BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22198_g4_i1 len=4497 path=[11641:0-864 12506:865-928 27036:929-2015
3037:2016-2041 3063:2042-4496]

Length=4497
                                                                      Score     E

ref|XP_006366078.1|  PREDICTED: pleiotropic drug resistance prote...   2330   0.0     
ref|XP_009775073.1|  PREDICTED: pleiotropic drug resistance prote...   2327   0.0     
gb|AFA43815.1|  ABCG/PDR subfamily ABC transporter                     2325   0.0     
ref|XP_004245225.1|  PREDICTED: pleiotropic drug resistance prote...   2325   0.0     
gb|AFA43816.1|  ABCG/PDR subfamily ABC protein                         2323   0.0     
ref|XP_011081908.1|  PREDICTED: pleiotropic drug resistance prote...   2323   0.0     
ref|XP_009589545.1|  PREDICTED: pleiotropic drug resistance prote...   2316   0.0     
gb|EYU21929.1|  hypothetical protein MIMGU_mgv1a023987mg               2303   0.0     
ref|XP_006366077.1|  PREDICTED: pleiotropic drug resistance prote...   2293   0.0     
ref|XP_004245224.1|  PREDICTED: pleiotropic drug resistance prote...   2291   0.0     
ref|XP_010648604.1|  PREDICTED: pleiotropic drug resistance prote...   2257   0.0     
ref|XP_007013791.1|  Pleiotropic drug resistance 12                    2253   0.0     
ref|XP_008392128.1|  PREDICTED: pleiotropic drug resistance prote...   2246   0.0     
ref|XP_002514350.1|  ATP-binding cassette transporter, putative        2246   0.0     Ricinus communis
ref|XP_010648603.1|  PREDICTED: pleiotropic drug resistance prote...   2242   0.0     
ref|XP_008394025.1|  PREDICTED: pleiotropic drug resistance prote...   2239   0.0     
gb|ACU82515.1|  pleiotropic drug resistance protein                    2238   0.0     Cucumis sativus [cucumbers]
emb|CDP04826.1|  unnamed protein product                               2237   0.0     
ref|XP_004291476.1|  PREDICTED: pleiotropic drug resistance prote...   2237   0.0     
ref|XP_004148099.1|  PREDICTED: pleiotropic drug resistance prote...   2236   0.0     
emb|CAN80954.1|  hypothetical protein VITISV_032205                    2234   0.0     Vitis vinifera
ref|XP_008459146.1|  PREDICTED: pleiotropic drug resistance prote...   2233   0.0     
ref|XP_004156752.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...   2231   0.0     
ref|XP_008392127.1|  PREDICTED: pleiotropic drug resistance prote...   2228   0.0     
ref|XP_009334795.1|  PREDICTED: pleiotropic drug resistance prote...   2227   0.0     
ref|XP_007227084.1|  hypothetical protein PRUPE_ppa000234mg            2223   0.0     
ref|XP_010049001.1|  PREDICTED: pleiotropic drug resistance prote...   2220   0.0     
ref|XP_010254262.1|  PREDICTED: pleiotropic drug resistance prote...   2215   0.0     
ref|XP_002324840.1|  hypothetical protein POPTR_0018s01240g            2214   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010254261.1|  PREDICTED: pleiotropic drug resistance prote...   2213   0.0     
ref|XP_010249930.1|  PREDICTED: pleiotropic drug resistance prote...   2213   0.0     
ref|XP_006476214.1|  PREDICTED: pleiotropic drug resistance prote...   2210   0.0     
ref|XP_006450535.1|  hypothetical protein CICLE_v10010431mg            2209   0.0     
ref|XP_006476215.1|  PREDICTED: pleiotropic drug resistance prote...   2206   0.0     
ref|XP_006476216.1|  PREDICTED: pleiotropic drug resistance prote...   2205   0.0     
ref|XP_003526427.1|  PREDICTED: pleiotropic drug resistance prote...   2202   0.0     
gb|KDO79586.1|  hypothetical protein CISIN_1g046196mg                  2202   0.0     
gb|KHN07106.1|  Pleiotropic drug resistance protein 1                  2201   0.0     
ref|XP_010249929.1|  PREDICTED: pleiotropic drug resistance prote...   2199   0.0     
ref|XP_006476213.1|  PREDICTED: pleiotropic drug resistance prote...   2195   0.0     
emb|CDP04827.1|  unnamed protein product                               2193   0.0     
ref|XP_007137056.1|  hypothetical protein PHAVU_009G096200g            2192   0.0     
ref|XP_010254256.1|  PREDICTED: pleiotropic drug resistance prote...   2189   0.0     
ref|XP_010049003.1|  PREDICTED: pleiotropic drug resistance prote...   2189   0.0     
ref|XP_010254257.1|  PREDICTED: pleiotropic drug resistance prote...   2186   0.0     
gb|KCW81449.1|  hypothetical protein EUGRSUZ_C02834                    2185   0.0     
gb|KDP33642.1|  hypothetical protein JCGZ_07213                        2184   0.0     
ref|XP_010254258.1|  PREDICTED: pleiotropic drug resistance prote...   2184   0.0     
ref|XP_011019747.1|  PREDICTED: pleiotropic drug resistance prote...   2178   0.0     
emb|CDP04832.1|  unnamed protein product                               2177   0.0     
gb|KHN08104.1|  Pleiotropic drug resistance protein 1                  2177   0.0     
ref|XP_002514351.1|  ATP-binding cassette transporter, putative        2175   0.0     Ricinus communis
ref|XP_008445146.1|  PREDICTED: pleiotropic drug resistance prote...   2160   0.0     
ref|XP_007013788.1|  Pleiotropic drug resistance 12                    2159   0.0     
ref|XP_004501294.1|  PREDICTED: pleiotropic drug resistance prote...   2159   0.0     
ref|XP_004138743.1|  PREDICTED: pleiotropic drug resistance prote...   2159   0.0     
ref|XP_010648606.1|  PREDICTED: pleiotropic drug resistance prote...   2150   0.0     
ref|XP_002309596.1|  hypothetical protein POPTR_0006s26460g            2142   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_003603455.1|  Pleiotropic drug resistance protein               2134   0.0     
ref|XP_010910610.1|  PREDICTED: pleiotropic drug resistance prote...   2129   0.0     
ref|XP_009334794.1|  PREDICTED: pleiotropic drug resistance prote...   2125   0.0     
gb|KGN62906.1|  hypothetical protein Csa_2G379370                      2123   0.0     
ref|XP_009401814.1|  PREDICTED: pleiotropic drug resistance prote...   2123   0.0     
ref|XP_009401806.1|  PREDICTED: pleiotropic drug resistance prote...   2122   0.0     
ref|XP_008361068.1|  PREDICTED: pleiotropic drug resistance prote...   2122   0.0     
ref|XP_009407444.1|  PREDICTED: pleiotropic drug resistance prote...   2117   0.0     
ref|XP_007023982.1|  Pleiotropic drug resistance 12                    2117   0.0     
ref|XP_007013787.1|  Pleiotropic drug resistance 12                    2114   0.0     
ref|XP_008795450.1|  PREDICTED: pleiotropic drug resistance prote...   2110   0.0     
ref|XP_009401798.1|  PREDICTED: pleiotropic drug resistance prote...   2109   0.0     
ref|XP_008361067.1|  PREDICTED: pleiotropic drug resistance prote...   2107   0.0     
ref|XP_010654715.1|  PREDICTED: pleiotropic drug resistance prote...   2105   0.0     
ref|XP_002512728.1|  ATP-binding cassette transporter, putative        2105   0.0     Ricinus communis
emb|CBI36229.3|  unnamed protein product                               2102   0.0     
emb|CAN74185.1|  hypothetical protein VITISV_001190                    2100   0.0     Vitis vinifera
ref|XP_008219880.1|  PREDICTED: putative pleiotropic drug resista...   2100   0.0     
ref|XP_002297807.2|  hypothetical protein POPTR_0001s14660g            2095   0.0     Populus trichocarpa [western balsam poplar]
gb|KDP36995.1|  hypothetical protein JCGZ_06051                        2094   0.0     
ref|XP_009416092.1|  PREDICTED: pleiotropic drug resistance prote...   2094   0.0     
ref|XP_002304712.2|  hypothetical protein POPTR_0003s17730g            2093   0.0     Populus trichocarpa [western balsam poplar]
emb|CAN77690.1|  hypothetical protein VITISV_022715                    2090   0.0     Vitis vinifera
ref|XP_007226604.1|  hypothetical protein PRUPE_ppa023430mg            2088   0.0     
ref|XP_011034492.1|  PREDICTED: pleiotropic drug resistance prote...   2087   0.0     
ref|XP_010914974.1|  PREDICTED: pleiotropic drug resistance prote...   2087   0.0     
ref|XP_010249928.1|  PREDICTED: putative pleiotropic drug resista...   2087   0.0     
ref|XP_011020655.1|  PREDICTED: pleiotropic drug resistance prote...   2085   0.0     
ref|XP_006368914.1|  hypothetical protein POPTR_0001s14650g            2085   0.0     
ref|XP_010654718.1|  PREDICTED: pleiotropic drug resistance prote...   2084   0.0     
ref|XP_002304713.2|  hypothetical protein POPTR_0003s17740g            2083   0.0     Populus trichocarpa [western balsam poplar]
emb|CBI36227.3|  unnamed protein product                               2080   0.0     
ref|XP_010654716.1|  PREDICTED: pleiotropic drug resistance prote...   2080   0.0     
ref|XP_008373537.1|  PREDICTED: pleiotropic drug resistance prote...   2079   0.0     
ref|XP_010914973.1|  PREDICTED: pleiotropic drug resistance prote...   2078   0.0     
gb|KDP36996.1|  hypothetical protein JCGZ_06052                        2076   0.0     
ref|XP_009347962.1|  PREDICTED: pleiotropic drug resistance prote...   2075   0.0     
ref|XP_009343426.1|  PREDICTED: pleiotropic drug resistance prote...   2074   0.0     
gb|KDP37161.1|  hypothetical protein JCGZ_06217                        2073   0.0     
gb|KDO58233.1|  hypothetical protein CISIN_1g000541mg                  2072   0.0     
ref|XP_008219877.1|  PREDICTED: pleiotropic drug resistance prote...   2072   0.0     
ref|XP_010914975.1|  PREDICTED: putative pleiotropic drug resista...   2071   0.0     
gb|KCW81450.1|  hypothetical protein EUGRSUZ_C02835                    2071   0.0     
ref|XP_004291477.1|  PREDICTED: pleiotropic drug resistance prote...   2071   0.0     
ref|XP_010916538.1|  PREDICTED: pleiotropic drug resistance prote...   2070   0.0     
ref|XP_008219879.1|  PREDICTED: pleiotropic drug resistance prote...   2070   0.0     
ref|XP_006465411.1|  PREDICTED: pleiotropic drug resistance prote...   2068   0.0     
ref|XP_008219878.1|  PREDICTED: pleiotropic drug resistance prote...   2067   0.0     
gb|AES58950.2|  ABC-2 and plant PDR ABC-type transporter family p...   2067   0.0     
ref|XP_008373544.1|  PREDICTED: pleiotropic drug resistance prote...   2065   0.0     
ref|XP_010925283.1|  PREDICTED: putative pleiotropic drug resista...   2063   0.0     
ref|XP_009385804.1|  PREDICTED: putative pleiotropic drug resista...   2063   0.0     
ref|XP_002298123.2|  ABC transporter family protein                    2062   0.0     Populus trichocarpa [western balsam poplar]
emb|CDO98093.1|  unnamed protein product                               2061   0.0     
ref|XP_002527332.1|  ATP-binding cassette transporter, putative        2061   0.0     Ricinus communis
ref|XP_006427144.1|  hypothetical protein CICLE_v10024707mg            2061   0.0     
gb|KDP36994.1|  hypothetical protein JCGZ_06050                        2060   0.0     
ref|XP_004498643.1|  PREDICTED: pleiotropic drug resistance prote...   2060   0.0     
ref|XP_009616095.1|  PREDICTED: pleiotropic drug resistance prote...   2060   0.0     
ref|XP_003588699.1|  Pleiotropic drug resistance ABC transporter ...   2058   0.0     
ref|XP_010925282.1|  PREDICTED: putative pleiotropic drug resista...   2058   0.0     
ref|XP_010654717.1|  PREDICTED: pleiotropic drug resistance prote...   2058   0.0     
emb|CBI36226.3|  unnamed protein product                               2058   0.0     
emb|CBI36210.3|  unnamed protein product                               2058   0.0     
ref|XP_010654722.1|  PREDICTED: pleiotropic drug resistance prote...   2058   0.0     
emb|CBI20980.3|  unnamed protein product                               2058   0.0     
ref|XP_002514347.1|  ATP-binding cassette transporter, putative        2058   0.0     Ricinus communis
ref|XP_006465412.1|  PREDICTED: pleiotropic drug resistance prote...   2057   0.0     
ref|XP_004506879.1|  PREDICTED: pleiotropic drug resistance prote...   2056   0.0     
ref|XP_008775867.1|  PREDICTED: pleiotropic drug resistance prote...   2056   0.0     
ref|XP_003545503.1|  PREDICTED: pleiotropic drug resistance prote...   2056   0.0     
gb|KDO58232.1|  hypothetical protein CISIN_1g047682mg                  2055   0.0     
ref|XP_002514348.1|  ATP-binding cassette transporter, putative        2055   0.0     Ricinus communis
ref|XP_011082498.1|  PREDICTED: pleiotropic drug resistance prote...   2053   0.0     
gb|AIU41654.1|  ABC transporter family protein                         2053   0.0     
ref|XP_011082577.1|  PREDICTED: pleiotropic drug resistance prote...   2052   0.0     
ref|XP_009799503.1|  PREDICTED: pleiotropic drug resistance prote...   2052   0.0     
dbj|BAB92011.1|  pleiotropic drug resistance like protein              2052   0.0     Nicotiana tabacum [American tobacco]
ref|XP_002527330.1|  ATP-binding cassette transporter, putative        2051   0.0     Ricinus communis
ref|XP_006601131.1|  PREDICTED: putative pleiotropic drug resista...   2051   0.0     
ref|XP_009596530.1|  PREDICTED: pleiotropic drug resistance prote...   2050   0.0     
ref|XP_008775866.1|  PREDICTED: pleiotropic drug resistance prote...   2049   0.0     
emb|CBI36223.3|  unnamed protein product                               2049   0.0     
gb|KDP36998.1|  hypothetical protein JCGZ_06054                        2049   0.0     
ref|XP_010654719.1|  PREDICTED: pleiotropic drug resistance prote...   2048   0.0     
ref|XP_006596115.1|  PREDICTED: pleiotropic drug resistance prote...   2048   0.0     
gb|AGT28054.1|  pleiotropic drug resistance transporter 2              2048   0.0     
ref|XP_006596116.1|  PREDICTED: pleiotropic drug resistance prote...   2048   0.0     
ref|XP_007217658.1|  hypothetical protein PRUPE_ppa000226mg            2048   0.0     
dbj|BAO45894.1|  pleiotropic drug resistance ABC transporter           2046   0.0     
ref|XP_003546230.1|  PREDICTED: pleiotropic drug resistance prote...   2046   0.0     
ref|XP_008775868.1|  PREDICTED: pleiotropic drug resistance prote...   2046   0.0     
ref|XP_003528365.1|  PREDICTED: pleiotropic drug resistance prote...   2046   0.0     
ref|XP_004247841.1|  PREDICTED: pleiotropic drug resistance prote...   2046   0.0     
emb|CDO98092.1|  unnamed protein product                               2045   0.0     
ref|XP_004951497.1|  PREDICTED: putative pleiotropic drug resista...   2045   0.0     
ref|XP_007161247.1|  hypothetical protein PHAVU_001G054400g            2044   0.0     
gb|KHN45207.1|  Pleiotropic drug resistance protein 1                  2044   0.0     
gb|KHN22481.1|  Pleiotropic drug resistance protein 1                  2043   0.0     
ref|XP_010023519.1|  PREDICTED: pleiotropic drug resistance prote...   2043   0.0     
ref|XP_006360347.1|  PREDICTED: pleiotropic drug resistance prote...   2043   0.0     
ref|XP_010023531.1|  PREDICTED: ABC transporter G family member 4...   2043   0.0     
ref|XP_010023520.1|  PREDICTED: pleiotropic drug resistance prote...   2042   0.0     
emb|CBI36209.3|  unnamed protein product                               2042   0.0     
gb|KCW59818.1|  hypothetical protein EUGRSUZ_H02563                    2041   0.0     
gb|KEH28743.1|  drug resistance transporter-like ABC domain protein    2041   0.0     
gb|KHN12917.1|  Pleiotropic drug resistance protein 1                  2040   0.0     
ref|XP_010023530.1|  PREDICTED: ABC transporter G family member 4...   2040   0.0     
ref|NP_001288053.1|  ABC transporter-like                              2040   0.0     
ref|XP_010532149.1|  PREDICTED: ABC transporter G family member 4...   2040   0.0     
ref|XP_010023529.1|  PREDICTED: ABC transporter G family member 4...   2040   0.0     
ref|XP_008228659.1|  PREDICTED: pleiotropic drug resistance prote...   2040   0.0     
ref|XP_002451754.1|  hypothetical protein SORBIDRAFT_04g007270         2040   0.0     Sorghum bicolor [broomcorn]
ref|XP_010654721.1|  PREDICTED: pleiotropic drug resistance prote...   2039   0.0     
ref|XP_010023528.1|  PREDICTED: ABC transporter G family member 4...   2039   0.0     
ref|XP_010102803.1|  Pleiotropic drug resistance protein 1             2039   0.0     
ref|XP_007225462.1|  hypothetical protein PRUPE_ppa000256mg            2039   0.0     
ref|XP_004239864.1|  PREDICTED: pleiotropic drug resistance prote...   2039   0.0     
ref|XP_002451753.1|  hypothetical protein SORBIDRAFT_04g007260         2038   0.0     Sorghum bicolor [broomcorn]
ref|XP_007200339.1|  hypothetical protein PRUPE_ppa000227mg            2038   0.0     
ref|XP_010023527.1|  PREDICTED: ABC transporter G family member 4...   2038   0.0     
ref|XP_009415905.1|  PREDICTED: pleiotropic drug resistance prote...   2037   0.0     
gb|KEH28744.1|  drug resistance transporter-like ABC domain protein    2037   0.0     
ref|XP_002527329.1|  ATP-binding cassette transporter, putative        2036   0.0     Ricinus communis
ref|XP_008679861.1|  PREDICTED: putative pleiotropic drug resista...   2036   0.0     
gb|AGT28055.1|  pleiotropic drug resistance transporter 3              2036   0.0     
ref|XP_010061953.1|  PREDICTED: pleiotropic drug resistance prote...   2035   0.0     
emb|CBI36212.3|  unnamed protein product                               2035   0.0     
ref|XP_011081963.1|  PREDICTED: pleiotropic drug resistance prote...   2033   0.0     
ref|XP_009415904.1|  PREDICTED: pleiotropic drug resistance prote...   2032   0.0     
ref|XP_002297805.2|  hypothetical protein POPTR_0001s14630g            2032   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011020597.1|  PREDICTED: pleiotropic drug resistance prote...   2032   0.0     
ref|XP_011012297.1|  PREDICTED: pleiotropic drug resistance prote...   2031   0.0     
ref|XP_010061952.1|  PREDICTED: pleiotropic drug resistance prote...   2031   0.0     
gb|AGT28053.1|  pleiotropic drug resistance transporter 1              2031   0.0     
ref|XP_010061954.1|  PREDICTED: pleiotropic drug resistance prote...   2030   0.0     
ref|XP_009779532.1|  PREDICTED: pleiotropic drug resistance prote...   2030   0.0     
ref|XP_010537955.1|  PREDICTED: ABC transporter G family member 4...   2028   0.0     
emb|CBI36213.3|  unnamed protein product                               2028   0.0     
ref|XP_006829655.1|  hypothetical protein AMTR_s00122p00117310         2028   0.0     
ref|XP_007150694.1|  hypothetical protein PHAVU_005G173700g            2028   0.0     
ref|XP_006427145.1|  hypothetical protein CICLE_v10024697mg            2027   0.0     
ref|XP_004486707.1|  PREDICTED: pleiotropic drug resistance prote...   2026   0.0     
ref|XP_010023532.1|  PREDICTED: ABC transporter G family member 4...   2026   0.0     
ref|XP_007135719.1|  hypothetical protein PHAVU_010G152500g            2026   0.0     
gb|KCW59813.1|  hypothetical protein EUGRSUZ_H02560                    2024   0.0     
ref|XP_010670733.1|  PREDICTED: pleiotropic drug resistance prote...   2024   0.0     
ref|XP_009370616.1|  PREDICTED: pleiotropic drug resistance prote...   2024   0.0     
ref|XP_010023517.1|  PREDICTED: pleiotropic drug resistance prote...   2024   0.0     
ref|XP_004486706.1|  PREDICTED: pleiotropic drug resistance prote...   2023   0.0     
ref|XP_003597818.1|  Pleiotropic drug resistance protein               2022   0.0     
ref|XP_010061955.1|  PREDICTED: pleiotropic drug resistance prote...   2021   0.0     
ref|XP_010023518.1|  PREDICTED: pleiotropic drug resistance prote...   2021   0.0     
dbj|BAP90384.1|  ATP binding cassette transporter                      2021   0.0     
ref|XP_010023521.1|  PREDICTED: ABC transporter G family member 4...   2020   0.0     
ref|XP_006597138.1|  PREDICTED: pleiotropic drug resistance prote...   2020   0.0     
ref|XP_004253003.1|  PREDICTED: pleiotropic drug resistance prote...   2020   0.0     
ref|XP_008785597.1|  PREDICTED: putative pleiotropic drug resista...   2019   0.0     
ref|XP_008235577.1|  PREDICTED: pleiotropic drug resistance prote...   2019   0.0     
ref|XP_010648605.1|  PREDICTED: pleiotropic drug resistance prote...   2018   0.0     
ref|XP_009399772.1|  PREDICTED: putative pleiotropic drug resista...   2018   0.0     
ref|XP_007150693.1|  hypothetical protein PHAVU_005G173600g            2017   0.0     
ref|XP_010691233.1|  PREDICTED: pleiotropic drug resistance prote...   2016   0.0     
ref|XP_003597816.1|  Pleiotropic drug resistance protein               2016   0.0     
ref|XP_009335239.1|  PREDICTED: pleiotropic drug resistance prote...   2015   0.0     
gb|KHN22479.1|  Pleiotropic drug resistance protein 1                  2015   0.0     
ref|XP_006365806.1|  PREDICTED: pleiotropic drug resistance prote...   2014   0.0     
ref|XP_006349934.1|  PREDICTED: pleiotropic drug resistance prote...   2014   0.0     
gb|AES68067.2|  drug resistance transporter-like ABC domain protein    2014   0.0     
ref|XP_006647060.1|  PREDICTED: putative pleiotropic drug resista...   2014   0.0     
ref|XP_009335238.1|  PREDICTED: pleiotropic drug resistance prote...   2012   0.0     
gb|EEC72716.1|  hypothetical protein OsI_06321                         2011   0.0     Oryza sativa Indica Group [Indian rice]
emb|CAN83563.1|  hypothetical protein VITISV_025401                    2010   0.0     Vitis vinifera
gb|EYU29215.1|  hypothetical protein MIMGU_mgv1a018488mg               2009   0.0     
ref|XP_006360348.1|  PREDICTED: pleiotropic drug resistance prote...   2009   0.0     
gb|EEE56535.1|  hypothetical protein OsJ_05840                         2009   0.0     Oryza sativa Japonica Group [Japonica rice]
sp|Q8GU88.1|PDR7_ORYSJ  RecName: Full=Putative pleiotropic drug r...   2009   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EYU29216.1|  hypothetical protein MIMGU_mgv1a000208mg               2008   0.0     
ref|NP_173005.1|  ABC transporter G family member 40                   2008   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008358474.1|  PREDICTED: pleiotropic drug resistance prote...   2007   0.0     
ref|XP_010033906.1|  PREDICTED: pleiotropic drug resistance prote...   2006   0.0     
ref|XP_004239865.1|  PREDICTED: pleiotropic drug resistance prote...   2006   0.0     
ref|XP_006416897.1|  hypothetical protein EUTSA_v10006564mg            2004   0.0     
ref|XP_003569331.1|  PREDICTED: pleiotropic drug resistance prote...   2004   0.0     
ref|XP_010459089.1|  PREDICTED: ABC transporter G family member 4...   2003   0.0     
gb|KHN09389.1|  Pleiotropic drug resistance protein 1                  2002   0.0     
ref|XP_010459091.1|  PREDICTED: ABC transporter G family member 4...   2002   0.0     
ref|XP_004239867.2|  PREDICTED: pleiotropic drug resistance prote...   2000   0.0     
ref|XP_003543663.1|  PREDICTED: pleiotropic drug resistance prote...   2000   0.0     
ref|XP_002528564.1|  ATP-binding cassette transporter, putative        2000   0.0     Ricinus communis
ref|XP_006441387.1|  hypothetical protein CICLE_v10018487mg            2000   0.0     
gb|KCW59823.1|  hypothetical protein EUGRSUZ_H02569                    1999   0.0     
ref|XP_004247842.1|  PREDICTED: pleiotropic drug resistance prote...   1999   0.0     
ref|XP_004239866.1|  PREDICTED: pleiotropic drug resistance prote...   1999   0.0     
emb|CDY36570.1|  BnaA06g10230D                                         1998   0.0     
gb|KHN44144.1|  Pleiotropic drug resistance protein 1                  1998   0.0     
ref|XP_004148018.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...   1997   0.0     
ref|XP_009148948.1|  PREDICTED: ABC transporter G family member 40     1997   0.0     
ref|XP_010497221.1|  PREDICTED: ABC transporter G family member 4...   1996   0.0     
ref|XP_002529327.1|  ATP-binding cassette transporter, putative        1996   0.0     Ricinus communis
ref|XP_004289998.1|  PREDICTED: pleiotropic drug resistance prote...   1996   0.0     
ref|XP_002514349.1|  ATP-binding cassette transporter, putative        1995   0.0     Ricinus communis
ref|XP_003546218.1|  PREDICTED: pleiotropic drug resistance prote...   1994   0.0     
gb|EPS67051.1|  hypothetical protein M569_07724                        1994   0.0     
emb|CDY39660.1|  BnaC05g11890D                                         1994   0.0     
gb|KHN22480.1|  Pleiotropic drug resistance protein 1                  1993   0.0     
ref|XP_003569329.1|  PREDICTED: pleiotropic drug resistance prote...   1992   0.0     
ref|XP_010110325.1|  Pleiotropic drug resistance protein 1             1991   0.0     
ref|XP_002892871.1|  ATPDR12/PDR12                                     1991   0.0     
sp|Q8GU92.1|PDR2_ORYSJ  RecName: Full=Probable pleiotropic drug r...   1991   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KDO58223.1|  hypothetical protein CISIN_1g000524mg                  1990   0.0     
gb|KDO58212.1|  hypothetical protein CISIN_1g000512mg                  1990   0.0     
ref|XP_010234020.1|  PREDICTED: putative pleiotropic drug resista...   1989   0.0     
ref|XP_006466163.1|  PREDICTED: pleiotropic drug resistance prote...   1989   0.0     
ref|XP_006465416.1|  PREDICTED: pleiotropic drug resistance prote...   1989   0.0     
ref|XP_004969127.1|  PREDICTED: pleiotropic drug resistance prote...   1989   0.0     
ref|XP_006427136.1|  hypothetical protein CICLE_v10024709mg            1989   0.0     
sp|Q8GU89.1|PDR4_ORYSJ  RecName: Full=Pleiotropic drug resistance...   1988   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EEE54967.1|  hypothetical protein OsJ_02559                         1988   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006576269.1|  PREDICTED: PDR-like ABC-transporter isoform X1    1988   0.0     
gb|EAY74922.1|  hypothetical protein OsI_02816                         1988   0.0     Oryza sativa Indica Group [Indian rice]
gb|KDO58213.1|  hypothetical protein CISIN_1g000512mg                  1988   0.0     
ref|XP_006465418.1|  PREDICTED: pleiotropic drug resistance prote...   1988   0.0     
gb|KCW59811.1|  hypothetical protein EUGRSUZ_H02558                    1987   0.0     
ref|XP_008346192.1|  PREDICTED: pleiotropic drug resistance prote...   1987   0.0     
ref|NP_001043539.1|  Os01g0609300                                      1987   0.0     
ref|XP_006644354.1|  PREDICTED: pleiotropic drug resistance prote...   1984   0.0     
sp|A2WSH0.1|PDR3_ORYSI  RecName: Full=Pleiotropic drug resistance...   1984   0.0     
ref|XP_010033905.1|  PREDICTED: ABC transporter G family member 4...   1983   0.0     
gb|KGN58140.1|  hypothetical protein Csa_3G550680                      1983   0.0     
gb|EMT06883.1|  Pleiotropic drug resistance protein 4                  1983   0.0     
ref|XP_006465512.1|  PREDICTED: pleiotropic drug resistance prote...   1983   0.0     
ref|XP_006465417.1|  PREDICTED: pleiotropic drug resistance prote...   1983   0.0     
ref|XP_011072267.1|  PREDICTED: pleiotropic drug resistance prote...   1982   0.0     
gb|AES81617.2|  drug resistance transporter-like ABC domain protein    1982   0.0     
ref|XP_008656641.1|  PREDICTED: pleiotropic drug resistance prote...   1982   0.0     
ref|XP_009799502.1|  PREDICTED: pleiotropic drug resistance prote...   1980   0.0     
ref|XP_006644353.1|  PREDICTED: probable pleiotropic drug resista...   1980   0.0     
ref|XP_007162608.1|  hypothetical protein PHAVU_001G165700g            1979   0.0     
gb|AAQ02685.1|  PDR-type ABC transporter 9                             1979   0.0     
ref|XP_010476642.1|  PREDICTED: ABC transporter G family member 4...   1979   0.0     
ref|XP_009619611.1|  PREDICTED: pleiotropic drug resistance prote...   1979   0.0     
ref|XP_006601130.1|  PREDICTED: pleiotropic drug resistance prote...   1976   0.0     
sp|O24367.1|TUR2_SPIPO  RecName: Full=Pleiotropic drug resistance...   1976   0.0     
ref|XP_004252847.1|  PREDICTED: pleiotropic drug resistance prote...   1975   0.0     
ref|XP_006646084.1|  PREDICTED: pleiotropic drug resistance prote...   1973   0.0     
gb|AES81581.2|  drug resistance transporter-like ABC domain protein    1972   0.0     
gb|KDO58225.1|  hypothetical protein CISIN_1g000540mg                  1972   0.0     
ref|XP_011072269.1|  PREDICTED: pleiotropic drug resistance prote...   1972   0.0     
ref|XP_003597819.1|  Pleiotropic drug resistance protein               1972   0.0     
gb|KFK43809.1|  hypothetical protein AALP_AA1G175900                   1971   0.0     
ref|XP_003625399.1|  Pleiotropic drug resistance protein               1971   0.0     
gb|AES81619.2|  drug resistance transporter-like ABC domain protein    1971   0.0     
emb|CAN61052.1|  hypothetical protein VITISV_026320                    1970   0.0     
ref|XP_008675479.1|  PREDICTED: pleiotropic drug resistance prote...   1969   0.0     
ref|XP_008228623.1|  PREDICTED: pleiotropic drug resistance prote...   1969   0.0     
gb|AFW83220.1|  hypothetical protein ZEAMMB73_049092                   1969   0.0     
ref|XP_007161249.1|  hypothetical protein PHAVU_001G054500g            1968   0.0     
ref|XP_004969129.1|  PREDICTED: pleiotropic drug resistance prote...   1968   0.0     
ref|XP_008656640.1|  PREDICTED: pleiotropic drug resistance prote...   1968   0.0     
ref|XP_003625398.1|  Pleiotropic drug resistance protein               1968   0.0     
emb|CDM83155.1|  unnamed protein product                               1967   0.0     
ref|XP_004498642.1|  PREDICTED: pleiotropic drug resistance prote...   1966   0.0     
gb|KEH28742.1|  drug resistance transporter-like ABC domain protein    1965   0.0     
ref|XP_006427133.1|  hypothetical protein CICLE_v10027224mg            1965   0.0     
gb|KHN15512.1|  Pleiotropic drug resistance protein 1                  1964   0.0     
ref|XP_006427135.1|  hypothetical protein CICLE_v10024711mg            1964   0.0     
ref|XP_007217092.1|  hypothetical protein PRUPE_ppa000231mg            1964   0.0     
tpg|DAA58928.1|  TPA: hypothetical protein ZEAMMB73_427923             1964   0.0     
ref|XP_002458140.1|  hypothetical protein SORBIDRAFT_03g027520         1963   0.0     
ref|XP_008377598.1|  PREDICTED: pleiotropic drug resistance prote...   1963   0.0     
gb|AES81579.2|  drug resistance transporter-like ABC domain protein    1962   0.0     
ref|XP_010099662.1|  Pleiotropic drug resistance protein 1             1962   0.0     
ref|XP_008242858.1|  PREDICTED: pleiotropic drug resistance prote...   1962   0.0     
ref|XP_004498641.1|  PREDICTED: pleiotropic drug resistance prote...   1962   0.0     
gb|KCW59814.1|  hypothetical protein EUGRSUZ_H02560                    1961   0.0     
sp|Q949G3.1|PDR1_NICPL  RecName: Full=Pleiotropic drug resistance...   1961   0.0     
gb|EMT16838.1|  Putative pleiotropic drug resistance protein 7         1961   0.0     
gb|KDO58222.1|  hypothetical protein CISIN_1g000524mg                  1959   0.0     
ref|XP_010033933.1|  PREDICTED: pleiotropic drug resistance prote...   1959   0.0     
gb|KDO58231.1|  hypothetical protein CISIN_1g000576mg                  1957   0.0     
ref|XP_002458137.1|  hypothetical protein SORBIDRAFT_03g027490         1957   0.0     
ref|NP_001043541.1|  Os01g0609900                                      1957   0.0     
ref|XP_003625401.1|  Pleiotropic drug resistance protein               1956   0.0     
gb|AES81616.2|  drug resistance transporter-like ABC domain protein    1955   0.0     
gb|AES81585.2|  drug resistance transporter-like ABC domain protein    1953   0.0     
ref|XP_002458139.1|  hypothetical protein SORBIDRAFT_03g027510         1952   0.0     
ref|XP_010110323.1|  Pleiotropic drug resistance protein 1             1950   0.0     
ref|XP_003566865.1|  PREDICTED: pleiotropic drug resistance prote...   1949   0.0     
ref|XP_006465413.1|  PREDICTED: pleiotropic drug resistance prote...   1947   0.0     
ref|XP_002303856.2|  hypothetical protein POPTR_0003s18140g            1947   0.0     
ref|XP_006348041.1|  PREDICTED: pleiotropic drug resistance prote...   1947   0.0     
ref|NP_001043538.1|  Os01g0609200                                      1947   0.0     
ref|NP_001237697.1|  PDR-like ABC-transporter                          1944   0.0     
ref|XP_010033935.1|  PREDICTED: pleiotropic drug resistance prote...   1943   0.0     
ref|XP_009619822.1|  PREDICTED: pleiotropic drug resistance prote...   1940   0.0     
ref|XP_002458135.1|  hypothetical protein SORBIDRAFT_03g027460         1939   0.0     
ref|XP_010033934.1|  PREDICTED: pleiotropic drug resistance prote...   1939   0.0     
ref|NP_001172460.1|  Os01g0609066                                      1938   0.0     
ref|XP_004969125.1|  PREDICTED: pleiotropic drug resistance prote...   1938   0.0     
sp|Q7PC80.1|PDR1_ORYSJ  RecName: Full=Probable pleiotropic drug r...   1938   0.0     
ref|XP_006427140.1|  hypothetical protein CICLE_v10024710mg            1937   0.0     
gb|KDO58226.1|  hypothetical protein CISIN_1g000529mg                  1936   0.0     
ref|XP_007204684.1|  hypothetical protein PRUPE_ppa000258mg            1936   0.0     
ref|XP_008447485.1|  PREDICTED: pleiotropic drug resistance prote...   1934   0.0     
ref|XP_007162609.1|  hypothetical protein PHAVU_001G165800g            1934   0.0     
ref|XP_006465419.1|  PREDICTED: pleiotropic drug resistance prote...   1932   0.0     
ref|XP_004969123.1|  PREDICTED: probable pleiotropic drug resista...   1932   0.0     
ref|NP_001042955.1|  Os01g0342700                                      1931   0.0     
dbj|BAD05827.1|  putative PDR-like ABC transporter                     1931   0.0     
ref|XP_010026664.1|  PREDICTED: pleiotropic drug resistance prote...   1930   0.0     
gb|EYU35725.1|  hypothetical protein MIMGU_mgv1a000224mg               1930   0.0     
emb|CAD59567.1|  PDR-like ABC transporter                              1930   0.0     
ref|XP_011072266.1|  PREDICTED: pleiotropic drug resistance prote...   1927   0.0     
ref|XP_004252174.1|  PREDICTED: pleiotropic drug resistance prote...   1927   0.0     
ref|XP_004956368.1|  PREDICTED: pleiotropic drug resistance prote...   1926   0.0     
ref|XP_004969126.1|  PREDICTED: pleiotropic drug resistance prote...   1925   0.0     
ref|XP_006465421.1|  PREDICTED: pleiotropic drug resistance prote...   1924   0.0     
ref|XP_002451110.1|  hypothetical protein SORBIDRAFT_05g024240         1924   0.0     
ref|XP_007201767.1|  hypothetical protein PRUPE_ppa000267mg            1923   0.0     
dbj|BAK01114.1|  predicted protein                                     1923   0.0     
ref|XP_003625361.1|  Pleiotropic drug resistance protein               1923   0.0     
ref|XP_003588698.1|  Pleiotropic drug resistance protein               1921   0.0     
gb|EAZ44307.1|  hypothetical protein OsJ_28928                         1921   0.0     
gb|EEC84379.1|  hypothetical protein OsI_30931                         1920   0.0     
gb|EMS61936.1|  Pleiotropic drug resistance protein 4                  1920   0.0     
ref|XP_002462387.1|  hypothetical protein SORBIDRAFT_02g024840         1920   0.0     
ref|XP_004252846.1|  PREDICTED: pleiotropic drug resistance prote...   1920   0.0     
ref|XP_007162618.1|  hypothetical protein PHAVU_001G166300g            1919   0.0     
ref|XP_007200951.1|  hypothetical protein PRUPE_ppa000265mg            1919   0.0     
gb|EMT16409.1|  Pleiotropic drug resistance protein 4                  1918   0.0     
gb|EMS59048.1|  Putative pleiotropic drug resistance protein 7         1918   0.0     
emb|CAN63107.1|  hypothetical protein VITISV_025103                    1917   0.0     
gb|EYU21586.1|  hypothetical protein MIMGU_mgv1a000211mg               1916   0.0     
ref|XP_010238072.1|  PREDICTED: pleiotropic drug resistance prote...   1913   0.0     
gb|KDO58216.1|  hypothetical protein CISIN_1g000512mg                  1912   0.0     
ref|NP_001274820.1|  pleiotropic drug resistance protein 1-like        1911   0.0     
ref|XP_004300718.1|  PREDICTED: pleiotropic drug resistance prote...   1911   0.0     
emb|CDM86331.1|  unnamed protein product                               1910   0.0     
ref|XP_008235761.1|  PREDICTED: pleiotropic drug resistance prote...   1909   0.0     
ref|XP_008677970.1|  PREDICTED: putative pleiotropic drug resista...   1908   0.0     
ref|XP_007023998.1|  Pleiotropic drug resistance 12                    1908   0.0     
ref|XP_004956611.1|  PREDICTED: pleiotropic drug resistance prote...   1907   0.0     
gb|AFW60393.1|  hypothetical protein ZEAMMB73_326542                   1907   0.0     
dbj|BAD52527.1|  putative PDR-type ABC transporter 2                   1907   0.0     
gb|KHN09391.1|  Pleiotropic drug resistance protein 1                  1907   0.0     
gb|KEH23979.1|  drug resistance transporter-like ABC domain protein    1907   0.0     
gb|EMS67193.1|  Pleiotropic drug resistance protein 4                  1906   0.0     
ref|XP_009364039.1|  PREDICTED: pleiotropic drug resistance prote...   1905   0.0     
gb|EAY74913.1|  hypothetical protein OsI_02806                         1904   0.0     
ref|XP_007199068.1|  hypothetical protein PRUPE_ppa018716mg            1904   0.0     
ref|XP_006466162.1|  PREDICTED: pleiotropic drug resistance prote...   1903   0.0     
ref|XP_004969128.1|  PREDICTED: pleiotropic drug resistance prote...   1903   0.0     
ref|XP_006576968.1|  PREDICTED: pleiotropic drug resistance prote...   1902   0.0     
ref|XP_008377599.1|  PREDICTED: pleiotropic drug resistance prote...   1899   0.0     
ref|XP_003574423.1|  PREDICTED: pleiotropic drug resistance prote...   1899   0.0     
dbj|BAJ99663.1|  predicted protein                                     1895   0.0     
ref|XP_003553514.1|  PREDICTED: pleiotropic drug resistance prote...   1894   0.0     
ref|XP_008389930.1|  PREDICTED: pleiotropic drug resistance prote...   1894   0.0     
ref|XP_006652070.1|  PREDICTED: probable pleiotropic drug resista...   1894   0.0     
ref|XP_003625400.1|  Pleiotropic drug resistance protein               1894   0.0     
ref|XP_006604517.1|  PREDICTED: pleiotropic drug resistance prote...   1890   0.0     
gb|KHG17289.1|  Pleiotropic drug resistance 1                          1888   0.0     
ref|XP_008373552.1|  PREDICTED: pleiotropic drug resistance prote...   1887   0.0     
ref|XP_002462237.1|  hypothetical protein SORBIDRAFT_02g022270         1885   0.0     
ref|XP_002458136.1|  hypothetical protein SORBIDRAFT_03g027480         1884   0.0     
ref|XP_002458133.1|  hypothetical protein SORBIDRAFT_03g027440         1883   0.0     
ref|XP_008461059.1|  PREDICTED: pleiotropic drug resistance prote...   1882   0.0     
ref|XP_006427137.1|  hypothetical protein CICLE_v10024715mg            1882   0.0     
gb|KHN02456.1|  Pleiotropic drug resistance protein 1                  1882   0.0     
ref|XP_008652577.1|  PREDICTED: pleiotropic drug resistance prote...   1879   0.0     
gb|KGN45317.1|  hypothetical protein Csa_7G433950                      1877   0.0     
ref|XP_006427134.1|  hypothetical protein CICLE_v10024711mg            1877   0.0     
gb|EEC71063.1|  hypothetical protein OsI_02808                         1875   0.0     
ref|XP_008652578.1|  PREDICTED: pleiotropic drug resistance prote...   1873   0.0     
emb|CBH32605.1|  ABC transporter domain containing protein,expressed   1873   0.0     
gb|KHG24038.1|  Pleiotropic drug resistance 1                          1873   0.0     
gb|EMT02497.1|  Pleiotropic drug resistance protein 3                  1871   0.0     
ref|XP_006465420.1|  PREDICTED: pleiotropic drug resistance prote...   1871   0.0     
ref|XP_008775870.1|  PREDICTED: pleiotropic drug resistance prote...   1869   0.0     
ref|XP_004506880.1|  PREDICTED: pleiotropic drug resistance prote...   1868   0.0     
ref|XP_004158765.1|  PREDICTED: pleiotropic drug resistance prote...   1868   0.0     
ref|XP_008775869.1|  PREDICTED: pleiotropic drug resistance prote...   1868   0.0     
ref|XP_004135831.1|  PREDICTED: pleiotropic drug resistance prote...   1868   0.0     
ref|XP_006465414.1|  PREDICTED: pleiotropic drug resistance prote...   1866   0.0     
ref|XP_008775871.1|  PREDICTED: pleiotropic drug resistance prote...   1862   0.0     
ref|XP_007023821.1|  Pleiotropic drug resistance 12                    1862   0.0     
ref|XP_006427142.1|  hypothetical protein CICLE_v10027401mg            1860   0.0     
ref|XP_002458132.1|  hypothetical protein SORBIDRAFT_03g027430         1856   0.0     
ref|XP_006427141.1|  hypothetical protein CICLE_v10027430mg            1855   0.0     
ref|XP_006829656.1|  hypothetical protein AMTR_s00122p00119310         1855   0.0     
ref|XP_009780354.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...   1853   0.0     
dbj|BAD52520.1|  putative ABC1 protein                                 1852   0.0     
gb|EEC83509.1|  hypothetical protein OsI_29079                         1850   0.0     
gb|KDO58228.1|  hypothetical protein CISIN_1g038815mg                  1846   0.0     
ref|XP_010254260.1|  PREDICTED: pleiotropic drug resistance prote...   1846   0.0     
gb|EMT20966.1|  Pleiotropic drug resistance protein 4                  1845   0.0     
ref|XP_004493880.1|  PREDICTED: pleiotropic drug resistance prote...   1841   0.0     
ref|XP_002527331.1|  ATP-binding cassette transporter, putative        1838   0.0     
ref|XP_004493879.1|  PREDICTED: pleiotropic drug resistance prote...   1838   0.0     
ref|XP_007162620.1|  hypothetical protein PHAVU_001G166500g            1838   0.0     
gb|KCW59819.1|  hypothetical protein EUGRSUZ_H02564                    1835   0.0     
ref|XP_004965830.1|  PREDICTED: pleiotropic drug resistance prote...   1835   0.0     
ref|XP_002972164.1|  ATP-binding cassette transporter                  1833   0.0     
gb|AES81623.2|  drug resistance transporter-like ABC domain protein    1833   0.0     
gb|KDO44268.1|  hypothetical protein CISIN_1g000808mg                  1832   0.0     
ref|XP_002972176.1|  ATP-binding cassette transporter                  1830   0.0     
gb|EYU21593.1|  hypothetical protein MIMGU_mgv1a000235mg               1828   0.0     
gb|EPS71654.1|  hypothetical protein M569_03105                        1826   0.0     
ref|XP_006441386.1|  hypothetical protein CICLE_v10024468mg            1823   0.0     
gb|AES81621.2|  drug resistance transporter-like ABC domain protein    1821   0.0     
emb|CAN61934.1|  hypothetical protein VITISV_005227                    1820   0.0     
ref|XP_002977484.1|  ATP-binding cassette transporter                  1816   0.0     
ref|XP_006306599.1|  hypothetical protein CARUB_v10008103mg            1815   0.0     
gb|KDP45005.1|  hypothetical protein JCGZ_01505                        1811   0.0     
ref|XP_004493881.1|  PREDICTED: pleiotropic drug resistance prote...   1811   0.0     
ref|XP_007023992.1|  Pleiotropic drug resistance 12 isoform 3          1810   0.0     
ref|XP_008675480.1|  PREDICTED: pleiotropic drug resistance prote...   1810   0.0     
gb|KDO58217.1|  hypothetical protein CISIN_1g000512mg                  1809   0.0     
ref|XP_003625405.1|  Pleiotropic drug resistance protein               1809   0.0     
gb|KHG28138.1|  Pleiotropic drug resistance 1                          1808   0.0     
ref|XP_007161248.1|  hypothetical protein PHAVU_001G054500g            1808   0.0     
ref|XP_007015918.1|  Pleiotropic drug resistance 6                     1806   0.0     
ref|XP_010926683.1|  PREDICTED: pleiotropic drug resistance prote...   1806   0.0     
ref|XP_007162612.1|  hypothetical protein PHAVU_001G166000g            1805   0.0     
ref|XP_003625403.1|  Pleiotropic drug resistance protein               1805   0.0     
ref|XP_002972170.1|  ATP-binding cassette transporter                  1805   0.0     
gb|KEH23973.1|  drug resistance transporter-like ABC domain protein    1803   0.0     
ref|XP_010273226.1|  PREDICTED: pleiotropic drug resistance prote...   1803   0.0     
ref|XP_010049726.1|  PREDICTED: pleiotropic drug resistance prote...   1803   0.0     
gb|KCW53771.1|  hypothetical protein EUGRSUZ_J030242                   1802   0.0     
gb|EAZ12650.1|  hypothetical protein OsJ_02565                         1802   0.0     
ref|XP_010651721.1|  PREDICTED: pleiotropic drug resistance prote...   1801   0.0     
gb|KCW65223.1|  hypothetical protein EUGRSUZ_G02707                    1800   0.0     
emb|CAN83834.1|  hypothetical protein VITISV_006821                    1800   0.0     
ref|XP_010067156.1|  PREDICTED: pleiotropic drug resistance prote...   1799   0.0     
tpg|DAA61077.1|  TPA: hypothetical protein ZEAMMB73_555070             1798   0.0     
ref|XP_010242632.1|  PREDICTED: pleiotropic drug resistance prote...   1798   0.0     
ref|XP_006427143.1|  hypothetical protein CICLE_v10024714mg            1798   0.0     
ref|XP_011090010.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...   1795   0.0     
ref|XP_010658728.1|  PREDICTED: pleiotropic drug resistance prote...   1795   0.0     
ref|XP_010244003.1|  PREDICTED: pleiotropic drug resistance prote...   1795   0.0     



