAMTMIEYLTA  148
            VT+QAG+NPP  ++++D     AG+        P Y+  FL+ NTL+ S+++ +I  LT 
Sbjct  50   VTFQAGVNPPGGVWQDDGNGHTAGRAIYATHKGPFYV--FLISNTLALSSSIFIIVMLTH  107

Query  149  NMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKKC  319
              P+  E  I+   M   Y  A     P  + K   I+ ++A+PY++R   + Y+ C
Sbjct  108  RFPFHFEVMIATLSMIVTYGSAVFAVTPNESVKFRYILFTAALPYVLR---FFYQMC  161



>ref|XP_007052364.1| Uncharacterized protein TCM_005755 [Theobroma cacao]
 gb|EOX96521.1| Uncharacterized protein TCM_005755 [Theobroma cacao]
Length=192

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 12/115 (10%)
 Frame = +2

Query  2    VTYQAGINPPAYIYK--ND--------AGKDSPVYIIFFLMVNTLSFSAAMTMIEYLTAN  151
            VT+QAG+NPP  +++  ND           DS  Y +F L  NTL+FSAA+ +I  LT N
Sbjct  45   VTFQAGVNPPGGVWQETNDYHTAGTAICASDSDAYYVF-LTSNTLAFSAAVLVIMSLTHN  103

Query  152  MPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKK  316
             P++ E R++   M   Y  +A  +   +  K  + ++++A P ++R L  L  K
Sbjct  104  FPFKFEVRVACVSMIITYG-SAIFAVTGDEDKFQLALITAAAPLILRCLIQLLVK  157



>ref|XP_010241720.1| PREDICTED: uncharacterized protein LOC104586248 [Nelumbo nucifera]
Length=160

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 59/113 (52%), Gaps = 9/113 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDA-GKD--------SPVYIIFFLMVNTLSFSAAMTMIEYLTANM  154
            VT+QAG NPP  ++++   G +        SPV    FL+ NT+  SA++++I YLT   
Sbjct  48   VTFQAGANPPGGVWQDTKLGHEPGTSIYSKSPVPFTLFLVANTVGLSASISIITYLTIGF  107

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYK  313
            P   E   ++Y M   Y+ +     P  + K   +++ + +P+L+R +   Y+
Sbjct  108  PLYAEVITALYSMILTYASSVIAVTPKGSVKYRYVLIGALLPFLLRFIRQTYR  160



>ref|NP_001235831.1| uncharacterized protein LOC100500285 [Glycine max]
 gb|ACU15320.1| unknown [Glycine max]
Length=175

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 62/114 (54%), Gaps = 11/114 (10%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKND-----AGK-----DSPVYIIFFLMVNTLSFSAAMTMIEYLTAN  151
            VT+QAG+NPP  +++ D     AG+     D+  Y + FL+ NTL+FS ++ +I  LT  
Sbjct  42   VTFQAGVNPPGGVWQEDKDGHVAGRAIYASDTQAYYV-FLIFNTLAFSNSILVILSLTHK  100

Query  152  MPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYK  313
             P+  E  ++   MA  Y  +     P ++ +   I++++A P++ R L  ++ 
Sbjct  101  FPFHFEICVATISMAVTYGSSIFAVSPDDSVRFRYILITAAGPFVFRFLVLIFN  154



>emb|CDP09408.1| unnamed protein product [Coffea canephora]
Length=401

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 22/126 (17%)
 Frame = +2

Query  2    VTYQAGINPPAYIYK-----NDA------GKDSPVYIIFFLMVNTLSFSAAMTMIEYLTA  148
            VT+QAG+ PP+ I       ND       G  +  Y+  FL  N+L  +A++++I YLT 
Sbjct  263  VTFQAGVTPPSSILDMSNQPNDENQAAIFGSHATSYL--FLFSNSLGLTASLSIIIYLTR  320

Query  149  NMPYQRETRISIYCMAFGYSWAA-----ARSPPINATKTTIIIVSSAVPYLVRSLP----  301
              P+QRE  I ++ M F Y ++       +          ++ V+  +P+L+R LP    
Sbjct  321  GFPFQRELLICVFAMMFSYGFSVSGILKGQKQEKEMAGYILLTVAFLLPFLIRWLPTWGK  380

Query  302  YLYKKC  319
              +KKC
Sbjct  381  MAWKKC  386



>gb|KDP28882.1| hypothetical protein JCGZ_14653 [Jatropha curcas]
Length=162

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 59/114 (52%), Gaps = 9/114 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVYIIF---------FLMVNTLSFSAAMTMIEYLTANM  154
            VT+QAG+NPP  ++++D G       I+         FL+ NT++ S ++ +I  LT   
Sbjct  42   VTFQAGVNPPGGVWQDDEGGHVAGRAIYATQKNAYYIFLISNTVALSTSLLLIVSLTYRF  101

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKK  316
            P+  E  ++ + M   Y+ A     P  + +   I+++++VP+L R    ++ K
Sbjct  102  PFHFEIWVATFSMIVTYASAIFAVTPDESVRFRYILLAASVPFLARCSIQIFNK  155