>ref|XP_006366078.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum 
tuberosum]
Length=1453

 Score =  2330 bits (6038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1177/1437 (82%), Positives = 1320/1437 (92%), Gaps = 5/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR+S ++VFSRSSRE  +D+E  LKWAA+EKLPTYLRIRRGIL+ EE  G  +E+D+ K
Sbjct  20    VWRNSAMDVFSRSSREDYDDEEA-LKWAALEKLPTYLRIRRGILSEEE--GQYREVDITK  76

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L + E+R+LLERLV+IA EDNE FLLKLK R DRVG+DLPTIEVRFEHLNVDAEA VGSR
Sbjct  77    LDLVERRNLLERLVKIADEDNEKFLLKLKKRIDRVGLDLPTIEVRFEHLNVDAEARVGSR  136

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNFT NILE F+NYLHILP+RKKPLPILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  137   ALPTIFNFTVNILEDFLNYLHILPSRKKPLPILHDVSGIIKPGRMTLLLGPPSSGKTTLL  196

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             L LAGKLD DLKVSGRVTYNGH M EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  197   LGLAGKLDKDLKVSGRVTYNGHGMDEFVPQRTSAYISQNDLHIGEMTVRETLAFSARCQG  256

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG +YE+LAELSRREKE NIKPDPD+D++MK+   +GQEA+VVTDY LKILGLE+CAD +
Sbjct  257   VGAKYEILAELSRREKEANIKPDPDVDIFMKSAWNDGQEANVVTDYTLKILGLEICADTI  316

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKRLTTGEM+VGPARALFMDEISTGLDSSTT+QIVNSIRQSIHILQG
Sbjct  317   VGDEMIRGISGGQRKRLTTGEMMVGPARALFMDEISTGLDSSTTYQIVNSIRQSIHILQG  376

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF+++GFKCP+RKGVADFLQE
Sbjct  377   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEYLGFKCPQRKGVADFLQE  436

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW RR+E Y+FITV EFSEAFQSFHVG+KLGDELAVPFDKSKSHPAAL+ K
Sbjct  437   VTSRKDQEQYWARRDEPYKFITVREFSEAFQSFHVGRKLGDELAVPFDKSKSHPAALTTK  496

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             +YGV+KKELLKAC +RE+LLMKRNSFVYIFKMIQL LMA + MT+FLRTEM +N++ DG 
Sbjct  497   RYGVSKKELLKACTAREYLLMKRNSFVYIFKMIQLTLMATITMTLFLRTEMHRNTMIDGA  556

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             VF+GAL++AVIM MFNGFSELALSI+KLP+FYKQRDL FFP W YALPTWILKIP+TLVE
Sbjct  557   VFLGALYYAVIMIMFNGFSELALSIMKLPSFYKQRDLLFFPAWTYALPTWILKIPITLVE  616

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWVCMTYY IGF+ D GRFFKQLFLLIC+NQMAS LFR  AA GR++IVANTFGSCA+
Sbjct  617   VAIWVCMTYYVIGFEADVGRFFKQLFLLICLNQMASGLFRFLAALGRNIIVANTFGSCAL  676

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVP--SGTSETLG  2154
             ++VLV+GGFILSRD+VK+W IWGYWISP+MYAQNAI+VNE+LGKSW HVP  S  ++TLG
Sbjct  677   LIVLVMGGFILSRDNVKQWLIWGYWISPMMYAQNAIAVNEFLGKSWAHVPPNSTGTDTLG  736

Query  2155  VTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERN  2334
             V+ L+SRGIFPEA WYWIGVGAL+GYV L NFLF +AL YLNP GKPQA+LSEET+AERN
Sbjct  737   VSFLKSRGIFPEARWYWIGVGALLGYVLLFNFLFTVALAYLNPFGKPQAVLSEETVAERN  796

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             A K+GE IEL   G S+SE+GN VRRS SSRS+SSRVG++   D N ++GM+LPFEPL I
Sbjct  797   ASKKGEVIELSPIGKSSSERGNDVRRSASSRSMSSRVGNITEGDINKRKGMILPFEPLSI  856

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFD+I+YAVDMP EMK+QG  EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  857   TFDDIRYAVDMPQEMKSQGFIEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  916

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYIEG+I+ISGYPK+QETFARIAGYCEQTDIHSPHVTVYESL YSAWLRLP E+DT
Sbjct  917   RKTGGYIEGTISISGYPKQQETFARIAGYCEQTDIHSPHVTVYESLQYSAWLRLPREVDT  976

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
              TR+ F+EEVM+LVEL  LREALVGLPGVNGLSTEQRKRLT+AVELVANPSIIFMDEPTS
Sbjct  977   ETRKRFIEEVMELVELKPLREALVGLPGVNGLSTEQRKRLTVAVELVANPSIIFMDEPTS  1036

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEI+VGPLGRH
Sbjct  1037  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIFVGPLGRH  1096

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SS LI+YFE I+G+ +IRDGYNPATWML+ITS AQEAALG+DF E+YRNSELYRRNKALI
Sbjct  1097  SSHLIKYFEGIDGVPKIRDGYNPATWMLDITSVAQEAALGVDFTELYRNSELYRRNKALI  1156

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             +ELS PAPGSKDLYF TKYSQSFFTQ MAC WKQHWSYWRNPPYTAVRLLFT F AL+FG
Sbjct  1157  KELSVPAPGSKDLYFQTKYSQSFFTQSMACFWKQHWSYWRNPPYTAVRLLFTFFIALMFG  1216

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G KRR QQD+ NA+G MYA+V+FLGVQNATSVQPVVAIERTVFYRERAAGMYSA
Sbjct  1217  TIFWDLGSKRRRQQDILNAIGSMYASVLFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  1276

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAFGQ++IELP++F+QT+IYGVIVYAMIGFEWT AKF W++FFMYFTLLYFTLYGMMT
Sbjct  1277  LPYAFGQIMIELPYIFIQTIIYGVIVYAMIGFEWTVAKFFWYLFFMYFTLLYFTLYGMMT  1336

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNH+IAAI+SSAFY  WNLFSGFI+PKTR+PVWWRWYYYICP+SWTLYGLIASQFG
Sbjct  1337  VAVTPNHSIAAIVSSAFYAVWNLFSGFIVPKTRMPVWWRWYYYICPISWTLYGLIASQFG  1396

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+++KL+T ETV++F++SFFDF +DFVGYVA I+VGI V+F FIFA+SIKAFNFQ R
Sbjct  1397  DLQDKLETKETVEEFIESFFDFKYDFVGYVAVILVGISVLFLFIFAYSIKAFNFQKR  1453



>ref|XP_009775073.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nicotiana 
sylvestris]
Length=1452

 Score =  2327 bits (6030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1179/1437 (82%), Positives = 1312/1437 (91%), Gaps = 6/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR+S ++VFSRSSREA +++   LKWAA+EKLPTYLRIRRGIL  EE  G  +E+D+ K
Sbjct  20    VWRNSAMDVFSRSSREADDEEA--LKWAALEKLPTYLRIRRGILTEEE--GQSREVDITK  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L + E+R+LLERLV+IA EDNE FLLKLK R DRVG+DLPTIEVRFEH++VDAEA VGSR
Sbjct  76    LDLVERRNLLERLVKIADEDNEKFLLKLKKRIDRVGLDLPTIEVRFEHVSVDAEARVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNFT NILE F+NYLHILP+RKKPLPILH+VSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  136   ALPTIFNFTVNILEDFLNYLHILPSRKKPLPILHEVSGIIKPGRMTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD DLKVSGRVTYNGH M EFVP+R+SAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  196   LALAGKLDKDLKVSGRVTYNGHGMDEFVPQRSSAYISQNDLHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG +YE+LAELSRREKE NIKPDPD+D++MK+   EGQEA+VVTDY LKILGLE+CAD L
Sbjct  256   VGAKYEILAELSRREKEANIKPDPDVDIFMKSAWNEGQEANVVTDYTLKILGLEICADTL  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKRLTTGEM+VGPARALFMDEISTGLDSSTT+QIVNSIRQSIHILQG
Sbjct  316   VGDEMIRGISGGQRKRLTTGEMMVGPARALFMDEISTGLDSSTTYQIVNSIRQSIHILQG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF++MGF CPERKGVADFLQE
Sbjct  376   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEYMGFMCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQY   R+E Y FITV EFSE+FQSFH+G+KLGDELAVPFDKSKSHPAAL+ K
Sbjct  436   VTSRKDQEQYRACRDEPYNFITVREFSESFQSFHIGRKLGDELAVPFDKSKSHPAALTTK  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             +YGV+KKELLKAC +RE+LLMKRNSFVYIFKMIQL LMA + MT+FL+TEM +N+  DG 
Sbjct  496   RYGVSKKELLKACTAREYLLMKRNSFVYIFKMIQLTLMASITMTLFLQTEMHRNTTTDGA  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             VF+GALF+AVIM MFNGFSELALSI+KLP+FYKQRDL FFP WAYALPTWILKIPVTLVE
Sbjct  556   VFLGALFYAVIMIMFNGFSELALSIMKLPSFYKQRDLLFFPAWAYALPTWILKIPVTLVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWVCMTYY IGF+ D GRFFKQLFLLICVNQMAS LFR   A GR+VIVANTFGSCA+
Sbjct  616   VAIWVCMTYYVIGFEADVGRFFKQLFLLICVNQMASGLFRFIGALGRNVIVANTFGSCAL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVP--SGTSETLG  2154
             + V+V+GGFILSRDDVKKWWIWGYWISP+MYAQNAI+VNE+LGKSW HVP  S  +ETLG
Sbjct  676   LTVIVMGGFILSRDDVKKWWIWGYWISPMMYAQNAIAVNEFLGKSWAHVPPNSTGTETLG  735

Query  2155  VTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERN  2334
             V+ L+SRGIFPEA WYWIG GAL+GYV L NFLF +AL YLNP GK QA+LSEET+AERN
Sbjct  736   VSFLKSRGIFPEARWYWIGAGALLGYVLLFNFLFTVALAYLNPFGKSQAVLSEETVAERN  795

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             A KRGE I+L L    +SE+ N VRRS SSRS+SSRVGS+  AD N +RGM+LPFEPL I
Sbjct  796   ASKRGEVIKLSLIEKHSSERLNDVRRSASSRSMSSRVGSITEADLNKRRGMILPFEPLSI  855

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFD+I+YAVDMP EMKAQG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  856   TFDDIRYAVDMPQEMKAQGVAEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  915

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYI+G+I+ISGYPK+QETFARIAGYCEQTDIHSPHVTVYESL +SAWLRLP E+DT
Sbjct  916   RKTGGYIDGTISISGYPKQQETFARIAGYCEQTDIHSPHVTVYESLQFSAWLRLPHEVDT  975

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
              TR+MFVEEVM+LVELT LREALVGLPGVNGLSTEQRKRLT+AVELVANPSIIFMDEPTS
Sbjct  976   ETRKMFVEEVMELVELTPLREALVGLPGVNGLSTEQRKRLTVAVELVANPSIIFMDEPTS  1035

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH
Sbjct  1036  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  1095

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SS LI+YFE I+G+ +I+DGYNPATWMLEITS AQEAA GIDF E+Y+NSELYRRNKALI
Sbjct  1096  SSHLIKYFEGIDGVPKIKDGYNPATWMLEITSVAQEAARGIDFTELYKNSELYRRNKALI  1155

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             +ELS PAP SKDLYFPTKYSQSFFTQCMAC WKQ WSYWRNPPYTAVRL+FT F AL+FG
Sbjct  1156  KELSVPAPCSKDLYFPTKYSQSFFTQCMACFWKQRWSYWRNPPYTAVRLMFTFFIALMFG  1215

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G +R+ QQDL NA+G MY AV+FLGVQNATSVQPV+AIERTVFYRERAAGMYSA
Sbjct  1216  TIFWDLGSRRKRQQDLLNAIGSMYVAVLFLGVQNATSVQPVIAIERTVFYRERAAGMYSA  1275

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAFGQV+IELP+LF+QT+IYGVIVY MIGFEWT AKF W++FFMYFTLLYFTLYGMMT
Sbjct  1276  LPYAFGQVMIELPYLFIQTIIYGVIVYVMIGFEWTVAKFFWYLFFMYFTLLYFTLYGMMT  1335

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNH+IAAIISSAFY  WNLF GF++PKTR+PVWWRWYYYICP+SWTLYGLIASQFG
Sbjct  1336  VAVTPNHSIAAIISSAFYAIWNLFCGFVVPKTRMPVWWRWYYYICPISWTLYGLIASQFG  1395

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+++KLDTNETV++F++SFFDF +DFVGYVA I+VGI V+F FIFAFSIKAFNFQ R
Sbjct  1396  DIQDKLDTNETVEEFIESFFDFKYDFVGYVAVILVGISVVFLFIFAFSIKAFNFQKR  1452



>gb|AFA43815.1| ABCG/PDR subfamily ABC transporter [Petunia axillaris]
Length=1452

 Score =  2325 bits (6026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1171/1437 (81%), Positives = 1313/1437 (91%), Gaps = 6/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR+S ++VFSRSSREA +++   LKWAA+EKLPTYLRIRRGIL  EE  G  +E+D+ K
Sbjct  20    VWRNSAMDVFSRSSREADDEEA--LKWAALEKLPTYLRIRRGILTEEE--GQSREVDITK  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L + E+R+LLERL++I  EDNE FLLKLK R DRVG+DLPTIEVRFEHL+VDAEA VGSR
Sbjct  76    LDLVERRNLLERLIKITDEDNEKFLLKLKERIDRVGLDLPTIEVRFEHLSVDAEARVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FNFT NILE F+NYLHILPNRK+PLPILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  136   ALPTVFNFTVNILEDFLNYLHILPNRKQPLPILHDVSGIIKPGRMTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD DLKVSGRVTYNGH+M EFV +R+SAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  196   LALAGKLDKDLKVSGRVTYNGHDMNEFVAQRSSAYISQYDLHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG +YE+LAELSRREKE NIKPDPD+D++MKA   EGQEA+VVTDY LKILGLE+CAD +
Sbjct  256   VGAKYEILAELSRREKEANIKPDPDVDIFMKAAWNEGQEANVVTDYTLKILGLEICADTI  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMI GISGGQRKRLTTGEM+VGPARALFMDEISTGLDSSTT+QIVNSIRQSIHILQG
Sbjct  316   VGDEMIPGISGGQRKRLTTGEMMVGPARALFMDEISTGLDSSTTYQIVNSIRQSIHILQG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF++MGF CPERKGVADFLQE
Sbjct  376   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEYMGFICPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW RREE+Y+FITV EFSEAFQ+FH+G+KLGDELAVPFDKSKSHPAAL+ K
Sbjct  436   VTSRKDQEQYWARREESYKFITVREFSEAFQAFHIGRKLGDELAVPFDKSKSHPAALTTK  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             +YGV+KKELLKAC +RE+LLMKRNSFVYIFKMIQL LMA + MT+FLRTEM +N+  DG 
Sbjct  496   RYGVSKKELLKACTAREYLLMKRNSFVYIFKMIQLTLMASITMTLFLRTEMHRNTTIDGA  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             VF+GALF+A+IM MFNGFSELALSI+KLP+FYK RDL FFPPWAYALPTWILKIP+TLVE
Sbjct  556   VFLGALFYALIMIMFNGFSELALSIMKLPSFYKHRDLLFFPPWAYALPTWILKIPITLVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWVCMTYY IGF+ D GRFFKQL LLICVNQMAS LFRL  A GR++IVANTFGS  +
Sbjct  616   VAIWVCMTYYVIGFEADVGRFFKQLLLLICVNQMASGLFRLMGALGRNIIVANTFGSFVL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVP--SGTSETLG  2154
             + VLV+GGF+LSRDDVKKWWIWGYWISP+MYAQNAI+VNE+LGKSW HVP  S ++ETLG
Sbjct  676   LTVLVMGGFVLSRDDVKKWWIWGYWISPMMYAQNAIAVNEFLGKSWAHVPPNSTSTETLG  735

Query  2155  VTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERN  2334
             V+ L+SRGIFP+A WYWIG GAL+GYVFL NFLF +AL YLNP GKPQA+LSEET+AERN
Sbjct  736   VSFLKSRGIFPDARWYWIGAGALIGYVFLFNFLFAVALAYLNPFGKPQAVLSEETVAERN  795

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             A KRGE IEL   G S+SEKGN VRRS SSRS+SSRVGS+  AD + +RGM+LPFEPL I
Sbjct  796   ASKRGEVIELSSLGKSSSEKGNDVRRSASSRSMSSRVGSITAADLSKRRGMILPFEPLSI  855

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFD+I+YAVDMP EMKAQG TEDRL LL+G++GAFRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  856   TFDDIRYAVDMPQEMKAQGFTEDRLELLRGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  915

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYI+G+I+ISGYPK+QETFARIAGYCEQTDIHSPHVTVYESL +SAWLRLP E+DT
Sbjct  916   RKTGGYIDGTISISGYPKQQETFARIAGYCEQTDIHSPHVTVYESLQFSAWLRLPREVDT  975

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
             ATR+MF+EEVM+L+EL  LR+ALVGLPGVNGLSTEQRKRLT+AVELVANPSIIFMDEPTS
Sbjct  976   ATRKMFIEEVMELIELIPLRDALVGLPGVNGLSTEQRKRLTVAVELVANPSIIFMDEPTS  1035

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGR 
Sbjct  1036  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRQ  1095

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SS LI+YFE I+G+ +I+DGYNPATWMLEITS AQE ALG DF E+Y+NSELYRRNKALI
Sbjct  1096  SSHLIKYFEGIDGVPKIKDGYNPATWMLEITSVAQEGALGNDFTELYKNSELYRRNKALI  1155

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             +ELS PA  SKDLYFPTKYSQSFFTQCMAC WKQHWSYWRNPPYTAVR++FT F AL+FG
Sbjct  1156  KELSVPASCSKDLYFPTKYSQSFFTQCMACFWKQHWSYWRNPPYTAVRIMFTFFIALMFG  1215

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G +R  QQDL NA+G MY AV+FLGVQNAT+VQPV+AIERTVFYRERAAGMYSA
Sbjct  1216  TIFWDLGSRRERQQDLLNAIGSMYIAVLFLGVQNATTVQPVIAIERTVFYRERAAGMYSA  1275

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             +PYAFGQV+IELP+LF+QT+IYGVIVYAMIGFEWT AKF W++FFMYFTLLYFTLYGMMT
Sbjct  1276  MPYAFGQVMIELPYLFLQTIIYGVIVYAMIGFEWTVAKFFWYLFFMYFTLLYFTLYGMMT  1335

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNH+IAAIISSAFY  WNLF GFI+PKTR+PVWWRWYYYICP+SWTLYGLIASQFG
Sbjct  1336  VAVTPNHSIAAIISSAFYAVWNLFCGFIVPKTRMPVWWRWYYYICPISWTLYGLIASQFG  1395

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D++++LDTNETV+ F+++FFDF HDFVGYVA I+VGI V+F FIFAFSIK FNFQ R
Sbjct  1396  DIQDRLDTNETVEQFIENFFDFKHDFVGYVALILVGISVLFLFIFAFSIKTFNFQKR  1452



>ref|XP_004245225.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum 
lycopersicum]
Length=1453

 Score =  2325 bits (6024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1176/1437 (82%), Positives = 1320/1437 (92%), Gaps = 5/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR+SGV+VFSRSSRE  +D+E  LKWAA+EKLPTYLRIRRGIL+ EE  G  +E+D+ K
Sbjct  20    VWRNSGVDVFSRSSREDYDDEEA-LKWAALEKLPTYLRIRRGILSEEE--GQYREVDITK  76

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L + E+R+LLERLV+IA EDNE FLLKLK R DRVG+DLPTIEVRFEHLNVDAEA VGSR
Sbjct  77    LDLVERRNLLERLVKIADEDNEKFLLKLKKRIDRVGLDLPTIEVRFEHLNVDAEARVGSR  136

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNFT NI+E F+NYLHILP+RKKPLPILH++SGIIKP RMTLLLGPPSSGKTTLL
Sbjct  137   ALPTIFNFTVNIIEDFLNYLHILPSRKKPLPILHEISGIIKPGRMTLLLGPPSSGKTTLL  196

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             L LAGKLD DLKVSGRVTYNGH M EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  197   LGLAGKLDKDLKVSGRVTYNGHGMDEFVPQRTSAYISQNDLHIGEMTVRETLAFSARCQG  256

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG +YE+LAELSRREKE NIKPDPD+D++MK+   +GQEA+VVTDY LKILGLE+CAD +
Sbjct  257   VGAKYEILAELSRREKEANIKPDPDVDIFMKSAWNDGQEANVVTDYTLKILGLEICADTI  316

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKRLTTGEM+VGPARALFMDEISTGLDSSTT+QIVNSIRQSIHILQG
Sbjct  317   VGDEMIRGISGGQRKRLTTGEMMVGPARALFMDEISTGLDSSTTYQIVNSIRQSIHILQG  376

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF+++GFKCP+RKGVADFLQE
Sbjct  377   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEYIGFKCPQRKGVADFLQE  436

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW RR+E Y+FITV EFSEAFQSFHVG+KLGDELAVPFDKSKSHPAAL+ +
Sbjct  437   VTSRKDQEQYWARRDEPYKFITVREFSEAFQSFHVGRKLGDELAVPFDKSKSHPAALTTE  496

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             +YGV+KKELLKAC +RE+LLMKRNSFVYIFKMIQL LMA + MT+FLRTEM ++++ DG 
Sbjct  497   RYGVSKKELLKACTAREYLLMKRNSFVYIFKMIQLTLMATITMTLFLRTEMHRDTMIDGA  556

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             VF+GAL++AVIM MFNGFSELALSI+KLP+FYK RDL FFP W YALPTWILKIP+TLVE
Sbjct  557   VFLGALYYAVIMIMFNGFSELALSIMKLPSFYKHRDLLFFPAWTYALPTWILKIPITLVE  616

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWVCMTYY IGF+ D GRFFKQLFLLIC+NQMAS LFR  AA GR+VIVANTFGSCA+
Sbjct  617   VAIWVCMTYYVIGFEADVGRFFKQLFLLICLNQMASGLFRFLAALGRNVIVANTFGSCAL  676

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVP--SGTSETLG  2154
             ++VLV+GGFILSRD+VK+W IWGYWISP+MYAQNAI+VNE+LGKSW HVP  S  ++TLG
Sbjct  677   LIVLVMGGFILSRDNVKQWLIWGYWISPMMYAQNAIAVNEFLGKSWAHVPPNSTGTDTLG  736

Query  2155  VTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERN  2334
             V+ L+SRGIFPEA WYWIGVGAL+GYV L NFLF +AL YLNP GKPQA+LSEET+AERN
Sbjct  737   VSFLKSRGIFPEARWYWIGVGALLGYVLLFNFLFTVALAYLNPFGKPQAVLSEETVAERN  796

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             A KRGE IEL   G S+SE+GN VRRS SSRS+SSRVG++   D N ++GM+LPFEPL I
Sbjct  797   ASKRGEVIELSPIGKSSSERGNDVRRSASSRSMSSRVGNIAEGDLNKRKGMILPFEPLSI  856

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFD+I+YAVDMP EMKAQG TEDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  857   TFDDIRYAVDMPQEMKAQGFTEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  916

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYIEG+I+ISGYPK+Q TFARIAGYCEQTDIHSPHVTVYESL YSAWLRLP E+DT
Sbjct  917   RKTGGYIEGTISISGYPKQQATFARIAGYCEQTDIHSPHVTVYESLQYSAWLRLPREVDT  976

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
              TR+ F+EEVM+LVEL  LREALVGLPGVNGLSTEQRKRLT+AVELVANPSIIFMDEPTS
Sbjct  977   ETRKRFIEEVMELVELKPLREALVGLPGVNGLSTEQRKRLTVAVELVANPSIIFMDEPTS  1036

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEI+VGPLGRH
Sbjct  1037  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIFVGPLGRH  1096

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SS LI+YFE I+G+ +I+DGYNPATWML+ITS AQEAALGIDF E+YRNSELYRRNKALI
Sbjct  1097  SSHLIKYFEGIDGVLKIKDGYNPATWMLDITSVAQEAALGIDFTELYRNSELYRRNKALI  1156

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             QELS PAPGSKDLYF TKYSQSFFTQ MAC WKQHWSYWRNPPYTAVRL+FT F AL+FG
Sbjct  1157  QELSVPAPGSKDLYFETKYSQSFFTQSMACFWKQHWSYWRNPPYTAVRLMFTFFIALMFG  1216

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G KRR QQD+ NA+G MYAAV+FLGVQNATSVQPVVAIERTVFYRERAAGMYSA
Sbjct  1217  TIFWDLGSKRRRQQDILNAIGSMYAAVLFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  1276

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAFGQ++IELP++F+QT+IYGVIVYAMIGFEWT AKF+W++FFMYFTLLYFTLYGMMT
Sbjct  1277  LPYAFGQIMIELPYIFIQTIIYGVIVYAMIGFEWTVAKFIWYLFFMYFTLLYFTLYGMMT  1336

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNH+IAAIISSAFY  WNLFSGFI+PKTR+PVWWRWY+YICP+SWTLYGL+ASQFG
Sbjct  1337  VAVTPNHSIAAIISSAFYAVWNLFSGFIVPKTRMPVWWRWYFYICPISWTLYGLVASQFG  1396

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+++KL+T ETV++F++SFFDF +DFVGYVA I+VGI V F FIFA+SIKAFNFQ R
Sbjct  1397  DLQDKLETKETVEEFIESFFDFKYDFVGYVALILVGISVGFLFIFAYSIKAFNFQKR  1453



>gb|AFA43816.1| ABCG/PDR subfamily ABC protein [Petunia x hybrida]
Length=1452

 Score =  2323 bits (6020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1169/1437 (81%), Positives = 1312/1437 (91%), Gaps = 6/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR+S ++VFSRSSREA +++   LKWAA+EKLPTYLRIRRGIL  EE  G  +E+D+ K
Sbjct  20    VWRNSAMDVFSRSSREADDEEA--LKWAALEKLPTYLRIRRGILTEEE--GQSREVDITK  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L + E+R+LLERL++I  EDNE FLLKLK R DRVG+DLPTIEVRFEHL+VDAEA VGSR
Sbjct  76    LDLVERRNLLERLIKITDEDNEKFLLKLKERIDRVGLDLPTIEVRFEHLSVDAEARVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FNFT NILE F+NYLHILPNRK+PLPILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  136   ALPTVFNFTVNILEDFLNYLHILPNRKQPLPILHDVSGIIKPGRMTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD DLKVSGRVTYNGH+M EFV +R+SAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  196   LALAGKLDKDLKVSGRVTYNGHDMNEFVAQRSSAYISQYDLHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG +YE+LAELSRREKE NIKPDPD+D++MKA   EGQEA+VVTDY LKILGLE+CAD +
Sbjct  256   VGAKYEILAELSRREKEANIKPDPDVDIFMKAAWNEGQEANVVTDYTLKILGLEICADTI  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKRLTTGEM+VGPARALFMDEISTGLDSSTT+QIVNSIRQSIHILQG
Sbjct  316   VGDEMVRGISGGQRKRLTTGEMMVGPARALFMDEISTGLDSSTTYQIVNSIRQSIHILQG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF++MGF CPERKGVADFLQE
Sbjct  376   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEYMGFICPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW RREE+Y+FITV EFSEAFQ+FH+G+KLGDELAVPFDKSKSHPAAL+ K
Sbjct  436   VTSRKDQEQYWARREESYKFITVREFSEAFQAFHIGRKLGDELAVPFDKSKSHPAALTTK  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             +YGV+KKELLKAC +RE+LLMKRNSFVYIFKMIQL LMA + MT+FL TEM +N+  DG 
Sbjct  496   RYGVSKKELLKACTAREYLLMKRNSFVYIFKMIQLTLMASITMTLFLPTEMHRNTTIDGA  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             VF+GALF+A+IM MFNGFSELALSI+KLP+FYK RDL FFPPWAYALPTWILKIP+TLVE
Sbjct  556   VFLGALFYALIMIMFNGFSELALSIMKLPSFYKHRDLLFFPPWAYALPTWILKIPITLVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWVCMTYY IGF+ D GRFFKQL LLICVNQMAS LFRL  A GR++IVANTFGS  +
Sbjct  616   VAIWVCMTYYVIGFEADVGRFFKQLLLLICVNQMASGLFRLMGALGRNIIVANTFGSFVL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVP--SGTSETLG  2154
             + VLV+GGF+LSRDDVKKWWIWGYWISP+MYAQNAI+VNE+LGKSW HVP  S ++ETLG
Sbjct  676   LTVLVMGGFVLSRDDVKKWWIWGYWISPMMYAQNAIAVNEFLGKSWAHVPPNSTSTETLG  735

Query  2155  VTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERN  2334
             V+ L+SRGIFP+A WYWIG GAL+GYVFL NFLF +AL YLNP GKPQA+LSEET+AERN
Sbjct  736   VSFLKSRGIFPDARWYWIGAGALIGYVFLFNFLFAVALAYLNPFGKPQAVLSEETVAERN  795

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             A KRGE IEL   G S+SEKGN VRRS SSRS+SSRVGS+  AD + +RGM+LPFEPL I
Sbjct  796   ASKRGEVIELSSLGKSSSEKGNDVRRSASSRSMSSRVGSITAADLSKRRGMILPFEPLSI  855

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFD+I+YAVDMP EMKAQG TEDRL LL+G++GAFRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  856   TFDDIRYAVDMPQEMKAQGFTEDRLELLRGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  915

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYI+G+I+ISGYPK+QETFARIAGYCEQTDIHSPHVTVYESL +SAWLRLP E+DT
Sbjct  916   RKTGGYIDGTISISGYPKQQETFARIAGYCEQTDIHSPHVTVYESLQFSAWLRLPREVDT  975

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
             ATR+MF+EEVM+L+EL  LR+ALVGLPGVNGLSTEQRKRLT+AVELVANPSIIFMDEPTS
Sbjct  976   ATRKMFIEEVMELIELIPLRDALVGLPGVNGLSTEQRKRLTVAVELVANPSIIFMDEPTS  1035

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGR 
Sbjct  1036  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRQ  1095

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SS LI+YFE I+G+ +I+DGYNPATWMLEITS AQE ALG DF E+Y+NSELYRRNKALI
Sbjct  1096  SSHLIKYFEGIDGVPKIKDGYNPATWMLEITSVAQEGALGNDFTELYKNSELYRRNKALI  1155

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             +ELS PA  SKDLYFPTKYSQSFFTQCMAC WKQHWSYWRNPPYTAVR++FT F AL+FG
Sbjct  1156  KELSVPASCSKDLYFPTKYSQSFFTQCMACFWKQHWSYWRNPPYTAVRIMFTFFIALMFG  1215

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G +R  QQDL NA+G MY AV+FLGVQNAT+VQPV+AIERTVFYRERAAGMYSA
Sbjct  1216  TIFWDLGSRRERQQDLLNAIGSMYIAVLFLGVQNATTVQPVIAIERTVFYRERAAGMYSA  1275

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             +PYAFGQV+IELP+LF+QT+IYGVIVYAMIGFEWT AKF W++FFMYFTLLYFTLYGMMT
Sbjct  1276  MPYAFGQVMIELPYLFLQTIIYGVIVYAMIGFEWTVAKFFWYLFFMYFTLLYFTLYGMMT  1335

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPN +IAAIISSAFY  WNLF GFI+PKTR+PVWWRWYYYICP+SWTLYGLIASQFG
Sbjct  1336  VAVTPNQSIAAIISSAFYAVWNLFCGFIVPKTRMPVWWRWYYYICPISWTLYGLIASQFG  1395

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D++++LDTNETV+ F+++FFDF HDFVGYVA I+VGI V+F FIFAFSIK FNFQ R
Sbjct  1396  DIQDRLDTNETVEQFIENFFDFKHDFVGYVALILVGISVLFLFIFAFSIKTFNFQKR  1452



>ref|XP_011081908.1| PREDICTED: pleiotropic drug resistance protein 1-like [Sesamum 
indicum]
Length=1451

 Score =  2323 bits (6019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1161/1436 (81%), Positives = 1310/1436 (91%), Gaps = 5/1436 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++G+E FSRSSREA +++   LKWAA+EKLPT LRIRRGI   EE  G  +EID++ 
Sbjct  20    IWRNTGMEAFSRSSREADDEEA--LKWAALEKLPTNLRIRRGIFTEEE--GKTREIDIKN  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+++L+ERL+RIA+E NE FLLKLK R  RVG+D PTIEVR+EHLNVDAEAYVGSR
Sbjct  76    LGLVERKNLVERLLRIAEEGNEKFLLKLKERIQRVGLDFPTIEVRYEHLNVDAEAYVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FNFT NILE F++YLH+LP+RKKPLPILHDVSGIIKP RMTLLLGPP SGKTTLL
Sbjct  136   ALPTVFNFTVNILEGFLSYLHVLPSRKKPLPILHDVSGIIKPGRMTLLLGPPCSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD +LKVSGRVTYNGHEM EFVP+RTSAYI+Q+DLHIGE+TVRETLAFSARCQG
Sbjct  196   LALAGKLDPELKVSGRVTYNGHEMEEFVPQRTSAYISQNDLHIGELTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEMLAELSRREKE NIKPDPD+D++MKA SIEGQ+ASVVTDYI+KILGLEVCAD L
Sbjct  256   VGARYEMLAELSRREKEANIKPDPDLDIFMKAASIEGQDASVVTDYIIKILGLEVCADTL  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG
Sbjct  316   VGDEMVRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY LFDDIILLSDG++VYQGPR++VLEFF+ MGF+CPERKGVADFLQE
Sbjct  376   TAVISLLQPAPETYNLFDDIILLSDGEIVYQGPREHVLEFFEFMGFRCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQY + ++E Y +++  EFSEAFQSFHVG+KLGDELAVPFDK KSH  AL+  
Sbjct  436   VTSKKDQEQYRIHKDEPYSYVSSKEFSEAFQSFHVGRKLGDELAVPFDKEKSHRDALTTV  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC +REFLLMKRNSFVYIFK+IQL+LM  ++MTVFLRTEMPKN++ DG 
Sbjct  496   KYGVSKKELLKACVAREFLLMKRNSFVYIFKLIQLILMGSISMTVFLRTEMPKNTVTDGG  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALF+A+IM MFNGFSELALSILKLP FYKQRDL FFPPWAY+LP WILKIP+TLVE
Sbjct  556   IYMGALFYALIMIMFNGFSELALSILKLPVFYKQRDLLFFPPWAYSLPAWILKIPITLVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWV +TYY  G+D DAGRFFKQL LLI +NQMA  LFRL  A GR++IVANTFGSCA+
Sbjct  616   VAIWVGLTYYPTGYDSDAGRFFKQLLLLIVINQMAGGLFRLVGALGRNIIVANTFGSCAL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGFILSRD++K WWIWGYW SPLMY QNAI+VNE+LGKSW H+P G +E +GV+
Sbjct  676   LTVLVLGGFILSRDNIKSWWIWGYWFSPLMYGQNAIAVNEFLGKSWSHIPPGATEPVGVS  735

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L++RGIFPEA WYWIG+GA++GY FL NFL  LALTYLNPLGKPQA+LSEETLAER A 
Sbjct  736   ILKARGIFPEARWYWIGLGAIIGYAFLFNFLVTLALTYLNPLGKPQAILSEETLAERTAS  795

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             KR EPIEL  +G  TS + + V+RSVS+RS+SSRVGS++ ADP+ KRGM+LPFEPL +TF
Sbjct  796   KRIEPIELSSRGKRTSGREDDVQRSVSARSMSSRVGSISNADPSRKRGMILPFEPLSMTF  855

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+I YAVDMP EMKA G+ E+RL LLKG++GAFRPGVLTALMGISGAGKTTLMDVL+GRK
Sbjct  856   DDIHYAVDMPQEMKAHGIQEERLELLKGVSGAFRPGVLTALMGISGAGKTTLMDVLSGRK  915

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+G ITISGYPK+QETFARIAGYCEQTDIHSPHVTVYESL +SAWLRLPPE+D AT
Sbjct  916   TGGYIDGRITISGYPKKQETFARIAGYCEQTDIHSPHVTVYESLQFSAWLRLPPEVDAAT  975

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R MF+EEVM+LVELT LR+ALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  976   RTMFIEEVMELVELTPLRDALVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1035

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS
Sbjct  1036  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  1095

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI++FE I+GI +I+DGYNPATWMLE+TSEAQEAALG++FAEVYRNSELYRRNKALI+E
Sbjct  1096  QLIKFFEGIDGISKIKDGYNPATWMLEVTSEAQEAALGVNFAEVYRNSELYRRNKALIKE  1155

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS PAPGSKDLYF T YSQSF+TQCMACLWKQHWSYWRNPPYTAVRLLFTTF A++FGT+
Sbjct  1156  LSTPAPGSKDLYFQTHYSQSFWTQCMACLWKQHWSYWRNPPYTAVRLLFTTFIAIMFGTI  1215

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR+ QQD+FNAMG MYAAV+FLGVQNATSVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1216  FWDLGSKRKKQQDIFNAMGSMYAAVLFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  1275

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQ V+ELP+L +QTL+YGVIVYAMIGFEWT AKFLW++FFMYFTLLYFTLYGMMTVA
Sbjct  1276  YAFGQAVVELPNLLIQTLVYGVIVYAMIGFEWTVAKFLWYLFFMYFTLLYFTLYGMMTVA  1335

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNIAAI+SSAFY  WNLFSGFIIPKTRIPVWWRWYYY+CP+SWTLYGL+ASQFGD+
Sbjct  1336  VTPNHNIAAIVSSAFYALWNLFSGFIIPKTRIPVWWRWYYYVCPISWTLYGLVASQFGDI  1395

Query  4141  KEKLDTN-ETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K +LD N +TV++FV+++F F HDFVGYVA II GI V+F FIFAFSI+ FNFQ R
Sbjct  1396  KAQLDDNDQTVEEFVRNYFGFRHDFVGYVAVIIAGIAVLFAFIFAFSIRVFNFQKR  1451



>ref|XP_009589545.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nicotiana 
tomentosiformis]
Length=1452

 Score =  2316 bits (6002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1175/1437 (82%), Positives = 1308/1437 (91%), Gaps = 6/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR+S ++VFSRSSREA +++   LKWAA+EKLPTYLRIRRGIL  EE  G  +E+D+ K
Sbjct  20    VWRNSAMDVFSRSSREADDEEA--LKWAALEKLPTYLRIRRGILTEEE--GQSREVDITK  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L + E+R+LLERLV+IA EDNE FLLKLK R  RVG+DLPTIEVRFEH++VDAEA VGSR
Sbjct  76    LDLVERRNLLERLVKIADEDNEKFLLKLKKRIARVGLDLPTIEVRFEHVSVDAEARVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNFT NILE F+NYLHILP+RKKPLPILH+VSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  136   ALPTIFNFTVNILEDFLNYLHILPSRKKPLPILHEVSGIIKPGRMTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD DLKVSGRVTYNGH M EFVP+R+SAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  196   LALAGKLDKDLKVSGRVTYNGHGMDEFVPQRSSAYISQNDLHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG +YE+LAELSRREK  NIKPDPD+D++MK+   EGQEA+VVTDY LKILGLE+CAD L
Sbjct  256   VGAKYEILAELSRREKGANIKPDPDVDIFMKSAWNEGQEANVVTDYTLKILGLEICADTL  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKRLTTGEM+VGPARALFMDEISTGLDSSTT+QIVNSIRQSIHILQG
Sbjct  316   VGDEMIRGISGGQRKRLTTGEMMVGPARALFMDEISTGLDSSTTYQIVNSIRQSIHILQG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF++MGF CPERKGVADFLQE
Sbjct  376   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEYMGFMCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW RR+E Y++ITV EFSE+FQSFH+G+KLGDELAVPFDKSKSHPAAL+ K
Sbjct  436   VTSRKDQEQYWARRDEPYKYITVREFSESFQSFHIGRKLGDELAVPFDKSKSHPAALTTK  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
              YG++KKELLKAC +RE+LLMKRNSFVYIFKMIQL LMA + MT+FLRTEM +N+  DG 
Sbjct  496   NYGISKKELLKACTAREYLLMKRNSFVYIFKMIQLTLMASITMTLFLRTEMHRNTTTDGA  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             VF+GALF+AVIM MFNGFSELALSI+KLP+FYKQRDL FFP WAYALPTWILKIPVTLVE
Sbjct  556   VFLGALFYAVIMIMFNGFSELALSIMKLPSFYKQRDLLFFPAWAYALPTWILKIPVTLVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWVCMTYY IGF+ D GRFFKQLFLLICVNQMAS LFR   A GR+VIVANTFGSCA+
Sbjct  616   VAIWVCMTYYVIGFEADVGRFFKQLFLLICVNQMASGLFRFIGALGRNVIVANTFGSCAL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVP--SGTSETLG  2154
             + VLV+GGFILSRDDVKKWWIWGYWISP+MYAQNAI+VNE+LGKSW HVP  S  +ETLG
Sbjct  676   LTVLVMGGFILSRDDVKKWWIWGYWISPMMYAQNAIAVNEFLGKSWAHVPPNSTGTETLG  735

Query  2155  VTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERN  2334
             V+ L+SRGIFPEA WYWIG GAL+GYV L NF+F +AL YLNP GK QA+LSEET+AERN
Sbjct  736   VSFLKSRGIFPEARWYWIGAGALLGYVLLFNFMFTVALAYLNPFGKSQAVLSEETVAERN  795

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             A KRGE IEL      +SE+GN VRRS SSRS+SSRVGS+  AD N +RGM+LPFEPL I
Sbjct  796   ASKRGEVIELSPIEKRSSERGNDVRRSASSRSMSSRVGSITEADLNKRRGMILPFEPLSI  855

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFD+I+YAVDMP EMKAQG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  856   TFDDIRYAVDMPQEMKAQGVAEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  915

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYI+G+I+ISGYPK+QETFARIAGYCEQTDIHSPHVTVYESL +SA LRLP E+DT
Sbjct  916   RKTGGYIDGTISISGYPKQQETFARIAGYCEQTDIHSPHVTVYESLQFSALLRLPREVDT  975

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
              TR+MFVEEVM+LVELT LREALVGLPGVNGLSTEQRKRLT+AVELVANPSIIFMDEPTS
Sbjct  976   ETRKMFVEEVMELVELTPLREALVGLPGVNGLSTEQRKRLTVAVELVANPSIIFMDEPTS  1035

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH
Sbjct  1036  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  1095

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SS LI+YFE I+G+ +I+DGYNPATWMLEITS AQEAA  IDF E+Y+NSELYRRNKALI
Sbjct  1096  SSHLIKYFEGIDGVPKIKDGYNPATWMLEITSVAQEAARVIDFTELYKNSELYRRNKALI  1155

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             +ELS PAP SKDLYFPTKYSQSFFTQC AC WKQHWSYWRNPPYTAVRL+FT F AL+FG
Sbjct  1156  KELSVPAPCSKDLYFPTKYSQSFFTQCKACFWKQHWSYWRNPPYTAVRLMFTFFIALMFG  1215

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G +R+ QQDL NA+G MYAAV+FLGVQNATSVQPV+AIERTVFYRERAAGMYSA
Sbjct  1216  TIFWDLGSRRKRQQDLLNAIGSMYAAVLFLGVQNATSVQPVIAIERTVFYRERAAGMYSA  1275

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAFGQV+IELP+LF+QT+IYGVIVY MIGFEWT AKF W++FFMYFTLLYFTLYGMMT
Sbjct  1276  LPYAFGQVMIELPYLFIQTIIYGVIVYVMIGFEWTVAKFFWYLFFMYFTLLYFTLYGMMT  1335

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNH+IAAIISSAFY  WNLF GF++PKTR+PVWWRWYYYICPVSWTLYGLIASQFG
Sbjct  1336  VAVTPNHSIAAIISSAFYAIWNLFCGFVVPKTRMPVWWRWYYYICPVSWTLYGLIASQFG  1395

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+++ LDTNETV+ F+++FFD  +DFVGYVA I+VGI V+F FIFA+SIKAFNFQ R
Sbjct  1396  DLQDILDTNETVEQFIENFFDIKYDFVGYVAVILVGISVVFLFIFAYSIKAFNFQKR  1452



>gb|EYU21929.1| hypothetical protein MIMGU_mgv1a023987mg [Erythranthe guttata]
Length=1434

 Score =  2303 bits (5968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1140/1435 (79%), Positives = 1294/1435 (90%), Gaps = 19/1435 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++G+E FSRS ++A +D+E  LKWAA+EKLPTYLRIRRG+L  +E  G  +E+D++ 
Sbjct  19    IWRNTGMESFSRSEKDAEDDEEA-LKWAALEKLPTYLRIRRGMLVEDE--GKTREVDIKN  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG++E+R+L+ERL++IA+E NE FLLKLK R  RVG+D PTIEVRFE+LNVDA+AY G R
Sbjct  76    LGLSERRNLVERLLKIAEEGNEKFLLKLKERIQRVGLDFPTIEVRFENLNVDADAYAGGR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNFT NILE F++YL ILPNRKKPLPILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  136   ALPTIFNFTVNILEGFLSYLRILPNRKKPLPILHDVSGIIKPGRMTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD +LK+SGRVTYNGHEM EFVP+RTSAYI+QHDLHIGE+TVRETLAFSARCQG
Sbjct  196   LALAGKLDPELKISGRVTYNGHEMNEFVPQRTSAYISQHDLHIGELTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML ELSRREKE NIKPDPD+D+YMKA SI GQEASVVTDYI+KILGLEVCAD L
Sbjct  256   VGARYEMLTELSRREKEANIKPDPDLDIYMKASSIGGQEASVVTDYIIKILGLEVCADTL  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM RGISGGQRKRLTTGEM+VGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG
Sbjct  316   VGDEMFRGISGGQRKRLTTGEMMVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             T +ISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF+HMGF+CPERKGVADFLQE
Sbjct  376   TTIISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEHMGFRCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQY ++++E YE+++V EFSEAF+SF +G++LGDELAVPFDK KSHP AL+  
Sbjct  436   VTSKKDQEQYRIQKDETYEYVSVQEFSEAFRSFRIGQELGDELAVPFDKEKSHPTALTTD  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC +RE+LLMKRNSFVYIFKM+QL+++A +++T+FLRTEMPKN++ DG 
Sbjct  496   KYGVSKKELLKACVAREYLLMKRNSFVYIFKMLQLIIVASISLTLFLRTEMPKNNVTDGG  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +++GALFFA+IM MFNGFSELALSI+KLP F+KQRDL FFPPWAY LP+WILKIP+TLVE
Sbjct  556   IYLGALFFALIMIMFNGFSELALSIMKLPVFFKQRDLLFFPPWAYTLPSWILKIPITLVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWV MTYYA G+D DAGRFF+QL LLICVNQMASALFRL  A GR++IVANTFGSCA+
Sbjct  616   VAIWVGMTYYATGYDSDAGRFFRQLLLLICVNQMASALFRLMGALGRNLIVANTFGSCAL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + V VLGGFILSRDD+KKWWIWG+W SPLMY QNAI+VNE+LGKSW HVP+G++E++G+T
Sbjct  676   LTVFVLGGFILSRDDIKKWWIWGFWTSPLMYGQNAIAVNEFLGKSWSHVPAGSTESVGLT  735

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL++RG+F EA WYWIGVGA++GYVFL NFL  +ALTYLNP GKPQA+L EE +AERNA 
Sbjct  736   VLKARGLFSEARWYWIGVGAIIGYVFLFNFLVTVALTYLNPFGKPQAILPEEAVAERNA-  794

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
              RG+ +      GS S +   V  +               ADPN KRGM+LPFEPL ITF
Sbjct  795   GRGDDVRRSSSSGSMSSRVGTVIGN---------------ADPNRKRGMILPFEPLSITF  839

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
              +I+YAVDMP EMKAQG+ E+RL LLKG++GAFRPGVLTALMGISGAGKTTLMDVLAGRK
Sbjct  840   CDIRYAVDMPQEMKAQGIQENRLELLKGVSGAFRPGVLTALMGISGAGKTTLMDVLAGRK  899

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI G+ITISGYPK+QETFARIAGYCEQTDIHSPHVTV+ESL +SAW+RLPPE+DTAT
Sbjct  900   TGGYINGTITISGYPKKQETFARIAGYCEQTDIHSPHVTVHESLQFSAWMRLPPEVDTAT  959

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELT LREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  960   RKMFIEEVMELVELTPLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1019

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS
Sbjct  1020  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  1079

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI+YFE I+GI +I+DGYNPATWML+ITS AQEAALG+DFAE+Y+NSEL R+NKALI+E
Sbjct  1080  QLIKYFEEIDGISKIKDGYNPATWMLDITSTAQEAALGVDFAELYKNSELCRKNKALIEE  1139

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             L+ P PGSKDLYF  +YSQSF TQCMACLWKQHWSYWRNPPYTAVRLLFTTF ALLFGT+
Sbjct  1140  LTVPIPGSKDLYFSKRYSQSFSTQCMACLWKQHWSYWRNPPYTAVRLLFTTFIALLFGTI  1199

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FWGIG KR  QQD+FNAMG MY AV+FLG+QNATSVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1200  FWGIGSKRERQQDVFNAMGSMYVAVLFLGIQNATSVQPVVAIERTVFYRERAAGMYSALP  1259

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQ VIELP+L +QTLIYGVIVYAMIGFEWT  KF W+IFFMYFTL+YFT YGMMTVA
Sbjct  1260  YAFGQAVIELPYLLIQTLIYGVIVYAMIGFEWTVVKFFWYIFFMYFTLMYFTFYGMMTVA  1319

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNIAAI+SSAFYG WNLFSGFIIPKTRIPVWWRWYYY CP++WTLYGL+ASQFGDV
Sbjct  1320  VTPNHNIAAIVSSAFYGLWNLFSGFIIPKTRIPVWWRWYYYACPIAWTLYGLVASQFGDV  1379

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +++LDT+ETV +FV S+F F HDFVGYVA II G+ V+FGFIFAFSI+AFNFQ R
Sbjct  1380  QDRLDTDETVAEFVHSYFGFQHDFVGYVAIIITGLAVLFGFIFAFSIRAFNFQKR  1434



>ref|XP_006366077.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum 
tuberosum]
Length=1455

 Score =  2293 bits (5942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1150/1437 (80%), Positives = 1302/1437 (91%), Gaps = 3/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR+S ++VFSRSS     DDEEAL+WAA+EKLPTY RIRRG+L  EEEG   +E+D+ K
Sbjct  20    VWRNSAMDVFSRSSSREDYDDEEALRWAALEKLPTYRRIRRGLLLEEEEGQS-REVDITK  78

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L + E+R+LL+RLV+IA EDNE  L+KLK R DRVG+DLPTIEVRFEHLN+DAEA VGSR
Sbjct  79    LDLIERRNLLDRLVKIADEDNEKLLMKLKQRIDRVGLDLPTIEVRFEHLNIDAEARVGSR  138

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNFT NILE F+NYLHILP+RKKPLPILH V GIIKP RMTLLLGPPSSGKTTLL
Sbjct  139   ALPTIFNFTVNILEDFLNYLHILPSRKKPLPILHGVGGIIKPGRMTLLLGPPSSGKTTLL  198

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD+DLKVSGRVTYNGH M EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  199   LALAGKLDNDLKVSGRVTYNGHGMDEFVPQRTSAYISQNDLHIGEMTVRETLAFSARCQG  258

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG +YE+LAELSRREKE NIKPDPDID++MK+   EGQEA+V+TDY LKILGLE+CAD L
Sbjct  259   VGTKYEILAELSRREKEANIKPDPDIDIFMKSAWNEGQEANVITDYTLKILGLEICADTL  318

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKRLTTGEM+VGPARALFMDEISTGLDSSTT+QIVNSIRQSIHILQG
Sbjct  319   VGDEMIRGISGGQRKRLTTGEMMVGPARALFMDEISTGLDSSTTYQIVNSIRQSIHILQG  378

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF+++GFKCP+RKGVADFLQE
Sbjct  379   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEYLGFKCPQRKGVADFLQE  438

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW RR+E Y FIT  EFS+ FQSF VG+KLGDELAVPFDKSKSHPAAL+ K
Sbjct  439   VTSRKDQEQYWSRRDEPYRFITACEFSDVFQSFDVGRKLGDELAVPFDKSKSHPAALTTK  498

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             +YG++KKELLKAC +RE+LLMKRNSFVYIFKM+QL LMA +AMT+FLRTEM +++  DG 
Sbjct  499   RYGISKKELLKACTAREYLLMKRNSFVYIFKMVQLTLMASIAMTLFLRTEMHRDTTIDGA  558

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +++GALF+AVI  MFNGFSELALSI+KLP+FYKQRD  FFP WAYALPTWILKIP+TLVE
Sbjct  559   IYLGALFYAVITIMFNGFSELALSIMKLPSFYKQRDFLFFPAWAYALPTWILKIPITLVE  618

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             +AIWVCMTYY IGF+ D GRFFKQ+FLLIC++QMAS LFR  AA GR++IVANTFGSCA+
Sbjct  619   IAIWVCMTYYVIGFEADVGRFFKQIFLLICLSQMASGLFRFLAALGRNIIVANTFGSCAL  678

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVP--SGTSETLG  2154
             ++VLV+GGFILSRDDVK+W IWGYWISP+MYAQNAI+VNE+LGKSW HVP  S  ++TLG
Sbjct  679   LIVLVMGGFILSRDDVKQWLIWGYWISPMMYAQNAIAVNEFLGKSWAHVPPNSTGTDTLG  738

Query  2155  VTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERN  2334
             V+ L+SRGIFPEA WYWIG GAL GYV L NFLF +AL YLNP  KPQA+LSEE +AERN
Sbjct  739   VSFLKSRGIFPEARWYWIGAGALFGYVLLFNFLFTVALAYLNPFSKPQAILSEEIVAERN  798

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             A KRGE IEL   G S+SE+GN V  S SSRSLS+RVG++   D N ++GM+LPFEPL I
Sbjct  799   ASKRGEVIELSPIGKSSSERGNDVPVSTSSRSLSTRVGNITEGDLNKRKGMILPFEPLSI  858

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFD+I+YAVDMP EMK QG  EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  859   TFDDIRYAVDMPQEMKTQGFIEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  918

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGY+EG+I+ISGYPK+QETFARI+GYCEQTDIHSPHVTVYESL+YSAWLRLP E+DT
Sbjct  919   RKTGGYVEGTISISGYPKQQETFARISGYCEQTDIHSPHVTVYESLLYSAWLRLPREVDT  978

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
              TR+ F+EEVM+LVELT LREALVGLPGVNGLSTEQRKRLT+AVELVANPSIIFMDEPTS
Sbjct  979   ETRKSFIEEVMELVELTPLREALVGLPGVNGLSTEQRKRLTVAVELVANPSIIFMDEPTS  1038

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEI+VGPLGRH
Sbjct  1039  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIFVGPLGRH  1098

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SS LI+YFE I+G+ +IRDGYNPATWMLE+TS AQEA LGIDF E+Y+NSELYRRNKALI
Sbjct  1099  SSHLIKYFEGIDGVLKIRDGYNPATWMLEVTSLAQEAVLGIDFTELYKNSELYRRNKALI  1158

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             QELS PA GSKDLYF TKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRL+FT F +L+ G
Sbjct  1159  QELSVPASGSKDLYFETKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLMFTFFVSLMLG  1218

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FWG+G KR  QQD+ NA+G MYAA++FLG+ NA+SVQPVVAIERTVFYRERAAGMYSA
Sbjct  1219  TIFWGLGSKRGKQQDILNAIGSMYAAILFLGIINASSVQPVVAIERTVFYRERAAGMYSA  1278

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAFGQV+IELPHLF+QT+IYGVIVYAMIGFEWT  KF W++FFMYFTLLYFTLYGMMT
Sbjct  1279  LPYAFGQVMIELPHLFLQTIIYGVIVYAMIGFEWTVTKFFWYLFFMYFTLLYFTLYGMMT  1338

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNH IA+I+SSAFY  WNLF GF++PKTR+PVWWRWYYYICP+SWTLYGLIASQFG
Sbjct  1339  VAVTPNHTIASIVSSAFYTIWNLFCGFVVPKTRMPVWWRWYYYICPLSWTLYGLIASQFG  1398

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D++++LDT ETV++F+++FFD+ HDFVGYVA I+VGI V+F FIFA+SIK+FNFQ R
Sbjct  1399  DLQDRLDTKETVEEFLENFFDYKHDFVGYVAVILVGISVVFLFIFAYSIKSFNFQKR  1455



>ref|XP_004245224.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum 
lycopersicum]
Length=1454

 Score =  2291 bits (5937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1152/1437 (80%), Positives = 1298/1437 (90%), Gaps = 4/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR+S ++VFSRSS     DDEEAL+WAA+EKLPTY RIRRG+L  EE  G  +E+D+ K
Sbjct  20    VWRNSAMDVFSRSSSREDYDDEEALRWAALEKLPTYSRIRRGLLLEEE--GQSREVDITK  77

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L + E+R+LL+RLV+IA EDNE  L+KLK R DRVG+DLPTIEVRFEHLNVDAEA VGSR
Sbjct  78    LDLIERRNLLDRLVKIADEDNEKLLMKLKQRIDRVGLDLPTIEVRFEHLNVDAEARVGSR  137

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNFT NILE F+NY+HILP+RKKPLPILH VSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  138   ALPTIFNFTVNILEDFLNYIHILPSRKKPLPILHGVSGIIKPGRMTLLLGPPSSGKTTLL  197

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             L LAGKLD DLKVSGRVTYNGH M EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  198   LGLAGKLDKDLKVSGRVTYNGHGMDEFVPQRTSAYISQNDLHIGEMTVRETLAFSARCQG  257

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG +YE+LAELSRREKE NIKPDPD+D++MK+   EGQEA+V+TDY LKILGLE+CAD L
Sbjct  258   VGDKYEILAELSRREKEANIKPDPDVDIFMKSAWNEGQEANVITDYTLKILGLEICADTL  317

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKRLTTGEM+VGPARALFMDEISTGLDSSTT+QIVNSIRQSIHILQG
Sbjct  318   VGDEMIRGISGGQRKRLTTGEMMVGPARALFMDEISTGLDSSTTYQIVNSIRQSIHILQG  377

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDG++VYQGPR+NVLEFF++MGFKCPERKGVADFLQE
Sbjct  378   TAVISLLQPAPETYDLFDDIILLSDGKIVYQGPRENVLEFFEYMGFKCPERKGVADFLQE  437

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW RR+E Y FIT  EFS+ FQSFHVG+KLG+ELAVPFDKSKSHPAAL+ K
Sbjct  438   VTSRKDQEQYWSRRDEPYRFITSCEFSDVFQSFHVGRKLGEELAVPFDKSKSHPAALTTK  497

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             +YG++KKELLKACA+RE+LLMKRNSFVYIFKM+QL +MA +AMT+FLRTEM +++  DG 
Sbjct  498   RYGISKKELLKACAAREYLLMKRNSFVYIFKMVQLTMMASIAMTLFLRTEMHRDTTIDGA  557

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             V++GALF+AVI  MFNGFSELALSI+KLP+FYKQRDL FFP WAYALPTWILKIP+TLVE
Sbjct  558   VYLGALFYAVITVMFNGFSELALSIMKLPSFYKQRDLLFFPAWAYALPTWILKIPITLVE  617

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             +AIWVCMTYY IGF+ D GRFFKQLFLLIC+NQMAS LFR  AA GR++IVANTFGSCA+
Sbjct  618   IAIWVCMTYYVIGFEADVGRFFKQLFLLICLNQMASGLFRFLAALGRNIIVANTFGSCAL  677

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVP--SGTSETLG  2154
             ++VLV+GGFILSRDDVK+W IWGYW SP+MYAQNAI+VNE+LGKSW HVP  S  ++TLG
Sbjct  678   LVVLVMGGFILSRDDVKQWLIWGYWTSPMMYAQNAIAVNEFLGKSWSHVPPNSTGTDTLG  737

Query  2155  VTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERN  2334
             V+ L+SRGIFPEA WYWIG GAL+GYV L NFLF +AL YLNP GKPQA++SEE + ER 
Sbjct  738   VSFLKSRGIFPEARWYWIGAGALIGYVLLFNFLFTVALAYLNPFGKPQAIISEEIVVERI  797

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             A KRGE IEL   G S+SE+GN V  S SSRSLSSRVG++   D + +RGM+LPFEPL I
Sbjct  798   ASKRGEVIELSPIGKSSSERGNDVAISASSRSLSSRVGNITEGDLSKRRGMILPFEPLSI  857

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFD+I+YAVDMP EMKAQG  EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  858   TFDDIRYAVDMPQEMKAQGFIEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  917

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYI G+I+ISGYPK+QETFARI+GYCEQTDIHSPHVTVYESL YSAWLRLP E+DT
Sbjct  918   RKTGGYINGTISISGYPKQQETFARISGYCEQTDIHSPHVTVYESLQYSAWLRLPREVDT  977

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
              TR+ F+EEVM+LVEL  LREALVGLPGVNGLSTEQRKRLT+AVELVANPSIIFMDEPTS
Sbjct  978   ETRKNFIEEVMELVELIPLREALVGLPGVNGLSTEQRKRLTVAVELVANPSIIFMDEPTS  1037

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEI+VGPLGRH
Sbjct  1038  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIFVGPLGRH  1097

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SS LI+YFE I+G+ +IRDGYNPATWMLE+TS AQEA LGIDF E+Y+NSELYRRNKALI
Sbjct  1098  SSHLIKYFEGIDGVLKIRDGYNPATWMLEVTSLAQEAVLGIDFTELYKNSELYRRNKALI  1157

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             QELS  APGSKDLYF T+YSQSFFTQCMACLWKQH SYWRNPPYTAVRL+FT F +L+ G
Sbjct  1158  QELSVAAPGSKDLYFETEYSQSFFTQCMACLWKQHLSYWRNPPYTAVRLMFTFFVSLMLG  1217

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FWG+G KR  QQD+ NA+G MY+A++FLG+ NATSVQPVVAIERTVFYRERAAGMYSA
Sbjct  1218  TIFWGLGSKRGRQQDILNAIGSMYSAILFLGIINATSVQPVVAIERTVFYRERAAGMYSA  1277

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAFGQV+IELPHLF+QT+IYGVIVYAMIGFEWT AKF W++FFMYFTLLYFTLYGMMT
Sbjct  1278  LPYAFGQVMIELPHLFLQTIIYGVIVYAMIGFEWTVAKFFWYLFFMYFTLLYFTLYGMMT  1337

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNH IA+I+SSAFY  WNLF GF++PKTR+PVWWRWYYY+CP+SWTLYGLIASQFG
Sbjct  1338  VAVTPNHTIASIVSSAFYTIWNLFCGFVVPKTRMPVWWRWYYYVCPLSWTLYGLIASQFG  1397

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             DV++KLDT ETV+ F+++FFD+ HDFVGYVA I+VGI V F FIFA+SIKAFNFQ R
Sbjct  1398  DVQDKLDTKETVEQFLENFFDYKHDFVGYVAVILVGISVAFLFIFAYSIKAFNFQKR  1454



>ref|XP_010648604.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Vitis vinifera]
 emb|CBI20978.3| unnamed protein product [Vitis vinifera]
Length=1436

 Score =  2257 bits (5848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1115/1439 (77%), Positives = 1283/1439 (89%), Gaps = 25/1439 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG+EVFSRSSR+  +++   LKWAAIEKLPTYLRIRRGILA EE  G  +EID+  
Sbjct  19    IWRNSGMEVFSRSSRDEDDEEA--LKWAAIEKLPTYLRIRRGILAEEE--GKAREIDITS  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ EK++LLERLV+IA+EDNE FLLKLK R DRVG+D+PTIEVRFEH+ VDAEAY+G R
Sbjct  75    LGLIEKKNLLERLVKIAEEDNEKFLLKLKERIDRVGLDIPTIEVRFEHITVDAEAYIGGR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTI NF+AN+LE F+NYLHILP+RKKPLPILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPTIINFSANMLEGFLNYLHILPSRKKPLPILHDVSGIIKPGRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             L LAGKL SDLK+SGRV+YNGH M EFVP+R+SAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  195   LTLAGKLGSDLKLSGRVSYNGHGMDEFVPQRSSAYISQYDLHIGEMTVRETLAFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG  Y+MLAELSRREK  NIKPDPDID+YMKA +++GQ  S++TDYILKILGLEVCAD +
Sbjct  255   VGTGYDMLAELSRREKVANIKPDPDIDIYMKAAALKGQGGSLITDYILKILGLEVCADTI  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQ++RLTTGEMLVGPA+ALFMDEISTGLDSSTTFQIVNSIRQSIHIL+G
Sbjct  315   VGDEMVRGISGGQKRRLTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSIRQSIHILKG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF+HMGFKCPERKGVADFLQE
Sbjct  375   TAIISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEHMGFKCPERKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQYW  R E Y F+TV EFSEAFQSFHVG++LGDELA+PFDK+K+H AAL+ K
Sbjct  435   VTSKKDQEQYWAHRGEPYSFVTVTEFSEAFQSFHVGRRLGDELAIPFDKAKAHTAALTTK  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC SRE LLMKRNSFVYIFKM QL+L+AF+ MT+FLRT+MP+ +IADG 
Sbjct  495   KYGVSKKELLKACISRELLLMKRNSFVYIFKMSQLILLAFIMMTLFLRTDMPRKTIADGW  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +F+G++FF ++M MFNGFSELAL+I+KLP FYKQRDL F+P WAY+LPTWILKIP+TLVE
Sbjct  555   IFLGSMFFTLMMIMFNGFSELALTIMKLPVFYKQRDLLFYPSWAYSLPTWILKIPITLVE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWV MTYY +GFDP+  RFF+Q  LL+CVNQMAS L RL AA GR++IVANTFGS A+
Sbjct  615   VAIWVFMTYYVVGFDPNIERFFRQYLLLLCVNQMASGLLRLMAALGRNIIVANTFGSFAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLV+GGF+LS+DDVK WW+WGYWISP+MY QNAI+VNE+LGKSWRHVP   +E LGV 
Sbjct  675   LAVLVMGGFVLSKDDVKPWWMWGYWISPMMYGQNAIAVNEFLGKSWRHVPENATEPLGVL  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERN--  2334
             VL+SRGIFPEA+WYW+GVGAL+GYVFL NFLF +AL YLNP GK Q +LSEETL E++  
Sbjct  735   VLKSRGIFPEAYWYWLGVGALIGYVFLFNFLFTVALAYLNPYGKHQTVLSEETLTEQSSR  794

Query  2335  --ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPL  2508
               +C  G+ I    + GS+               LS+RVGS N AD N KRGM+LPFEPL
Sbjct  795   GTSCTGGDKI----RSGSSRS-------------LSARVGSFNNADQNRKRGMILPFEPL  837

Query  2509  CITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVL  2688
              ITFDEI+YAVDMP EMK+QG+ E+RL LLKG++G+FRPGVLTALMG+SGAGKTTLMDVL
Sbjct  838   SITFDEIRYAVDMPQEMKSQGIPENRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVL  897

Query  2689  AGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEI  2868
             AGRKTGGYI+GSI ISGYPK Q+TFARI+GYCEQTDIHSPHVTVYESL+YSAWLRLPPE+
Sbjct  898   AGRKTGGYIDGSIKISGYPKNQKTFARISGYCEQTDIHSPHVTVYESLLYSAWLRLPPEV  957

Query  2869  DTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEP  3048
             D+ATR+MF+EEVM+LVEL SLR+ALVGLPGV+GLSTEQRKRLT+AVELVANPSIIFMDEP
Sbjct  958   DSATRKMFIEEVMELVELNSLRQALVGLPGVDGLSTEQRKRLTVAVELVANPSIIFMDEP  1017

Query  3049  TSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLG  3228
             TSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIY GPLG
Sbjct  1018  TSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYAGPLG  1077

Query  3229  RHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKA  3408
              HS+ LI+YFE I+G+ +I+DGYNPATWMLE+TS AQEAALGI+F +VY+NSELYRRNKA
Sbjct  1078  HHSAHLIKYFEGIDGVSKIKDGYNPATWMLEVTSAAQEAALGINFTDVYKNSELYRRNKA  1137

Query  3409  LIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALL  3588
             LI+ELS P PGSKDLYFPT+YSQSFF QC  CLWKQHWSYWRNP YTAVRLLFTTF AL+
Sbjct  1138  LIKELSTPPPGSKDLYFPTQYSQSFFAQCKTCLWKQHWSYWRNPSYTAVRLLFTTFIALM  1197

Query  3589  FGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMY  3768
             FGT+FW +G +R+ +QDLFNAMG MY AV+F+G QNATSVQPVVAIERTVFYRE+AAGMY
Sbjct  1198  FGTIFWDLGSRRQRKQDLFNAMGSMYCAVLFIGAQNATSVQPVVAIERTVFYREKAAGMY  1257

Query  3769  SALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGM  3948
             SALPYAFGQV+IELP++ +QT+IYGVIVYAMIGF+WT  KF W+IFFMYFT LYFT YGM
Sbjct  1258  SALPYAFGQVMIELPYILIQTIIYGVIVYAMIGFDWTMTKFFWYIFFMYFTFLYFTFYGM  1317

Query  3949  MTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQ  4128
             M VAV+PNHNIAAIISSAFY  WNLFSGFI+P+TRIPVWWRWYY+ CP+SWTLYGLI SQ
Sbjct  1318  MAVAVSPNHNIAAIISSAFYAIWNLFSGFIVPRTRIPVWWRWYYWCCPISWTLYGLIGSQ  1377

Query  4129  FGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             FGD+K+KLDT ET++DFV+S+F F +DF+G VA +IVGI V+FGF FA+SI+AFNFQ R
Sbjct  1378  FGDMKDKLDTGETIEDFVRSYFGFRNDFLGIVAVVIVGITVLFGFTFAYSIRAFNFQKR  1436



>ref|XP_007013791.1| Pleiotropic drug resistance 12 [Theobroma cacao]
 gb|EOY31410.1| Pleiotropic drug resistance 12 [Theobroma cacao]
Length=1450

 Score =  2253 bits (5838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1113/1411 (79%), Positives = 1272/1411 (90%), Gaps = 2/1411 (0%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIEKLPTYLR+RRGIL  EE  G  +E+D++ LG  E+R+LLERLV+IA+EDNE F
Sbjct  42    LKWAAIEKLPTYLRVRRGILTEEE--GQSREVDIKDLGFIERRNLLERLVKIAEEDNEKF  99

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK R +RVG+D+PTIEVRFEHLNV+AEAYVGSRALPT+FNF+ANILE  ++YL ILP
Sbjct  100   LLKLKERIERVGLDMPTIEVRFEHLNVEAEAYVGSRALPTMFNFSANILEGLLSYLRILP  159

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKKPLPIL+DVSGIIKP RM LLLGPPSSGKTTLLLALAGKL  DLK SGRVTYNGH M
Sbjct  160   SRKKPLPILNDVSGIIKPRRMALLLGPPSSGKTTLLLALAGKLGKDLKFSGRVTYNGHGM  219

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQGVG RYEMLAELSRREKE NIKPDP
Sbjct  220   EEFVPQRTSAYISQYDLHIGEMTVRETLAFSARCQGVGPRYEMLAELSRREKEANIKPDP  279

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID+YMKA ++EGQEASVVTDYILKILGLEVCAD +VG+EMIRGISGGQ+KR+TTGEMLV
Sbjct  280   DIDIYMKAAALEGQEASVVTDYILKILGLEVCADTMVGNEMIRGISGGQKKRVTTGEMLV  339

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTT+QIVNS+RQSIHIL GTA+ISLLQPAPETY+LFDDIILLS
Sbjct  340   GPARALFMDEISTGLDSSTTYQIVNSLRQSIHILNGTALISLLQPAPETYDLFDDIILLS  399

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR+NVLEFF+ +GFKCPERKGVADFLQEVTSRKDQEQYW R++E Y F++V 
Sbjct  400   DGQIVYQGPRENVLEFFECIGFKCPERKGVADFLQEVTSRKDQEQYWARKDEPYSFVSVK  459

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQSFH+G+KLGD+LA PFDKSKSHPAAL+ +KYGV+KKEL+KAC SRE+LLMKRN
Sbjct  460   EFAEAFQSFHIGQKLGDDLATPFDKSKSHPAALTKEKYGVSKKELIKACVSREYLLMKRN  519

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
              FVY+FKMIQL++M F+ MT+FLRTEM ++++ DG VFMGALFF +IM MFNGF+ELA++
Sbjct  520   LFVYVFKMIQLIIMGFITMTLFLRTEMHRDTMTDGVVFMGALFFILIMIMFNGFAELAMT  579

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I+KLP FYKQRDL F+P WAY+LP WILKIP++++EV IWV MTYY IGFDPDAGRFFK 
Sbjct  580   IMKLPIFYKQRDLLFYPSWAYSLPAWILKIPISVLEVTIWVFMTYYVIGFDPDAGRFFKH  639

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               +L+C++QMAS LFRL    GR++IVANT GS A++ VLV+GGFIL+RDD+KKWWIWGY
Sbjct  640   YLILLCLSQMASGLFRLMGGLGRNIIVANTCGSFALLAVLVMGGFILARDDIKKWWIWGY  699

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             WISPLMY QNAI+VNE+LGKSWR +P  + E LGV++L+SRGIFPEAHWYWIGVGAL+GY
Sbjct  700   WISPLMYGQNAIAVNEFLGKSWRQIPPNSKEPLGVSILKSRGIFPEAHWYWIGVGALIGY  759

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
              FL NFLF L L YL+P GKPQA++S+ETLAE+ A K GE  EL L+G  +SE+G   RR
Sbjct  760   CFLFNFLFTLTLKYLDPFGKPQAIISKETLAEKIASKTGENAELSLRGKGSSERGIESRR  819

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
             S SSRSLS++VGS+N A  N KRGMVLPFEPL ++FDEIKYAVDMP EMKAQG++EDRL 
Sbjct  820   SASSRSLSAKVGSINEATQNRKRGMVLPFEPLSMSFDEIKYAVDMPQEMKAQGVSEDRLE  879

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGY+EG+I ISGYPK+QETFARI
Sbjct  880   LLKGVSGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYVEGTIKISGYPKKQETFARI  939

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQTDIHSPHVTVYESL++SAWLRLPPE+D+ TR MF+EEVM+LVELTSLREALVGL
Sbjct  940   SGYCEQTDIHSPHVTVYESLLFSAWLRLPPEVDSETRMMFIEEVMELVELTSLREALVGL  999

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  1000  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1059

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHS  LI+YFE I GI RI+DGYNPATW
Sbjct  1060  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSCHLIKYFEEITGIPRIKDGYNPATW  1119

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLE+TS AQE  LG++   +Y+NSELY RNKAL++ELS PAPGSKDLYF T+YSQS  TQ
Sbjct  1120  MLEVTSAAQEETLGVNLTNIYKNSELYWRNKALVKELSSPAPGSKDLYFLTRYSQSLITQ  1179

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQ+WSYWRNPPYTAVR LFTT  ALLFGT+FW +G KR  QQD+ NAMG MYAA
Sbjct  1180  CMACLWKQYWSYWRNPPYTAVRFLFTTVIALLFGTIFWDLGSKRTRQQDVLNAMGSMYAA  1239

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+F+G QN+ SVQPVVA+ERTVFYRERAAGMYSALPYAFGQVV+ELP++ VQT+IYGVIV
Sbjct  1240  VLFIGFQNSASVQPVVAVERTVFYRERAAGMYSALPYAFGQVVVELPYVLVQTVIYGVIV  1299

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             YAMIGF+WTAAKF W++FFMYFT LYFT YGMMTVAVTPNHNIAAI+SSAF   WNLFSG
Sbjct  1300  YAMIGFDWTAAKFFWYLFFMYFTFLYFTFYGMMTVAVTPNHNIAAIVSSAFLALWNLFSG  1359

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             F+IP+TRIPVWWRWYY++CP+SWTLYGLIASQ+GD+K++ D+ ETV+ FV+++F F  +F
Sbjct  1360  FVIPRTRIPVWWRWYYWVCPISWTLYGLIASQYGDIKDRFDSGETVEHFVRNYFGFRDEF  1419

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             VG VA + VGICV+FGFIFAFSIKAFNFQ R
Sbjct  1420  VGVVAVVTVGICVLFGFIFAFSIKAFNFQKR  1450



>ref|XP_008392128.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Malus domestica]
Length=1451

 Score =  2246 bits (5821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1114/1435 (78%), Positives = 1280/1435 (89%), Gaps = 4/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+S ++VFS+SS +  +++   LKWAAIEKLPTYLRIRRGIL  EEEG G +EIDV+ 
Sbjct  21    IWRNSTMDVFSKSSHDEDDEEA--LKWAAIEKLPTYLRIRRGILT-EEEGKG-REIDVKN  76

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++++LERLV+ A+EDNE FLLKLK R +RVG+D+PTIEVR+EHLNV+AEAYVG R
Sbjct  77    LGLLERKNVLERLVKTAEEDNEKFLLKLKDRINRVGLDMPTIEVRYEHLNVEAEAYVGGR  136

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF ANILE  +N++HILP+RK PLP+L DVSGIIKP RMTLLLGPP SGKTTLL
Sbjct  137   ALPTIFNFVANILEGCLNFVHILPSRKHPLPMLTDVSGIIKPRRMTLLLGPPGSGKTTLL  196