>ref|XP_010247943.1| PREDICTED: uncharacterized protein LOC104590881 [Nelumbo nucifera]
Length=157

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 53/113 (47%), Gaps = 8/113 (7%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVYII--------FFLMVNTLSFSAAMTMIEYLTANMP  157
            VT+QAGINPP  +++++ G ++   I+         F++ NTL FSAA  +I Y     P
Sbjct  45   VTFQAGINPPGGVWQDNKGHEAGKSILGDKHAVYNIFILANTLGFSAACNIIGYFVTGCP  104

Query  158  YQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKK  316
               E  I+I  M+  Y  A     P       +   +  +P L+R L    KK
Sbjct  105  MFMEVYIAILSMSATYGAAVVDITPNGTLNFGLFAFALFLPCLLRWLVNCSKK  157



>ref|XP_007052372.1| Uncharacterized protein TCM_005766 [Theobroma cacao]
 gb|EOX96529.1| Uncharacterized protein TCM_005766 [Theobroma cacao]
Length=192

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 58/115 (50%), Gaps = 12/115 (10%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKND----------AGKDSPVYIIFFLMVNTLSFSAAMTMIEYLTAN  151
            VT+QAG+NPP  +++               DS  Y +F L  NTL+FSAA+ +I  LT N
Sbjct  45   VTFQAGVNPPGGVWQETKADHIAGTAICASDSDAYYVF-LTSNTLAFSAAVLVIMSLTHN  103

Query  152  MPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKK  316
             P++ E R++   M   Y  A     P   T   + ++++A P ++R L  L  K
Sbjct  104  FPFKFEVRVAGVSMIITYGSAIFAVTPDGET-FQLALITAAAPLILRCLIQLLVK  157



>emb|CBI16686.3| unnamed protein product [Vitis vinifera]
Length=176

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 58/114 (51%), Gaps = 9/114 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVYIIF---------FLMVNTLSFSAAMTMIEYLTANM  154
            VT+QAGINPP  ++++D     P   I+         FL+ NT++FS ++ ++  LT   
Sbjct  36   VTFQAGINPPGGVWQDDKDGHRPGRAIYSYQTKEFYVFLISNTVAFSTSILLLISLTHKF  95

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKK  316
            P+  E  ++   M   Y+ +     P    K   I+ ++A P+++R L  ++ +
Sbjct  96   PFHFEVILATTSMVVTYASSVFAVTPDELVKFRYILFAAAAPFIIRCLLQVWAR  149



>emb|CDP09409.1| unnamed protein product [Coffea canephora]
Length=470

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 62/125 (50%), Gaps = 19/125 (15%)
 Frame = +2

Query  2    VTYQAGINPPAYIYK--NDAGKDSPVYIIF--------FLMVNTLSFSAAMTMIEYLTAN  151
            VT+QAG+ PP+ +    N    D     IF        FL  N+L  +A++++I YLT  
Sbjct  332  VTFQAGVTPPSGVLDKPNQPNPDQNQAAIFGSHATSYLFLFSNSLGLTASLSIIIYLTGG  391

Query  152  MPYQRETRISIYCM--AFGYSWAAARSPPINATKTT---IIIVSSAVPYLVRSLP----Y  304
             P+QRE  ISI+ M   +G+S +          +     ++ V+  +P+L+R LP     
Sbjct  392  FPFQRELLISIFAMMSTYGFSVSGILKKQRREKEVVGYILLTVAFLLPFLMRWLPTCGKM  451

Query  305  LYKKC  319
             +KKC
Sbjct  452  AWKKC  456



>ref|XP_010097817.1| Ankyrin repeat-containing protein [Morus notabilis]
 gb|EXB72240.1| Ankyrin repeat-containing protein [Morus notabilis]
Length=475

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 58/133 (44%), Gaps = 36/133 (27%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKD--------------------SPVYII-------------  82
            VT+QAG+NPP       +  +                    SPV  +             
Sbjct  319  VTFQAGVNPPGGFVAEKSQPNVNSTNTTSYAPPPSSPDQSYSPVSTVGLSAISAALGSIA  378

Query  83   ---FFLMVNTLSFSAAMTMIEYLTANMPYQRETRISIYCMAFGYSWAAARSPPINATKTT  253
               +FL  N+L F+A++ ++ YLTA  P+QRE +IS+Y M F Y  +     P    +  
Sbjct  379  TSDWFLFGNSLGFAASVNVLIYLTAGFPFQRELQISLYSMMFAYGCSVNDIQPKEIARCL  438

Query  254  IIIVSSAVPYLVR  292
            I+ ++  VP LVR
Sbjct  439  ILAIAFLVPILVR  451



>ref|XP_006375173.1| hypothetical protein POPTR_0014s04950g [Populus trichocarpa]
 gb|ERP52970.1| hypothetical protein POPTR_0014s04950g [Populus trichocarpa]
Length=182