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRV YNGH M EFVP RTSAYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  197   LALAGKLAKDLKFSGRVAYNGHGMEEFVPERTSAYISQHDLHIGEMTVRETLAFSARCQG  256

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEMLAELSRREKE NI PDPD D+YMKA S+EGQE SVVTDYILK+LGLEVCADI+
Sbjct  257   VGPRYEMLAELSRREKEANIMPDPDXDIYMKAASLEGQETSVVTDYILKVLGLEVCADIM  316

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQIV S+R+SIHIL G
Sbjct  317   VGDEMVRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVKSLRESIHILSG  376

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDII+LSDGQ+VYQGPR+NVLEFF+HMGFKCPERKGVADFLQE
Sbjct  377   TAVISLLQPAPETYDLFDDIIVLSDGQIVYQGPRENVLEFFEHMGFKCPERKGVADFLQE  436

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQYW  +EE Y FI+  EF EAFQSFH+G+KLGDELA PFDKSK HPAAL+ +
Sbjct  437   VTSKKDQEQYWADKEEPYNFISSKEFXEAFQSFHIGRKLGDELATPFDKSKGHPAALTTQ  496

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC  REFLLMKRNSFVYIFKM QL L+AF++MT+FLRTEM KN++ DG 
Sbjct  497   KYGVSKKELLKACIDREFLLMKRNSFVYIFKMTQLTLLAFISMTLFLRTEMHKNTVDDGG  556

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +FMGA+FF VI+ MFNGFSELA++I+KLP F+KQRDL F+P WAY+LPTWILKIP++ VE
Sbjct  557   IFMGAMFFTVIIVMFNGFSELAMTIMKLPVFFKQRDLLFYPAWAYSLPTWILKIPISFVE  616

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV MTYY IGFDP+  RFF+Q  LL+ +NQMAS LFR   A GR++IVANTFGS A+
Sbjct  617   VAVWVVMTYYVIGFDPNIERFFRQYLLLLLLNQMASGLFRFMGALGRNIIVANTFGSFAL  676

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGF+LSRDDVKKWW+WGYW SP+MY QNAI+VNE+LG SW HVP  ++E+LG+ 
Sbjct  677   LAVLVLGGFVLSRDDVKKWWVWGYWASPMMYGQNAIAVNEFLGDSWSHVPPNSTESLGIM  736

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRG+F E +WYWIGVGA VGY+FL NF + LAL +LNP  KPQA+LS+E LAE+   
Sbjct  737   VLKSRGVFIEPYWYWIGVGATVGYIFLFNFFYTLALKFLNPFEKPQAVLSKEALAEKLTD  796

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             + G+ +EL  +G ++S+  N  RRSVS R+LS+RVGS+  A+ N KRGMVLPFEPL ITF
Sbjct  797   QTGDSVELSSRGKNSSDPRNESRRSVSLRTLSARVGSITEANQNKKRGMVLPFEPLWITF  856

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEIKYAVDMP EMK QG+TEDRL LLKG+ GAFRPGVLTALMGISGAGKTTLMDVLAGRK
Sbjct  857   DEIKYAVDMPQEMKTQGVTEDRLPLLKGVTGAFRPGVLTALMGISGAGKTTLMDVLAGRK  916

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGG+IEG+ITISGYPK+QETFARI+GYCEQTDIHSPHVTVYESLVYSA LRLPPE+D+ T
Sbjct  917   TGGFIEGNITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSASLRLPPEVDSXT  976

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELTS+REALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  977   RKMFIEEVMELVELTSIREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1036

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIYVGP GRHS+
Sbjct  1037  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYVGPXGRHSA  1096

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I+G+ +I+DGYNPATWMLEIT+ AQEA LG++F E+YRNSELYRRNKA+I+E
Sbjct  1097  HLIKYFEDIDGVPKIKDGYNPATWMLEITAAAQEAVLGVNFTEIYRNSELYRRNKAMIKE  1156

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P  GSKDLYFPT+YSQSFF+QCMACLWKQH SYWRNPPY+AVRLLFTTF AL+FGT+
Sbjct  1157  LSTPPAGSKDLYFPTQYSQSFFSQCMACLWKQHLSYWRNPPYSAVRLLFTTFIALMFGTI  1216

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KRR QQDLFNAMG +YAAV+F+G QN++SVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1217  FWDLGSKRRNQQDLFNAMGSIYAAVLFIGXQNSSSVQPVVAIERTVFYRERAAGMYSALP  1276

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQVVIELP++FVQT+IYGVIVY MIGFEWT +KFLW+IFFMYFT LYFT YGMMTVA
Sbjct  1277  YAFGQVVIELPYIFVQTIIYGVIVYTMIGFEWTVSKFLWYIFFMYFTFLYFTFYGMMTVA  1336

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNI AI++SAFY  WNLFSGFI+P+TR+P+WWRWYY+ICPVS+TLYGLIASQFGD+
Sbjct  1337  VTPNHNIGAIVASAFYAIWNLFSGFIVPRTRMPIWWRWYYWICPVSYTLYGLIASQFGDI  1396

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K+K D+ E+V+ FV+++F +  D +G VA + VGICV+FGF FAFSIKAFNFQ R
Sbjct  1397  KDKFDSGESVEHFVRNYFGYRRDLLGVVAAVHVGICVLFGFTFAFSIKAFNFQKR  1451



>ref|XP_002514350.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF48304.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1449

 Score =  2246 bits (5821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1097/1435 (76%), Positives = 1283/1435 (89%), Gaps = 4/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ +E+FS+SSR+  +++   LKWAA+EKLPTYLRIRRGIL   E+GG  +EID+  
Sbjct  19    IWRNTTLEIFSKSSRDEDDEEA--LKWAALEKLPTYLRIRRGILI--EQGGQSREIDINS  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ EKR+LLERLV+IA+EDNE FLLKLK R D+VG+D+PTIEVRFEHL+V+AEAYVGSR
Sbjct  75    LGLIEKRNLLERLVKIAEEDNEKFLLKLKDRIDKVGLDMPTIEVRFEHLSVEAEAYVGSR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FNF+ N+ EAF+NYLHILP+RKKPL IL+DVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPTMFNFSVNMFEAFLNYLHILPSRKKPLSILNDVSGIIKPRRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRVTYNGH M EFVP+RTSAYI+Q+D+HIGEMTVRETLAFSARCQG
Sbjct  195   LALAGKLTKDLKFSGRVTYNGHGMEEFVPQRTSAYISQYDIHIGEMTVRETLAFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML EL+RREKE NIKPDPDID+YMKA ++EGQEA+VVTDYILKILGLE+CAD L
Sbjct  255   VGSRYEMLMELARREKEANIKPDPDIDIYMKAAALEGQEANVVTDYILKILGLELCADTL  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM RGISGGQ+KR+TTGEMLVGPA+ALFMDEISTGLDS+TTFQIVNS+RQS+HIL G
Sbjct  315   VGDEMARGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSTTTFQIVNSLRQSVHILSG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+I+LLQPAPET+ELFDDIILLSDGQ+VYQGPR+NVL+FF++MGFKCPERKGVADFLQE
Sbjct  375   TALIALLQPAPETFELFDDIILLSDGQIVYQGPRENVLDFFEYMGFKCPERKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  +++ Y F++V EFSEAFQSFH+G+KLGDELA PFDKSK+HP +L+ K
Sbjct  435   VTSRKDQEQYWAHKDQPYLFVSVNEFSEAFQSFHIGRKLGDELATPFDKSKAHPDSLTTK  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKEL KAC SRE+LLMKRNSFVYIFKM QL+++ F+ MT+FLRTEM +N+  DG 
Sbjct  495   KYGVSKKELFKACISREYLLMKRNSFVYIFKMTQLIILGFITMTLFLRTEMHRNTETDGG  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             V++GALFF V   MFNGFSELA++ILKLP FYKQRDL F+P WAYALPTWILKIP+T VE
Sbjct  555   VYLGALFFTVTTIMFNGFSELAMTILKLPVFYKQRDLLFYPSWAYALPTWILKIPITFVE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV MTYY IGFDP+  RFFKQ  +L+  NQMASALFRLTAA GR++IVANT G+ AM
Sbjct  615   VAVWVVMTYYVIGFDPNIQRFFKQYLILLITNQMASALFRLTAALGRNIIVANTVGAFAM  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +  LVLGGF++SRD+VKKWWIWGYW SP+MY QNAISVNE+LG SW H P  +++ LGVT
Sbjct  675   LTALVLGGFVISRDNVKKWWIWGYWFSPMMYVQNAISVNEFLGSSWNHFPPNSTKPLGVT  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRG+FPEA+WYWIG GAL GY+FL NFLF LAL YL+P GKPQA++S+E  +E+ A 
Sbjct  735   LLKSRGLFPEAYWYWIGFGALTGYIFLFNFLFTLALKYLDPFGKPQAIISKEAYSEKTAV  794

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             + GE IEL  K  +  E+G+   R  SSR+ S+RV S++ A  N KRGMVLPF+PL ITF
Sbjct  795   RTGEFIELSSKEKNFQERGSASHRVASSRTSSARVSSLSNAFENSKRGMVLPFQPLSITF  854

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
              +++YAV MP EMK QG+TEDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  855   ADVRYAVQMPQEMKTQGITEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  914

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+ITISGYPK+QETFARI+GYCEQTDIHSPHVTVYESL+YSAWLRLPPE+D+ T
Sbjct  915   TGGYIEGNITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLLYSAWLRLPPEVDSDT  974

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R MFVEEVM+LVELTSLREALVGLPGVNGLS EQRKRLT+AVELVANPSIIFMDEPTSGL
Sbjct  975   RNMFVEEVMELVELTSLREALVGLPGVNGLSVEQRKRLTVAVELVANPSIIFMDEPTSGL  1034

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGP+GRH+ 
Sbjct  1035  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPVGRHAC  1094

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I GI +I+DGYNPATWMLE+T+ AQE ALG+DF+++Y+NSELYR+NKALI+E
Sbjct  1095  HLIKYFEDIEGIPKIKDGYNPATWMLEVTTTAQEVALGVDFSDIYKNSELYRKNKALIKE  1154

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS+P PGSKDLYFPT+YS+SF TQCMACLWKQHWSYWRNPPYTAVRL+F TF AL+FGT+
Sbjct  1155  LSRPLPGSKDLYFPTQYSKSFTTQCMACLWKQHWSYWRNPPYTAVRLVFATFIALMFGTI  1214

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR  +QD+FNAMG MYAAV+FLG  N+T+VQPVVAIERTVFYRERAAGMYSAL 
Sbjct  1215  FWKLGTKRSRRQDIFNAMGSMYAAVLFLGFHNSTAVQPVVAIERTVFYRERAAGMYSALA  1274

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV+IE+P++ +QT+IYGVIVYAM+GFEWT +KF W++FFMYFTLLYFT YGMM VA
Sbjct  1275  YAFGQVMIEVPYILIQTIIYGVIVYAMVGFEWTISKFFWYLFFMYFTLLYFTFYGMMNVA  1334

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPNHNIAAI+SSAFY  WN+FSGFI+P+TRIP+WWRWYY+ CP++WTLYGL+ASQFGD+
Sbjct  1335  ITPNHNIAAIVSSAFYAIWNIFSGFIVPRTRIPIWWRWYYWACPIAWTLYGLVASQFGDI  1394

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             KE+LDT ETV+ F++S+F F HDFVG VA ++VGICV+FGF+FAFSI+ FNFQ R
Sbjct  1395  KEELDTGETVEHFLRSYFGFQHDFVGIVAVVLVGICVLFGFLFAFSIRTFNFQRR  1449



>ref|XP_010648603.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Vitis vinifera]
Length=1470

 Score =  2242 bits (5809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1115/1473 (76%), Positives = 1283/1473 (87%), Gaps = 59/1473 (4%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG+EVFSRSSR+  +++   LKWAAIEKLPTYLRIRRGILA EE  G  +EID+  
Sbjct  19    IWRNSGMEVFSRSSRDEDDEEA--LKWAAIEKLPTYLRIRRGILAEEE--GKAREIDITS  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ EK++LLERLV+IA+EDNE FLLKLK R DRVG+D+PTIEVRFEH+ VDAEAY+G R
Sbjct  75    LGLIEKKNLLERLVKIAEEDNEKFLLKLKERIDRVGLDIPTIEVRFEHITVDAEAYIGGR  134

Query  361   ALPTIFNFTANILE----------------------------------AFMNYLHILPNR  438
             ALPTI NF+AN+LE                                   F+NYLHILP+R
Sbjct  135   ALPTIINFSANMLEVIHFLDYINLCMYTLCSNLLSCKQSHAMIFLSLKGFLNYLHILPSR  194

Query  439   KKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEMTE  618
             KKPLPILHDVSGIIKP RMTLLLGPPSSGKTTLLL LAGKL SDLK+SGRV+YNGH M E
Sbjct  195   KKPLPILHDVSGIIKPGRMTLLLGPPSSGKTTLLLTLAGKLGSDLKLSGRVSYNGHGMDE  254

Query  619   FVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDPDI  798
             FVP+R+SAYI+Q+DLHIGEMTVRETLAFSARCQGVG  Y+MLAELSRREK  NIKPDPDI
Sbjct  255   FVPQRSSAYISQYDLHIGEMTVRETLAFSARCQGVGTGYDMLAELSRREKVANIKPDPDI  314

Query  799   DVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLVGP  978
             D+YMKA +++GQ  S++TDYILKILGLEVCAD +VGDEM+RGISGGQ++RLTTGEMLVGP
Sbjct  315   DIYMKAAALKGQGGSLITDYILKILGLEVCADTIVGDEMVRGISGGQKRRLTTGEMLVGP  374

Query  979   ARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLSDG  1158
             A+ALFMDEISTGLDSSTTFQIVNSIRQSIHIL+GTA+ISLLQPAPETY+LFDDIILLSDG
Sbjct  375   AKALFMDEISTGLDSSTTFQIVNSIRQSIHILKGTAIISLLQPAPETYDLFDDIILLSDG  434

Query  1159  QVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVGEF  1338
             Q+VYQGPR+NVLEFF+HMGFKCPERKGVADFLQEVTS+KDQEQYW  R E Y F+TV EF
Sbjct  435   QIVYQGPRENVLEFFEHMGFKCPERKGVADFLQEVTSKKDQEQYWAHRGEPYSFVTVTEF  494

Query  1339  SEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRNSF  1518
             SEAFQSFHVG++LGDELA+PFDK+K+H AAL+ KKYGV+KKELLKAC SRE LLMKRNSF
Sbjct  495   SEAFQSFHVGRRLGDELAIPFDKAKAHTAALTTKKYGVSKKELLKACISRELLLMKRNSF  554

Query  1519  VYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALSIL  1698
             VYIFKM QL+L+AF+ MT+FLRT+MP+ +IADG +F+G++FF ++M MFNGFSELAL+I+
Sbjct  555   VYIFKMSQLILLAFIMMTLFLRTDMPRKTIADGWIFLGSMFFTLMMIMFNGFSELALTIM  614

Query  1699  KLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQLF  1878
             KLP FYKQRDL F+P WAY+LPTWILKIP+TLVEVAIWV MTYY +GFDP+  RFF+Q  
Sbjct  615   KLPVFYKQRDLLFYPSWAYSLPTWILKIPITLVEVAIWVFMTYYVVGFDPNIERFFRQYL  674

Query  1879  LLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGYWI  2058
             LL+CVNQMAS L RL AA GR++IVANTFGS A++ VLV+GGF+LS+DDVK WW+WGYWI
Sbjct  675   LLLCVNQMASGLLRLMAALGRNIIVANTFGSFALLAVLVMGGFVLSKDDVKPWWMWGYWI  734

Query  2059  SPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGYVF  2238
             SP+MY QNAI+VNE+LGKSWRHVP   +E LGV VL+SRGIFPEA+WYW+GVGAL+GYVF
Sbjct  735   SPMMYGQNAIAVNEFLGKSWRHVPENATEPLGVLVLKSRGIFPEAYWYWLGVGALIGYVF  794

Query  2239  LLNFLFCLALTYLNPLGKPQAMLSEETLAERN----ACKRGEPIELELKGGSTSEKgnvv  2406
             L NFLF +AL YLNP GK Q +LSEETL E++    +C  G+ I    + GS+       
Sbjct  795   LFNFLFTVALAYLNPYGKHQTVLSEETLTEQSSRGTSCTGGDKI----RSGSSRS-----  845

Query  2407  rrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDR  2586
                     LS+RVGS N AD N KRGM+LPFEPL ITFDEI+YAVDMP EMK+QG+ E+R
Sbjct  846   --------LSARVGSFNNADQNRKRGMILPFEPLSITFDEIRYAVDMPQEMKSQGIPENR  897

Query  2587  LVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFA  2766
             L LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYI+GSI ISGYPK Q+TFA
Sbjct  898   LELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGSIKISGYPKNQKTFA  957

Query  2767  RIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALV  2946
             RI+GYCEQTDIHSPHVTVYESL+YSAWLRLPPE+D+ATR+MF+EEVM+LVEL SLR+ALV
Sbjct  958   RISGYCEQTDIHSPHVTVYESLLYSAWLRLPPEVDSATRKMFIEEVMELVELNSLRQALV  1017

Query  2947  GLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV  3126
             GLPGV+GLSTEQRKRLT+AVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV
Sbjct  1018  GLPGVDGLSTEQRKRLTVAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV  1077

Query  3127  VCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPA  3306
             VCTIHQPSIDIFDAFDEL LLKRGGEEIY GPLG HS+ LI+YFE I+G+ +I+DGYNPA
Sbjct  1078  VCTIHQPSIDIFDAFDELFLLKRGGEEIYAGPLGHHSAHLIKYFEGIDGVSKIKDGYNPA  1137

Query  3307  TWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFF  3486
             TWMLE+TS AQEAALGI+F +VY+NSELYRRNKALI+ELS P PGSKDLYFPT+YSQSFF
Sbjct  1138  TWMLEVTSAAQEAALGINFTDVYKNSELYRRNKALIKELSTPPPGSKDLYFPTQYSQSFF  1197

Query  3487  TQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMY  3666
              QC  CLWKQHWSYWRNP YTAVRLLFTTF AL+FGT+FW +G +R+ +QDLFNAMG MY
Sbjct  1198  AQCKTCLWKQHWSYWRNPSYTAVRLLFTTFIALMFGTIFWDLGSRRQRKQDLFNAMGSMY  1257

Query  3667  AAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGV  3846
              AV+F+G QNATSVQPVVAIERTVFYRE+AAGMYSALPYAFGQV+IELP++ +QT+IYGV
Sbjct  1258  CAVLFIGAQNATSVQPVVAIERTVFYREKAAGMYSALPYAFGQVMIELPYILIQTIIYGV  1317

Query  3847  IVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLF  4026
             IVYAMIGF+WT  KF W+IFFMYFT LYFT YGMM VAV+PNHNIAAIISSAFY  WNLF
Sbjct  1318  IVYAMIGFDWTMTKFFWYIFFMYFTFLYFTFYGMMAVAVSPNHNIAAIISSAFYAIWNLF  1377

Query  4027  SGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdh  4206
             SGFI+P+TRIPVWWRWYY+ CP+SWTLYGLI SQFGD+K+KLDT ET++DFV+S+F F +
Sbjct  1378  SGFIVPRTRIPVWWRWYYWCCPISWTLYGLIGSQFGDMKDKLDTGETIEDFVRSYFGFRN  1437

Query  4207  dfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             DF+G VA +IVGI V+FGF FA+SI+AFNFQ R
Sbjct  1438  DFLGIVAVVIVGITVLFGFTFAYSIRAFNFQKR  1470



>ref|XP_008394025.1| PREDICTED: pleiotropic drug resistance protein 1-like [Malus 
domestica]
Length=1451

 Score =  2239 bits (5803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1110/1435 (77%), Positives = 1283/1435 (89%), Gaps = 4/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+S ++VFS+SS +A +++   LKWAAIEKLPTYLRI+RGIL  EEEG G +EID++ 
Sbjct  21    IWRNSTMDVFSKSSHDADDEEA--LKWAAIEKLPTYLRIQRGILT-EEEGKG-REIDIKN  76

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++++LERLV+ A EDNE FLLKLK R +RVG+D+PTIE+RFEHLNV+AEAYVG R
Sbjct  77    LGLLERKNVLERLVKTADEDNEKFLLKLKDRINRVGLDIPTIELRFEHLNVEAEAYVGGR  136

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF ANILE  +N++H+LP+RK PLPIL DVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  137   ALPTIFNFLANILEGCLNFVHVLPSRKHPLPILADVSGIIKPRRMTLLLGPPSSGKTTLL  196

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRV YNGH M EFVP RTSAYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  197   LALAGKLAKDLKFSGRVEYNGHGMEEFVPERTSAYISQHDLHIGEMTVRETLAFSARCQG  256

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEMLAELSRREKE NI PDPD+D+YMKA S++GQE +VVTDYILKILGLEVCADI+
Sbjct  257   VGPRYEMLAELSRREKEANIIPDPDLDIYMKAASLQGQETNVVTDYILKILGLEVCADIM  316

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQ+KRLTTGEMLVGPARALFMDEISTGLDSSTTFQIV S+R+SIHIL G
Sbjct  317   VGDEMVRGISGGQKKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVKSLRESIHILSG  376

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF+HMGFKCPERKGVADFLQE
Sbjct  377   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEHMGFKCPERKGVADFLQE  436

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQYW  +EE Y FI+  EF+EAFQSFH+G+KLGDELA PF+KS  HPAAL+ +
Sbjct  437   VTSKKDQEQYWADKEEPYSFISSKEFAEAFQSFHIGRKLGDELATPFEKSMGHPAALTTQ  496

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC  REFLLMKRNSFVYIFKM QL LMAF++MT+F RT++ KN++ DG 
Sbjct  497   KYGVSKKELLKACIDREFLLMKRNSFVYIFKMTQLTLMAFISMTLFCRTDLHKNTVDDGG  556

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +FMGA+FFAV++ MFNGFSELA++I+KLP F+KQRDL F+P WAY+LPTWILKIP++ VE
Sbjct  557   IFMGAMFFAVVIIMFNGFSELAMTIMKLPVFFKQRDLLFYPAWAYSLPTWILKIPISFVE  616

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV MTYY IGFDP+  RF KQ  LL+ +NQMAS LFR   A GR++IVANTFGS A+
Sbjct  617   VAVWVIMTYYVIGFDPNFERFLKQYLLLLLLNQMASGLFRFMGALGRNIIVANTFGSFAL  676

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGF+LSRD+V KWW+WGYW SP+MY QNAI+VNE+LG SW HVP  ++E+LG+ 
Sbjct  677   VAVLVLGGFVLSRDNVMKWWVWGYWASPMMYGQNAIAVNEFLGNSWSHVPPNSTESLGIM  736

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRG+F E +WYW+GVGA +GY+FL NF + LAL +LNP GKPQA+LS+E LAE+ A 
Sbjct  737   VLKSRGVFLEPYWYWLGVGATIGYIFLFNFFYTLALKFLNPFGKPQAVLSKEALAEKLAD  796

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K G+ +EL  +G ++S+  N  RRSVSSR+LS+RVGS+   + N KRGMVLPFEPL ITF
Sbjct  797   KAGDSVELSSRGKNSSDSRNESRRSVSSRTLSARVGSIAEVNGNKKRGMVLPFEPLWITF  856

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEIKYAVDMP EMK QG+TEDRL LLKG+ GAFRPGVLTALMGISGAGKTTLMDVLAGRK
Sbjct  857   DEIKYAVDMPQEMKTQGVTEDRLQLLKGVTGAFRPGVLTALMGISGAGKTTLMDVLAGRK  916

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
              GGYIEG+ITISGYPK+QETFARI+GYCEQTDIHSPHVTVYESLVYSA LRLPPE+D+ T
Sbjct  917   MGGYIEGNITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSASLRLPPEVDSTT  976

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELTS+REALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  977   RKMFIEEVMELVELTSIREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1036

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEI+VGPLGRHSS
Sbjct  1037  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIFVGPLGRHSS  1096

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I+G+ +I+DGYNPATWMLEIT+ AQEA++G++F E+YRNSELY RNKA+I+E
Sbjct  1097  HLIKYFEDIDGVPKIKDGYNPATWMLEITAAAQEASIGVNFTEIYRNSELYGRNKAMIKE  1156

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P  GSKDLYFPT+YSQSFF+QCMACLWKQH SYWRNPPY+AVRL+FTTF AL+FGT+
Sbjct  1157  LSTPPAGSKDLYFPTQYSQSFFSQCMACLWKQHLSYWRNPPYSAVRLMFTTFIALMFGTI  1216

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR ++QDLFNAMG MYAAV+F+GVQNA SVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1217  FWDLGSKRTSKQDLFNAMGSMYAAVLFIGVQNAASVQPVVAIERTVFYRERAAGMYSALP  1276

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQVVIELP++FVQT+IYGVIVYAMIGF+WT +KFLW++FFMYFT LYFT YGMMTVA
Sbjct  1277  YAFGQVVIELPYIFVQTIIYGVIVYAMIGFDWTVSKFLWYLFFMYFTFLYFTFYGMMTVA  1336

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNIAAI+SSAFY  WNLFSGFI+P+TR+P+WWRWYY+ICPVS+TLYGL+ASQFGD+
Sbjct  1337  VTPNHNIAAIVSSAFYAIWNLFSGFIVPRTRMPIWWRWYYWICPVSYTLYGLVASQFGDI  1396

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K+K DT E+V+ FV+ +F +  DF+G VA + VGICV+FGF FAFSIK FNFQ R
Sbjct  1397  KDKFDTGESVEHFVRDYFGYRRDFLGAVAAVHVGICVLFGFTFAFSIKVFNFQKR  1451



>gb|ACU82515.1| pleiotropic drug resistance protein [Cucumis sativus]
Length=1451

 Score =  2238 bits (5799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1092/1437 (76%), Positives = 1264/1437 (88%), Gaps = 6/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+S +EVFSRSSR+  +++   LKWA+IE+LPTYLR+RRGIL  + E    +EIDV+ 
Sbjct  19    IWRNSAMEVFSRSSRDDDDEEA--LKWASIERLPTYLRVRRGILNLDGESA--REIDVQN  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+R++LERLV+IA++DNE FLLKLK+R +RVG+DLP IEVRFEHL V+AEA+   R
Sbjct  75    LGLLERRNILERLVKIAEDDNERFLLKLKNRMERVGLDLPAIEVRFEHLEVEAEAHTAGR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FNF+ N+LE F++Y HI+PNRKK L ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPTMFNFSLNMLEGFLSYFHIIPNRKKQLSILHDVSGIIKPGRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
               LAGKL  DLK SGRVTYNGH M EFVP+RTSAYI+Q DLHIGEMTVRETL+FSARCQG
Sbjct  195   KTLAGKLGKDLKFSGRVTYNGHGMNEFVPQRTSAYISQQDLHIGEMTVRETLSFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+ML ELSRREK  NIKPDPD+D+ MKA ++ GQE +VVTDY+LKILGLE+CAD +
Sbjct  255   VGPRYDMLTELSRREKAANIKPDPDLDIIMKAAALGGQETNVVTDYVLKILGLEICADTM  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM RGISGGQ+KR+TTGEMLVGP+RALFMDEISTGLDSSTT+QIVNS+RQ IHIL G
Sbjct  315   VGDEMFRGISGGQKKRVTTGEMLVGPSRALFMDEISTGLDSSTTYQIVNSMRQYIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETYELFDDIIL+SDGQVVYQGPR+NVLEFFQHMGF CP+RKGVADFLQE
Sbjct  375   TALISLLQPAPETYELFDDIILISDGQVVYQGPRENVLEFFQHMGFTCPQRKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW +R+E Y F++V EFSEAFQSFHVGKKLGDELA PFDKSKSHPAAL+ +
Sbjct  435   VTSRKDQEQYWTKRDEVYRFVSVEEFSEAFQSFHVGKKLGDELATPFDKSKSHPAALTTE  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG +KKELLKAC SRE LLMKRNSFVYIFK+IQL+LMAFV MT+F RTEM + ++ DG+
Sbjct  495   KYGASKKELLKACISRELLLMKRNSFVYIFKLIQLILMAFVTMTLFFRTEMHRRTVDDGS  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             V+MGALFFA+I+TMFNGFSELAL+ILKLP FYKQRD  FFPPWAY++PTWILKIP+T VE
Sbjct  555   VYMGALFFAIIITMFNGFSELALTILKLPVFYKQRDFLFFPPWAYSIPTWILKIPITFVE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY +GFDP+AGRFFK   +L+ VNQMASALFRL  A GR++IVANTFGS A+
Sbjct  615   VGIWVVMTYYVVGFDPNAGRFFKHFLMLLFVNQMASALFRLIGALGRNIIVANTFGSFAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGF+L+RDDV  WWIWGYWISP+MYAQN I+VNE+LG  WRH    ++E+LGV 
Sbjct  675   LTVLVLGGFVLARDDVHPWWIWGYWISPMMYAQNGIAVNEFLGHKWRHPAPNSNESLGVL  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRGIFP+A WYWIGVGA +GY+ L NFLF +AL YL+P  KPQA++S+ET  +++  
Sbjct  735   ILKSRGIFPQASWYWIGVGATIGYILLFNFLFTIALQYLDPFEKPQAIVSKETSTDKSVK  794

Query  2341  KRGEPIELEL--KGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             K  +  ELEL  KG S+SE+        S  S +        A+ N KRGMVLPFEP  I
Sbjct  795   KSQDVQELELSSKGKSSSERTENQISLSSRTSSARVGSFSEEANQNKKRGMVLPFEPHSI  854

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFDEI+YAVDMP EMK+QG+TEDRL LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  855   TFDEIRYAVDMPQEMKSQGVTEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAG  914

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYIEG+ITISGYPK+QETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPP++D+
Sbjct  915   RKTGGYIEGNITISGYPKKQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPDVDS  974

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
             ATR+MFVEEVM+L+EL  LR+A+VGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTS
Sbjct  975   ATRKMFVEEVMELIELNPLRDAIVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTS  1034

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LL+RGGEEIYVGP+GRH
Sbjct  1035  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLRRGGEEIYVGPVGRH  1094

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SSQLI YFE+I G+ +I+DGYNPATWMLEIT+ AQE  LG++F  +Y++SELYRRNKALI
Sbjct  1095  SSQLIEYFESIEGVPKIKDGYNPATWMLEITTAAQETTLGVNFNTLYKDSELYRRNKALI  1154

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             +ELS P   S +LYFPTKYSQSFF QC+ACLWKQH SYWRNPPY+AVR LFTTF AL+FG
Sbjct  1155  KELSVPNENSNELYFPTKYSQSFFIQCIACLWKQHLSYWRNPPYSAVRFLFTTFIALMFG  1214

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G KR TQQDLFNAMG MYAAV+F+GVQNATSVQPVVAIERTVFYRERAAGMYSA
Sbjct  1215  TIFWDLGSKRGTQQDLFNAMGSMYAAVLFIGVQNATSVQPVVAIERTVFYRERAAGMYSA  1274

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAFGQVVIELP++F+QT++YGVIVY MIGFEWTAAKF W+IFFMYFTLLYFT YGMMT
Sbjct  1275  LPYAFGQVVIELPYIFIQTVVYGVIVYGMIGFEWTAAKFFWYIFFMYFTLLYFTFYGMMT  1334

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNHNIAAI+SSAFYGFWNLFSGFI+P+TRIP+WWRWYY+ICPV+WTLYGL+ SQFG
Sbjct  1335  VAVTPNHNIAAIVSSAFYGFWNLFSGFIVPRTRIPIWWRWYYWICPVAWTLYGLVTSQFG  1394

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+ + +D+N+TV +FV ++F + +DF+G VA + VGI V+FGFIFAFSIK FNFQ R
Sbjct  1395  DINDPMDSNQTVAEFVSNYFGYKYDFLGVVAAVHVGITVLFGFIFAFSIKVFNFQKR  1451



>emb|CDP04826.1| unnamed protein product [Coffea canephora]
Length=1448

 Score =  2237 bits (5797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1131/1435 (79%), Positives = 1268/1435 (88%), Gaps = 5/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG++VFSRSSRE  +++   L WAAIEKLPT LRIRR IL  EE   G KEIDVE 
Sbjct  19    IWRNSGLDVFSRSSREEDDEEA--LTWAAIEKLPTCLRIRRAILTEEE---GSKEIDVEN  73

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EK++LLERL++IA+EDNE FLLKL+ R DRVGI LPTIEVRFEHLNVDA+A+  SR
Sbjct  74    LGELEKKNLLERLLKIAEEDNEKFLLKLRKRMDRVGISLPTIEVRFEHLNVDAQAHASSR  133

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNFT NILE+F NYLHILPNRKK L IL DVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  134   ALPTIFNFTVNILESFFNYLHILPNRKKKLTILRDVSGIIKPGRMTLLLGPPSSGKTTLL  193

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLDSDLKVSGRVTYNGHEM EFVP RTSAYI+Q+DLH+ E+TVRETL+FSARCQG
Sbjct  194   LALAGKLDSDLKVSGRVTYNGHEMKEFVPERTSAYISQYDLHMAELTVRETLSFSARCQG  253

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML ELSRREKELNIKPDPDIDV+MKA S+EGQEASV+TDYILK+LGLEVCAD L
Sbjct  254   VGPRYEMLVELSRREKELNIKPDPDIDVFMKAASLEGQEASVITDYILKVLGLEVCADTL  313

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKR+T GEM+VGPARALFMDEISTGLDSSTTFQIVNSI+QSIHIL+G
Sbjct  314   VGDEMIRGISGGQRKRVTAGEMMVGPARALFMDEISTGLDSSTTFQIVNSIKQSIHILEG  373

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             T VISLLQPAPETY+LFDDIILLSDG++VYQGPR++VLEFF+HMGFKCPERKGVADFLQE
Sbjct  374   TTVISLLQPAPETYDLFDDIILLSDGEIVYQGPRESVLEFFEHMGFKCPERKGVADFLQE  433

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQYW +R+  Y FI+  EFSEAFQSFHVG+KLGDELA+PFDK+K HPAAL+ K
Sbjct  434   VTSKKDQEQYWAQRDVPYNFISSREFSEAFQSFHVGRKLGDELAIPFDKAKGHPAALTTK  493

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             +YGV+KKELLKAC +RE+LLMKRNSFVYIFKMIQL+LMA +AMTVFLRT M KN+  DG 
Sbjct  494   RYGVSKKELLKACTAREYLLMKRNSFVYIFKMIQLILMASIAMTVFLRTNMHKNTTTDGG  553

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +F+GALF++V+M MFNGFSELALSILKLP FYKQRD  FFP WAY+LPTWILKIP++ VE
Sbjct  554   IFVGALFYSVVMIMFNGFSELALSILKLPVFYKQRDFLFFPAWAYSLPTWILKIPISFVE  613

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
               +W CMTYY IGFDPD  RFF+  FLL+C+NQMASALFR  AA GR++IVANT G+CA+
Sbjct  614   AIVWSCMTYYTIGFDPDIQRFFRHFFLLVCINQMASALFRCMAAIGRNIIVANTGGTCAL  673

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGF+LS+DD+KKWWIWGYW+SPL YAQ AISVNE+LGKSW  VP G  E LGV 
Sbjct  674   VTVLVLGGFVLSKDDIKKWWIWGYWLSPLNYAQTAISVNEFLGKSWSKVPPGAIEPLGVL  733

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SR IF EA WYWIG+G L+GY+ + N+LF LALTYLNP GK +A++ +E   E    
Sbjct  734   VLKSRRIFTEAKWYWIGLGGLIGYILVCNYLFTLALTYLNPFGKSRAVVPQENSDESQDS  793

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
              R + IEL       S   N V RSVSSRS+SSRVGS N  + N K+GMVLPFEPL ITF
Sbjct  794   TRSKLIELSSGRKRASGGDNEVGRSVSSRSISSRVGSTNEVNQNRKKGMVLPFEPLSITF  853

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D I+YAVDMP EMKAQG+ E +L LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  854   DNIRYAVDMPQEMKAQGVIESQLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  913

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+G I+ISGYPK+QETFARIAGYCEQTDIHSPHVTVYESL YSAWLRLPPE+D A 
Sbjct  914   TGGYIDGRISISGYPKKQETFARIAGYCEQTDIHSPHVTVYESLQYSAWLRLPPEVDAAM  973

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVEL  LREALVGLPGVNGLSTEQRKRLT+AVELVANPSIIFMDEPTSGL
Sbjct  974   RKMFIEEVMELVELNPLREALVGLPGVNGLSTEQRKRLTVAVELVANPSIIFMDEPTSGL  1033

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH S
Sbjct  1034  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHCS  1093

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             +LI YFE I G+ +I+DGYNPATWMLE+TS AQE ALGIDFAEVY+NSE+YRRNK LI+E
Sbjct  1094  KLINYFEGIPGVNKIKDGYNPATWMLEVTSAAQEVALGIDFAEVYKNSEVYRRNKELIKE  1153

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSKDLYFPT+YSQSFF QCMACLWKQH SYWRNPPY+AVR LFTTF AL+FGT+
Sbjct  1154  LSTPVPGSKDLYFPTQYSQSFFIQCMACLWKQHLSYWRNPPYSAVRFLFTTFIALMFGTI  1213

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR+++QD+FNAMG MYAAV+FLGVQNATSVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1214  FWDLGSKRKSKQDIFNAMGSMYAAVIFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  1273

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQVVIE+P+ FVQTLIYG+I+YAMIGFEWT AKF W++FFM+F L+YFT YGMMTVA
Sbjct  1274  YAFGQVVIEIPYNFVQTLIYGIIIYAMIGFEWTVAKFFWYLFFMFFALVYFTYYGMMTVA  1333

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPN NIAAI+SSAFY  WNLFSGFIIPK+RIPVWWRWYYY+ PVSWTLYGL+ASQF D+
Sbjct  1334  VTPNANIAAIVSSAFYALWNLFSGFIIPKSRIPVWWRWYYYLSPVSWTLYGLVASQFADI  1393

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +  LDTNETVK F++S+F F HDFV YVA I VGI V+FGFIFA+SIKAFNFQ R
Sbjct  1394  EHDLDTNETVKHFIESYFGFKHDFVVYVAIIHVGISVLFGFIFAYSIKAFNFQKR  1448



>ref|XP_004291476.1| PREDICTED: pleiotropic drug resistance protein 1-like [Fragaria 
vesca subsp. vesca]
Length=1444

 Score =  2237 bits (5796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1098/1435 (77%), Positives = 1273/1435 (89%), Gaps = 11/1435 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+S ++VFS+SS +  +++   LKWAAIEKLPTYLRIRRGI   EE  G  +EID++ 
Sbjct  21    IWRNSTMDVFSKSSHDEEDEEA--LKWAAIEKLPTYLRIRRGIFTEEE--GEAREIDIKN  76

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++++LERLV++A EDNE FL+KLK+R DRVG++ PTIEVRFEHL+V+AEAYVG R
Sbjct  77    LGLLERKNVLERLVKVADEDNERFLMKLKNRIDRVGLEFPTIEVRFEHLSVEAEAYVGGR  136

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF+ANILE F+++  I+P RK P PIL DVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  137   ALPTIFNFSANILEGFLSFCRIIPTRKHPFPILDDVSGIIKPKRMTLLLGPPSSGKTTLL  196

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRV YNGH M EFVP RTSAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  197   LALAGKLAKDLKSSGRVVYNGHGMEEFVPERTSAYISQYDLHIGEMTVRETLAFSARCQG  256

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEMLAELSRREKE NI P+ D+D+YMKA S+EGQEASVVTDYILKILGLEVCAD +
Sbjct  257   VGGRYEMLAELSRREKEANIMPEKDLDIYMKAASLEGQEASVVTDYILKILGLEVCADTM  316

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM RGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQIVNS+RQSIHIL G
Sbjct  317   VGDEMFRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSLRQSIHILNG  376

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF++MGFKCPERKGVADFLQE
Sbjct  377   TALISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEYMGFKCPERKGVADFLQE  436

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQYW ++EE Y FI+  EFSEAFQSFH+G+KLGDELA PFDKSK HPAAL+ K
Sbjct  437   VTSKKDQEQYWFQKEEPYNFISSKEFSEAFQSFHIGRKLGDELATPFDKSKGHPAALTTK  496

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC +RE+LLMKRNSFVYIFKM QL L+AF++MT+F RTEMP++++ DG 
Sbjct  497   KYGVSKKELLKACIAREYLLMKRNSFVYIFKMTQLTLLAFISMTLFFRTEMPRHTVEDGG  556

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +FMGA+FF +I+ MFNGFSELAL+I+KLP F+KQRDL F+P WAY+LPTWILKIP+T VE
Sbjct  557   IFMGAMFFTIIIIMFNGFSELALTIMKLPVFFKQRDLLFYPAWAYSLPTWILKIPITFVE  616

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWV MTYY IGFDP+ GRFFKQ  LL+ VNQMAS LFR   A GR++IVANTFGS A+
Sbjct  617   VAIWVFMTYYVIGFDPNPGRFFKQYLLLLFVNQMASGLFRFMGALGRNIIVANTFGSFAL  676

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLV+GGFILSRD+V+ WW+WGYW+SP+MY+QNAI+VNE+LG SW HVP  ++E+LG+ 
Sbjct  677   LAVLVMGGFILSRDNVQAWWLWGYWVSPMMYSQNAIAVNEFLGDSWSHVPPNSNESLGIM  736

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRG+F EAHWYWIGVGA +GY+FL NF + +AL YL+P GKPQA+LS+E LAE+ A 
Sbjct  737   VLKSRGVFVEAHWYWIGVGATIGYIFLFNFFYTVALQYLDPFGKPQAVLSKEALAEKTAA  796

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
               G  +EL  +G ++S   +   +S    S +        A+ N K+GMVLPFEPL ITF
Sbjct  797   TAGGNLELSSRGNNSSGSVSSRTQSARVGSFNE-------ANENRKKGMVLPFEPLWITF  849

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEIKY+VDMP EMK QG+TE+RL LLKG+ GAFRPGVLTALMGISGAGKTTLMDVLAGRK
Sbjct  850   DEIKYSVDMPQEMKTQGITEERLPLLKGVTGAFRPGVLTALMGISGAGKTTLMDVLAGRK  909

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG ITISGYPK+QETFARI+GYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D+AT
Sbjct  910   TGGYIEGDITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSAT  969

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFVEEVM+LVELTS+RE+LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  970   RKMFVEEVMELVELTSIRESLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1029

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIYVGPLGRHSS
Sbjct  1030  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYVGPLGRHSS  1089

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI+YFE I G+ +I+DGYNPATWMLE+TS AQE  LG++F ++YR+SELYRRNK LI+E
Sbjct  1090  QLIKYFEEIEGVPKIKDGYNPATWMLEVTSAAQEVVLGVNFTDIYRSSELYRRNKDLIKE  1149

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P  G++DLYF TKYSQSF+ QCMACLWKQH SYWRNPPY+AVRLLFTTF AL+FGT+
Sbjct  1150  LSTPPQGTQDLYFSTKYSQSFYYQCMACLWKQHLSYWRNPPYSAVRLLFTTFIALMFGTI  1209

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR+ QQD+FNAMG MYAAV+F+GVQNATSVQPVVA+ERTVFYRERAAGMYSALP
Sbjct  1210  FWDLGSKRKNQQDVFNAMGSMYAAVLFIGVQNATSVQPVVAVERTVFYRERAAGMYSALP  1269

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQVVIELP++FVQT+IYGVIVYAMIGF+WT +KFLW++FFMYFT LYFT YGMMTVA
Sbjct  1270  YAFGQVVIELPYIFVQTVIYGVIVYAMIGFDWTVSKFLWYLFFMYFTFLYFTFYGMMTVA  1329

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNIAAI+SSAFY  WNLFSGFIIP+TR+P+WWRWYY+ICPVS+TLYGL+ASQFGD+
Sbjct  1330  VTPNHNIAAIVSSAFYAIWNLFSGFIIPRTRMPIWWRWYYWICPVSYTLYGLVASQFGDI  1389

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             KE +++ E+V+DFV+++F + HD VG +A ++VGI V+FGF FAFSIKAFNFQ R
Sbjct  1390  KEVMESGESVEDFVRNYFGYRHDLVGIIAVVLVGISVLFGFTFAFSIKAFNFQKR  1444



>ref|XP_004148099.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cucumis 
sativus]
 gb|KGN63378.1| hypothetical protein Csa_2G433930 [Cucumis sativus]
Length=1451

 Score =  2236 bits (5793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1091/1437 (76%), Positives = 1263/1437 (88%), Gaps = 6/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+S +EVFSRSSR+  +++   LKWA+IE+LPTYLR+RRGIL  + E    +EIDV+ 
Sbjct  19    IWRNSAMEVFSRSSRDDDDEEA--LKWASIERLPTYLRVRRGILNLDGESA--REIDVQN  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+R++LERLV+IA++DNE FLLKLK+R +RVG+DLP IEVRFEHL V+AEA+   R
Sbjct  75    LGLLERRNILERLVKIAEDDNERFLLKLKNRMERVGLDLPAIEVRFEHLEVEAEAHTAGR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FNF+ N+LE F++Y HI+PNRKK L ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPTMFNFSLNMLEGFLSYFHIIPNRKKQLSILHDVSGIIKPGRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
               LAGKL  DLK SGRVTYNGH M EFVP+RTSAYI+Q DLHIGEMTVRETL+FSARCQG
Sbjct  195   KTLAGKLGKDLKFSGRVTYNGHGMNEFVPQRTSAYISQQDLHIGEMTVRETLSFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+ML ELSRREK  NIKPDPD+D+ MKA ++ GQE +VVTDY+LKILGLE+CAD +
Sbjct  255   VGPRYDMLTELSRREKAANIKPDPDLDIIMKAAALGGQETNVVTDYVLKILGLEICADTM  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM RGISGGQ+KR+TTGEMLVGP+RALFMDEISTGLDSSTT+QIVNS+RQ IHIL G
Sbjct  315   VGDEMFRGISGGQKKRVTTGEMLVGPSRALFMDEISTGLDSSTTYQIVNSMRQYIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETYELFDDIIL+SDGQVVYQGPR+NVLEFFQHMGF CP+RKGVADFLQE
Sbjct  375   TALISLLQPAPETYELFDDIILISDGQVVYQGPRENVLEFFQHMGFTCPQRKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW +R+E Y F++V EFSEAFQSFHVGKKLGDELA PFDKSKSHPAAL+ +
Sbjct  435   VTSRKDQEQYWTKRDEVYRFVSVEEFSEAFQSFHVGKKLGDELATPFDKSKSHPAALTTE  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG +KKELLKAC SRE LLMKRNSFVYIFK+IQL+LMAFV MT+F RTEM + ++ DG+
Sbjct  495   KYGASKKELLKACISRELLLMKRNSFVYIFKLIQLILMAFVTMTLFFRTEMHRRTVDDGS  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             V+MGALFFA+I+ MFNGFSELAL+ILKLP FYKQRD  FFPPWAY++PTWILKIP+T VE
Sbjct  555   VYMGALFFAIIIIMFNGFSELALTILKLPVFYKQRDFLFFPPWAYSIPTWILKIPITFVE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY +GFDP+AGRFFK   +L+ VNQMASALFRL  A GR++IVANTFGS A+
Sbjct  615   VGIWVVMTYYVVGFDPNAGRFFKHFLMLLFVNQMASALFRLIGALGRNIIVANTFGSFAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGF+L+RDDV  WWIWGYWISP+MYAQN I+VNE+LG  WRH    ++E+LGV 
Sbjct  675   LTVLVLGGFVLARDDVHPWWIWGYWISPMMYAQNGIAVNEFLGHKWRHPAPNSNESLGVL  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRGIFP+A WYWIGVGA +GY+ L NFLF +AL YL+P  KPQA++S+ET  +++  
Sbjct  735   ILKSRGIFPQASWYWIGVGATIGYILLFNFLFTIALQYLDPFEKPQAIVSKETSTDKSVK  794

Query  2341  KRGEPIELEL--KGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             K  +  ELEL  KG S+SE+        S  S +        A+ N KRGMVLPFEP  I
Sbjct  795   KSQDVQELELSSKGKSSSERTENQISLSSRTSSARVGSFSEEANQNKKRGMVLPFEPHSI  854

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFDEI+YAVDMP EMK+QG+TEDRL LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  855   TFDEIRYAVDMPQEMKSQGVTEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAG  914

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYIEG+ITISGYPK+QETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPP++D+
Sbjct  915   RKTGGYIEGNITISGYPKKQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPDVDS  974

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
             ATR+MFVEEVM+L+EL  LR+A+VGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTS
Sbjct  975   ATRKMFVEEVMELIELNPLRDAIVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTS  1034

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LL+RGGEEIYVGP+GRH
Sbjct  1035  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLRRGGEEIYVGPVGRH  1094

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SSQLI YFE+I G+ +I+DGYNPATWMLEIT+ AQE  LG++F  +Y++SELYRRNKALI
Sbjct  1095  SSQLIEYFESIEGVPKIKDGYNPATWMLEITTAAQETTLGVNFNTLYKDSELYRRNKALI  1154

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             +ELS P   S +LYFPTKYSQSFF QC+ACLWKQH SYWRNPPY+AVR LFTTF AL+FG
Sbjct  1155  KELSVPNENSNELYFPTKYSQSFFIQCIACLWKQHLSYWRNPPYSAVRFLFTTFIALMFG  1214

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G KR TQQDLFNAMG MYAAV+F+GVQNATSVQPVVAIERTVFYRERAAGMYSA
Sbjct  1215  TIFWDLGSKRGTQQDLFNAMGSMYAAVLFIGVQNATSVQPVVAIERTVFYRERAAGMYSA  1274

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAFGQVVIELP++F+QT++YGVIVY MIGFEWTAAKF W+IFFMYFTLLYFT YGMMT
Sbjct  1275  LPYAFGQVVIELPYIFIQTVVYGVIVYGMIGFEWTAAKFFWYIFFMYFTLLYFTFYGMMT  1334

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNHNIAAI+SSAFYGFWNLFSGFI+P+TRIP+WWRWYY+ICPV+WTLYGL+ SQFG
Sbjct  1335  VAVTPNHNIAAIVSSAFYGFWNLFSGFIVPRTRIPIWWRWYYWICPVAWTLYGLVTSQFG  1394

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+ + +D+N+TV +FV ++F + +DF+G VA + VGI V+FGFIFAFSIK FNFQ R
Sbjct  1395  DINDPMDSNQTVAEFVSNYFGYKYDFLGVVAAVHVGITVLFGFIFAFSIKVFNFQKR  1451



>emb|CAN80954.1| hypothetical protein VITISV_032205 [Vitis vinifera]
Length=1441

 Score =  2234 bits (5789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1099/1452 (76%), Positives = 1268/1452 (87%), Gaps = 46/1452 (3%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG+EVFSRSSR+  +++   LKWAAIEKLPTYLRIRRGILA EE  G  +EID+  
Sbjct  19    IWRNSGMEVFSRSSRDEDDEEA--LKWAAIEKLPTYLRIRRGILAEEE--GKAREIDITS  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ EK++LLERLV+IA+EDNE FLLKLK R DRVG+D+PTIEVRFEH+ VDAEAY+G R
Sbjct  75    LGLIEKKNLLERLVKIAEEDNEKFLLKLKERIDRVGLDIPTIEVRFEHITVDAEAYIGGR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTI NF+AN+LE F+NYLHILP+RKKPLPILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPTIINFSANMLEGFLNYLHILPSRKKPLPILHDVSGIIKPGRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             L LAGKL SDLK+SGRV+YNGH M EFVP+R+SAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  195   LTLAGKLGSDLKLSGRVSYNGHGMDEFVPQRSSAYISQYDLHIGEMTVRETLAFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG  Y+MLAELSRREK  NIKPDPDID+YMKA +++GQ  S++TDYILKILGLE CAD +
Sbjct  255   VGTGYDMLAELSRREKVANIKPDPDIDIYMKAAALKGQGGSLITDYILKILGLEXCADTI  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQ++RLTTGEMLVGPA+ALFMDEISTGLDSSTTFQIVNSIRQSIHIL+G
Sbjct  315   VGDEMVRGISGGQKRRLTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSIRQSIHILKG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF+HMGFKCPERKGVADFLQE
Sbjct  375   TAIISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEHMGFKCPERKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQYW  R E Y F+TV EFSEAFQSFHVG++LGDELA+PFDK+K+H AAL+ K
Sbjct  435   VTSKKDQEQYWAHRGEPYSFVTVTEFSEAFQSFHVGRRLGDELAIPFDKAKAHTAALTTK  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+K ELLKAC SRE LLMKRNSFVYIFKM QL+L+AF+ MT+FLRT+MP+ +IADG 
Sbjct  495   KYGVSKXELLKACISRELLLMKRNSFVYIFKMSQLILLAFIMMTLFLRTDMPRKTIADGW  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +F+G++FF ++M MFNGFSELAL+I+KLP FYKQRDL F+P WAY+LPTWILKIP+TLVE
Sbjct  555   IFLGSMFFTLMMIMFNGFSELALTIMKLPVFYKQRDLLFYPSWAYSLPTWILKIPITLVE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWV MTYY +GFDP+  RFF+Q  LL+CVNQMAS L RL AA GR++IVANTFGS A+
Sbjct  615   VAIWVFMTYYVVGFDPNIERFFRQYLLLLCVNQMASGLLRLMAALGRNIIVANTFGSFAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLV+GGF+LS+DDVK WW+WGYWISP+MY QNAI+VNE+LGKSWRHVP   +E LGV 
Sbjct  675   LAVLVMGGFVLSKDDVKPWWMWGYWISPMMYGQNAIAVNEFLGKSWRHVPENATEPLGVL  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRGIFPEA+WYW+GVGAL+GYVFL NFLF +AL YLNP GK Q +LSEETL E+++ 
Sbjct  735   VLKSRGIFPEAYWYWLGVGALIGYVFLFNFLFTVALAYLNPYGKHQTVLSEETLTEQSSR  794

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
                     +++ GS+                            + +RGM+LPFEPL I F
Sbjct  795   GTSSTGGDKIRSGSSRSL-------------------------SARRGMILPFEPLSIXF  829

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEI+YAVDMP EMKAQG+ E+RL LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  830   DEIRYAVDMPQEMKAQGIPENRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRK  889

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+GSI ISGYPK Q+TFARI+GYCEQTDIHSPHVTVYESL+YSAWLRLPPE+D+AT
Sbjct  890   TGGYIDGSIKISGYPKNQKTFARISGYCEQTDIHSPHVTVYESLLYSAWLRLPPEVDSAT  949

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVEL SLR+ALVGLPGV+GLSTEQRKRLT+AVELVANPSIIFMDEPTSGL
Sbjct  950   RKMFIEEVMELVELNSLRQALVGLPGVDGLSTEQRKRLTVAVELVANPSIIFMDEPTSGL  1009

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIY GPLG HS+
Sbjct  1010  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYAGPLGHHSA  1069

Query  3241  QLIRYFET-----------------INGIQRIRDGYNPATWMLEITSEAQEAALGIDFAE  3369
              LI+YFE                  I+G+ +I+DGYNPATWMLE+TS AQEAALGI+F +
Sbjct  1070  HLIKYFEVRSINTRDSRSSPYLPLGIDGVSKIKDGYNPATWMLEVTSAAQEAALGINFTD  1129

Query  3370  VYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYT  3549
             VY+NSELYRRNKALI+ELS P PGSKDLYFPT+YSQSFF QC  CLWKQHWSYWRNP YT
Sbjct  1130  VYKNSELYRRNKALIKELSTPPPGSKDLYFPTQYSQSFFAQCKTCLWKQHWSYWRNPSYT  1189

Query  3550  AVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIE  3729
             AVRLLFTTF A++FGT+FW +G +R+ QQDLFNAMG MY AV+F+G QNATSVQPVVAIE
Sbjct  1190  AVRLLFTTFIAVMFGTIFWDLGSRRQRQQDLFNAMGSMYCAVLFIGAQNATSVQPVVAIE  1249

Query  3730  RTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiff  3909
             RTVFYRE+AAGMYSALPYAFGQV+IELP++ +QT+IYGVIVYAMIGF+WT  KF W+IFF
Sbjct  1250  RTVFYREKAAGMYSALPYAFGQVMIELPYILIQTIIYGVIVYAMIGFDWTMTKFFWYIFF  1309

Query  3910  myftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYIC  4089
             MYFT LYFT YGMM VAV+PNHNIAAIISSAFY  WNLFSGFI+P+TRIPVWWRWYY+ C
Sbjct  1310  MYFTFLYFTFYGMMAVAVSPNHNIAAIISSAFYAIWNLFSGFIVPRTRIPVWWRWYYWCC  1369

Query  4090  PVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIF  4269
             P+SWTLYGLI SQFGD+K+KLDT ET++DFV+S+F F +DF+G VA +IVGI V+FGF F
Sbjct  1370  PISWTLYGLIGSQFGDMKDKLDTGETIEDFVRSYFGFRNDFLGIVAVVIVGITVLFGFTF  1429

Query  4270  AFSIKAFNFQTR  4305
             A+SI+AFNFQ R
Sbjct  1430  AYSIRAFNFQKR  1441



>ref|XP_008459146.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cucumis 
melo]
Length=1451

 Score =  2233 bits (5786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1090/1437 (76%), Positives = 1259/1437 (88%), Gaps = 6/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+S +EVFSRSSR+  +++   LKWA+IE+LPTYLR+RRGIL  + E    +EIDV+ 
Sbjct  19    IWRNSAMEVFSRSSRDEDDEEA--LKWASIERLPTYLRVRRGILNLDGESA--REIDVQN  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+R++LERLV+IA++DNE FLLKLK+R +RVG+DLP IEVRFEHL V+AEA+   R
Sbjct  75    LGLLERRNILERLVKIAEDDNERFLLKLKNRMERVGLDLPAIEVRFEHLEVEAEAHTAGR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FNF+ N+ E F++Y HI+PNRKK L ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPTMFNFSLNMFEGFLSYFHIIPNRKKQLSILHDVSGIIKPGRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
               LAGKL  DLK SGRVTYNGH M EFVP+RTSAYI+Q DLHIGEMTVRETL+FSARCQG
Sbjct  195   KTLAGKLGKDLKFSGRVTYNGHGMNEFVPQRTSAYISQQDLHIGEMTVRETLSFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+ML ELSRREK  NIKPDPD+D+ MKA ++ GQE +VVTDY+LKILGLE+CAD +
Sbjct  255   VGPRYDMLTELSRREKAANIKPDPDLDIIMKAAALGGQETNVVTDYVLKILGLEICADTM  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM RGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTT+QIVNS+RQSIHIL G
Sbjct  315   VGDEMFRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTYQIVNSMRQSIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETYELFDDIIL+SDGQVVYQGPR+NVLEFFQHMGF CP+RKGVADFLQE
Sbjct  375   TALISLLQPAPETYELFDDIILISDGQVVYQGPRENVLEFFQHMGFTCPQRKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW +R+E Y F++V EFSEAFQSFHVGKKLGDELA PFDKSKSHPAAL+ +
Sbjct  435   VTSRKDQEQYWTKRDEVYRFVSVEEFSEAFQSFHVGKKLGDELATPFDKSKSHPAALTTE  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG +KKELLKAC SRE LLMKRNSFVYIFK+ QL+LMAFV MT+F RTEM + ++ DG+
Sbjct  495   KYGASKKELLKACISRELLLMKRNSFVYIFKLTQLILMAFVTMTLFFRTEMRRRTVDDGS  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             V+MGALFFA+I+ MFNGFSELAL+ILKLP FYKQRD  FFPPWAY++PTWILKIP+T VE
Sbjct  555   VYMGALFFAIIIIMFNGFSELALTILKLPVFYKQRDFLFFPPWAYSIPTWILKIPITFVE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY +GFDP+AGRFFK   LL+CVNQMASALFRL  A GR++IVANTFGS A+
Sbjct  615   VGIWVVMTYYVVGFDPNAGRFFKHFLLLLCVNQMASALFRLIGALGRNIIVANTFGSFAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGF+L+RDDV  WWIWGYW SP+MYAQN I+VNE+LG  WRH    ++E+LGV 
Sbjct  675   LTVLVLGGFVLARDDVHPWWIWGYWTSPMMYAQNGIAVNEFLGHKWRHPGPNSTESLGVM  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRGIFP+A WYWIGVGA +GY+ L NFLF +AL YL+P  KPQA++S+ET  +++  
Sbjct  735   ILKSRGIFPQASWYWIGVGATIGYILLFNFLFTIALKYLDPFEKPQAVVSKETSTDKSVK  794

Query  2341  KRGEPIELEL--KGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             K  +  ELEL  KG STSE+        S  S +        A  N KRGMVLPFEP  I
Sbjct  795   KSQDVQELELSSKGKSTSERTENQISLSSRTSSARVGSFSEEAHQNKKRGMVLPFEPHSI  854

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
              FDEI+YAVDMP EMK+QG+TE+RL LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  855   AFDEIRYAVDMPQEMKSQGITENRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAG  914

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYIEG+ITISGYPK+QETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D+
Sbjct  915   RKTGGYIEGNITISGYPKKQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDS  974

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
             ATR+MFVEEVM+L+EL  LR+A+VGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTS
Sbjct  975   ATRKMFVEEVMELIELNPLRDAIVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTS  1034

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LL+RGGEEIYVGP+GRH
Sbjct  1035  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLRRGGEEIYVGPIGRH  1094

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SS LI YFE+I G+ +I+DGYNPATWMLEIT+ AQE  LG++F  +Y+ SELYRRNKALI
Sbjct  1095  SSHLIEYFESIEGVPKIKDGYNPATWMLEITTAAQETTLGVNFNTLYKASELYRRNKALI  1154

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             +ELS P   S +LYFPTKYSQSFF QC+ACLWKQH SYWRNPPY+AVR LFTTF AL+FG
Sbjct  1155  KELSVPNENSNELYFPTKYSQSFFIQCIACLWKQHLSYWRNPPYSAVRFLFTTFIALMFG  1214

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G KR TQQDLFNAMG MYAAV+F+GVQNATSVQPVVAIERTVFYRERAAGMYSA
Sbjct  1215  TIFWDLGSKRGTQQDLFNAMGSMYAAVLFIGVQNATSVQPVVAIERTVFYRERAAGMYSA  1274

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAFGQVVIELP++F+QT++YGVIVY MIGFEWTAAKF W+IFFMYFTLLYFT YGMMT
Sbjct  1275  LPYAFGQVVIELPYIFIQTVVYGVIVYGMIGFEWTAAKFFWYIFFMYFTLLYFTFYGMMT  1334

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNHNIAAI+SSAFYGFWNLFSGFI+P+TRIP+WWRWYY+ICPV+WTLYGL+ SQFG
Sbjct  1335  VAVTPNHNIAAIVSSAFYGFWNLFSGFIVPRTRIPIWWRWYYWICPVAWTLYGLVTSQFG  1394

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+ + +D+N+TV +FV ++F +++DF+G +A + VGI V+FGFIFAFSIK FNFQ R
Sbjct  1395  DINDPMDSNQTVAEFVSNYFGYEYDFLGVIAAVHVGITVLFGFIFAFSIKVFNFQKR  1451



>ref|XP_004156752.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 
1-like [Cucumis sativus]
Length=1451

 Score =  2231 bits (5782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1090/1437 (76%), Positives = 1262/1437 (88%), Gaps = 6/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+S +EVFSRSSR+  +++   LKWA+IE+LPTYLR+RRGIL  + E    +EIDV+ 
Sbjct  19    IWRNSAMEVFSRSSRDDDDEEA--LKWASIERLPTYLRVRRGILNLDGESA--REIDVQN  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+R++LERLV+IA++DNE FLLKLK+R +RVG+DLP IEVRFEHL V+AEA+   R
Sbjct  75    LGLLERRNILERLVKIAEDDNERFLLKLKNRMERVGLDLPAIEVRFEHLEVEAEAHTAGR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FNF+ N+LE F++Y HI+PNRKK L ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPTMFNFSLNMLEGFLSYFHIIPNRKKQLSILHDVSGIIKPGRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
               LAGKL  DLK SGRVTYNGH M EFVP+RTSAYI+Q DLHIGEMTVRETL+FSARCQG
Sbjct  195   KTLAGKLGKDLKFSGRVTYNGHGMNEFVPQRTSAYISQQDLHIGEMTVRETLSFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+ML ELSRREK  NIKPDPD+D+ MKA ++ GQE +VVTDY+LKILGLE+CAD +
Sbjct  255   VGPRYDMLTELSRREKAANIKPDPDLDIIMKAAALGGQETNVVTDYVLKILGLEICADTM  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM RGISGGQ+KR+TTGEMLVGP+RALFMDEISTGLDSSTT+QIVNS+RQ IHIL G
Sbjct  315   VGDEMFRGISGGQKKRVTTGEMLVGPSRALFMDEISTGLDSSTTYQIVNSMRQYIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETYELFDDIIL+SDGQVVYQGPR+NVLEFFQHMGF CP+RKGVADFLQE
Sbjct  375   TALISLLQPAPETYELFDDIILISDGQVVYQGPRENVLEFFQHMGFTCPQRKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW +R+E Y F++V EFSEAF SFHVGKKLGDELA PFDKSKSHPAAL+ +
Sbjct  435   VTSRKDQEQYWTKRDEVYRFVSVEEFSEAFXSFHVGKKLGDELATPFDKSKSHPAALTTE  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG +KKELLKAC SRE LLMKRNSFVYIFK+IQL+LMAFV MT+F RTEM + ++ DG+
Sbjct  495   KYGASKKELLKACISRELLLMKRNSFVYIFKLIQLILMAFVTMTLFFRTEMHRRTVDDGS  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             V+MGALFFA+I+ MFNGFSELAL+ILKLP FYKQRD  FFPPWAY++PTWILKIP+T VE
Sbjct  555   VYMGALFFAIIIIMFNGFSELALTILKLPVFYKQRDFLFFPPWAYSIPTWILKIPITFVE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY +GFDP+AGRFFK   +L+ VNQMASALFRL  A GR++IVANTFGS A+
Sbjct  615   VGIWVVMTYYVVGFDPNAGRFFKHFLMLLFVNQMASALFRLIGALGRNIIVANTFGSFAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGF+L+RDDV  WWIWGYWISP+MYAQN I+VNE+LG  WRH    ++E+LGV 
Sbjct  675   LTVLVLGGFVLARDDVHPWWIWGYWISPMMYAQNGIAVNEFLGHKWRHPAPNSNESLGVL  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRGIFP+A WYWIGVGA +GY+ L NFLF +AL YL+P  KPQA++S+ET  +++  
Sbjct  735   ILKSRGIFPQASWYWIGVGATIGYILLFNFLFTIALQYLDPFEKPQAIVSKETSTDKSVK  794

Query  2341  KRGEPIELEL--KGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             K  +  ELEL  KG S+SE+        S  S +        A+ N KRGMVLPFEP  I
Sbjct  795   KSQDVQELELSSKGKSSSERTENQISLSSRTSSARVGSFSEEANQNKKRGMVLPFEPHSI  854

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFDEI+YAVDMP EMK+QG+TEDRL LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  855   TFDEIRYAVDMPQEMKSQGVTEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAG  914

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYIEG+ITISGYPK+QETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPP++D+
Sbjct  915   RKTGGYIEGNITISGYPKKQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPDVDS  974

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
             ATR+MFVEEVM+L+EL  LR+A+VGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTS
Sbjct  975   ATRKMFVEEVMELIELNPLRDAIVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTS  1034

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LL+RGGEEIYVGP+GRH
Sbjct  1035  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLRRGGEEIYVGPVGRH  1094

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SSQLI YFE+I G+ +I+DGYNPATWMLEIT+ AQE  LG++F  +Y++SELYRRNKALI
Sbjct  1095  SSQLIEYFESIEGVPKIKDGYNPATWMLEITTAAQETTLGVNFNTLYKDSELYRRNKALI  1154

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             +ELS P   S +LYFPTKYSQSFF QC+ACLWKQH SYWRNPPY+AVR LFTTF AL+FG
Sbjct  1155  KELSVPNENSNELYFPTKYSQSFFIQCIACLWKQHLSYWRNPPYSAVRFLFTTFIALMFG  1214

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G KR TQQDLFNAMG MYAAV+F+GVQNATSVQPVVAIERTVFYRERAAGMYSA
Sbjct  1215  TIFWDLGSKRGTQQDLFNAMGSMYAAVLFIGVQNATSVQPVVAIERTVFYRERAAGMYSA  1274

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAFGQVVIELP++F+QT++YGVIVY MIGFEWTAAKF W+IFFMYFTLLYFT YGMMT
Sbjct  1275  LPYAFGQVVIELPYIFIQTVVYGVIVYGMIGFEWTAAKFFWYIFFMYFTLLYFTFYGMMT  1334

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNHNIAAI+SSAFYGFWNLFSGFI+P+TRIP+WWRWYY+ICPV+WTLYGL+ SQFG
Sbjct  1335  VAVTPNHNIAAIVSSAFYGFWNLFSGFIVPRTRIPIWWRWYYWICPVAWTLYGLVTSQFG  1394

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+ + +D+N+TV +FV ++F + +DF+G VA + VGI V+FGFIFAFSIK FNFQ R
Sbjct  1395  DINDPMDSNQTVAEFVSNYFGYKYDFLGVVAAVHVGITVLFGFIFAFSIKVFNFQKR  1451



>ref|XP_008392127.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Malus domestica]
Length=1477

 Score =  2228 bits (5774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1113/1461 (76%), Positives = 1279/1461 (88%), Gaps = 30/1461 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+S ++VFS+SS +  +++   LKWAAIEKLPTYLRIRRGIL  EEEG G +EIDV+ 
Sbjct  21    IWRNSTMDVFSKSSHDEDDEEA--LKWAAIEKLPTYLRIRRGILT-EEEGKG-REIDVKN  76

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++++LERLV+ A+EDNE FLLKLK R +RVG+D+PTIEVR+EHLNV+AEAYVG R
Sbjct  77    LGLLERKNVLERLVKTAEEDNEKFLLKLKDRINRVGLDMPTIEVRYEHLNVEAEAYVGGR  136

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF ANILE  +N++HILP+RK PLP+L DVSGIIKP RMTLLLGPP SGKTTLL
Sbjct  137   ALPTIFNFVANILEGCLNFVHILPSRKHPLPMLTDVSGIIKPRRMTLLLGPPGSGKTTLL  196

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRV YNGH M EFVP RTSAYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  197   LALAGKLAKDLKFSGRVAYNGHGMEEFVPERTSAYISQHDLHIGEMTVRETLAFSARCQG  256

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEMLAELSRREKE NI PDPD D+YMKA S+EGQE SVVTDYILK+LGLEVCADI+
Sbjct  257   VGPRYEMLAELSRREKEANIMPDPDXDIYMKAASLEGQETSVVTDYILKVLGLEVCADIM  316

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQIV S+R+SIHIL G
Sbjct  317   VGDEMVRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVKSLRESIHILSG  376

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDII+LSDGQ+VYQGPR+NVLEFF+HMGFKCPERKGVADFLQE
Sbjct  377   TAVISLLQPAPETYDLFDDIIVLSDGQIVYQGPRENVLEFFEHMGFKCPERKGVADFLQE  436

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQYW  +EE Y FI+  EF EAFQSFH+G+KLGDELA PFDKSK HPAAL+ +
Sbjct  437   VTSKKDQEQYWADKEEPYNFISSKEFXEAFQSFHIGRKLGDELATPFDKSKGHPAALTTQ  496

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC  REFLLMKRNSFVYIFKM QL L+AF++MT+FLRTEM KN++ DG 
Sbjct  497   KYGVSKKELLKACIDREFLLMKRNSFVYIFKMTQLTLLAFISMTLFLRTEMHKNTVDDGG  556

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +FMGA+FF VI+ MFNGFSELA++I+KLP F+KQRDL F+P WAY+LPTWILKIP++ VE
Sbjct  557   IFMGAMFFTVIIVMFNGFSELAMTIMKLPVFFKQRDLLFYPAWAYSLPTWILKIPISFVE  616

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV MTYY IGFDP+  RFF+Q  LL+ +NQMAS LFR   A GR++IVANTFGS A+
Sbjct  617   VAVWVVMTYYVIGFDPNIERFFRQYLLLLLLNQMASGLFRFMGALGRNIIVANTFGSFAL  676

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGF+LSRDDVKKWW+WGYW SP+MY QNAI+VNE+LG SW HVP  ++E+LG+ 
Sbjct  677   LAVLVLGGFVLSRDDVKKWWVWGYWASPMMYGQNAIAVNEFLGDSWSHVPPNSTESLGIM  736

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLN--------------------  2280
             VL+SRG+F E +WYWIGVGA VGY+FL NF + LAL +LN                    
Sbjct  737   VLKSRGVFIEPYWYWIGVGATVGYIFLFNFFYTLALKFLNRKYLCTYVFWYFHMNIITND  796

Query  2281  ------PLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrrsvssrslssr  2442
                      KPQA+LS+E LAE+   + G+ +EL  +G ++S+  N  RRSVS R+LS+R
Sbjct  797   PNNYFAAFEKPQAVLSKEALAEKLTDQTGDSVELSSRGKNSSDPRNESRRSVSLRTLSAR  856

Query  2443  vgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFR  2622
             VGS+  A+ N KRGMVLPFEPL ITFDEIKYAVDMP EMK QG+TEDRL LLKG+ GAFR
Sbjct  857   VGSITEANQNKKRGMVLPFEPLWITFDEIKYAVDMPQEMKTQGVTEDRLPLLKGVTGAFR  916

Query  2623  PGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIH  2802
             PGVLTALMGISGAGKTTLMDVLAGRKTGG+IEG+ITISGYPK+QETFARI+GYCEQTDIH
Sbjct  917   PGVLTALMGISGAGKTTLMDVLAGRKTGGFIEGNITISGYPKKQETFARISGYCEQTDIH  976

Query  2803  SPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQ  2982
             SPHVTVYESLVYSA LRLPPE+D+ TR+MF+EEVM+LVELTS+REALVGLPGVNGLSTEQ
Sbjct  977   SPHVTVYESLVYSASLRLPPEVDSXTRKMFIEEVMELVELTSIREALVGLPGVNGLSTEQ  1036

Query  2983  RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF  3162
             RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF
Sbjct  1037  RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF  1096

Query  3163  DAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQE  3342
             DAFDEL LLKRGGEEIYVGP GRHS+ LI+YFE I+G+ +I+DGYNPATWMLEIT+ AQE
Sbjct  1097  DAFDELFLLKRGGEEIYVGPXGRHSAHLIKYFEDIDGVPKIKDGYNPATWMLEITAAAQE  1156

Query  3343  AALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHW  3522
             A LG++F E+YRNSELYRRNKA+I+ELS P  GSKDLYFPT+YSQSFF+QCMACLWKQH 
Sbjct  1157  AVLGVNFTEIYRNSELYRRNKAMIKELSTPPAGSKDLYFPTQYSQSFFSQCMACLWKQHL  1216

Query  3523  SYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNAT  3702
             SYWRNPPY+AVRLLFTTF AL+FGT+FW +G KRR QQDLFNAMG +YAAV+F+G QN++
Sbjct  1217  SYWRNPPYSAVRLLFTTFIALMFGTIFWDLGSKRRNQQDLFNAMGSIYAAVLFIGXQNSS  1276

Query  3703  SVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTA  3882
             SVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELP++FVQT+IYGVIVY MIGFEWT 
Sbjct  1277  SVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPYIFVQTIIYGVIVYTMIGFEWTV  1336

Query  3883  AKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPV  4062
             +KFLW+IFFMYFT LYFT YGMMTVAVTPNHNI AI++SAFY  WNLFSGFI+P+TR+P+
Sbjct  1337  SKFLWYIFFMYFTFLYFTFYGMMTVAVTPNHNIGAIVASAFYAIWNLFSGFIVPRTRMPI  1396

Query  4063  WWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVG  4242
             WWRWYY+ICPVS+TLYGLIASQFGD+K+K D+ E+V+ FV+++F +  D +G VA + VG
Sbjct  1397  WWRWYYWICPVSYTLYGLIASQFGDIKDKFDSGESVEHFVRNYFGYRRDLLGVVAAVHVG  1456

Query  4243  ICVMFGFIFAFSIKAFNFQTR  4305
             ICV+FGF FAFSIKAFNFQ R
Sbjct  1457  ICVLFGFTFAFSIKAFNFQKR  1477



>ref|XP_009334795.1| PREDICTED: pleiotropic drug resistance protein 1-like [Pyrus 
x bretschneideri]
Length=1451

 Score =  2227 bits (5770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1106/1435 (77%), Positives = 1275/1435 (89%), Gaps = 4/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+S ++VFS+SS +A +++   LKWAAIEKLPTYLRI+RGIL  EEEG G +EID++ 
Sbjct  21    IWRNSTMDVFSKSSHDADDEEA--LKWAAIEKLPTYLRIQRGILT-EEEGKG-REIDIKN  76

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++++LERLV+ A EDNE FLLKLK R +RVG+D+PTIEVRFEHLNV+AEAYVG R
Sbjct  77    LGLLERKNVLERLVKTADEDNEKFLLKLKDRINRVGLDIPTIEVRFEHLNVEAEAYVGGR  136

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF ANILE  +N++H+LP+RK PLPIL DVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  137   ALPTIFNFLANILEGSLNFVHVLPSRKHPLPILADVSGIIKPRRMTLLLGPPSSGKTTLL  196

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRV YNGH M EFVP RTSAYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  197   LALAGKLAKDLKFSGRVEYNGHGMEEFVPERTSAYISQHDLHIGEMTVRETLAFSARCQG  256

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEMLAELSRREKE NI PDPD+D+YMKA S++GQE +VVTDYILKILGLEVC+DI+
Sbjct  257   VGPRYEMLAELSRREKEANIIPDPDLDIYMKAASLQGQETNVVTDYILKILGLEVCSDIM  316

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQ+KRLTTGEMLVGPARALFMDEISTGLDSSTTFQIV S+R+SIHIL G
Sbjct  317   VGDEMVRGISGGQKKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVKSLRESIHILSG  376

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVL+FF+HMGFKCPERKGVADFLQE
Sbjct  377   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLDFFEHMGFKCPERKGVADFLQE  436

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQYW  +EE Y FI+  EF+EAFQSFH G+KLGDELA PF+KS  HPAAL+ +
Sbjct  437   VTSKKDQEQYWADKEEPYGFISSKEFAEAFQSFHTGRKLGDELATPFEKSMGHPAALTTQ  496

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC  REFLLMKRNSFVYIFKM QL LMAF++MT+F RT + KN++ DG 
Sbjct  497   KYGVSKKELLKACIDREFLLMKRNSFVYIFKMTQLTLMAFISMTLFCRTNLHKNTVDDGG  556

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +FMGA+FFAV+M MFNGFSELA++I+KLP F+KQRDL F+P WAY+LPTWILKIP++ VE
Sbjct  557   IFMGAMFFAVVMIMFNGFSELAMTIMKLPVFFKQRDLLFYPAWAYSLPTWILKIPISFVE  616

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV MTYY IGFDP+  RF KQ  LL+ +NQMAS LFR   A GR++IVANTFGS A+
Sbjct  617   VAVWVIMTYYVIGFDPNFERFLKQYLLLLLLNQMASGLFRFMGALGRNIIVANTFGSFAL  676

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGF+LSRD+V KWW+WGYW SP+MY QNAI+VNE+LG SW HVP  + E+LG+ 
Sbjct  677   VAVLVLGGFVLSRDNVMKWWVWGYWASPMMYGQNAIAVNEFLGDSWSHVPPNSIESLGIM  736

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+S G+F E +WYW+GVGA +GY+FL NF + LAL +LNP GKPQA+LS+E  AE+ A 
Sbjct  737   ILKSHGVFLEPYWYWLGVGATIGYIFLFNFFYTLALKFLNPFGKPQAVLSKEAFAEKLAD  796

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K G+ +EL  +G ++S+  N  RRSVSSR+LS+RVGS++  + N KRGMVLPFEPL ITF
Sbjct  797   KAGDSVELSSRGKNSSDSRNESRRSVSSRTLSARVGSISEVNGNKKRGMVLPFEPLWITF  856

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEI YAVDMP EMK QG+TEDRL LLKG+ GAFRPGVLTALMGISGAGKTTLMDVLAGRK
Sbjct  857   DEINYAVDMPQEMKTQGVTEDRLQLLKGVTGAFRPGVLTALMGISGAGKTTLMDVLAGRK  916

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+ITISGYPK+QETFARI+GYCEQTDIHSPHVTVYESL YSA LRLPPE+D+ T
Sbjct  917   TGGYIEGNITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLAYSASLRLPPEVDSTT  976

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R MF+EEVM+LVEL S+REALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  977   RRMFIEEVMELVELISIREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1036

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS
Sbjct  1037  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  1096

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I+G+ +I+DGYNPATWMLEIT+ AQEA++G++F E+YRNSELY RNKA+I+E
Sbjct  1097  HLIKYFEDIDGVPKIKDGYNPATWMLEITAAAQEASIGVNFTEIYRNSELYGRNKAMIKE  1156

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P  GSKDLYFPT+YSQSFF+QCMACLWKQH SYWRNPPY+AVRLLFTTF AL+FGT+
Sbjct  1157  LSTPPAGSKDLYFPTQYSQSFFSQCMACLWKQHLSYWRNPPYSAVRLLFTTFIALMFGTI  1216

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR ++QDLFNAMG MYAAV+F+GVQNA SVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1217  FWDLGSKRTSRQDLFNAMGSMYAAVLFIGVQNAASVQPVVAIERTVFYRERAAGMYSALP  1276

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQVVIELP++FVQT+IYGVIVY MIGF+WT +KFLW++FFMYFT LYFT YGMMTVA
Sbjct  1277  YAFGQVVIELPYIFVQTIIYGVIVYTMIGFDWTVSKFLWYLFFMYFTFLYFTFYGMMTVA  1336

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNIAAI+SSAFY  WNLFSGFI+P+TR+P+WWRWYY+ICPVS+TLYGL+ASQFGD+
Sbjct  1337  VTPNHNIAAIVSSAFYAIWNLFSGFIVPRTRMPIWWRWYYWICPVSYTLYGLVASQFGDI  1396

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              +K DT E+V+ FV+ +F +  DF+G VA + VGICV+FGF FAFSIK FNFQ R
Sbjct  1397  NDKFDTGESVEHFVRDYFGYRRDFLGAVAAVHVGICVLFGFTFAFSIKVFNFQKR  1451



>ref|XP_007227084.1| hypothetical protein PRUPE_ppa000234mg [Prunus persica]
 gb|EMJ28283.1| hypothetical protein PRUPE_ppa000234mg [Prunus persica]
Length=1421

 Score =  2223 bits (5760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1095/1415 (77%), Positives = 1255/1415 (89%), Gaps = 20/1415 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIEKLPTYLRIRRGIL   E  G  +EID++ LG  E+RS               F
Sbjct  23    LKWAAIEKLPTYLRIRRGILTEAE--GQAREIDIKNLGSLERRS--------------KF  66

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK R +RVG+D+PTIEVRFEHL+V+AEAYVG RALPTIFNF  NILE F+N++H+LP
Sbjct  67    LLKLKDRINRVGLDIPTIEVRFEHLSVEAEAYVGGRALPTIFNFCVNILEGFLNFVHVLP  126

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK+PLPIL DVSGIIKP RMTLLLGPPSSGKTTLLLALAGKL  +LK SGRV YNGH M
Sbjct  127   SRKQPLPILDDVSGIIKPRRMTLLLGPPSSGKTTLLLALAGKLAKELKFSGRVAYNGHGM  186

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP RTSAYI+QHDLHIGEMTVRETLAFSARCQGVG RYEMLAELSRREK  NI PD 
Sbjct  187   EEFVPERTSAYISQHDLHIGEMTVRETLAFSARCQGVGPRYEMLAELSRREKAANIMPDA  246

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             D+D+YMKA S+EGQE +VVTDYILKILGLEVCADI+VGDEM+RGISGGQ+KR+TTGEMLV
Sbjct  247   DLDIYMKAASLEGQETNVVTDYILKILGLEVCADIMVGDEMVRGISGGQKKRVTTGEMLV  306

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQIVNS+RQSIHIL GTA+ISLLQPAPETY+LFDDIILLS
Sbjct  307   GPARALFMDEISTGLDSSTTFQIVNSLRQSIHILSGTALISLLQPAPETYDLFDDIILLS  366