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 59/114 (52%), Gaps = 8/114 (7%)
 Frame = +2

Query  2    VTYQAGINPPAYIYK--NDAGK-----DSPVYIIFFLMVNTLSFSAAMTMIEYLTANMPY  160
            VT+QAG+NPP  +++  N AG+         Y +F L+ NTL+ S  + +I  LT   P+
Sbjct  45   VTFQAGVNPPGGVWQEGNHAGRAIYASQKRAYYVF-LVSNTLALSTCILVITSLTYRFPF  103

Query  161  QRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKKCC  322
              E   +   M   Y+ A     P  + +    +++++VP+++R   Y +KK C
Sbjct  104  HLEIWAATASMMITYASAVFAVTPHESVRFRYPLIAASVPFVMRCFGYFFKKYC  157



>ref|XP_003552476.1| PREDICTED: uncharacterized protein LOC100805925 [Glycine max]
Length=175

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 59/114 (52%), Gaps = 11/114 (10%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGK----------DSPVYIIFFLMVNTLSFSAAMTMIEYLTAN  151
            VT+QAG+NPP  +++   G+          D   Y + FL+ NTL+FS ++ +I  LT  
Sbjct  42   VTFQAGVNPPGGVWQETNGEHIAGRAIYASDKQAYYV-FLIFNTLAFSNSILVILSLTHK  100

Query  152  MPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYK  313
             P+  E  ++   MA  Y  +     P ++ +   I++++A P++ R L  ++ 
Sbjct  101  FPFHFEICVATISMAVTYGSSIFAVSPDDSVRFRYILITAAGPFVFRFLVLIFN  154



>ref|XP_002270425.2| PREDICTED: uncharacterized protein LOC100242687 [Vitis vinifera]
Length=328

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVYIIF---------FLMVNTLSFSAAMTMIEYLTANM  154
            VT+QAGINPP  ++++D     P   I+         FL+ NT++FS ++ ++  LT   
Sbjct  188  VTFQAGINPPGGVWQDDKDGHRPGRAIYSYQTKEFYVFLISNTVAFSTSILLLISLTHKF  247

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKKCC  322
            P+  E  ++   M   Y+ +     P    K   I+ ++A P+++R L  ++ +  
Sbjct  248  PFHFEVILATTSMVVTYASSVFAVTPDELVKFRYILFAAAAPFIIRCLLQVWARLT  303


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 54/103 (52%), Gaps = 9/103 (9%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVYIIF---------FLMVNTLSFSAAMTMIEYLTANM  154
            VT+QAG+NPP  +++++     P   I+         FL+ NT++ S ++ ++ YLT   
Sbjct  45   VTFQAGVNPPGGVWQDNDNGHVPGTAIYASQKATFYLFLIFNTMALSTSLLLVLYLTHRF  104

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPY  283
            P+  E  ++I  M   Y  A     P ++ +   +++++ VP+
Sbjct  105  PFYVEIWVAIMGMGVTYGSAIFAVTPGHSVRFRYVMLAAVVPW  147



>ref|XP_006370503.1| hypothetical protein POPTR_0001s43430g, partial [Populus trichocarpa]
 gb|ERP67072.1| hypothetical protein POPTR_0001s43430g, partial [Populus trichocarpa]
Length=179

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 59/119 (50%), Gaps = 6/119 (5%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVY------IIFFLMVNTLSFSAAMTMIEYLTANMPYQ  163
            VT+QAG+NPP  +++        +Y         FL+ NTL+ S  + +I  LT   P+ 
Sbjct  42   VTFQAGVNPPGGVWQEGDRVGRAIYASQKRAFYVFLISNTLALSTCILVITSLTYRFPFH  101

Query  164  RETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKKCCY*DIEA  340
             E   +   +   Y+ A     P  + +   ++++++VP+++R   Y +KK C  + E+
Sbjct  102  LEIWAATASIMITYASAVFAVTPNESVRFRYLLIAASVPFVMRCFGYFFKKYCMSENES  160



>ref|XP_008232384.1| PREDICTED: uncharacterized protein LOC103331532 [Prunus mume]
Length=170

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 62/122 (51%), Gaps = 17/122 (14%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKND-----AGK------DSPVYIIFFLMVNTLSFSAAMTMIEYLTA  148
            VT+QAG+NPP  ++++      AG+       +P Y+  FL+ NTL+ S A+ +I  LT 
Sbjct  44   VTFQAGVNPPGGVWQDSQNGHTAGRAIYATHKAPFYV--FLISNTLALSTAIFIIISLTH  101

Query  149  NMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYK----K  316
              P+  E  ++   M   Y  A     P  A +   ++ ++A+P+++R    ++K    K
Sbjct  102  RFPFHLEVLVATVSMIVTYGSAVFAVTPNEAVQFRYLLTAAALPFIIRIFIQVFKMYKPK  161

Query  317  CC  322
            C 
Sbjct  162  CV  163



>ref|XP_006370511.1| hypothetical protein POPTR_0001s43480g [Populus trichocarpa]
 ref|XP_006370712.1| hypothetical protein POPTR_0001s45110g [Populus trichocarpa]
 gb|ERP67080.1| hypothetical protein POPTR_0001s43480g [Populus trichocarpa]
 gb|ERP67281.1| hypothetical protein POPTR_0001s45110g [Populus trichocarpa]
Length=182

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 59/119 (50%), Gaps = 6/119 (5%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVY------IIFFLMVNTLSFSAAMTMIEYLTANMPYQ  163
            VT+QAG+NPP  +++        +Y         FL+ NTL+ S  + +I  LT   P+ 
Sbjct  45   VTFQAGVNPPGGVWQEGDRVGRAIYASQKRAFYVFLISNTLALSTCILVITSLTYRFPFH  104

Query  164  RETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKKCCY*DIEA  340
             E   +   +   Y+ A     P  + +   ++++++VP+++R   Y +KK C  + E+
Sbjct  105  LEIWAATASIMITYASAVFAVTPNESVRFRYLLIAASVPFVMRCFGYFFKKYCMSENES  163



>ref|XP_002270460.1| PREDICTED: uncharacterized protein LOC100264971 [Vitis vinifera]
 emb|CBI16685.3| unnamed protein product [Vitis vinifera]
Length=176

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVYIIF---------FLMVNTLSFSAAMTMIEYLTANM  154
            VT+QAG+ PP  ++++D     P   I+         FL+ NT++FS ++ ++  LT   
Sbjct  36   VTFQAGVTPPGGVWQDDKDGHRPGRAIYSYQTKEFYVFLISNTVAFSTSILLLISLTHKF  95

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKKCC  322
            P+  E  ++   M   Y+ +     P    K   I++++A P+++R L  ++ +  
Sbjct  96   PFHFEVILATTSMVVTYASSVFAVTPDELVKFRYILLAAAAPFIIRFLLQVWARLT  151



>ref|XP_008234034.1| PREDICTED: ankyrin repeat-containing protein At3g12360 [Prunus 
mume]
Length=446

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (50%), Gaps = 22/115 (19%)
 Frame = +2

Query  8    YQAGINPPAYIYKNDAG--KD-------------------SPVYIIFFLMVNTLSFSAAM  124
            +Q G++PP  +++++AG  K+                   S V  +FF   NT+ FS ++
Sbjct  313  FQVGLSPPNGVWQDNAGLTKNGTGSAEPANLAGKSIMGSYSAVAFVFFESFNTIGFSVSL  372

Query  125  TMIEYLTANMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLV  289
             MI  LT+N P Q E +I I+ M   Y+ A     P N TK  +I+ +S  P LV
Sbjct  373  HMINVLTSNFPLQLELQICIFAMYCTYNAAMTSIAPDN-TKVFVIVFTSVFPALV  426



>ref|XP_007052374.1| Uncharacterized protein TCM_005768 [Theobroma cacao]
 gb|EOX96531.1| Uncharacterized protein TCM_005768 [Theobroma cacao]
Length=192

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 60/115 (52%), Gaps = 12/115 (10%)
 Frame = +2

Query  2    VTYQAGINPPAYIYK-----NDAG-----KDSPVYIIFFLMVNTLSFSAAMTMIEYLTAN  151
            VT+QAG+NPP  +++     + AG      +S  Y +F L  NTL+FSAA+ +I  LT N
Sbjct  45   VTFQAGVNPPGGVWQETKDGHTAGTAICESESSAYYVF-LTSNTLAFSAAVLVIMSLTHN  103

Query  152  MPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKK  316
             P++ E R++   M   Y  A     P   T   + ++++A P  +R L  L  K
Sbjct  104  FPFKFEVRVAAVSMIITYGSAIFAVTPDEET-FRLALITAAAPLAMRCLIQLLVK  157



>ref|XP_010242097.1| PREDICTED: uncharacterized protein LOC104586527 [Nelumbo nucifera]
Length=148

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 14/109 (13%)
 Frame = +2

Query  2    VTYQAGINPPAYIYK-----NDAGK-----DSPVYIIFFLMVNTLSFSAAMTMIEYLTAN  151
            VT+QAG+NPP  +++     ++AGK     D   Y +F L  NTL FS A  +I YL  N
Sbjct  32   VTFQAGVNPPGGVWQESTKTHEAGKSIMGYDKNGYRLF-LFGNTLGFSIACNIIIYLIPN  90

Query  152  MPYQR---ETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLV  289
             P +       I+I+ + F Y  + A   P  +   ++ ++   VPYL+
Sbjct  91   TPLRNLKVMVYIAIFSLTFTYGVSVAAITPETSVNLSLFLIFIGVPYLI  139



>ref|XP_007220388.1| hypothetical protein PRUPE_ppa021699mg, partial [Prunus persica]
 gb|EMJ21587.1| hypothetical protein PRUPE_ppa021699mg, partial [Prunus persica]
Length=160