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR+NVLEFF+HMGFKCPERKGVADFLQEVTS+KDQEQYW ++EE Y FI+  
Sbjct  367   DGQIVYQGPRENVLEFFEHMGFKCPERKGVADFLQEVTSKKDQEQYWAQKEEPYNFISSK  426

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQSFH+G+KLGDELA PFDKSK HPAAL+  KYGV+KKELLKAC SRE+LLMKRN
Sbjct  427   EFAEAFQSFHIGRKLGDELATPFDKSKGHPAALTTMKYGVSKKELLKACISREYLLMKRN  486

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFKM QL LMAF++MT+FLRT+M ++++ADG ++MGA+FF +I+ MFNGFSELA++
Sbjct  487   SFVYIFKMTQLTLMAFMSMTLFLRTKMHRDTVADGGIYMGAMFFTIIIIMFNGFSELAMT  546

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I+KLP F+KQRDL F+P WAY+LPTWILKIP+T +E A+WV MTYY IGFDP+  RFFKQ
Sbjct  547   IMKLPVFFKQRDLLFYPSWAYSLPTWILKIPITFIECAVWVVMTYYVIGFDPNIERFFKQ  606

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+C+NQMAS LFR   A GR++IVANTFGS A++ VLV+GGFILSR+DV+KWW+WGY
Sbjct  607   YLLLLCLNQMASGLFRFMGALGRNIIVANTFGSFALLAVLVMGGFILSREDVQKWWLWGY  666

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W+SP+MY QNAI+VNE+LGKSW HVP  ++E+LG+ VL+SRG+F E +WYWIGVGA +GY
Sbjct  667   WVSPMMYGQNAIAVNEFLGKSWSHVPPNSTESLGIMVLKSRGVFIEPYWYWIGVGATIGY  726

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             +FL NF + LAL YL+P GKPQA+LS+E LAE+ + + G+ IEL  +G ++S+  N  RR
Sbjct  727   IFLFNFFYTLALKYLDPFGKPQAILSKEALAEKTSDRTGDSIELSSRGKNSSDSRNESRR  786

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
             SVSSR+LSSRVGS+  A+ N KRGMVLPFEPL ITFDEI YAVDMP EMK QG+TEDRL 
Sbjct  787   SVSSRTLSSRVGSITEANENRKRGMVLPFEPLWITFDEITYAVDMPEEMKTQGITEDRLK  846

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG+ GAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEG+ITISG+PK+QETFARI
Sbjct  847   LLKGVTGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGNITISGHPKKQETFARI  906

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D++TR+MFVEEVM+LVELT +REALVGL
Sbjct  907   SGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSSTRKMFVEEVMELVELTPIREALVGL  966

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  967   PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1026

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDEL LLKRGGEEIYVGPLGRHS+ LI+YFE I+G+ +I+DGYNPATW
Sbjct  1027  TIHQPSIDIFDAFDELFLLKRGGEEIYVGPLGRHSTHLIKYFEEIDGVPKIKDGYNPATW  1086

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             ML+IT+ AQEAALG++F E+Y+NSELY RNKALI++LS P  GSKDLYFPT+YSQSFF+Q
Sbjct  1087  MLDITAAAQEAALGVNFTEIYKNSELYGRNKALIKDLSTPPAGSKDLYFPTQYSQSFFSQ  1146

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQH SYWRNPPY+AVRLLFTTF AL+FGT+FW +G KRR+QQDLFNAMG MYAA
Sbjct  1147  CMACLWKQHLSYWRNPPYSAVRLLFTTFIALMFGTIFWDLGSKRRSQQDLFNAMGSMYAA  1206

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+F+GVQNA+SVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELP++FVQT+IYGVIV
Sbjct  1207  VLFIGVQNASSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPYIFVQTIIYGVIV  1266

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             YAMIGF+WT +KFLW++FFMYFT LYFT YGMMTVAVTPNHNIAAI+SSAFY  WNLFSG
Sbjct  1267  YAMIGFDWTVSKFLWYLFFMYFTFLYFTFYGMMTVAVTPNHNIAAIVSSAFYAIWNLFSG  1326

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffd----f  4200
             FIIP+TR+P+WWRWYY+ICPVS+TLYGL+ASQFGD+KE  D+ E+    V+ F      +
Sbjct  1327  FIIPRTRMPIWWRWYYWICPVSYTLYGLVASQFGDIKEIFDSGESAGKSVEHFVKDYFGY  1386

Query  4201  dhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
               DF+G VA + VGICV+FGF FAFSIK FNFQ R
Sbjct  1387  RQDFLGVVAAVHVGICVLFGFTFAFSIKVFNFQKR  1421



>ref|XP_010049001.1| PREDICTED: pleiotropic drug resistance protein 1-like [Eucalyptus 
grandis]
 gb|KCW81448.1| hypothetical protein EUGRSUZ_C02833 [Eucalyptus grandis]
Length=1466

 Score =  2220 bits (5753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1097/1437 (76%), Positives = 1274/1437 (89%), Gaps = 6/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG E+FSRSSR+  +++   LKWAA+EKLPTYLRI+RGILA EE  G   E+D+  
Sbjct  34    IWRTSGREIFSRSSRDEDDEEA--LKWAALEKLPTYLRIQRGILAEEE--GQITEVDIWN  89

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+R+LLERL++ A+EDNE FLLKLK R DRVG+D+PTIEVRFEHLNV+AEA+VGSR
Sbjct  90    LGLIERRNLLERLLKTAEEDNEKFLLKLKQRIDRVGLDIPTIEVRFEHLNVEAEAHVGSR  149

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNFT NI+E F+N  HILP+RKKPLPIL+DVSGIIKP RMTLLLGPP  GKTTLL
Sbjct  150   ALPTIFNFTVNIVEGFLNCFHILPSRKKPLPILNDVSGIIKPHRMTLLLGPPGCGKTTLL  209

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD DLK SGRVTYNGHEM EFVP+RTSAYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  210   LALAGKLDKDLKFSGRVTYNGHEMEEFVPQRTSAYISQHDLHIGEMTVRETLAFSARCQG  269

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+ML ELSRREK  NIKPDPDID++MKA S++GQE +VVTDYILKILGLE+CADI+
Sbjct  270   VGPRYDMLTELSRREKAANIKPDPDIDIFMKAASLKGQETNVVTDYILKILGLEICADIM  329

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQ+KR+TTGEMLVGPA+ALFMDEISTGLDSSTTFQIVNS+RQS+HIL G
Sbjct  330   VGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSLRQSVHILNG  389

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF HMGF+CPERKGVADFLQE
Sbjct  390   TALISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFGHMGFRCPERKGVADFLQE  449

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++  Y F+TV EFSEAFQSFH+G+KLGD+LA+PFDKS+SHPAAL+ +
Sbjct  450   VTSRKDQEQYWANKDSPYRFVTVKEFSEAFQSFHIGRKLGDQLAMPFDKSRSHPAALTTE  509

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV++KELL+AC SRE LLMKRNSFVY+FKM QL+L+AF+ MTVFLRTEM ++++ DG 
Sbjct  510   KYGVSRKELLRACISRELLLMKRNSFVYVFKMCQLILVAFITMTVFLRTEMHRDTVTDGG  569

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF +I+ MFNGFSELA++I+KLP FYKQRD  FFP W YALPTWILKIP+++VE
Sbjct  570   IYFGALFFTLIIIMFNGFSELAMTIMKLPVFYKQRDFLFFPEWTYALPTWILKIPISIVE  629

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV MTYY IG+DPDAGR FKQ  LL+C+NQMASALFR   A GR++IVANTFGS  +
Sbjct  630   VAVWVFMTYYVIGYDPDAGRLFKQYLLLLCLNQMASALFRFIGAVGRNMIVANTFGSFGL  689

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + ++VLGGFI+SR D+K WWIWGYW SP+MY QNAI+VNE+LGK WRH+P+  +E LGV+
Sbjct  690   LAIMVLGGFIISRVDIKPWWIWGYWSSPMMYGQNAIAVNEFLGKQWRHIPANATEPLGVS  749

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRGIFPEA WYWIGVGA +GY+ L NFLF +AL YLNP GKPQA+LS+ETL E+ A 
Sbjct  750   VLKSRGIFPEARWYWIGVGASIGYIVLFNFLFTVALKYLNPFGKPQAVLSKETLVEKVAS  809

Query  2341  KRGEPIEL--ELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             K GE IEL       S+S+K +  + S +S +LS+R GS N +DPN KRGMVLPFEPL I
Sbjct  810   KHGEVIELSSRGSQRSSSKKESGHQGSAASGTLSTRGGSTNDSDPNRKRGMVLPFEPLSI  869

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
              FD+++YAVDMP EMKAQG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  870   AFDDVRYAVDMPQEMKAQGILEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  929

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYI+G+ITISGYPK+QETFARI+GYCEQTDIHSPHVTVYESL YSAWLRLP E+D+
Sbjct  930   RKTGGYIDGTITISGYPKQQETFARISGYCEQTDIHSPHVTVYESLAYSAWLRLPSEVDS  989

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
              TR+MF+EEVM+L+ELT LREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS
Sbjct  990   ETRKMFIEEVMELIELTPLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  1049

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL LLKRGG+EIYVGPLG+H
Sbjct  1050  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLLKRGGQEIYVGPLGQH  1109

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             SS LI YFE I+G+ +I+DGYNPATWMLE+T+ AQE  LG +F EVYRNSEL+RRNK LI
Sbjct  1110  SSHLIDYFEGISGVSKIKDGYNPATWMLEVTAAAQEEILGFNFTEVYRNSELFRRNKTLI  1169

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
              ELS P PGSKDLYFP +YSQSFFTQCMACLWKQ+WSYWRNP YTAVRLLFTTF AL+FG
Sbjct  1170  NELSTPPPGSKDLYFPAQYSQSFFTQCMACLWKQYWSYWRNPSYTAVRLLFTTFIALMFG  1229

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G KR  QQDLFNA+G MYAA +F+G QN+TSVQPVVAIERTVFYRER AGMYSA
Sbjct  1230  TIFWNLGSKRGNQQDLFNAIGSMYAACLFIGFQNSTSVQPVVAIERTVFYRERGAGMYSA  1289

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAF QVVIE+P+ F+QT+ YGVIVY+MIGF+WTA+KF W+IF M+F+LLYFT YGMM+
Sbjct  1290  LPYAFAQVVIEIPYTFLQTVTYGVIVYSMIGFDWTASKFFWYIFCMFFSLLYFTYYGMMS  1349

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPN +IAAI SSAFY  WNLFSGF++P+ R+PVWWRWYY+  P+SWTLYGL+ASQFG
Sbjct  1350  VAVTPNQHIAAITSSAFYAIWNLFSGFVVPRPRMPVWWRWYYWADPISWTLYGLVASQFG  1409

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+K +LDT ETVKDFV+S+F + HDF+G VA ++VG+ V+FGFIFAFSI+AFNFQ R
Sbjct  1410  DIKHQLDTGETVKDFVRSYFGYKHDFLGVVAAVLVGLPVLFGFIFAFSIRAFNFQKR  1466



>ref|XP_010254262.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Nelumbo nucifera]
Length=1455

 Score =  2215 bits (5740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1091/1415 (77%), Positives = 1248/1415 (88%), Gaps = 6/1415 (0%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPTY RIR+G+L+    GG  KEID+E L + EK+ LLERL++IA EDNE+F
Sbjct  43    LKWAALEKLPTYNRIRKGLLSGV--GGETKEIDIESLSLQEKKVLLERLLKIADEDNENF  100

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVG+D+P IEVRFEHLNVDAEAYVGSRALPTIFN++ N+ E F+NYLHILP
Sbjct  101   LLKLKNRIDRVGLDIPKIEVRFEHLNVDAEAYVGSRALPTIFNYSVNMFEEFLNYLHILP  160

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKKPL ILHDVSGIIKP RMTLLLGPP SGKTTLLLALAGKL SD+K SGRVTYNGH+M
Sbjct  161   SRKKPLSILHDVSGIIKPCRMTLLLGPPGSGKTTLLLALAGKLGSDVKFSGRVTYNGHKM  220

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+Q+DLHIGEMTVRETLAFSARCQGVG  YEMLAELSRREKE NIKPDP
Sbjct  221   NEFVPQRTAAYISQYDLHIGEMTVRETLAFSARCQGVGTGYEMLAELSRREKETNIKPDP  280

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID+YMKA ++EGQEASVVTDYILKILGLE+CAD LVGDEM RGISGGQ+KR+TTGEMLV
Sbjct  281   DIDIYMKAAALEGQEASVVTDYILKILGLEICADTLVGDEMFRGISGGQKKRVTTGEMLV  340

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQI+NS+RQSIHIL GTA+ISLLQPAPETYELFDDIILLS
Sbjct  341   GPARALFMDEISTGLDSSTTFQILNSLRQSIHILNGTALISLLQPAPETYELFDDIILLS  400

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQEVTS KDQEQYW R++E Y FI V 
Sbjct  401   DGQIVYQGPRENVLEFFESMGFKCPERKGVADFLQEVTSWKDQEQYWARKDEPYRFIPVK  460

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQSFHVG KLGDELA PFDK+KSHPA+L+ KKYGV+KKELLKAC SRE LLMKRN
Sbjct  461   EFAEAFQSFHVGLKLGDELANPFDKTKSHPASLTTKKYGVSKKELLKACISRELLLMKRN  520

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
              FVYIFKM QL ++ F+AMT+FLR +M ++S+ DG +++GALFF ++M MFNG+SELAL+
Sbjct  521   YFVYIFKMTQLTILGFIAMTLFLRIKMHRDSVIDGGIYIGALFFTLMMIMFNGYSELALT  580

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             ILKLP FYKQRDL F+P WAY+LPTWILKIP T  EVA+WV MTYY IGFDP+ GR FKQ
Sbjct  581   ILKLPVFYKQRDLLFYPSWAYSLPTWILKIPYTFFEVAVWVFMTYYVIGFDPNVGRLFKQ  640

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ VNQMAS LFR   A GR +IVANTFGS +++ +LV+GGF++SR+DVKKWW WGY
Sbjct  641   YLLLLGVNQMASGLFRFIGAVGRDMIVANTFGSFSLLAILVMGGFVVSREDVKKWWKWGY  700

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             WISP+MY QNAI+VNE+LG SW HVP  ++E LGVTVL+SRGIFP+A+WYW+GVGALVGY
Sbjct  701   WISPMMYGQNAIAVNEFLGNSWSHVPPNSTEPLGVTVLKSRGIFPKAYWYWLGVGALVGY  760

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGS----TSEKgn  2400
             +FL N LF LAL+YLNP GKPQ ++SEE+L E+ A + GE I+L  +  S    TS    
Sbjct  761   MFLFNVLFTLALSYLNPFGKPQPVVSEESLNEKWANRTGEFIKLSSREKSSVCQTSSTEE  820

Query  2401  vvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTE  2580
                    S  +S         + N KRGMVLPF+PL ITFDEI+Y+VDMP E+KAQG+ E
Sbjct  821   GNEMRSMSSGISPASTETINGNQNRKRGMVLPFQPLSITFDEIRYSVDMPQELKAQGVPE  880

Query  2581  DRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQET  2760
             D+L LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAGRKT GYI+G ITISGYPK+QET
Sbjct  881   DQLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTCGYIDGCITISGYPKKQET  940

Query  2761  FARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREA  2940
             FARI+GYCEQ DIHSPHVTVYE+L+YSAWLRLP E+ +ATREMFVEEVM+LVELTSLREA
Sbjct  941   FARISGYCEQNDIHSPHVTVYEALLYSAWLRLPLEVKSATREMFVEEVMELVELTSLREA  1000

Query  2941  LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR  3120
             LVGLP VNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR
Sbjct  1001  LVGLPSVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR  1060

Query  3121  TVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYN  3300
             TVVCTIHQPSIDIFDAFDELLLLK+GGEEIYVGPLGRHS  LI+YFE I G+ +I DGYN
Sbjct  1061  TVVCTIHQPSIDIFDAFDELLLLKQGGEEIYVGPLGRHSCHLIKYFEGIQGVGKINDGYN  1120

Query  3301  PATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQS  3480
             PATWMLE+TS AQE  LG++F +VY++SELYRRNKALI EL+ PAPGS DLYFPT+YSQS
Sbjct  1121  PATWMLEVTSRAQETVLGVNFTDVYKSSELYRRNKALINELNTPAPGSSDLYFPTRYSQS  1180

Query  3481  FFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGC  3660
             FFTQCMACLWKQH+SYWRNPPYTAVRLLFTTF AL+FGT+FW +G +R  QQDLFNAMG 
Sbjct  1181  FFTQCMACLWKQHYSYWRNPPYTAVRLLFTTFTALMFGTIFWDLGSRRSKQQDLFNAMGS  1240

Query  3661  MYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIY  3840
             MYAAV+FLG+QNA+SVQPVVAIERTVFYRERAAGMYSALPYAFGQV+IE+P++F+QTLIY
Sbjct  1241  MYAAVLFLGIQNASSVQPVVAIERTVFYRERAAGMYSALPYAFGQVMIEVPYIFLQTLIY  1300

Query  3841  GVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWN  4020
             GVIVY+MIGFEWT AKF W +FFMY TLLYFT YGMMTVAVTPNHNIAAII++AFY  WN
Sbjct  1301  GVIVYSMIGFEWTVAKFFWHLFFMYMTLLYFTCYGMMTVAVTPNHNIAAIIATAFYAIWN  1360

Query  4021  LFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdf  4200
             LFSGFI+P+ RIP+WWRWYY++CPVSWTLYGL+ASQFGDV+EKLD+ ETV++F++S+F F
Sbjct  1361  LFSGFIVPRPRIPIWWRWYYWVCPVSWTLYGLVASQFGDVEEKLDSGETVEEFLRSYFGF  1420

Query  4201  dhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              HDF+G VA ++VG  V+FGFIFAFSI+AFNFQ R
Sbjct  1421  RHDFIGVVAVVVVGFTVLFGFIFAFSIRAFNFQKR  1455



>ref|XP_002324840.1| hypothetical protein POPTR_0018s01240g [Populus trichocarpa]
 gb|EEF03405.1| hypothetical protein POPTR_0018s01240g [Populus trichocarpa]
Length=1429

 Score =  2214 bits (5736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1086/1440 (75%), Positives = 1256/1440 (87%), Gaps = 36/1440 (3%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+S ++VFSRSSR+  +++   LKWAAIEKLPT LR+RRGIL  EE  G  +EID+  
Sbjct  21    IWRNSTLDVFSRSSRDEDDEEA--LKWAAIEKLPTCLRMRRGILTEEE--GQAREIDIAS  76

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ EKR+L+ERLV+IA+EDNE FLLKLK R  RVG+D+PTIEVRFEHL+++AEAYVG R
Sbjct  77    LGLIEKRNLVERLVKIAEEDNERFLLKLKERIHRVGLDIPTIEVRFEHLSIEAEAYVGGR  136

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF+AN+LE F+++LHILP+RK+P PILHD+SGIIKP RMTLLLGPPSSGKTTLL
Sbjct  137   ALPTIFNFSANMLEGFLSFLHILPSRKQPFPILHDLSGIIKPRRMTLLLGPPSSGKTTLL  196

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SG VTYNGH M EFVP+RTSAYI+Q+DLHIGEMTVRETL+FSARCQG
Sbjct  197   LALAGKLGKDLKSSGSVTYNGHGMAEFVPQRTSAYISQYDLHIGEMTVRETLSFSARCQG  256

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML ELSRRE+E NIKPDPDID++MKA ++EGQE +V TDYILKILGL++CAD +
Sbjct  257   VGPRYEMLTELSRREREANIKPDPDIDIFMKAAALEGQETTVTTDYILKILGLDICADTM  316

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQ+KRLTTGEMLVGPARALFMDEISTGLDSSTTFQI NS+RQ+ HIL G
Sbjct  317   VGDEMIRGISGGQKKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIANSLRQTTHILNG  376

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             T  ISLLQPAPETY+LFDDIILLS+G ++YQGPR+NVLEFF+ +GFKCPERKGVADFLQE
Sbjct  377   TTFISLLQPAPETYDLFDDIILLSEGLIIYQGPRENVLEFFESLGFKCPERKGVADFLQE  436

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  R++ Y F++  EFSEAFQSFH+G+KLGDELA PFDKSKSHPAAL+ +
Sbjct  437   VTSRKDQEQYWACRDQPYSFVSAKEFSEAFQSFHIGRKLGDELATPFDKSKSHPAALTTE  496

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC SREFLLMKRNSFVYIFK  QL+++A + MT+FLRTEM +N+I DG 
Sbjct  497   KYGVSKKELLKACISREFLLMKRNSFVYIFKFTQLIILASITMTIFLRTEMHRNTIVDGG  556

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +++GALFFA+I+ MFNGFSELA++I+KLP FYKQRDL F+PPWAYA+PTWILKIP+T VE
Sbjct  557   IYLGALFFAIIVIMFNGFSELAMTIMKLPIFYKQRDLLFYPPWAYAIPTWILKIPITFVE  616

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIW  MTYY IGFDP+ GRFFKQ  + +  NQM+S LFR+T A GR++IVANTFGS A 
Sbjct  617   VAIWTIMTYYVIGFDPNIGRFFKQYLIFVLANQMSSGLFRMTGALGRNIIVANTFGSFAF  676

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGFILSRD+VK WWIWGYW+SPLMY QNA SVNE+LG SWRH+P  ++E+LGV 
Sbjct  677   LAVLVLGGFILSRDNVKPWWIWGYWVSPLMYVQNAASVNEFLGHSWRHIPPNSTESLGVV  736

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRGIFPEAHWYWIG+GAL+GY  L NFLF LAL YLNP GKPQAMLS+E LAERNA 
Sbjct  737   VLKSRGIFPEAHWYWIGIGALIGYTLLFNFLFTLALKYLNPFGKPQAMLSKEALAERNAN  796

Query  2341  KRGE----PIELELKG-GSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEP  2505
             + G+    P  L +   G  S+                            KRGMVLPF+P
Sbjct  797   RTGDSSARPPSLRMHSFGDASQN---------------------------KRGMVLPFQP  829

Query  2506  LCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDV  2685
             L ITFDEI+Y+VDMP EMKAQG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDV
Sbjct  830   LSITFDEIRYSVDMPQEMKAQGILEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDV  889

Query  2686  LAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPE  2865
             L+GRKTGGYIEG I+ISGYPK Q+TFARI+GYCEQ DIHSPHVTVYESLVYSAWLRL P+
Sbjct  890   LSGRKTGGYIEGRISISGYPKNQQTFARISGYCEQMDIHSPHVTVYESLVYSAWLRLSPD  949

Query  2866  IDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDE  3045
             +D+ TR+MF+EEV++LVEL  LREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDE
Sbjct  950   VDSETRKMFIEEVVELVELNPLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDE  1009

Query  3046  PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPL  3225
             PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIYVGP+
Sbjct  1010  PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYVGPV  1069

Query  3226  GRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNK  3405
             GRH+  LI+Y E I G+ +I+DG+NPATWMLE+TS AQEA LG+DF ++Y+NSEL+RRNK
Sbjct  1070  GRHACHLIKYLEEIEGVPKIKDGHNPATWMLEVTSAAQEALLGVDFTDIYKNSELFRRNK  1129

Query  3406  ALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNAL  3585
             ALI+ELS P PGS DLYFPT+YS SFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTF AL
Sbjct  1130  ALIKELSSPPPGSNDLYFPTQYSHSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFIAL  1189

Query  3586  LFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGM  3765
             +FGT+FW +G KRR +QD+FN+MG MYAAV+F+GVQNATSVQPVVAIERTVFYRERAAGM
Sbjct  1190  MFGTIFWDMGSKRRNRQDIFNSMGSMYAAVLFIGVQNATSVQPVVAIERTVFYRERAAGM  1249

Query  3766  YSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyG  3945
             YSALPYAF QV+IE+P++ VQTLIYGVIVY MIGF+WT +KF W+IFFMYFTLLY T YG
Sbjct  1250  YSALPYAFAQVMIEIPYVLVQTLIYGVIVYTMIGFDWTVSKFFWYIFFMYFTLLYMTFYG  1309

Query  3946  MMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIAS  4125
             MMTVAVTPNHN+AAI+SSAFY  WNLFSGFI+P+TRIP+WWRWY++ CP+SWTLYGLIAS
Sbjct  1310  MMTVAVTPNHNVAAIVSSAFYAIWNLFSGFIVPRTRIPIWWRWYFWACPISWTLYGLIAS  1369

Query  4126  QFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             Q+GD+K+KL+ +ETV+DFV+++F F HDFVG  A +IVGICV+F F FAFSI+AFNFQ R
Sbjct  1370  QYGDIKDKLEGDETVEDFVRNYFGFRHDFVGTCAIVIVGICVLFAFTFAFSIRAFNFQRR  1429



>ref|XP_010254261.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Nelumbo nucifera]
Length=1457

 Score =  2213 bits (5735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1089/1417 (77%), Positives = 1249/1417 (88%), Gaps = 8/1417 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPTY RIR+G+L+    GG  KEID+E L + EK+ LLERL++IA EDNE+F
Sbjct  43    LKWAALEKLPTYNRIRKGLLSGV--GGETKEIDIESLSLQEKKVLLERLLKIADEDNENF  100

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVG+D+P IEVRFEHLNVDAEAYVGSRALPTIFN++ N+ E F+NYLHILP
Sbjct  101   LLKLKNRIDRVGLDIPKIEVRFEHLNVDAEAYVGSRALPTIFNYSVNMFEEFLNYLHILP  160

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKKPL ILHDVSGIIKP RMTLLLGPP SGKTTLLLALAGKL SD+K SGRVTYNGH+M
Sbjct  161   SRKKPLSILHDVSGIIKPCRMTLLLGPPGSGKTTLLLALAGKLGSDVKFSGRVTYNGHKM  220

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+Q+DLHIGEMTVRETLAFSARCQGVG  YEMLAELSRREKE NIKPDP
Sbjct  221   NEFVPQRTAAYISQYDLHIGEMTVRETLAFSARCQGVGTGYEMLAELSRREKETNIKPDP  280

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID+YMKA ++EGQEASVVTDYILKILGLE+CAD LVGDEM RGISGGQ+KR+TTGEMLV
Sbjct  281   DIDIYMKAAALEGQEASVVTDYILKILGLEICADTLVGDEMFRGISGGQKKRVTTGEMLV  340

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQI+NS+RQSIHIL GTA+ISLLQPAPETYELFDDIILLS
Sbjct  341   GPARALFMDEISTGLDSSTTFQILNSLRQSIHILNGTALISLLQPAPETYELFDDIILLS  400

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQEVTS KDQEQYW R++E Y FI V 
Sbjct  401   DGQIVYQGPRENVLEFFESMGFKCPERKGVADFLQEVTSWKDQEQYWARKDEPYRFIPVK  460

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQSFHVG KLGDELA PFDK+KSHPA+L+ KKYGV+KKELLKAC SRE LLMKRN
Sbjct  461   EFAEAFQSFHVGLKLGDELANPFDKTKSHPASLTTKKYGVSKKELLKACISRELLLMKRN  520

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
              FVYIFKM QL ++ F+AMT+FLR +M ++S+ DG +++GALFF ++M MFNG+SELAL+
Sbjct  521   YFVYIFKMTQLTILGFIAMTLFLRIKMHRDSVIDGGIYIGALFFTLMMIMFNGYSELALT  580

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             ILKLP FYKQRDL F+P WAY+LPTWILKIP T  EVA+WV MTYY IGFDP+ GR FKQ
Sbjct  581   ILKLPVFYKQRDLLFYPSWAYSLPTWILKIPYTFFEVAVWVFMTYYVIGFDPNVGRLFKQ  640

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ VNQMAS LFR   A GR +IVANTFGS +++ +LV+GGF++SR+DVKKWW WGY
Sbjct  641   YLLLLGVNQMASGLFRFIGAVGRDMIVANTFGSFSLLAILVMGGFVVSREDVKKWWKWGY  700

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             WISP+MY QNAI+VNE+LG SW HVP  ++E LGVTVL+SRGIFP+A+WYW+GVGALVGY
Sbjct  701   WISPMMYGQNAIAVNEFLGNSWSHVPPNSTEPLGVTVLKSRGIFPKAYWYWLGVGALVGY  760

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELK------GGSTSEK  2394
             +FL N LF LAL+YLNP GKPQ ++SEE+L E+ A + GE I+L  +        S+++ 
Sbjct  761   MFLFNVLFTLALSYLNPFGKPQPVVSEESLNEKWANRTGEFIKLSSREKSSVCQTSSTDA  820

Query  2395  gnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGL  2574
                      S  +S         + N KRGMVLPF+PL ITFDEI+Y+VDMP E+KAQG+
Sbjct  821   EEGNEMRSMSSGISPASTETINGNQNRKRGMVLPFQPLSITFDEIRYSVDMPQELKAQGV  880

Query  2575  TEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQ  2754
              ED+L LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAGRKT GYI+G ITISGYPK+Q
Sbjct  881   PEDQLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTCGYIDGCITISGYPKKQ  940

Query  2755  ETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLR  2934
             ETFARI+GYCEQ DIHSPHVTVYE+L+YSAWLRLP E+ +ATREMFVEEVM+LVELTSLR
Sbjct  941   ETFARISGYCEQNDIHSPHVTVYEALLYSAWLRLPLEVKSATREMFVEEVMELVELTSLR  1000

Query  2935  EALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  3114
             EALVGLP VNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT
Sbjct  1001  EALVGLPSVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  1060

Query  3115  GRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDG  3294
             GRTVVCTIHQPSIDIFDAFDELLLLK+GGEEIYVGPLGRHS  LI+YFE I G+ +I DG
Sbjct  1061  GRTVVCTIHQPSIDIFDAFDELLLLKQGGEEIYVGPLGRHSCHLIKYFEGIQGVGKINDG  1120

Query  3295  YNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYS  3474
             YNPATWMLE+TS AQE  LG++F +VY++SELYRRNKALI EL+ PAPGS DLYFPT+YS
Sbjct  1121  YNPATWMLEVTSRAQETVLGVNFTDVYKSSELYRRNKALINELNTPAPGSSDLYFPTRYS  1180

Query  3475  QSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAM  3654
             QSFFTQCMACLWKQH+SYWRNPPYTAVRLLFTTF AL+FGT+FW +G +R  QQDLFNAM
Sbjct  1181  QSFFTQCMACLWKQHYSYWRNPPYTAVRLLFTTFTALMFGTIFWDLGSRRSKQQDLFNAM  1240

Query  3655  GCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTL  3834
             G MYAAV+FLG+QNA+SVQPVVAIERTVFYRERAAGMYSALPYAFGQV+IE+P++F+QTL
Sbjct  1241  GSMYAAVLFLGIQNASSVQPVVAIERTVFYRERAAGMYSALPYAFGQVMIEVPYIFLQTL  1300

Query  3835  IYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGF  4014
             IYGVIVY+MIGFEWT AKF W +FFMY TLLYFT YGMMTVAVTPNHNIAAII++AFY  
Sbjct  1301  IYGVIVYSMIGFEWTVAKFFWHLFFMYMTLLYFTCYGMMTVAVTPNHNIAAIIATAFYAI  1360

Query  4015  WNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksff  4194
             WNLFSGFI+P+ RIP+WWRWYY++CPVSWTLYGL+ASQFGDV+EKLD+ ETV++F++S+F
Sbjct  1361  WNLFSGFIVPRPRIPIWWRWYYWVCPVSWTLYGLVASQFGDVEEKLDSGETVEEFLRSYF  1420

Query  4195  dfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              F HDF+G VA ++VG  V+FGFIFAFSI+AFNFQ R
Sbjct  1421  GFRHDFIGVVAVVVVGFTVLFGFIFAFSIRAFNFQKR  1457



>ref|XP_010249930.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nelumbo 
nucifera]
Length=1444

 Score =  2213 bits (5734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1097/1437 (76%), Positives = 1265/1437 (88%), Gaps = 12/1437 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWRS+GVEVFSRSSRE  +++   LKWAA+EKLPTY RIR+GIL     G  P E+D+  
Sbjct  18    VWRSNGVEVFSRSSREDDDEEA--LKWAALEKLPTYDRIRKGILTGV--GSQPTEVDIGS  73

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EK++L+ERLVR+A+EDNE FLLKLK+R +RVGIDLPTIEVRFEHLN++A+AYVGSR
Sbjct  74    LGYQEKKNLIERLVRVAEEDNEKFLLKLKNRIERVGIDLPTIEVRFEHLNINADAYVGSR  133

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNFTANI E F+N+LHILP+RKKPL ILHDVSGIIKP+RMTLLLGPPSSGKTTLL
Sbjct  134   ALPTIFNFTANIFEGFLNFLHILPSRKKPLCILHDVSGIIKPSRMTLLLGPPSSGKTTLL  193

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD DLKVSGRVTYNGH M EFVP+RTSAYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  194   LALAGKLDPDLKVSGRVTYNGHGMDEFVPQRTSAYISQHDLHIGEMTVRETLAFSARCQG  253

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+ML ELSRREK  NIKPDPDID+YMKA ++EGQEASVVTDYILKILGL+VCAD +
Sbjct  254   VGARYDMLTELSRREKAANIKPDPDIDIYMKAATLEGQEASVVTDYILKILGLDVCADTM  313

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKR+TTGEMLVGPARALFMDEISTGLDSSTT+QIV+S+RQSIHIL G
Sbjct  314   VGDEMLRGISGGQRKRVTTGEMLVGPARALFMDEISTGLDSSTTYQIVSSLRQSIHILNG  373

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY LFDDIILLSDGQVVYQGPR++VL+FF+ MGFKCPERKGVADFLQE
Sbjct  374   TAVISLLQPAPETYNLFDDIILLSDGQVVYQGPREHVLDFFESMGFKCPERKGVADFLQE  433

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW R+ E Y F+TV EF+EAFQSFHVG+KLGDEL+ PFDK+KSHPAAL+ K
Sbjct  434   VTSKKDQKQYWARKHEPYRFVTVKEFAEAFQSFHVGQKLGDELSTPFDKTKSHPAALTTK  493

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKEL KA  SRE LLMKRNSFVYIFKM QL +MAF+ MT+FLRT+M ++   DG 
Sbjct  494   KYGVSKKELFKASMSREILLMKRNSFVYIFKMTQLAIMAFITMTLFLRTKMHRDDSTDGG  553

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +++GALFFA+I  MFNG SE++++I KLP FYKQRDL FFP WAY+LPTWILKIP+T +E
Sbjct  554   IYLGALFFALITLMFNGLSEISMTIAKLPVFYKQRDLLFFPAWAYSLPTWILKIPITFIE  613

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
               IWV +TYY IGFDP+  RFF+Q FLL+ +NQMASALFR   A GR++IVANTFG+ A+
Sbjct  614   AGIWVFITYYVIGFDPNVERFFRQYFLLLLINQMASALFRFIGATGRNMIVANTFGAFAV  673

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +  +VLGGFILSR+DVK WWIWGYWISPLMY QNAISVNE+LGK+WRHV   ++E LGVT
Sbjct  674   LTFVVLGGFILSRNDVKNWWIWGYWISPLMYGQNAISVNEFLGKNWRHVLPNSTEPLGVT  733

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             V++SRG FPEAHWYWIGVGA +GY+FL N L+ +AL YL+P GKPQA+L E    E    
Sbjct  734   VIKSRGFFPEAHWYWIGVGATIGYMFLFNILYTVALHYLDPFGKPQAILPE---GEARTG  790

Query  2341  KRGEPIELEL--KGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
             +  E   LE+   G +TS +       V+S S S+R+        N KRGMVLPF+PL I
Sbjct  791   EDNELSSLEMTSSGHTTSGEQKDGIIGVASESSSARIDE---VSQNRKRGMVLPFQPLSI  847

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFDEI+Y VDMP EMK QG+TEDRL LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  848   TFDEIRYFVDMPQEMKDQGVTEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAG  907

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYIEGSITISGYPK+QETFARI+GYCEQ DIHSPHVTVYES++YSAWLRLP +++ 
Sbjct  908   RKTGGYIEGSITISGYPKKQETFARISGYCEQNDIHSPHVTVYESILYSAWLRLPSDVEP  967

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
             +TR+MF+EEVM+LVEL SLR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS
Sbjct  968   STRKMFIEEVMELVELNSLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  1027

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLG +
Sbjct  1028  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGHN  1087

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             S  LI+YFE I G+ +I+ GYNPATWMLE+T+ AQE  LG+ FA+VY+NSELYRRNK+LI
Sbjct  1088  SCHLIKYFEEIEGVSKIKYGYNPATWMLEVTTVAQEETLGVSFADVYKNSELYRRNKSLI  1147

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             QELS P PGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPY AVR +FTTF ALLFG
Sbjct  1148  QELSTPPPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYIAVRFIFTTFIALLFG  1207

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G KR  QQDLFNAMG MYAAV+FLG+QNA+SVQPVVA+ERTVFYRERAAGMYSA
Sbjct  1208  TIFWDLGSKRSRQQDLFNAMGSMYAAVLFLGIQNASSVQPVVAVERTVFYRERAAGMYSA  1267

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAFGQV+IE+PH+FVQ ++YGVIVYAMIGFEWTAAKF W++FFMYFTLLYFT YGMM 
Sbjct  1268  LPYAFGQVMIEIPHIFVQAVVYGVIVYAMIGFEWTAAKFFWYLFFMYFTLLYFTFYGMMA  1327

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNHN+AAI+SSAFYG WNLFSGFI+P+TR+PVWWRWYY+ICPV+WTLYGL+ASQFG
Sbjct  1328  VAVTPNHNVAAIVSSAFYGIWNLFSGFIVPRTRMPVWWRWYYWICPVAWTLYGLVASQFG  1387

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+++K++T++TV++F++S+F F HDF+G V+ +I+G  V+F FIFAFSI+AFNFQ R
Sbjct  1388  DIQDKIETDQTVEEFLRSYFGFRHDFLGVVSAVIIGFTVLFAFIFAFSIRAFNFQRR  1444



>ref|XP_006476214.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Citrus sinensis]
Length=1452

 Score =  2210 bits (5727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1106/1435 (77%), Positives = 1272/1435 (89%), Gaps = 2/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ ++VF+RSSRE   DD+EAL WAAIEKLPTYLR++RG+L  +E  G  +E+D++ 
Sbjct  20    IWRNNTLDVFARSSREDTYDDDEALTWAAIEKLPTYLRVQRGMLTEDE--GQAREVDIKN  77

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+R+L+ERL++IA+EDNE FLLKLK R +RVG+D+PTIEVRFEHLNV+AEAY+GSR
Sbjct  78    LGFIERRNLIERLLKIAEEDNEKFLLKLKDRIERVGLDIPTIEVRFEHLNVEAEAYIGSR  137

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FN  AN+LE F+NYLH+LP+RKKPL ILHDVSGIIKP R+TLLLGPPSSGKTTLL
Sbjct  138   ALPTVFNSCANMLEGFLNYLHVLPSRKKPLTILHDVSGIIKPQRLTLLLGPPSSGKTTLL  197

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRVTYNGH M EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  198   LALAGKLGKDLKFSGRVTYNGHGMEEFVPQRTSAYISQNDLHIGEMTVRETLAFSARCQG  257

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYE+L ELSRREK  NIKPDPDID+ MKA S+EGQE +VVTDY+LKILGLEVCAD +
Sbjct  258   VGPRYEVLQELSRREKAANIKPDPDIDLIMKAASLEGQEKNVVTDYVLKILGLEVCADTM  317

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTT+QIVNS+RQSIHIL G
Sbjct  318   VGDEMLRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTYQIVNSLRQSIHILNG  377

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDD+ILLSDGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  378   TAVISLLQPAPETYELFDDLILLSDGQIVYQGPRENVLEFFERMGFKCPERKGVADFLQE  437

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++E Y F+T  EFSE FQSFH+G+KLGDELA PFDKSKSHPAAL+ K
Sbjct  438   VTSRKDQEQYWANKDEPYSFVTAKEFSEVFQSFHIGQKLGDELATPFDKSKSHPAALTTK  497

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG +KKELLKAC +RE+LLMKRNSFVY FKM Q+   A VAMT+FLRTEM ++++ DG 
Sbjct  498   KYGASKKELLKACFAREYLLMKRNSFVYFFKMFQIFFSASVAMTLFLRTEMHRSTVEDGG  557

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFFAVI  MFNGFSEL+++I+KLP FYKQRD  FFP WAY+LPTWILKIP+T +E
Sbjct  558   IYMGALFFAVITIMFNGFSELSMTIMKLPVFYKQRDFLFFPAWAYSLPTWILKIPITFIE  617

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY +GF+ +  RF KQ FLL+CVNQ AS LFRL  A GR++IVANTFGS A 
Sbjct  618   VGIWVFMTYYVVGFESNIERFVKQYFLLLCVNQTASGLFRLMGALGRNIIVANTFGSFAN  677

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGFILSRDDVKKWW+WGYW SP+MY QNA++VNE+LGKSW HVP  ++E LGV 
Sbjct  678   LTVLVLGGFILSRDDVKKWWLWGYWFSPMMYGQNALAVNEFLGKSWGHVPPNSTEPLGVV  737

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRG+FP A+WYWIGVGAL+GYV L NFLF +AL YL+P GKPQA+LSEE LA++NAC
Sbjct  738   ILKSRGLFPNAYWYWIGVGALLGYVLLFNFLFTVALKYLDPFGKPQAILSEEALAKKNAC  797

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K  EP+EL     S+ ++GN   R+VS R+LS+RV S N AD N KRGM+LPFEP  ITF
Sbjct  798   KTEEPVELSSGVQSSYDRGNESHRNVSFRTLSARVRSFNEADQNRKRGMILPFEPHSITF  857

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+I+YA+DMP EMKAQG+ +DRL  LKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  858   DDIRYALDMPQEMKAQGIPDDRLEFLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  917

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGY+ GSITISGYPK QETFARI+GYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D+ T
Sbjct  918   TGGYVSGSITISGYPKNQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSDT  977

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFVEEVM+LVEL  +REALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  978   RKMFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1037

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLL+KRGGEEIYVGPLGRH S
Sbjct  1038  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLMKRGGEEIYVGPLGRHCS  1097