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 56/113 (50%), Gaps = 9/113 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVYIIF---------FLMVNTLSFSAAMTMIEYLTANM  154
            VT+QAG+NPP  ++++     +    I+         FL+ NTL+ S A+ +I  LT   
Sbjct  43   VTFQAGVNPPGGVWQDSQNGHTAGRAIYATHKTAFYVFLISNTLALSTAIFIIISLTHKF  102

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYK  313
            P+  E  ++   M   Y  A     P  + +   I+ ++A+P+++R    ++K
Sbjct  103  PFHLEVLVATVSMIVTYGSAVFAVTPNESVQFRYILTAAALPFIIRIFVQVFK  155



>ref|XP_007052376.1| Ankyrin repeat family protein [Theobroma cacao]
 gb|EOX96533.1| Ankyrin repeat family protein [Theobroma cacao]
Length=301

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (52%), Gaps = 13/110 (12%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKND-----------AGKDSPVYIIFFLMVNTLSFSAAMTMIEYLTA  148
            VT+QAG+NPP  +++++           A +  P Y+  FL+ NTL+ SA++ +I  LT 
Sbjct  40   VTFQAGVNPPGGVWQDNGNGHYAGRAIYASQTVPFYV--FLISNTLALSASVLVIISLTY  97

Query  149  NMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSL  298
              P+  E  ++   M   Y+ A     P    K   ++ ++AVP+ +R L
Sbjct  98   RFPFHLEVIVATISMIVTYASAVFAVTPREFVKFRYVMAAAAVPFAIRRL  147


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 60/114 (53%), Gaps = 11/114 (10%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKND-----AGK-----DSPVYIIFFLMVNTLSFSAAMTMIEYLTAN  151
            VT+QAG++PP  ++++      AG+      +P Y + FL+ NTL+ SA++ +I  LT  
Sbjct  183  VTFQAGVSPPGGVWQDSEHGHVAGRAIYASQAPAYYV-FLIANTLALSASILVIISLTYR  241

Query  152  MPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYK  313
             P+  E  ++   M   Y  A     P  + +   I+ ++AVP+ +R L  L+ 
Sbjct  242  FPFHLEVIVATISMMVTYGSAVFAVTPHESVRFRYIMAAAAVPFAIRFLIQLFN  295



>ref|XP_007052365.1| Ankyrin repeat family protein [Theobroma cacao]
 gb|EOX96522.1| Ankyrin repeat family protein [Theobroma cacao]
Length=209

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (52%), Gaps = 13/110 (12%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKND-----------AGKDSPVYIIFFLMVNTLSFSAAMTMIEYLTA  148
            VT+QAG+NPP  +++++           A +  P Y+  FL+ NTL+ SA++ +I  LT 
Sbjct  40   VTFQAGVNPPGGVWQDNGNGHYAGRAIYASQTVPFYV--FLISNTLALSASVLVIISLTY  97

Query  149  NMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSL  298
              P+  E  ++   M   Y+ A     P    K   ++ ++AVP+ +R L
Sbjct  98   RFPFHLEVIVATISMIVTYASAVFAVTPREFLKFRYVMAAAAVPFAIRRL  147



>ref|XP_010054567.1| PREDICTED: uncharacterized protein LOC104442889 [Eucalyptus grandis]
Length=176

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 56/116 (48%), Gaps = 9/116 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVYIIF---------FLMVNTLSFSAAMTMIEYLTANM  154
            +T+QAG+NPP  +++++    S    I+         FL+ NT + S ++ +I YLT   
Sbjct  54   ITFQAGVNPPGGVWQDNEDSHSAGMAIYASRQIAFYVFLISNTFALSTSLLVIVYLTYKF  113

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKKCC  322
            P   E  ++   M   Y+ A     P  + +   ++++ A+P + R +   Y K C
Sbjct  114  PLHPEIWVATASMMVTYASAIFAVTPHESVRFRYVLLAGALPVICRCVFQAYGKFC  169



>gb|KCW76914.1| hypothetical protein EUGRSUZ_D01263, partial [Eucalyptus grandis]
Length=183

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 56/116 (48%), Gaps = 9/116 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVYIIF---------FLMVNTLSFSAAMTMIEYLTANM  154
            +T+QAG+NPP  +++++    S    I+         FL+ NT + S ++ +I YLT   
Sbjct  61   ITFQAGVNPPGGVWQDNEDSHSAGMAIYASRQIAFYVFLISNTFALSTSLLVIVYLTYKF  120

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKKCC  322
            P   E  ++   M   Y+ A     P  + +   ++++ A+P + R +   Y K C
Sbjct  121  PLHPEIWVATASMMVTYASAIFAVTPHESVRFRYVLLAGALPVICRCVFQAYGKFC  176



>ref|XP_010052777.1| PREDICTED: uncharacterized protein LOC104441349 [Eucalyptus grandis]
 gb|KCW76845.1| hypothetical protein EUGRSUZ_D01200 [Eucalyptus grandis]
Length=174

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 9/114 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVYIIF---------FLMVNTLSFSAAMTMIEYLTANM  154
            +T+QAG+NPP  I+++D    +    I+         FL+ NT +FS ++ +I  LT   
Sbjct  46   ITFQAGVNPPGGIWQDDKDGHTAGRAIYASHHIAFYVFLISNTFAFSTSLLVIVCLTYRF  105

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKK  316
            P   E  ++   M   Y+ A     P  + K   ++++ ++P + R +  L+ +
Sbjct  106  PLHAEIWVATASMMVTYASAIFAVTPHESVKFRYVLIAGSLPVICRCIVQLWGR  159



>ref|XP_007025564.1| Uncharacterized protein TCM_029825 [Theobroma cacao]
 gb|EOY28186.1| Uncharacterized protein TCM_029825 [Theobroma cacao]
Length=209

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 59/115 (51%), Gaps = 11/115 (10%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDA-GKD---------SPVYIIFFLMVNTLSFSAAMTMIEYLTAN  151
            VT+QAG+ PP  ++++D  G D          P     FL+ NT++F+ ++ +I  LT  
Sbjct  60   VTFQAGVTPPGGVWQDDTNGSDRAGRAIYASQPGAFYVFLISNTVAFATSIFVIVSLTHR  119

Query  152  MPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKK  316
             P+Q E R++   M   Y+ A     P        ++++  VP+++R L +++ K
Sbjct  120  FPFQLEIRVAAASMLATYASAIFAITP-EEVHFRYVLIAVVVPFVLRFLVHMFTK  173



>emb|CAN78752.1| hypothetical protein VITISV_043005 [Vitis vinifera]
Length=176

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 9/114 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVYIIF---------FLMVNTLSFSAAMTMIEYLTANM  154
            VT+QAG  PP  ++++D     P   I+         FL+ NT++FS ++ ++  LT   
Sbjct  36   VTFQAGXXPPGGVWQDDKDGHRPGRAIYSYQTKEFYVFLISNTVAFSTSILLLISLTHKF  95

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKK  316
            P+  E  ++   M   Y+ +     P    K   I+ ++A P+++R L  ++ +
Sbjct  96   PFHFEVILATTSMVVTYASSVFAVTPDELVKFRYILXAAAAPFIIRCLLQVWAR  149



>ref|XP_007052377.1| Ankyrin repeat family protein [Theobroma cacao]
 gb|EOX96534.1| Ankyrin repeat family protein [Theobroma cacao]
Length=443

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/133 (26%), Positives = 59/133 (44%), Gaps = 29/133 (22%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDA---------------------------GKDSPVYIIFFLMVN  100
            VT+QAG+NPP+ + + D+                           G  +  Y+  FL  N
Sbjct  295  VTFQAGLNPPSGLLEYDSQSNPASGNVTRAGPAVTSALVAASALLGTQATSYL--FLFWN  352

Query  101  TLSFSAAMTMIEYLTANMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVP  280
            +   +A++++I YLT   P+QRE  IS+  M F Y ++       +     ++ V+  +P
Sbjct  353  SFGITASLSIIIYLTGGFPFQRELLISMLSMMFSYGFSIYGMTEKDGVAFVLLTVAFVLP  412

Query  281  YLVRSLPYLYKKC  319
            + +R LP    K 
Sbjct  413  FALRWLPTWVNKA  425



>ref|XP_006375176.1| hypothetical protein POPTR_0014s04980g, partial [Populus trichocarpa]
 gb|ERP52973.1| hypothetical protein POPTR_0014s04980g, partial [Populus trichocarpa]
Length=209

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/131 (26%), Positives = 58/131 (44%), Gaps = 36/131 (27%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAG----------------------------------KDSPVYI  79
            VT+QAG+NPP  ++++D G                                  +  P Y+
Sbjct  50   VTFQAGVNPPGGVWQDDNGIKPAAGANPPSPGGERQEYKFEEHHAAGRAIYASQKHPYYV  109

Query  80   IFFLMVNTLSFSAAMTMIEYLTANMPYQRETRISIYCMAFGYSWAAARSPPINATKTTII  259
              FLM NTL+FSA++ +I  LT   P+  E  ++   M   Y+ A     P  +     +
Sbjct  110  --FLMSNTLAFSASLLVIPSLTYKFPFHFEIWVATASMMVTYASAIFAVTPRESVHFRYL  167

Query  260  IVSSAVPYLVR  292
            ++++AVP++ R
Sbjct  168  LITAAVPFITR  178



>ref|XP_010056381.1| PREDICTED: uncharacterized protein LOC104444417 [Eucalyptus grandis]
Length=161

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 58/115 (50%), Gaps = 13/115 (11%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKND-----------AGKDSPVYIIFFLMVNTLSFSAAMTMIEYLTA  148
            VT+QAG++PP  ++++            A +  P Y+  FL+ NTL+ ++++ +I  LT 
Sbjct  41   VTFQAGVSPPGGVWQDSSSGRVPGQAIYASQTGPFYV--FLVCNTLALASSINLIISLTW  98