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI+YFE I+G+ +I++GYNPATWMLE+T+ AQEAALGI+FA+VY+NSELY+ NK +I+E
Sbjct  1098  QLIKYFEGIDGVPKIKEGYNPATWMLEVTTPAQEAALGINFAKVYKNSELYKGNKEMIKE  1157

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSK+LYF T+YSQSFFTQCMACLWKQH SYWRNPPYTAVRL FTTF AL+FGT+
Sbjct  1158  LSIPPPGSKNLYFQTRYSQSFFTQCMACLWKQHLSYWRNPPYTAVRLFFTTFIALMFGTI  1217

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW IG KR  +QDLFNAMG MYAA++FLGVQNATSVQPVVA+ERTVFYRERAAGMYSALP
Sbjct  1218  FWDIGSKRANRQDLFNAMGSMYAAILFLGVQNATSVQPVVAVERTVFYRERAAGMYSALP  1277

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQVVIELPH+F+Q +IYGVIVYAMIGF+WT +KFLW++ FMY T LYFTLYGMMTVA
Sbjct  1278  YAFGQVVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFLWYLLFMYLTFLYFTLYGMMTVA  1337

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNIAAII+SAFY  WNLFSGFIIP+ R+P+WWRWY +ICPVSWTLYGL+ASQFGDV
Sbjct  1338  VTPNHNIAAIIASAFYVLWNLFSGFIIPRPRMPIWWRWYCWICPVSWTLYGLVASQFGDV  1397

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              +  D+ + V DFVK +F +DHD +G VA + VG+ V+FGF FA+SIKAFNFQ R
Sbjct  1398  NDTFDSGQKVGDFVKDYFGYDHDMLGVVAVVHVGLVVLFGFTFAYSIKAFNFQHR  1452



>ref|XP_006450535.1| hypothetical protein CICLE_v10010431mg [Citrus clementina]
 gb|ESR63775.1| hypothetical protein CICLE_v10010431mg [Citrus clementina]
Length=1452

 Score =  2209 bits (5724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1106/1435 (77%), Positives = 1272/1435 (89%), Gaps = 2/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ ++VF+RSSRE   DD+EAL WAAIEKLPTYLR++RG+L A+E  G  +E+D++ 
Sbjct  20    IWRNNTLDVFARSSREDTYDDDEALTWAAIEKLPTYLRVQRGMLTADE--GQAREVDIKN  77

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+R+L+ERL++IA+EDNE FLLKLK R +RVG+D+PTIEVRFEHLNV+AEAY+GSR
Sbjct  78    LGFIERRNLIERLLKIAEEDNEKFLLKLKVRIERVGLDIPTIEVRFEHLNVEAEAYIGSR  137

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FN  AN+LE F+NYLH+LP+RKKPL ILHDVSGIIKP R+ LLLGPPSSGKTTLL
Sbjct  138   ALPTVFNSCANMLEGFLNYLHVLPSRKKPLTILHDVSGIIKPRRLALLLGPPSSGKTTLL  197

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRVTYNGH M EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  198   LALAGKLGKDLKFSGRVTYNGHGMEEFVPQRTSAYISQNDLHIGEMTVRETLAFSARCQG  257

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYE+L ELSRREK  NIKPDPDID+ MKA S+EGQE +VVTDY+LKILGLEVCAD +
Sbjct  258   VGPRYEVLQELSRREKAANIKPDPDIDLIMKAASLEGQEKNVVTDYVLKILGLEVCADTM  317

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTT+QIVNS+RQSIHIL G
Sbjct  318   VGDEMLRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTYQIVNSLRQSIHILNG  377

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDD+ILLSDGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  378   TAVISLLQPAPETYELFDDLILLSDGQIVYQGPRENVLEFFERMGFKCPERKGVADFLQE  437

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++E Y F+T  EFSE FQSFH+G+KLGDELA PFDKSKSHPAAL+ K
Sbjct  438   VTSRKDQEQYWANKDEPYSFVTAKEFSEVFQSFHIGQKLGDELATPFDKSKSHPAALTTK  497

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG +KKELLKAC +RE+LLMKRNSFVY FKM Q+   A VAMT+FLRTEM ++++ DG 
Sbjct  498   KYGASKKELLKACFAREYLLMKRNSFVYFFKMFQIFFSASVAMTLFLRTEMHRSTVEDGG  557

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFFAVI  MFNGFSEL+++I+KLP FYKQRD  FFP WAY+LPTWILKIP+T +E
Sbjct  558   IYMGALFFAVITIMFNGFSELSMTIMKLPVFYKQRDFLFFPAWAYSLPTWILKIPITFIE  617

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY +GF+ +  RF KQ FLL+CVNQ AS LFRL  A GR++IVANTFGS A 
Sbjct  618   VGIWVFMTYYVVGFESNIERFVKQYFLLLCVNQTASGLFRLMGALGRNIIVANTFGSFAN  677

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGFILSRDDVKKWW+WGYW SP+MY QNA++VNE+LGKSW HVP  ++E LGV 
Sbjct  678   LTVLVLGGFILSRDDVKKWWLWGYWFSPMMYGQNALAVNEFLGKSWGHVPPNSTEPLGVV  737

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRG+FP A+WYWIGVGAL+GYV L NFLF +AL YL+P GKPQA+LSEE LA++NAC
Sbjct  738   ILKSRGLFPNAYWYWIGVGALLGYVLLFNFLFTVALKYLDPFGKPQAILSEEALAKKNAC  797

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K  EP+EL     S+ ++GN   R+VS R+LS+RV S N AD N KRGM+LPFEP  ITF
Sbjct  798   KTEEPVELSSGVQSSYDRGNESHRNVSFRTLSARVRSFNEADQNRKRGMILPFEPHSITF  857

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+I+YA+DMP EMKAQG+ +DRL  LKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  858   DDIRYALDMPQEMKAQGIPDDRLEFLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  917

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGY+ GSITISGYPK QETFARI+GYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D+ T
Sbjct  918   TGGYVSGSITISGYPKNQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSDT  977

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFVEEVM+LVEL  +REALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  978   RKMFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1037

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLL+KRGGEEIYVGPLGRH S
Sbjct  1038  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLMKRGGEEIYVGPLGRHCS  1097

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI+YFE I+G+ +I++GYNPATWMLE+T+ AQEAALGI+FA+VY+NSELY+ NK +I+E
Sbjct  1098  QLIKYFEGIDGVPKIKEGYNPATWMLEVTTPAQEAALGINFAKVYKNSELYKGNKEMIKE  1157

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSK+LYF T+YSQSFFTQCMACLWKQH SYWRNPPYTAVRL FTTF AL+FGT+
Sbjct  1158  LSIPPPGSKNLYFQTRYSQSFFTQCMACLWKQHLSYWRNPPYTAVRLFFTTFIALMFGTI  1217

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW IG KR  +QDLFNAMG MYAA++FLGVQNATSVQPVVA+ERTVFYRERAAGMYSALP
Sbjct  1218  FWDIGSKRANRQDLFNAMGSMYAAILFLGVQNATSVQPVVAVERTVFYRERAAGMYSALP  1277

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQVVIELPH+F+Q +IYGVIVYAMIGF+WT +KFLW++ FMY T LYFTLYGMMTVA
Sbjct  1278  YAFGQVVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFLWYLLFMYLTFLYFTLYGMMTVA  1337

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNIAAII+SAFY  WNLFSGFIIP+ R+P+WWRWY +ICPVSWTLYGL+ASQFGDV
Sbjct  1338  VTPNHNIAAIIASAFYVLWNLFSGFIIPRPRMPIWWRWYCWICPVSWTLYGLVASQFGDV  1397

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              +  D+ + V DFVK +F +DHD +G VA + VG+ V+FGF FA+SIKAFNFQ R
Sbjct  1398  NDTFDSGQKVGDFVKDYFGYDHDMLGVVAVVHVGLVVLFGFTFAYSIKAFNFQHR  1452



>ref|XP_006476215.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X3 [Citrus sinensis]
Length=1450

 Score =  2206 bits (5717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1107/1435 (77%), Positives = 1270/1435 (89%), Gaps = 4/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ ++VF+RSSRE   DD+EAL WAAIEKLPTYLR++RG+L  +E  G  +E+D++ 
Sbjct  20    IWRNNTLDVFARSSREDTYDDDEALTWAAIEKLPTYLRVQRGMLTEDE--GQAREVDIKN  77

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+R+L+ERL++IA+EDNE FLLKLK R +RVG+D+PTIEVRFEHLNV+AEAY+GSR
Sbjct  78    LGFIERRNLIERLLKIAEEDNEKFLLKLKDRIERVGLDIPTIEVRFEHLNVEAEAYIGSR  137

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FN  AN+LE F+NYLH+LP+RKKPL ILHDVSGIIKP R+TLLLGPPSSGKTTLL
Sbjct  138   ALPTVFNSCANMLEGFLNYLHVLPSRKKPLTILHDVSGIIKPQRLTLLLGPPSSGKTTLL  197

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRVTYNGH M EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  198   LALAGKLGKDLKFSGRVTYNGHGMEEFVPQRTSAYISQNDLHIGEMTVRETLAFSARCQG  257

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYE+L ELSRREK  NIKPDPDID+ MKA S+EGQE +VVTDY+LKILGLEVCAD +
Sbjct  258   VGPRYEVLQELSRREKAANIKPDPDIDLIMKAASLEGQEKNVVTDYVLKILGLEVCADTM  317

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTT+QIVNS+RQSIHIL G
Sbjct  318   VGDEMLRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTYQIVNSLRQSIHILNG  377

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDD+ILLSDGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  378   TAVISLLQPAPETYELFDDLILLSDGQIVYQGPRENVLEFFERMGFKCPERKGVADFLQE  437

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++E Y F+T  EFSE FQSFH+G+KLGDELA PFDKSKSHPAAL+ K
Sbjct  438   VTSRKDQEQYWANKDEPYSFVTAKEFSEVFQSFHIGQKLGDELATPFDKSKSHPAALTTK  497

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG +KKELLKAC +RE+LLMKRNSFVY FKM Q+   A VAMT+FLRTEM ++++ DG 
Sbjct  498   KYGASKKELLKACFAREYLLMKRNSFVYFFKMFQIFFSASVAMTLFLRTEMHRSTVEDGG  557

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFFAVI  MFNGFSEL+++I+KLP FYKQRD  FFP WAY+LPTWILKIP+T +E
Sbjct  558   IYMGALFFAVITIMFNGFSELSMTIMKLPVFYKQRDFLFFPAWAYSLPTWILKIPITFIE  617

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY +GF+ +  RF KQ FLL+CVNQ AS LFRL  A GR++IVANTFGS A 
Sbjct  618   VGIWVFMTYYVVGFESNIERFVKQYFLLLCVNQTASGLFRLMGALGRNIIVANTFGSFAN  677

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGFILSRDDVKKWW+WGYW SP+MY QNA++VNE+LGKSW HVP  ++E LGV 
Sbjct  678   LTVLVLGGFILSRDDVKKWWLWGYWFSPMMYGQNALAVNEFLGKSWGHVPPNSTEPLGVV  737

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRG+FP A+WYWIGVGAL+GYV L NFLF +AL YL+P GKPQA+LSEE LA++NAC
Sbjct  738   ILKSRGLFPNAYWYWIGVGALLGYVLLFNFLFTVALKYLDPFGKPQAILSEEALAKKNAC  797

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K  EP+  EL  G  S  GN   R+VS R+LS+RV S N AD N KRGM+LPFEP  ITF
Sbjct  798   KTEEPV--ELSSGVQSSYGNESHRNVSFRTLSARVRSFNEADQNRKRGMILPFEPHSITF  855

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+I+YA+DMP EMKAQG+ +DRL  LKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  856   DDIRYALDMPQEMKAQGIPDDRLEFLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  915

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGY+ GSITISGYPK QETFARI+GYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D+ T
Sbjct  916   TGGYVSGSITISGYPKNQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSDT  975

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFVEEVM+LVEL  +REALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  976   RKMFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1035

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLL+KRGGEEIYVGPLGRH S
Sbjct  1036  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLMKRGGEEIYVGPLGRHCS  1095

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI+YFE I+G+ +I++GYNPATWMLE+T+ AQEAALGI+FA+VY+NSELY+ NK +I+E
Sbjct  1096  QLIKYFEGIDGVPKIKEGYNPATWMLEVTTPAQEAALGINFAKVYKNSELYKGNKEMIKE  1155

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSK+LYF T+YSQSFFTQCMACLWKQH SYWRNPPYTAVRL FTTF AL+FGT+
Sbjct  1156  LSIPPPGSKNLYFQTRYSQSFFTQCMACLWKQHLSYWRNPPYTAVRLFFTTFIALMFGTI  1215

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW IG KR  +QDLFNAMG MYAA++FLGVQNATSVQPVVA+ERTVFYRERAAGMYSALP
Sbjct  1216  FWDIGSKRANRQDLFNAMGSMYAAILFLGVQNATSVQPVVAVERTVFYRERAAGMYSALP  1275

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQVVIELPH+F+Q +IYGVIVYAMIGF+WT +KFLW++ FMY T LYFTLYGMMTVA
Sbjct  1276  YAFGQVVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFLWYLLFMYLTFLYFTLYGMMTVA  1335

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNIAAII+SAFY  WNLFSGFIIP+ R+P+WWRWY +ICPVSWTLYGL+ASQFGDV
Sbjct  1336  VTPNHNIAAIIASAFYVLWNLFSGFIIPRPRMPIWWRWYCWICPVSWTLYGLVASQFGDV  1395

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              +  D+ + V DFVK +F +DHD +G VA + VG+ V+FGF FA+SIKAFNFQ R
Sbjct  1396  NDTFDSGQKVGDFVKDYFGYDHDMLGVVAVVHVGLVVLFGFTFAYSIKAFNFQHR  1450



>ref|XP_006476216.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X4 [Citrus sinensis]
Length=1446

 Score =  2205 bits (5713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1103/1435 (77%), Positives = 1268/1435 (88%), Gaps = 8/1435 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ ++VF+RSSRE   DD+EAL WAAIEKLPTYLR++RG+L  +E  G  +E+D++ 
Sbjct  20    IWRNNTLDVFARSSREDTYDDDEALTWAAIEKLPTYLRVQRGMLTEDE--GQAREVDIKN  77

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+R+L+ERL++IA+EDNE FLLKLK R +RVG+D+PTIEVRFEHLNV+AEAY+GSR
Sbjct  78    LGFIERRNLIERLLKIAEEDNEKFLLKLKDRIERVGLDIPTIEVRFEHLNVEAEAYIGSR  137

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FN  AN+LE F+NYLH+LP+RKKPL ILHDVSGIIKP R+TLLLGPPSSGKTTLL
Sbjct  138   ALPTVFNSCANMLEGFLNYLHVLPSRKKPLTILHDVSGIIKPQRLTLLLGPPSSGKTTLL  197

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRVTYNGH M EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  198   LALAGKLGKDLKFSGRVTYNGHGMEEFVPQRTSAYISQNDLHIGEMTVRETLAFSARCQG  257

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYE+L ELSRREK  NIKPDPDID+ MKA S+EGQE +VVTDY+LKILGLEVCAD +
Sbjct  258   VGPRYEVLQELSRREKAANIKPDPDIDLIMKAASLEGQEKNVVTDYVLKILGLEVCADTM  317

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTT+QIVNS+RQSIHIL G
Sbjct  318   VGDEMLRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTYQIVNSLRQSIHILNG  377

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDD+ILLSDGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  378   TAVISLLQPAPETYELFDDLILLSDGQIVYQGPRENVLEFFERMGFKCPERKGVADFLQE  437

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++E Y F+T  EFSE FQSFH+G+KLGDELA PFDKSKSHPAAL+ K
Sbjct  438   VTSRKDQEQYWANKDEPYSFVTAKEFSEVFQSFHIGQKLGDELATPFDKSKSHPAALTTK  497

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG +KKELLKAC +RE+LLMKRNSFVY FKM Q+   A VAMT+FLRTEM ++++ DG 
Sbjct  498   KYGASKKELLKACFAREYLLMKRNSFVYFFKMFQIFFSASVAMTLFLRTEMHRSTVEDGG  557

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFFAVI  MFNGFSEL+++I+KLP FYKQRD  FFP WAY+LPTWILKIP+T +E
Sbjct  558   IYMGALFFAVITIMFNGFSELSMTIMKLPVFYKQRDFLFFPAWAYSLPTWILKIPITFIE  617

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY +GF+ +  RF KQ FLL+CVNQ AS LFRL  A GR++IVANTFGS A 
Sbjct  618   VGIWVFMTYYVVGFESNIERFVKQYFLLLCVNQTASGLFRLMGALGRNIIVANTFGSFAN  677

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGFILSRDDVKKWW+WGYW SP+MY QNA++VNE+LGKSW HVP  ++E LGV 
Sbjct  678   LTVLVLGGFILSRDDVKKWWLWGYWFSPMMYGQNALAVNEFLGKSWGHVPPNSTEPLGVV  737

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRG+FP A+WYWIGVGAL+GYV L NFLF +AL YL+P GKPQA+LSEE LA++NAC
Sbjct  738   ILKSRGLFPNAYWYWIGVGALLGYVLLFNFLFTVALKYLDPFGKPQAILSEEALAKKNAC  797

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K  EP+EL      +S   +    +VS R+LS+RV S N AD N KRGM+LPFEP  ITF
Sbjct  798   KTEEPVEL------SSGVQSSYGENVSFRTLSARVRSFNEADQNRKRGMILPFEPHSITF  851

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+I+YA+DMP EMKAQG+ +DRL  LKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  852   DDIRYALDMPQEMKAQGIPDDRLEFLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  911

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGY+ GSITISGYPK QETFARI+GYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D+ T
Sbjct  912   TGGYVSGSITISGYPKNQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSDT  971

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFVEEVM+LVEL  +REALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  972   RKMFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1031

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLL+KRGGEEIYVGPLGRH S
Sbjct  1032  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLMKRGGEEIYVGPLGRHCS  1091

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI+YFE I+G+ +I++GYNPATWMLE+T+ AQEAALGI+FA+VY+NSELY+ NK +I+E
Sbjct  1092  QLIKYFEGIDGVPKIKEGYNPATWMLEVTTPAQEAALGINFAKVYKNSELYKGNKEMIKE  1151

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSK+LYF T+YSQSFFTQCMACLWKQH SYWRNPPYTAVRL FTTF AL+FGT+
Sbjct  1152  LSIPPPGSKNLYFQTRYSQSFFTQCMACLWKQHLSYWRNPPYTAVRLFFTTFIALMFGTI  1211

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW IG KR  +QDLFNAMG MYAA++FLGVQNATSVQPVVA+ERTVFYRERAAGMYSALP
Sbjct  1212  FWDIGSKRANRQDLFNAMGSMYAAILFLGVQNATSVQPVVAVERTVFYRERAAGMYSALP  1271

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQVVIELPH+F+Q +IYGVIVYAMIGF+WT +KFLW++ FMY T LYFTLYGMMTVA
Sbjct  1272  YAFGQVVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFLWYLLFMYLTFLYFTLYGMMTVA  1331

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNIAAII+SAFY  WNLFSGFIIP+ R+P+WWRWY +ICPVSWTLYGL+ASQFGDV
Sbjct  1332  VTPNHNIAAIIASAFYVLWNLFSGFIIPRPRMPIWWRWYCWICPVSWTLYGLVASQFGDV  1391

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              +  D+ + V DFVK +F +DHD +G VA + VG+ V+FGF FA+SIKAFNFQ R
Sbjct  1392  NDTFDSGQKVGDFVKDYFGYDHDMLGVVAVVHVGLVVLFGFTFAYSIKAFNFQHR  1446



>ref|XP_003526427.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine 
max]
Length=1448

 Score =  2202 bits (5707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1094/1435 (76%), Positives = 1266/1435 (88%), Gaps = 4/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWRS  ++VFS SSR   ++ E  LKWAAIEKLPTYLR+ RGIL   E  G P EID+ K
Sbjct  18    VWRSGSIDVFSGSSRRDDDEQE--LKWAAIEKLPTYLRMTRGILTETE--GQPTEIDINK  73

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L   ++++L+ERLV+IA++DNE FL KL+ R DRVG+++PTIE+RFEHLNV+AEA+VGSR
Sbjct  74    LCPLQRKNLVERLVKIAEQDNEKFLFKLRDRIDRVGLEIPTIEIRFEHLNVEAEAHVGSR  133

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF  N+ E F+N LH++P+RKKP  +L DVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  134   ALPTIFNFCINLFEGFLNSLHLIPSRKKPFTVLDDVSGIIKPKRMTLLLGPPSSGKTTLL  193

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAG+L  DLK SGRV+YNGH M EFVP+RTSAYI+Q DLHIGEMTVRETLAFSARCQG
Sbjct  194   LALAGRLSKDLKFSGRVSYNGHGMEEFVPQRTSAYISQTDLHIGEMTVRETLAFSARCQG  253

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             +G RYEMLAELSRREK  NIKPDPD+D+YMKA ++EGQE +VVTDYI+KILGLEVCAD +
Sbjct  254   IGTRYEMLAELSRREKAANIKPDPDLDIYMKAAALEGQETNVVTDYIMKILGLEVCADTM  313

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQ+VNS+RQSIHIL G
Sbjct  314   VGDDMIRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQMVNSLRQSIHILNG  373

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDDIILLSDGQ+VYQGPR+NVLEFF++MGFKCPERKGVADFLQE
Sbjct  374   TAVISLLQPAPETYELFDDIILLSDGQIVYQGPRENVLEFFEYMGFKCPERKGVADFLQE  433

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++E Y F+TV EF+EAFQSFH G+KLGDELA PFD SK HPA L+  
Sbjct  434   VTSRKDQEQYWANKDEPYSFVTVKEFAEAFQSFHAGRKLGDELATPFDMSKGHPAVLTKN  493

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             K+GV KKELLKAC SREFLLMKRNSFVYIFKM QL+L  F+ MT+FLRTEM +++  DG 
Sbjct  494   KFGVCKKELLKACVSREFLLMKRNSFVYIFKMWQLILTGFITMTLFLRTEMHRDTETDGG  553

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFF +I+ MFNG+SEL++SI+KLP FYKQRDL FFP WAY+LPTWILKIP+TLVE
Sbjct  554   IYMGALFFVLIVIMFNGYSELSMSIMKLPVFYKQRDLLFFPCWAYSLPTWILKIPITLVE  613

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY IGFDP   RF KQ FLL+C+NQMAS LFR   A GR++IVANT GS A+
Sbjct  614   VGIWVVMTYYVIGFDPSIERFIKQYFLLVCINQMASGLFRFMGAVGRNIIVANTVGSFAL  673

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + V+V+GGFILSR DVKKWW+WGYW SP+MY QNA++VNE+LGKSW HV   ++E LGV 
Sbjct  674   LAVMVMGGFILSRVDVKKWWLWGYWFSPMMYGQNALAVNEFLGKSWSHVTPNSTEPLGVK  733

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRGIFP+A+WYWIGVGA +GY+ L NFLF LAL YL+P GKPQA++SEE LAERNA 
Sbjct  734   VLKSRGIFPKAYWYWIGVGASIGYMLLFNFLFPLALHYLDPFGKPQALISEEALAERNAG  793

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             +    IEL  +   +S+KGN  RR+VSSR+LS+RVG +  ++ N KRGMVLPF PL ITF
Sbjct  794   RNEHIIELSSRIKGSSDKGNESRRNVSSRTLSARVGGIGASEHNKKRGMVLPFTPLSITF  853

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEI+Y+V+MP EMK+QG+ EDRL LLKG+NGAFRPGVLTALMG+SGAGKTTLMDVL+GRK
Sbjct  854   DEIRYSVEMPQEMKSQGILEDRLELLKGVNGAFRPGVLTALMGVSGAGKTTLMDVLSGRK  913

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             T GYI+G ITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D++T
Sbjct  914   TAGYIQGQITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSST  973

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  974   RQMFIEEVMELVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1033

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLG+H S
Sbjct  1034  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGQHCS  1093

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI +FE ING+ +I++GYNPATWMLE+TSEAQEAALG++FAE+Y+NS+LYRRNKALI+E
Sbjct  1094  HLINHFEGINGVPKIKNGYNPATWMLEVTSEAQEAALGVNFAEIYKNSDLYRRNKALIRE  1153

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             L+ P  GSKDLYFPTKYSQ+FFTQCMACLWKQH SYWRNPPY+AVRLLFTT  ALLFGT+
Sbjct  1154  LTTPPTGSKDLYFPTKYSQTFFTQCMACLWKQHLSYWRNPPYSAVRLLFTTIIALLFGTI  1213

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW IG KR+ +QDLFNAMG MYAAV+F+G+QNATSVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1214  FWDIGSKRQRKQDLFNAMGSMYAAVLFIGIQNATSVQPVVAIERTVFYRERAAGMYSALP  1273

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV IE+P++F+QTL+YGVIVYAMIGF+WT +KF W++FFM+FT LYFT YGMM V 
Sbjct  1274  YAFGQVAIEIPYIFIQTLVYGVIVYAMIGFDWTFSKFFWYLFFMFFTFLYFTFYGMMAVG  1333

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TP+HN+AAI+S  FY  WNLFSGF+IP+TR+PVWWRWY++ICPVSWTLYGL+ SQFGD+
Sbjct  1334  LTPDHNVAAIVSFGFYMIWNLFSGFVIPRTRMPVWWRWYFWICPVSWTLYGLVTSQFGDI  1393

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             KE +DT ETV++FV+S+F +  DFVG  A ++VG  ++FGF FAFSIKAFNFQ R
Sbjct  1394  KEPIDTGETVEEFVRSYFGYRDDFVGVAAAVLVGFTLLFGFTFAFSIKAFNFQKR  1448



>gb|KDO79586.1| hypothetical protein CISIN_1g046196mg [Citrus sinensis]
Length=1436

 Score =  2202 bits (5705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1094/1435 (76%), Positives = 1256/1435 (88%), Gaps = 18/1435 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ ++VF+RSSRE   DD+EAL WAAIEKLPTYLR++RG+L  +E  G  +E+D++ 
Sbjct  20    IWRNNTLDVFARSSREDTYDDDEALTWAAIEKLPTYLRVQRGMLTEDE--GQAREVDIKN  77

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+R+L+ERL++IA+EDNE FLLKLK R +RVG+D+PTIEVRFEHLNV+AEAY+GSR
Sbjct  78    LGFIERRNLIERLLKIAEEDNEKFLLKLKDRIERVGLDIPTIEVRFEHLNVEAEAYIGSR  137

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FN  AN+LE F+NYLH+LP+RKKPL ILHDVSGIIKP R+TLLLGPPSSGKTTLL
Sbjct  138   ALPTVFNSCANMLEGFLNYLHVLPSRKKPLTILHDVSGIIKPQRLTLLLGPPSSGKTTLL  197

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRVTYNGH M EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  198   LALAGKLGKDLKFSGRVTYNGHGMEEFVPQRTSAYISQNDLHIGEMTVRETLAFSARCQG  257

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYE+L ELSRREK  NIKPDPDID+ MKA S+EGQE +VVTDY+LKILGLEVCAD +
Sbjct  258   VGPRYEVLQELSRREKAANIKPDPDIDLIMKAASLEGQEKNVVTDYVLKILGLEVCADTM  317

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTT+QIVNS+RQSIHIL G
Sbjct  318   VGDEMLRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTYQIVNSLRQSIHILNG  377

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDD+ILLSDGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  378   TAVISLLQPAPETYELFDDLILLSDGQIVYQGPRENVLEFFERMGFKCPERKGVADFLQE  437

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++E Y F+T  EFSE FQSFH+G+KLGDELA PFDKSKSHPAAL+ K
Sbjct  438   VTSRKDQEQYWANKDEPYSFVTAKEFSEVFQSFHIGQKLGDELATPFDKSKSHPAALTTK  497

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG +KKELLKAC +RE+LLMKRNSFVY FKM Q+   A VAMT+FLRTEM ++++ DG 
Sbjct  498   KYGASKKELLKACFAREYLLMKRNSFVYFFKMFQIFFSASVAMTLFLRTEMHRSTVEDGG  557

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFFAVI  MFNGFSEL+++I+KLP FYKQRD  FFP WAY+LPTWILKIP+T +E
Sbjct  558   IYMGALFFAVITIMFNGFSELSMTIMKLPVFYKQRDFLFFPAWAYSLPTWILKIPITFIE  617

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY +GF+ +  RF KQ FLL+CVNQ AS LFRL  A GR++IVANTFGS A 
Sbjct  618   VGIWVFMTYYVVGFESNIERFVKQYFLLLCVNQTASGLFRLMGALGRNIIVANTFGSFAN  677

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGFILSRDDVKKWW+WGYW SP+MY QNA++VNE+LGKSW HVP  ++E LGV 
Sbjct  678   LTVLVLGGFILSRDDVKKWWLWGYWFSPMMYGQNALAVNEFLGKSWGHVPPNSTEPLGVV  737

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRG+FP A+WYWIGVGAL+GYV L NFLF +AL YL+P GKPQA+LSEE LA++NAC
Sbjct  738   ILKSRGLFPNAYWYWIGVGALLGYVLLFNFLFTVALKYLDPFGKPQAILSEEALAKKNAC  797

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K  EP+EL     S+  +                      AD N KRGM+LPFEP  ITF
Sbjct  798   KTEEPVELSSGVQSSYGEVRSFNE----------------ADQNRKRGMILPFEPHSITF  841

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+I+YA+DMP EMKAQG+ +DRL  LKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  842   DDIRYALDMPQEMKAQGIPDDRLEFLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  901

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGY+ GSITISGYPK QETFARI+GYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D+ T
Sbjct  902   TGGYVSGSITISGYPKNQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSDT  961

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFVEEVM+LVEL  +REALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  962   RKMFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1021

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLL+KRGGEEIYVGPLGRH S
Sbjct  1022  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLMKRGGEEIYVGPLGRHCS  1081

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI+YFE I+G+ +I++GYNPATWMLE+T+ AQEAALGI+FA+VY+NSELY+ NK +I+E
Sbjct  1082  QLIKYFEGIDGVPKIKEGYNPATWMLEVTTPAQEAALGINFAKVYKNSELYKGNKEMIKE  1141

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSK+LYF T+YSQSFFTQCMACLWKQH SYWRNPPYTAVRL FTTF AL+FGT+
Sbjct  1142  LSIPPPGSKNLYFQTRYSQSFFTQCMACLWKQHLSYWRNPPYTAVRLFFTTFIALMFGTI  1201

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW IG KR  +QDLFNAMG MYAA++FLGVQNATSVQPVVA+ERTVFYRERAAGMYSALP
Sbjct  1202  FWDIGSKRANRQDLFNAMGSMYAAILFLGVQNATSVQPVVAVERTVFYRERAAGMYSALP  1261

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQVVIELPH+F+Q +IYGVIVYAMIGF+WT +KFLW++ FMY T LYFTLYGMMTVA
Sbjct  1262  YAFGQVVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFLWYLLFMYLTFLYFTLYGMMTVA  1321

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNIAAII+SAFY  WNLFSGFIIP+ R+P+WWRWY +ICPVSWTLYGL+ASQFGDV
Sbjct  1322  VTPNHNIAAIIASAFYVLWNLFSGFIIPRPRMPIWWRWYCWICPVSWTLYGLVASQFGDV  1381

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              +  D+ + V DFVK +F +DHD +G VA + VG+ V+FGF FA+SIKAFNFQ R
Sbjct  1382  NDTFDSGQKVGDFVKDYFGYDHDMLGVVAVVHVGLVVLFGFTFAYSIKAFNFQHR  1436



>gb|KHN07106.1| Pleiotropic drug resistance protein 1 [Glycine soja]
Length=1448

 Score =  2201 bits (5703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1093/1435 (76%), Positives = 1265/1435 (88%), Gaps = 4/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWRS  ++VFS SSR   ++ E  LKWAAIEKLPTYLR+ RGIL   E  G P EID+ K
Sbjct  18    VWRSGSIDVFSGSSRRDDDEQE--LKWAAIEKLPTYLRMTRGILTETE--GQPTEIDINK  73

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L   ++++L+ERLV+IA++DNE FL KL+ R DRVG+++PTIE+RFEHLNV+AEA+VGSR
Sbjct  74    LCPLQRKNLVERLVKIAEQDNEKFLFKLRDRIDRVGLEIPTIEIRFEHLNVEAEAHVGSR  133

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF  N+ E F+N LH++P+RKKP  +L DVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  134   ALPTIFNFCINLFEGFLNSLHLIPSRKKPFTVLDDVSGIIKPKRMTLLLGPPSSGKTTLL  193

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAG+L  DLK SGRV+YNGH M EFVP+RTSAYI+Q DLHIGEMTVRETLAFSARCQG
Sbjct  194   LALAGRLSKDLKFSGRVSYNGHGMEEFVPQRTSAYISQTDLHIGEMTVRETLAFSARCQG  253

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             +G RYEMLAELSRREK  NIKPDPD+D+YMKA ++EGQE +VVTDYI+KILGLEVCAD +
Sbjct  254   IGTRYEMLAELSRREKAANIKPDPDLDIYMKAAALEGQETNVVTDYIMKILGLEVCADTM  313

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQ+VNS+RQSIHIL G
Sbjct  314   VGDDMIRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQMVNSLRQSIHILNG  373

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDDIILLSDGQ+VYQGPR+NVLEFF++MGFKCPERKGVADFLQE
Sbjct  374   TAVISLLQPAPETYELFDDIILLSDGQIVYQGPRENVLEFFEYMGFKCPERKGVADFLQE  433

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++E Y F+TV EF+EAFQSFH G+KLGDELA PFD SK HPA L+  
Sbjct  434   VTSRKDQEQYWANKDEPYSFVTVKEFAEAFQSFHAGRKLGDELATPFDMSKGHPAVLTKN  493

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             K+GV KKELLKAC SREFLLMKRNSFVYIFKM QL+L  F+ MT+FLRTEM +++  DG 
Sbjct  494   KFGVCKKELLKACVSREFLLMKRNSFVYIFKMWQLILTGFITMTLFLRTEMHRDTETDGG  553

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFF +I+ MFNG+SEL++SI+KLP FYKQRDL FFP WAY+LPTWILKIP+TLVE
Sbjct  554   IYMGALFFVLIVIMFNGYSELSMSIMKLPVFYKQRDLLFFPCWAYSLPTWILKIPITLVE  613

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY IGFDP   RF KQ FLL+C+NQMAS LFR   A GR++IVANT GS A+
Sbjct  614   VGIWVVMTYYVIGFDPSIERFIKQYFLLVCINQMASGLFRFMGAVGRNIIVANTVGSFAL  673

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + V+V+GGFILSR DVKKWW+WGYW SP+MY QNA++VNE+LGKSW HV   ++E LGV 
Sbjct  674   LAVMVMGGFILSRVDVKKWWLWGYWFSPMMYGQNALAVNEFLGKSWSHVTPNSTEPLGVK  733

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRGIFP+A+WYWIGVGA +GY+ L NFLF LAL YL+P GKPQA++SEE LAERNA 
Sbjct  734   VLKSRGIFPKAYWYWIGVGASIGYMLLFNFLFPLALHYLDPFGKPQALISEEALAERNAG  793

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             +    IEL  +   +S+KGN  RR+VSSR+LS+RVG +  ++ N KRGMVLPF PL ITF
Sbjct  794   RNEHIIELSSRIKGSSDKGNESRRNVSSRTLSARVGGIGASEHNKKRGMVLPFTPLSITF  853

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEI+Y+V+MP EMK+QG+ EDRL LLKG+NGAFRPGVLTALMG+SGAGKTTLMDVL+GRK
Sbjct  854   DEIRYSVEMPQEMKSQGILEDRLELLKGVNGAFRPGVLTALMGVSGAGKTTLMDVLSGRK  913

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             T GYI+G ITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D++T
Sbjct  914   TAGYIQGQITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSST  973

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  974   RQMFIEEVMELVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1033

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLG+H S
Sbjct  1034  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGQHCS  1093

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI +FE ING+ +I++GYNPATWMLE+TSEAQEAALG++FAE+Y+NS+LYRRNKALI+E
Sbjct  1094  HLINHFEGINGVPKIKNGYNPATWMLEVTSEAQEAALGVNFAEIYKNSDLYRRNKALIRE  1153

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             L+ P  GSKDLYFPTKYSQ+FFTQCMACLWKQH SYWRNPPY+AVRLLFTT  ALLFGT+
Sbjct  1154  LTTPPTGSKDLYFPTKYSQTFFTQCMACLWKQHLSYWRNPPYSAVRLLFTTIIALLFGTI  1213

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW IG KR+ +QDLFNAMG MYAAV+F+G+QNATSVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1214  FWDIGSKRQRKQDLFNAMGSMYAAVLFIGIQNATSVQPVVAIERTVFYRERAAGMYSALP  1273

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV IE+P++F+QTL+YGVIVYAMIGF+WT +KF W++FFM+FT LYFT YGMM V 
Sbjct  1274  YAFGQVAIEIPYIFIQTLVYGVIVYAMIGFDWTFSKFFWYLFFMFFTFLYFTFYGMMAVG  1333

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TP+HN+A I+S  FY  WNLFSGF+IP+TR+PVWWRWY++ICPVSWTLYGL+ SQFGD+
Sbjct  1334  LTPDHNVATIVSFGFYMIWNLFSGFVIPRTRMPVWWRWYFWICPVSWTLYGLVTSQFGDI  1393

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             KE +DT ETV++FV+S+F +  DFVG  A ++VG  ++FGF FAFSIKAFNFQ R
Sbjct  1394  KEPIDTGETVEEFVRSYFGYRDDFVGVAAAVLVGFTLLFGFTFAFSIKAFNFQKR  1448



>ref|XP_010249929.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nelumbo 
nucifera]
Length=1445

 Score =  2199 bits (5699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1084/1435 (76%), Positives = 1261/1435 (88%), Gaps = 7/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWRS  VEVFSRSSRE  +++   LKWAA+EKLPTY RIR+GIL     G  P E+D+  
Sbjct  18    VWRSDAVEVFSRSSREEDDEEA--LKWAALEKLPTYDRIRKGILTGV--GSQPTEVDIGN  73

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EK++L+ERLVR+A+EDNE FLLKLK+R +RVGIDLPTIEVRFEHLN++A+AYVGSR
Sbjct  74    LGFQEKKNLIERLVRVAEEDNEKFLLKLKNRIERVGIDLPTIEVRFEHLNINADAYVGSR  133

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNFTANI+E  +N+LHILP+RKKPL IL DVSGIIKP+RMTLLLGPPSSGKTTLL
Sbjct  134   ALPTIFNFTANIVEGILNFLHILPSRKKPLCILQDVSGIIKPSRMTLLLGPPSSGKTTLL  193

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD DLKVSGRVTYNGH M EFVP+RTSAYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  194   LALAGKLDPDLKVSGRVTYNGHGMDEFVPQRTSAYISQHDLHIGEMTVRETLAFSARCQG  253

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+ML ELSRREK  NIKPDPDID+YMKA ++EGQE SVVTDYILKILGL+VCAD +
Sbjct  254   VGERYDMLTELSRREKAANIKPDPDIDIYMKAATLEGQETSVVTDYILKILGLDVCADTM  313

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKR+TTGEMLVGPARALFMDEISTGLDSSTT+QIV+S+RQSIHIL G
Sbjct  314   VGDEMLRGISGGQRKRVTTGEMLVGPARALFMDEISTGLDSSTTYQIVSSLRQSIHILNG  373

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY LFDDIILLSDGQV+YQGPR++VL+FF+ MGFKCPERKG+ADFLQE
Sbjct  374   TAVISLLQPAPETYNLFDDIILLSDGQVIYQGPREHVLDFFESMGFKCPERKGIADFLQE  433

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW R+ + Y F+TV EF+EAFQSFH G+K+ DEL+ PFDK+K+H AAL+ K
Sbjct  434   VTSKKDQKQYWARKLKPYRFVTVKEFAEAFQSFHAGQKISDELSTPFDKTKNHAAALTTK  493

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKEL KAC SRE LLMKRNSFVY FKM QL ++AF+ MT+FLRTEM ++   DG 
Sbjct  494   KYGVSKKELFKACLSREILLMKRNSFVYFFKMAQLAILAFITMTLFLRTEMHQDDSTDGG  553

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFFA+I  MFNG SE++++I KLP FYKQRDL F+P WAY+LPTWILKIP+T +E
Sbjct  554   IYMGALFFALITVMFNGLSEISMTIAKLPVFYKQRDLLFYPAWAYSLPTWILKIPITFIE  613

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV +TYY IGFDP+  RFF+Q FLL+ +NQMASALFR   A GR++IVANTFG+ A+
Sbjct  614   VGIWVFITYYVIGFDPNVERFFRQYFLLLLINQMASALFRFIGATGRNMIVANTFGAFAV  673

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +  +VLGGFILSR+DVK WWIWGYWISPLMY QNAISVNE+LGK+WRHV   ++E LGVT
Sbjct  674   LTFVVLGGFILSRNDVKNWWIWGYWISPLMYGQNAISVNEFLGKNWRHVLPNSTEPLGVT  733

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             V++SRG FPEAHWYWIGVGA +GY+FL NFL+ +AL YL+P GKPQA+L +E  A     
Sbjct  734   VIKSRGFFPEAHWYWIGVGASIGYMFLFNFLYTVALHYLDPFGKPQAVLPDEGEARTGED  793

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
                  +E+   G +TS +       V+S S S+R+      + + KRGMVLPF+PL ITF
Sbjct  794   NELSSLEMTSSGHTTSGEQQDGIIRVASESSSARIDE---VNQHKKRGMVLPFQPLSITF  850

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEI+Y VDMP EMK QG+TEDRL LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  851   DEIRYFVDMPQEMKDQGVTEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRK  910

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+ITISGYPK+QETFARI+GYCEQ DIHSPHVTVYESL+YSAWLRLP ++D++T
Sbjct  911   TGGYIEGNITISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSDVDSST  970

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVEL  LR ALVGLPGVNGLSTEQRKR+TIAVELVANPSIIFMDEPTSGL
Sbjct  971   RKMFIEEVMELVELNPLRGALVGLPGVNGLSTEQRKRMTIAVELVANPSIIFMDEPTSGL  1030

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLGR S 
Sbjct  1031  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGRQSC  1090