Query  149  NMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYK  313
              P+  E  ++   MA  Y  A     P +  +   ++ +  VP+L+R L  + K
Sbjct  99   GFPFFLEVVVATVSMAVTYGSAIFAVTPKSDEQFRWLLFTGCVPFLLRLLIQMGK  153



>ref|XP_007052366.1| Ankyrin repeat family protein [Theobroma cacao]
 gb|EOX96523.1| Ankyrin repeat family protein [Theobroma cacao]
Length=442

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 58/133 (44%), Gaps = 29/133 (22%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDA---------------------------GKDSPVYIIFFLMVN  100
            VT+Q G+NPP+ + + D+                           G  +  Y+  FL  N
Sbjct  294  VTFQEGLNPPSGLLEYDSQSNPASGNVTRAGPAVTSAFVAASALLGTQATSYL--FLFWN  351

Query  101  TLSFSAAMTMIEYLTANMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVP  280
            +   +A++++I YLT   P+QRE  IS+  M F Y ++       +     ++ V+  +P
Sbjct  352  SFGLTASLSIIIYLTGGFPFQRELLISMLSMMFSYGFSIYGMTEKDGVAYALLTVAFVLP  411

Query  281  YLVRSLPYLYKKC  319
            + +R LP    K 
Sbjct  412  FALRWLPTWVNKA  424



>ref|XP_006375177.1| hypothetical protein POPTR_0014s04990g [Populus trichocarpa]
 gb|ERP52974.1| hypothetical protein POPTR_0014s04990g [Populus trichocarpa]
Length=321

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 61/115 (53%), Gaps = 19/115 (17%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKND-------AGK-----DSPVYIIFFLMVNTLSFSAAMTMIEYLT  145
            VT++AG+NPP  ++++D       AG+       P Y +F LM +TL FSA++ +I  LT
Sbjct  202  VTFEAGVNPPGGVWRDDNVNEHHAAGRAIYAFQKPPYYVF-LMSSTLEFSASLLVIPSLT  260

Query  146  ANMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLY  310
               P+  E  ++   M   Y+ A      I A     ++++++VP++ RS  Y +
Sbjct  261  YEFPFHFEIWVATASMMVTYASA------IFAVTHHYLLITASVPFISRSSIYTH  309



>ref|XP_011085716.1| PREDICTED: uncharacterized protein LOC105167627 [Sesamum indicum]
Length=158

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDSPVYIIF---------FLMVNTLSFSAAMTMIEYLTANM  154
            VT+QAG+NPP  ++++          I+         FL+ NTL+ S+++ ++  LT   
Sbjct  39   VTFQAGVNPPGGVWQDSKDGHKAGRAIYSSDKGAFYTFLISNTLALSSSILVLMALTYRF  98

Query  155  PYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVR  292
            PY  E  ++I  M   Y+ +     P  + K   ++ ++A P+++R
Sbjct  99   PYHVELWVAIMAMFVTYAASVFAVAPDESVKFRYLLATAAGPFVLR  144



>ref|XP_002526474.1| hypothetical protein RCOM_0658430 [Ricinus communis]
 gb|EEF35865.1| hypothetical protein RCOM_0658430 [Ricinus communis]
Length=179

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 57/113 (50%), Gaps = 8/113 (7%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDS--------PVYIIFFLMVNTLSFSAAMTMIEYLTANMP  157
            VT+Q+G+NPP  +++++ G  +        P     FL+ +TL+ S ++ +I  LT   P
Sbjct  52   VTFQSGVNPPGGVWQDNDGHHAGRAIYAFQPHTFYVFLVSSTLALSTSLLVIVSLTYRFP  111

Query  158  YQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKK  316
               E  ++   M   Y+ A     P    K   I++++A+P ++R L  + ++
Sbjct  112  LHLEIWVATASMIVTYASAIFAVTPRENVKVCYILITAALPLIMRILIQMLRQ  164



>ref|XP_010242098.1| PREDICTED: uncharacterized protein LOC104586528 [Nelumbo nucifera]
Length=175

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 47/97 (48%), Gaps = 11/97 (11%)
 Frame = +2

Query  8    YQAGINPPAYIYKN-----DAGK-----DSPVYIIFFLMVNTLSFSAAMTMIEYLTANMP  157
            ++AGINPP   +++     +AGK     +  VY +F L  NTL FSAA  +I Y     P
Sbjct  64   HEAGINPPGGAWQDTADGHEAGKSILGYNHSVYKLFIL-ANTLGFSAACNIIGYFVKGCP  122

Query  158  YQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVS  268
               E  I+I  M F Y  A     P  A  +++  ++
Sbjct  123  MYMEVYIAILSMCFTYGVAVGAISPDGALNSSLFAIA  159



>ref|XP_006295666.1| hypothetical protein CARUB_v10024782mg [Capsella rubella]
 gb|EOA28564.1| hypothetical protein CARUB_v10024782mg [Capsella rubella]
Length=420

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 54/108 (50%), Gaps = 4/108 (4%)
 Frame = +2

Query  5    TYQAGINPPAYIYKND----AGKDSPVYIIFFLMVNTLSFSAAMTMIEYLTANMPYQRET  172
            TYQA ++PP  +++ D        S +    F+ +N++ F  +M +I  LT  +P+  E 
Sbjct  293  TYQAVLSPPGGVWQEDYCINGYCQSWISYGIFIFLNSIGFFTSMELISLLTKGLPFYLEL  352

Query  173  RISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKK  316
            ++S+  +A  Y +A A   P        +++S  +P  V  +P L +K
Sbjct  353  QVSLTAVALAYGFAMAALSPNFGLGLFFMVLSVVLPIAVAKIPSLIRK  400



>ref|XP_007052361.1| Uncharacterized protein TCM_005751 [Theobroma cacao]
 gb|EOX96518.1| Uncharacterized protein TCM_005751 [Theobroma cacao]
Length=210

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 60/135 (44%), Gaps = 34/135 (25%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKNDAGKDS------------------PVYIIF---------FLMVN  100
            VT+QAG+NPP  +++++    +                  P   IF         FL  N
Sbjct  45   VTFQAGVNPPGGVWQDNEDNQTAVAANPPVAVRQDTKDRIPGTAIFASDSSAYYVFLTSN  104

Query  101  TLSFSAAMTMIEYLTANMPYQRETRISIYCMAFGYS---WAAARSPPINATKTTIIIVSS  271
            TL+FSAA+ +I  LT   P++ E R++   M   Y    +A  R    +  K  + ++ +
Sbjct  105  TLAFSAAVLLIMSLTHTFPFKFEVRVACVSMIITYGSAIFAVTR----DGDKFQLALIIA  160

Query  272  AVPYLVRSLPYLYKK  316
            A P ++R L  L  K
Sbjct  161  AAPLILRCLIQLLVK  175



>ref|XP_008343936.1| PREDICTED: uncharacterized protein LOC103406722 [Malus domestica]
Length=169

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 54/112 (48%), Gaps = 15/112 (13%)
 Frame = +2

Query  8    YQAGINPP-------AYIYKNDAGKDSPVYIIFFLMVNTLSFSAAMTMIEYLTANMPYQR  166
            +QAG++PP           KN  G  S   ++ ++  NT+ FS ++ MI++LT N P   
Sbjct  46   FQAGLSPPNGGLHYTTGSNKNGTGCGSNGLVVLYMFFNTIGFSVSLIMIDFLTRNFPLLF  105

Query  167  ETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLYKKCC  322
            + R  +  M   Y+ A   + P    K+ ++ ++S+ P  V     + + CC
Sbjct  106  KLRFCMVMMYGTYTVAVISTAP----KSMLLCITSSTPLFV----VILQLCC  149



>ref|XP_006397654.1| hypothetical protein EUTSA_v10001761mg [Eutrema salsugineum]
 gb|ESQ39107.1| hypothetical protein EUTSA_v10001761mg [Eutrema salsugineum]
Length=442

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/131 (24%), Positives = 57/131 (44%), Gaps = 27/131 (21%)
 Frame = +2

Query  5    TYQAGINPPAYIYKND-------------AGKDSPVYII--------------FFLMVNT  103
            TYQA ++PP  +++ D               K  PVYI                F+ +N+
Sbjct  294  TYQAALSPPGGVWQEDYCINGYCQITDIKGNKTKPVYIAGTTIMGSKSWISYGIFIFLNS  353

Query  104  LSFSAAMTMIEYLTANMPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPY  283
            + F  ++ +I  LT  +P+  E ++S+  +A  Y +A +   P        +++S  +P 
Sbjct  354  IGFFTSLELISLLTKGLPFYLELQVSLTALALTYGFAMSALSPNFGLGLFFMVISVVLPI  413

Query  284  LVRSLPYLYKK  316
             V  +P L +K
Sbjct  414  AVAKIPSLIRK  424



>ref|XP_007139677.1| hypothetical protein PHAVU_008G049700g [Phaseolus vulgaris]
 gb|ESW11671.1| hypothetical protein PHAVU_008G049700g [Phaseolus vulgaris]
Length=173

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 57/113 (50%), Gaps = 11/113 (10%)
 Frame = +2

Query  2    VTYQAGINPPAYIYKN-----DAGK-----DSPVYIIFFLMVNTLSFSAAMTMIEYLTAN  151
            VT+QA +NPP  +++       AGK     D   Y +F L+ NTL+F+ ++ +I  LT  
Sbjct  41   VTFQAAVNPPGGVWEETEDGKHAGKATYSLDKKGYYVF-LIFNTLAFANSVFIILSLTHK  99

Query  152  MPYQRETRISIYCMAFGYSWAAARSPPINATKTTIIIVSSAVPYLVRSLPYLY  310
             P+Q E   +   M+  Y  A     P +      +++++  P+++R L  ++
Sbjct  100  FPFQLEIWTATVSMSVSYGSAIFAITPKDPIHLRYVLITATAPFVLRILVLMF  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527163007440