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I G+ +I+DGYNPATWMLE+T+ AQE  LG++FAEVY+NSEL+RRNK+LIQE
Sbjct  1091  HLIKYFEGIEGVSKIKDGYNPATWMLEVTTMAQEEILGVNFAEVYKNSELHRRNKSLIQE  1150

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSKDLYFPT YSQSFFTQCMACLWKQHWSYWRNPPY AVR +FTTF ALLFGT+
Sbjct  1151  LSTPPPGSKDLYFPTMYSQSFFTQCMACLWKQHWSYWRNPPYIAVRFIFTTFIALLFGTI  1210

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR  QQDLFNAMG MYAAV+FLG+QNA+SVQPVVA+ERTVFYRERAAGMYSALP
Sbjct  1211  FWDLGSKRSRQQDLFNAMGSMYAAVLFLGIQNASSVQPVVAVERTVFYRERAAGMYSALP  1270

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV+IE+PH+FVQ ++YGVIVYAMIGFEWTAAKF W++FFMYFTLLYFT YGMM VA
Sbjct  1271  YAFGQVMIEIPHIFVQAVVYGVIVYAMIGFEWTAAKFFWYLFFMYFTLLYFTFYGMMAVA  1330

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHN+AAI+SSAFYG WNLFSGFI+P+TR+PVWWRWYY+ICPV+WTLYGL+ASQFGD+
Sbjct  1331  VTPNHNVAAIVSSAFYGIWNLFSGFIVPRTRMPVWWRWYYWICPVAWTLYGLVASQFGDI  1390

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             ++K++T++TV++F++S+F F HDF+G V+ +I+G  V+F FIFAFSI+AFNFQ R
Sbjct  1391  QDKIETDQTVEEFLRSYFGFRHDFLGVVSAVIIGFTVLFAFIFAFSIRAFNFQRR  1445



>ref|XP_006476213.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Citrus sinensis]
Length=1463

 Score =  2195 bits (5687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1108/1448 (77%), Positives = 1271/1448 (88%), Gaps = 17/1448 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ ++VF+RSSRE   DD+EAL WAAIEKLPTYLR++RG+L  +E  G  +E+D++ 
Sbjct  20    IWRNNTLDVFARSSREDTYDDDEALTWAAIEKLPTYLRVQRGMLTEDE--GQAREVDIKN  77

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+R+L+ERL++IA+EDNE FLLKLK R +RVG+D+PTIEVRFEHLNV+AEAY+GSR
Sbjct  78    LGFIERRNLIERLLKIAEEDNEKFLLKLKDRIERVGLDIPTIEVRFEHLNVEAEAYIGSR  137

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FN  AN+LE F+NYLH+LP+RKKPL ILHDVSGIIKP R+TLLLGPPSSGKTTLL
Sbjct  138   ALPTVFNSCANMLEGFLNYLHVLPSRKKPLTILHDVSGIIKPQRLTLLLGPPSSGKTTLL  197

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRVTYNGH M EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  198   LALAGKLGKDLKFSGRVTYNGHGMEEFVPQRTSAYISQNDLHIGEMTVRETLAFSARCQG  257

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYE+L ELSRREK  NIKPDPDID+ MKA S+EGQE +VVTDY+LKILGLEVCAD +
Sbjct  258   VGPRYEVLQELSRREKAANIKPDPDIDLIMKAASLEGQEKNVVTDYVLKILGLEVCADTM  317

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTT+QIVNS+RQSIHIL G
Sbjct  318   VGDEMLRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTYQIVNSLRQSIHILNG  377

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDD+ILLSDGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  378   TAVISLLQPAPETYELFDDLILLSDGQIVYQGPRENVLEFFERMGFKCPERKGVADFLQE  437

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++E Y F+T  EFSE FQSFH+G+KLGDELA PFDKSKSHPAAL+ K
Sbjct  438   VTSRKDQEQYWANKDEPYSFVTAKEFSEVFQSFHIGQKLGDELATPFDKSKSHPAALTTK  497

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG +KKELLKAC +RE+LLMKRNSFVY FKM Q+   A VAMT+FLRTEM ++++ DG 
Sbjct  498   KYGASKKELLKACFAREYLLMKRNSFVYFFKMFQIFFSASVAMTLFLRTEMHRSTVEDGG  557

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFFAVI  MFNGFSEL+++I+KLP FYKQRD  FFP WAY+LPTWILKIP+T +E
Sbjct  558   IYMGALFFAVITIMFNGFSELSMTIMKLPVFYKQRDFLFFPAWAYSLPTWILKIPITFIE  617

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY +GF+ +  RF KQ FLL+CVNQ AS LFRL  A GR++IVANTFGS A 
Sbjct  618   VGIWVFMTYYVVGFESNIERFVKQYFLLLCVNQTASGLFRLMGALGRNIIVANTFGSFAN  677

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGFILSRDDVKKWW+WGYW SP+MY QNA++VNE+LGKSW HVP  ++E LGV 
Sbjct  678   LTVLVLGGFILSRDDVKKWWLWGYWFSPMMYGQNALAVNEFLGKSWGHVPPNSTEPLGVV  737

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLN---PL----------GKPQA  2301
             +L+SRG+FP A+WYWIGVGAL+GYV L NFLF +AL YL+   PL          GKPQA
Sbjct  738   ILKSRGLFPNAYWYWIGVGALLGYVLLFNFLFTVALKYLDRKHPLFYTSFKAQAFGKPQA  797

Query  2302  MLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKR  2481
             +LSEE LA++NACK  EP+EL    G  S  GN   R+VS R+LS+RV S N AD N KR
Sbjct  798   ILSEEALAKKNACKTEEPVEL--SSGVQSSYGNESHRNVSFRTLSARVRSFNEADQNRKR  855

Query  2482  GMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGA  2661
             GM+LPFEP  ITFD+I+YA+DMP EMKAQG+ +DRL  LKG++GAFRPGVLTALMG+SGA
Sbjct  856   GMILPFEPHSITFDDIRYALDMPQEMKAQGIPDDRLEFLKGVSGAFRPGVLTALMGVSGA  915

Query  2662  GKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYS  2841
             GKTTLMDVLAGRKTGGY+ GSITISGYPK QETFARI+GYCEQTDIHSPHVTVYESLVYS
Sbjct  916   GKTTLMDVLAGRKTGGYVSGSITISGYPKNQETFARISGYCEQTDIHSPHVTVYESLVYS  975

Query  2842  AWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVAN  3021
             AWLRLPPE+D+ TR+MFVEEVM+LVEL  +REALVGLPGV+GLSTEQRKRLTIAVELVAN
Sbjct  976   AWLRLPPEVDSDTRKMFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVAN  1035

Query  3022  PSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGG  3201
             PSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLL+KRGG
Sbjct  1036  PSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLMKRGG  1095

Query  3202  EEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRN  3381
             EEIYVGPLGRH SQLI+YFE I+G+ +I++GYNPATWMLE+T+ AQEAALGI+FA+VY+N
Sbjct  1096  EEIYVGPLGRHCSQLIKYFEGIDGVPKIKEGYNPATWMLEVTTPAQEAALGINFAKVYKN  1155

Query  3382  SELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRL  3561
             SELY+ NK +I+ELS P PGSK+LYF T+YSQSFFTQCMACLWKQH SYWRNPPYTAVRL
Sbjct  1156  SELYKGNKEMIKELSIPPPGSKNLYFQTRYSQSFFTQCMACLWKQHLSYWRNPPYTAVRL  1215

Query  3562  LFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVF  3741
              FTTF AL+FGT+FW IG KR  +QDLFNAMG MYAA++FLGVQNATSVQPVVA+ERTVF
Sbjct  1216  FFTTFIALMFGTIFWDIGSKRANRQDLFNAMGSMYAAILFLGVQNATSVQPVVAVERTVF  1275

Query  3742  YRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyft  3921
             YRERAAGMYSALPYAFGQVVIELPH+F+Q +IYGVIVYAMIGF+WT +KFLW++ FMY T
Sbjct  1276  YRERAAGMYSALPYAFGQVVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFLWYLLFMYLT  1335

Query  3922  llyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSW  4101
              LYFTLYGMMTVAVTPNHNIAAII+SAFY  WNLFSGFIIP+ R+P+WWRWY +ICPVSW
Sbjct  1336  FLYFTLYGMMTVAVTPNHNIAAIIASAFYVLWNLFSGFIIPRPRMPIWWRWYCWICPVSW  1395

Query  4102  TLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSI  4281
             TLYGL+ASQFGDV +  D+ + V DFVK +F +DHD +G VA + VG+ V+FGF FA+SI
Sbjct  1396  TLYGLVASQFGDVNDTFDSGQKVGDFVKDYFGYDHDMLGVVAVVHVGLVVLFGFTFAYSI  1455

Query  4282  KAFNFQTR  4305
             KAFNFQ R
Sbjct  1456  KAFNFQHR  1463



>emb|CDP04827.1| unnamed protein product [Coffea canephora]
Length=1445

 Score =  2193 bits (5682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1084/1436 (75%), Positives = 1262/1436 (88%), Gaps = 10/1436 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR++ ++VFS+SSRE  +++   LKWAAIE+LPTY R+RRGIL  +EE G  +E+D+E 
Sbjct  19    VWRNTTIDVFSKSSREEDDEEA--LKWAAIERLPTYHRLRRGILT-DEEKGQRREVDIEH  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG AE++ +LER V+ A+EDNE FLLKLK R DRVGIDLPT+EVRF++L+V+AEA+VGSR
Sbjct  76    LGPAERKIILERQVKFAEEDNEKFLLKLKQRVDRVGIDLPTVEVRFQNLSVEAEAHVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+ NF+ANI+E  + YLHILPNRKKP PILHDVSGIIKPAR+TLLLGPPSSGKTTLL
Sbjct  136   ALPTLVNFSANIVEGLLGYLHILPNRKKPFPILHDVSGIIKPARLTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAG+LDSDLKVSG +TYNGH + EFVP+RTSAYI+QHDLHIGEMTVRETLAFS RCQG
Sbjct  196   LALAGRLDSDLKVSGNITYNGHGLNEFVPQRTSAYISQHDLHIGEMTVRETLAFSERCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG R++ML ELSRREK+ NIKPDPDID++MKA ++E QE++V +DYI+KILGLEVCAD L
Sbjct  256   VGPRHDMLEELSRREKQANIKPDPDIDIFMKAAALENQESTVKSDYIMKILGLEVCADTL  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VG+EMIRGISGGQRKR+TTGEM+VG +R   MDEISTGLDSSTTFQIVNSI++SIHILQG
Sbjct  316   VGNEMIRGISGGQRKRVTTGEMMVGASRVFLMDEISTGLDSSTTFQIVNSIKESIHILQG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDD+ILLSDGQ+VYQGPR++VL+FF++MGFKCPERKGVADFLQE
Sbjct  376   TAVISLLQPAPETYDLFDDVILLSDGQIVYQGPREHVLDFFENMGFKCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQYW  R   Y F++   F+EAFQSFHVG +LGDEL+V FDK+KSHPAALS K
Sbjct  436   VTSKKDQEQYWADRNAPYSFVSEKTFAEAFQSFHVGTQLGDELSVRFDKTKSHPAALSTK  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+K ELLKAC  REFLLMKRNSFVY F MI+L++MA + MTVFLRT++ K++  DG 
Sbjct  496   KYGVSKMELLKACMLREFLLMKRNSFVYTFAMIKLIVMALITMTVFLRTKIHKDTATDGG  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             + MGALFF +IM MFNGFSELAL+I+KLP FYKQRDL FFP WAYALPTWILKIP+TLVE
Sbjct  556   IVMGALFFTLIMIMFNGFSELALTIMKLPVFYKQRDLLFFPAWAYALPTWILKIPITLVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
              A+WV MTYY IGFD +AGRFF+Q  LL+CV+QMAS LFRL  + GR++I+ANTFGS ++
Sbjct  616   TALWVGMTYYVIGFDSNAGRFFRQYLLLVCVSQMASGLFRLMGSLGRNMIIANTFGSFSL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + V++LGGF+LS D++KKWWIWGYWISP+MY QNAI+VNE+LGKSWR V  G++E LG +
Sbjct  676   LAVMLLGGFLLSHDNIKKWWIWGYWISPMMYGQNAIAVNEFLGKSWRKVLPGSTEPLGAS  735

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL SRGIF EA WYWIGVGAL+GY+FL NFL+ LALTYL P  KPQA++SEE+LAERNA 
Sbjct  736   VLESRGIFAEARWYWIGVGALIGYLFLFNFLYTLALTYLKPFEKPQAVISEESLAERNAG  795

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K GE  EL  +G   +E+    R   S     S       A+P  KRGM+LPFEPL IT+
Sbjct  796   KTGEEAELSSEGKDMNERRTPGRSISSRVGSRSE------AEPTRKRGMLLPFEPLAITY  849

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEI+Y+VDMP EMK QG TEDRL LLKGI+GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  850   DEIRYSVDMPQEMKDQGQTEDRLELLKGISGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  909

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+I+ISGYPK+QETFARIAGYCEQ DIHSPHVTVYESL+YSAWLRLP E+D +T
Sbjct  910   TGGYIEGTISISGYPKKQETFARIAGYCEQNDIHSPHVTVYESLLYSAWLRLPNEVDAST  969

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFVEEVM+LVELT LREALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  970   RKMFVEEVMELVELTPLREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1029

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTV+TGRTVVCTIHQPSIDIFDAFDEL+LLKRGGEEIYVGPLG HSS
Sbjct  1030  DARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFDAFDELVLLKRGGEEIYVGPLGHHSS  1089

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             +LI+YFE I+G+ +IRDGYNPATWML++TS AQE+ALG++FAE+Y++SELYRRNK LI+E
Sbjct  1090  ELIKYFEGIDGVSKIRDGYNPATWMLDVTSLAQESALGVNFAELYKSSELYRRNKTLIKE  1149

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS PAPGSKDL+FPT YSQ FFTQ  ACLWKQH SYWRNP YTAVRL+FTTF AL+FGT+
Sbjct  1150  LSTPAPGSKDLFFPTAYSQPFFTQFTACLWKQHLSYWRNPKYTAVRLIFTTFIALMFGTV  1209

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR  +QDLFNAMG MYAAV+F+GVQNAT++QPV+AIERTVFYRERAAGMYSAL 
Sbjct  1210  FWNLGSKRTVRQDLFNAMGSMYAAVLFIGVQNATAIQPVIAIERTVFYRERAAGMYSALS  1269

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQ+VIELP++ VQT+IYGV+VYAMIGFEWTAAKF W++FFMYFTLLY+T YGMMTVA
Sbjct  1270  YAFGQIVIELPYILVQTIIYGVLVYAMIGFEWTAAKFFWYLFFMYFTLLYYTTYGMMTVA  1329

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPN  +AAI SSAFY  WNLFSGF+IPK +IPVWWRWYYYICPV+WTLYGL+ SQFGD+
Sbjct  1330  VTPNQQVAAIASSAFYILWNLFSGFLIPKPKIPVWWRWYYYICPVAWTLYGLVVSQFGDI  1389

Query  4141  KEK-LDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +EK LDTN+TV+ F++S+F F HDFVGYVA IIVG+  +F FIFAFSIK FNFQ R
Sbjct  1390  EEKMLDTNQTVQQFIRSYFGFRHDFVGYVAVIIVGVATLFTFIFAFSIKVFNFQKR  1445



>ref|XP_007137056.1| hypothetical protein PHAVU_009G096200g [Phaseolus vulgaris]
 ref|XP_007137057.1| hypothetical protein PHAVU_009G096200g [Phaseolus vulgaris]
 gb|ESW09050.1| hypothetical protein PHAVU_009G096200g [Phaseolus vulgaris]
 gb|ESW09051.1| hypothetical protein PHAVU_009G096200g [Phaseolus vulgaris]
Length=1449

 Score =  2192 bits (5681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1093/1435 (76%), Positives = 1266/1435 (88%), Gaps = 3/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWRSSGV+VFS SSR   +++E  LKWAAIEKLPTYLR+ RGIL  E EG  P EID+ K
Sbjct  18    VWRSSGVDVFSGSSRRDDDEEE--LKWAAIEKLPTYLRMTRGILT-EAEGQPPTEIDINK  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L   ++++L+ERLV+IA++DNE FL KL+ R DRVG+++PTIEVRFEHLNV+AEA+VGSR
Sbjct  75    LCPLQRKNLVERLVKIAEQDNEKFLFKLRDRIDRVGLEIPTIEVRFEHLNVEAEAHVGSR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF  N+LE F++ LH++P+RKKP  +L  VSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPTIFNFCINLLEGFLSSLHLIPSRKKPFTVLDGVSGIIKPRRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAG+L  DLK SGRV+YNG  M EFVP+RTSAYI+Q DLHIGEMTVRETLAFSARCQG
Sbjct  195   LALAGRLGKDLKFSGRVSYNGRGMEEFVPQRTSAYISQSDLHIGEMTVRETLAFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             +G RYEMLAELSRREK  NIKPDPD+D+YMKA ++EGQE +VVTDYI+KILGLEVCAD +
Sbjct  255   IGTRYEMLAELSRREKAENIKPDPDLDIYMKAAALEGQETNVVTDYIMKILGLEVCADTM  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQ+KR+TTGEMLVGP RALFMDEISTGLDSSTTFQ+VNS+RQSIHIL G
Sbjct  315   VGDDMIRGISGGQKKRVTTGEMLVGPTRALFMDEISTGLDSSTTFQMVNSLRQSIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDDIILLSDGQ+VYQGPR+NVLEFF++MGFKCPERKGVADFLQE
Sbjct  375   TAVISLLQPAPETYELFDDIILLSDGQIVYQGPRENVLEFFEYMGFKCPERKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++E Y FITV EF+EAFQSFH+G+KLGDELA PFD SK HPA L+  
Sbjct  435   VTSRKDQEQYWANKDEPYIFITVREFAEAFQSFHIGRKLGDELATPFDMSKGHPAVLTKN  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC SREFLLMKRNSFVYIFKM QL+L  F+ MT+FLRTEM +++  DG 
Sbjct  495   KYGVSKKELLKACVSREFLLMKRNSFVYIFKMWQLILTGFITMTLFLRTEMHRDTETDGG  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +FMGALFF +I+ MFNGFSEL++SI+KLP FYKQRDL FFP WAY+LPTWILKIP+TLVE
Sbjct  555   IFMGALFFVLIVIMFNGFSELSMSIMKLPVFYKQRDLLFFPSWAYSLPTWILKIPITLVE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV MTYY IGFDP   RF KQ FLL+C+NQMAS LFR   A GR++IVANT GS A+
Sbjct  615   VGIWVVMTYYVIGFDPSIERFIKQYFLLVCINQMASGLFRFMGAVGRNIIVANTVGSFAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + V+V+GGFILSR DVKKWW+WGYW SP+MYAQNA++VNE+LGKSW HVP  ++E LGV 
Sbjct  675   LAVMVMGGFILSRVDVKKWWLWGYWFSPMMYAQNALAVNEFLGKSWLHVPPNSTEPLGVK  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRGIFPEA+WYWIGVGA +GY+ L NFLF LAL YL+P GKPQA++SEE LAERNA 
Sbjct  735   VLKSRGIFPEAYWYWIGVGASIGYMALFNFLFPLALHYLDPFGKPQALISEEALAERNAG  794

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             +    +EL  +   +S+KGN  RRSV SR+LS+RVGS+  ++ N KRGMVLPF P  ITF
Sbjct  795   RNEHIVELSSRHNGSSDKGNEDRRSVCSRTLSARVGSIGASEHNTKRGMVLPFTPFSITF  854

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+I+YAV+MP EMK QG+ EDRL LLKG+NGAFRPGVLTALMG+SGAGKTTLMDVL+GRK
Sbjct  855   DDIRYAVEMPQEMKNQGILEDRLELLKGVNGAFRPGVLTALMGVSGAGKTTLMDVLSGRK  914

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             + GYI+G ITISGYPK+QETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D+AT
Sbjct  915   SAGYIQGQITISGYPKKQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSAT  974

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             ++MF+EEVM+LVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  975   KQMFIEEVMELVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1034

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLG+H S
Sbjct  1035  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGQHCS  1094

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             +LI YFE ING+ +I++GYNPATWMLE+TSEAQEA L ++F E+Y+NS+LY RNKALI+E
Sbjct  1095  ELISYFEGINGVPKIKNGYNPATWMLEVTSEAQEAVLEVNFTEIYKNSDLYGRNKALIRE  1154

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P  GSKDLY+PTKYSQ+FFTQCMACLWKQH SYWRNPPY+AVRLLFTT  ALLFGT+
Sbjct  1155  LSTPPAGSKDLYYPTKYSQTFFTQCMACLWKQHLSYWRNPPYSAVRLLFTTIIALLFGTI  1214

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW IG KR+ +QDLFNAMG MYAAV+F+G+ NATSVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1215  FWDIGSKRQRRQDLFNAMGSMYAAVLFIGIHNATSVQPVVAIERTVFYRERAAGMYSALP  1274

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV IE+P++ +QTL+YGVIVYAMIGF+WT +KF W++FFM+FT LYFT YGMM V 
Sbjct  1275  YAFGQVAIEIPYILIQTLVYGVIVYAMIGFDWTLSKFFWYLFFMFFTFLYFTFYGMMAVG  1334

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TP+HNIAAI+S  FY  WNLFSGF+IP+TR+PVWWRWY++ICPVSWTLYGL+ SQFGD+
Sbjct  1335  LTPDHNIAAIVSFGFYMIWNLFSGFVIPRTRMPVWWRWYFWICPVSWTLYGLVTSQFGDI  1394

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K+++++ ETV++FV+S+F +  DFVG  A ++VG  ++FGF FAFSIKAFNFQ R
Sbjct  1395  KDRIESGETVEEFVRSYFGYRDDFVGVAAAVLVGFTLLFGFTFAFSIKAFNFQKR  1449



>ref|XP_010254256.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nelumbo 
nucifera]
Length=1454

 Score =  2189 bits (5673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1084/1441 (75%), Positives = 1261/1441 (88%), Gaps = 10/1441 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR+S VEVFSRSSRE  +++   LKWAA+EKLPTY R+R+GIL     G    EID+  
Sbjct  18    VWRNSAVEVFSRSSREEDDEEA--LKWAALEKLPTYNRLRKGILIGA--GSELSEIDIGS  73

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ EK+ LL+RLVR+A+EDNE FL KLK+R DRVGID+PTIEVRFEHL+++A+AYVGSR
Sbjct  74    LGIQEKKDLLDRLVRVAEEDNEKFLSKLKNRIDRVGIDIPTIEVRFEHLSINADAYVGSR  133

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTI NF+ NI+E  +N+LH+LP+RKKP  IL DVSGIIKP+RM LLLGPPSSGKTTLL
Sbjct  134   ALPTILNFSVNIVEGLLNHLHLLPSRKKPFSILQDVSGIIKPSRMALLLGPPSSGKTTLL  193

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD DLKVSGRVTYNGH + EFVP+RTSAYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  194   LALAGKLDPDLKVSGRVTYNGHGLDEFVPQRTSAYISQHDLHIGEMTVRETLAFSARCQG  253

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG  YEML EL+RREK  NIKPDPDIDVYMKA S+EGQEASVVTDYILKILGL++CAD +
Sbjct  254   VGTGYEMLVELARREKAANIKPDPDIDVYMKASSLEGQEASVVTDYILKILGLDICADTM  313

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKR+TTGEMLVGPA+ALFMDEISTGLDSSTTFQIVNS+RQSIHIL G
Sbjct  314   VGDEMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSLRQSIHILNG  373

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDG++VYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  374   TAVISLLQPAPETYDLFDDIILLSDGEIVYQGPRENVLEFFESMGFKCPERKGVADFLQE  433

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW R++  Y F++  EF+EAF SFHVGKKL +ELA PFDK+KSHPAALS K
Sbjct  434   VTSKKDQKQYWARKDVPYSFVSAKEFAEAFHSFHVGKKLEEELATPFDKTKSHPAALSTK  493

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC+SREFLLMKRNSFVYIFKM QL ++A + MT+FLRT+M +    D  
Sbjct  494   KYGVSKKELLKACSSREFLLMKRNSFVYIFKMTQLTIVALITMTIFLRTKMHRRDDTDAG  553

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +FMGALFF +IM MFNGFSE+A++I KLP FYKQRDL FFP WAY+LPTWILKIP++ +E
Sbjct  554   IFMGALFFTLIMIMFNGFSEMAMTIQKLPVFYKQRDLLFFPAWAYSLPTWILKIPISFME  613

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV +TYY IGFDP+  R F+Q FLL+ VNQ+ASALFR   + GR++IVANTFGS ++
Sbjct  614   VAVWVFITYYVIGFDPNVERLFRQYFLLLLVNQVASALFRFIGSVGRNMIVANTFGSFSL  673

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGFILSR++VKKWWIWGYW+SPLMY QNA++VNE+LGKSWRHVP   +ETLGV+
Sbjct  674   LAVLVLGGFILSRENVKKWWIWGYWVSPLMYGQNALAVNEFLGKSWRHVPLNKTETLGVS  733

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
              ++SRG F EA WYWIGVGA++GY+FL NFLF +ALTYLNP  KPQA++SEETL+ ++  
Sbjct  734   AIKSRGFFAEARWYWIGVGAMIGYIFLFNFLFTVALTYLNPFEKPQAVISEETLSNKDTS  793

Query  2341  KRGEPIELELKGGSTS------EKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFE  2502
             +  E      +G S++      E+ + +RRSVSS   S R  +++  + N +RGMVLPF+
Sbjct  794   RTREVEGSSSQGMSSTGRTTSGERQDEIRRSVSSGFSSVRAETIDEVNENTRRGMVLPFQ  853

Query  2503  PLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMD  2682
             PL ITFDEI+Y+VDMP EMK QG+TEDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMD
Sbjct  854   PLSITFDEIRYSVDMPQEMKNQGVTEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMD  913

Query  2683  VLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPP  2862
             VLAGRKTGGYIEG+ITISGYPK+QETFARI+GYCEQ DIHSP+VTVYESL+YSAWLRLPP
Sbjct  914   VLAGRKTGGYIEGNITISGYPKKQETFARISGYCEQNDIHSPYVTVYESLLYSAWLRLPP  973

Query  2863  EIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMD  3042
             ++D++TR+MFVEEVM+LVEL SLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMD
Sbjct  974   DVDSSTRKMFVEEVMELVELNSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMD  1033

Query  3043  EPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGP  3222
             EPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGG+EIYVGP
Sbjct  1034  EPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGP  1093

Query  3223  LGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRN  3402
             LG HS  LI+YFE I G+ +I+DGYNPATWMLE+T+ AQE  LG+DF EVY+ SELYRRN
Sbjct  1094  LGHHSCHLIKYFEGIEGVSKIKDGYNPATWMLEVTTTAQEEILGVDFTEVYKRSELYRRN  1153

Query  3403  KALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNA  3582
             K+LI+ELS P+PGSKDLYFPTKYSQ F TQCMACLWKQH SYWRNP YTAVR LFTTF A
Sbjct  1154  KSLIEELSTPSPGSKDLYFPTKYSQPFITQCMACLWKQHLSYWRNPSYTAVRFLFTTFIA  1213

Query  3583  LLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAG  3762
             L+FGT+FW +G KR  +QDL NA+G MYAAV+FLGVQN+++VQPVVA+ERTVFYRE+AAG
Sbjct  1214  LMFGTIFWDLGSKRGRKQDLINAIGSMYAAVLFLGVQNSSAVQPVVAVERTVFYREKAAG  1273

Query  3763  MYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftly  3942
             MYSALPYA+ QV+IELPH+FVQ  +YGVIVYAMIGFEWTAAKF W IFFMYFTLLYFT Y
Sbjct  1274  MYSALPYAYAQVMIELPHIFVQASVYGVIVYAMIGFEWTAAKFFWHIFFMYFTLLYFTFY  1333

Query  3943  GMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIA  4122
             GMM VAVTPNHNIAAI+SSAFY  WNLFSGFI+P+TRIPVWWRWYY+ CPV+WTLYGL  
Sbjct  1334  GMMAVAVTPNHNIAAIVSSAFYLIWNLFSGFIVPRTRIPVWWRWYYWACPVAWTLYGLSV  1393

Query  4123  SQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQT  4302
             SQFGD++++LDT ETV+ +++ +F F HDF+G VA +IVG  V+F FIFAFSI+AFNFQ 
Sbjct  1394  SQFGDIEDRLDTGETVESYLREYFGFKHDFLGVVAAVIVGFTVLFVFIFAFSIRAFNFQR  1453

Query  4303  R  4305
             R
Sbjct  1454  R  1454



>ref|XP_010049003.1| PREDICTED: pleiotropic drug resistance protein 1-like [Eucalyptus 
grandis]
Length=1455

 Score =  2189 bits (5673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1090/1436 (76%), Positives = 1260/1436 (88%), Gaps = 5/1436 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG E+FSRSSR   +++   LKWAAIEKLPTYLRIRR I A +E  G  +E+DVE 
Sbjct  24    IWRNSGKEIFSRSSRNEDDEEA--LKWAAIEKLPTYLRIRRTIFADKE--GKIREVDVEN  79

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L + E+R+LLERL++ A+EDNE FLLKLK R +RVG+D PTIEVRFEHLNV+AEAYVGSR
Sbjct  80    LDLMERRNLLERLLKTAEEDNEKFLLKLKQRIERVGLDFPTIEVRFEHLNVEAEAYVGSR  139

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF+ N+LE F+NY HILP+RKKPLPIL+DVSGIIKP RMTLLLGPP SGKTTLL
Sbjct  140   ALPTIFNFSINMLEGFLNYFHILPSRKKPLPILNDVSGIIKPRRMTLLLGPPGSGKTTLL  199

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DL +SGRVTYNG  M EFVP+RTSAYI+Q+DLHI EMT+RETLAFSARCQG
Sbjct  200   LALAGKLGRDLTLSGRVTYNGQGMEEFVPQRTSAYISQYDLHIAEMTIRETLAFSARCQG  259

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG  Y+MLAEL RREKE NI PDPDID++MKA ++EGQE +VV DYI+KILGLE+CAD +
Sbjct  260   VGPHYDMLAELLRREKEANITPDPDIDIFMKAAALEGQETNVVVDYIIKILGLEICADTI  319

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQ+KR+TTGEMLVGPA+ALFMDEISTGLD STTFQIV S+RQSIHIL G
Sbjct  320   VGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDCSTTFQIVKSLRQSIHILNG  379

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA++SLLQPAPETY+LFDDIIL+S+GQ+VYQGPR+NVLEFF+HMGFKCPERKGVADFLQE
Sbjct  380   TALVSLLQPAPETYDLFDDIILVSEGQIVYQGPRENVLEFFRHMGFKCPERKGVADFLQE  439

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++  Y F+TV EFSEAFQSF +G+KLGD+L +PFDKSK  PAAL+ K
Sbjct  440   VTSRKDQEQYWANKDTPYRFVTVKEFSEAFQSFPIGQKLGDQLVIPFDKSKGLPAALTTK  499

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV++KELL+AC SRE LLMKRNSFVY FKM QL LMAF+ MTVFLRTEM ++++ DG 
Sbjct  500   KYGVSQKELLRACISREILLMKRNSFVYFFKMFQLTLMAFITMTVFLRTEMHRDTVIDGG  559

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF VI+ M NGFSELA++I+KLP FYKQRDL FFP WAY+LPTWILKIPVT+VE
Sbjct  560   IYFGALFFTVIIIMLNGFSELAMTIMKLPVFYKQRDLLFFPVWAYSLPTWILKIPVTIVE  619

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWV MTYY IG+DP AGRFFKQ FLL+C++QMAS LFRL AA GR+VIVANTFGS  +
Sbjct  620   VAIWVIMTYYVIGYDPYAGRFFKQYFLLLCLHQMASGLFRLIAALGRNVIVANTFGSFGL  679

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +  +VLGGFI+SRDD+K WWIWGYWISP+MY QNAISVNE+LGK WRH+P  ++E LGV 
Sbjct  680   LAFMVLGGFIISRDDIKPWWIWGYWISPMMYGQNAISVNEFLGKQWRHIPPNSTEPLGVL  739

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRGIFPEA WYWIGVGA +GY+FL NFLF +AL YL+P+GKPQA+LS+ETLAE+ A 
Sbjct  740   VLKSRGIFPEARWYWIGVGASIGYIFLFNFLFTVALKYLDPIGKPQAVLSKETLAEKIAS  799

Query  2341  KRGEPIEL-ELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCIT  2517
             K GE IEL      S+SE  +  +R V+ R LS+RV  +  +D N KRGMVLPFEPL I 
Sbjct  800   KNGEVIELSSRSQRSSSENESGAQRGVTHRKLSTRVEGIKDSDLNRKRGMVLPFEPLSIA  859

Query  2518  FDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGR  2697
             FD+I+YA+DMP EMKAQG+ EDRL LLKG++GAFR GVLTALMG+SGAGKTTLMDVLAGR
Sbjct  860   FDDIRYAIDMPREMKAQGIPEDRLELLKGVSGAFRTGVLTALMGVSGAGKTTLMDVLAGR  919

Query  2698  KTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTA  2877
             KTGGYI G+ITISGYPK+QETFARI+GYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D+ 
Sbjct  920   KTGGYINGTITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSK  979

Query  2878  TREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSG  3057
             TR+MF+E+VM+L+ELT LREALVGL GVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSG
Sbjct  980   TRKMFIEDVMELIELTPLREALVGLTGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSG  1039

Query  3058  LDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHS  3237
             LDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLK+GGEEIYVGP G+HS
Sbjct  1040  LDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKKGGEEIYVGPTGQHS  1099

Query  3238  SQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQ  3417
               LI YFE ING+ +I+DGYNPATWMLE+T+ AQE  LG++  EVYR+S+L+RRNKALI 
Sbjct  1100  LHLINYFEGINGVPKIKDGYNPATWMLEVTTAAQEEILGVNLTEVYRSSDLFRRNKALIN  1159

Query  3418  ELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGT  3597
             ELS P PGSKDL+FPT+YSQSFFTQCMACLWKQHWSY RN  YTAVRLLFTTF AL+FGT
Sbjct  1160  ELSTPPPGSKDLHFPTQYSQSFFTQCMACLWKQHWSYERNTAYTAVRLLFTTFIALMFGT  1219

Query  3598  MFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSAL  3777
             +FW +G KRR QQDLFNAMG MY+AV+F+G QN  SVQPVVAIERTVFYRERAAGMYSAL
Sbjct  1220  IFWNLGSKRRNQQDLFNAMGSMYSAVIFIGFQNTKSVQPVVAIERTVFYRERAAGMYSAL  1279

Query  3778  PYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTV  3957
             PYAF  V+IE+P++F+QT+IYGVIVYAMIGFEWTA+KF W+IF M+FTLL+FTLYGMM+V
Sbjct  1280  PYAFAHVIIEIPYIFIQTVIYGVIVYAMIGFEWTASKFFWYIFCMFFTLLFFTLYGMMSV  1339

Query  3958  AVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGD  4137
             AVTPNHNIA II+SAF+  WNLFSGFI+P TRIPVWWRWY + CP+ WTLYGL+ASQFGD
Sbjct  1340  AVTPNHNIATIIASAFFAIWNLFSGFIVPHTRIPVWWRWYSWTCPIFWTLYGLVASQFGD  1399

Query  4138  VKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             VK+ LD+ ETV++FV+S+F F HDF+G VA ++VG+ ++ GFIFAFS KAFNFQ R
Sbjct  1400  VKDVLDSGETVEEFVRSYFGFRHDFLGVVAIVLVGLSLLSGFIFAFSTKAFNFQKR  1455



>ref|XP_010254257.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Nelumbo nucifera]
Length=1451

 Score =  2186 bits (5664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1072/1411 (76%), Positives = 1247/1411 (88%), Gaps = 2/1411 (0%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA++KLPTY RIR+G+L+    GG  K++D+E LG+ EK+ LLERL+R+A+EDNE F
Sbjct  43    LKWAALQKLPTYNRIRKGLLSGV--GGETKQVDIESLGLQEKKILLERLLRVAEEDNEKF  100

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVG+D+P IEVRFEHLNVDAE YVGSRALPTIFNF+ N+LE F+NYLHILP
Sbjct  101   LLKLKNRIDRVGLDIPKIEVRFEHLNVDAETYVGSRALPTIFNFSVNMLEEFLNYLHILP  160

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKKPL ILHDVSGIIKP RMTLLLGPP SGKTTLLLALAGKL  DLK SGRVTYNGHEM
Sbjct  161   SRKKPLSILHDVSGIIKPCRMTLLLGPPGSGKTTLLLALAGKLGPDLKFSGRVTYNGHEM  220

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+Q+DLHIGEMTVRETLAFSARCQGVG  YEML ELSRREKE NIKPDP
Sbjct  221   DEFVPQRTAAYISQYDLHIGEMTVRETLAFSARCQGVGTGYEMLVELSRREKEANIKPDP  280

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID++MKA ++EGQEA+VVTDYILKILGLE+CAD LVGDEM RGISGGQ+KR+TTGEMLV
Sbjct  281   DIDIFMKAAALEGQEANVVTDYILKILGLEICADTLVGDEMFRGISGGQKKRVTTGEMLV  340

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQI+NS+RQS+HIL GTA+ISLLQPAPE YELFDDIILLS
Sbjct  341   GPARALFMDEISTGLDSSTTFQILNSLRQSVHILNGTALISLLQPAPEAYELFDDIILLS  400

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             +GQ+VYQGP +NVLEFF+ MGFKCPERKGVADFLQEVTS KDQEQYW R++E Y FI V 
Sbjct  401   EGQIVYQGPCENVLEFFESMGFKCPERKGVADFLQEVTSWKDQEQYWARKDEPYRFIPVK  460

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQSFHVG KLGDELA PF+K+KSHPAAL+ KKYGV+KKELLKAC SRE LLMKRN
Sbjct  461   EFAEAFQSFHVGLKLGDELANPFEKTKSHPAALTTKKYGVSKKELLKACISRELLLMKRN  520

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFKM QL +M F+ MT+FLR +M ++S+ DG +++GALFF ++M MFNG+SEL L+
Sbjct  521   SFVYIFKMTQLTIMGFITMTMFLRVKMHRDSVIDGGIYVGALFFTLLMIMFNGYSELTLT  580

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I+KLP FYKQRDL F+P WAYALPTWILKIP T +EVA+WV MTYY IGFDP+AGRFFKQ
Sbjct  581   IVKLPVFYKQRDLLFYPSWAYALPTWILKIPYTFIEVAVWVFMTYYVIGFDPNAGRFFKQ  640

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+CVNQMAS LFR   A GR++IVANTFG+ ++++++VLGGFILSR+DVKKWWIWGY
Sbjct  641   YLLLLCVNQMASGLFRFIGAVGRNMIVANTFGAFSLLVLMVLGGFILSREDVKKWWIWGY  700

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W SPLMY QNAI+VNE+LG SW HVP  ++E LGV VL+SRGIFP+A+WYW+GVG LVGY
Sbjct  701   WTSPLMYGQNAIAVNEFLGNSWSHVPPNSTEPLGVMVLKSRGIFPKAYWYWLGVGVLVGY  760

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             +FL NFLF LAL+YLNP GKPQ ++SEE+L E+   + GE I+L  +G ++++       
Sbjct  761   MFLFNFLFTLALSYLNPFGKPQPIISEESLNEKWTNRTGEFIKLSSRGKNSADAEEGNEM  820

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
                  S+S        ++ N KRGMVLPF+PL I FDEI+Y+VDMP E+KAQG+ EDRL 
Sbjct  821   RSMPSSISPGRTDAVNSNQNRKRGMVLPFQPLSIIFDEIRYSVDMPQELKAQGVPEDRLE  880

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEG ITISGYPK+QETFARI
Sbjct  881   LLKGVSGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGCITISGYPKKQETFARI  940

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQ DIHSPHVTVYE+L++SAWLRLP E+ +ATREMF+EEVM+LVELTSLREALVGL
Sbjct  941   SGYCEQDDIHSPHVTVYEALLFSAWLRLPSEVKSATREMFIEEVMELVELTSLREALVGL  1000

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGLS EQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  1001  PGVNGLSIEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1060

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDELLLLK+GGEEIY+G LGRHS  LI+YFE I G+ +I++GYNPATW
Sbjct  1061  TIHQPSIDIFDAFDELLLLKQGGEEIYMGQLGRHSCHLIKYFEGIPGVNKIKEGYNPATW  1120

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLE+T+  QEAALG++F ++Y+NSELYRRNKALI EL+ P+PGS+DLYFPT+YSQSFFTQ
Sbjct  1121  MLEVTTTEQEAALGVNFTDIYKNSELYRRNKALINELNTPSPGSRDLYFPTRYSQSFFTQ  1180

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
              +ACLWKQ++SYWRNPPYTAVRLLFTTF AL++GT+FW +G +R+ QQDLFNAMG MY+A
Sbjct  1181  SVACLWKQYYSYWRNPPYTAVRLLFTTFIALMYGTIFWDLGSRRKKQQDLFNAMGSMYSA  1240

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
              +FLGVQN TSVQP+VAIERTVFYRERAAGMYSALPYAFGQV++E+PH+F+QTLIYGVIV
Sbjct  1241  ALFLGVQNCTSVQPIVAIERTVFYRERAAGMYSALPYAFGQVMVEVPHIFLQTLIYGVIV  1300

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             Y+MIGFEWT  KF W++FFMY TLLYFT YGMMTVAVTPNHNIAAI+ +AF   WN+FSG
Sbjct  1301  YSMIGFEWTVDKFFWYLFFMYVTLLYFTFYGMMTVAVTPNHNIAAIVCTAFQSIWNIFSG  1360

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             FI+P+TRIP+WWRWYY+  P SWTLYGL+ SQFGDV+EKL++ ETV++F++S+F F HDF
Sbjct  1361  FIVPRTRIPIWWRWYYWANPFSWTLYGLVVSQFGDVQEKLESGETVEEFLRSYFGFRHDF  1420

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VA +IVG  V+FGFIFAFSI+AFNFQTR
Sbjct  1421  IGVVAVVIVGFTVLFGFIFAFSIRAFNFQTR  1451



>gb|KCW81449.1| hypothetical protein EUGRSUZ_C02834 [Eucalyptus grandis]
Length=1437

 Score =  2185 bits (5663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1082/1435 (75%), Positives = 1249/1435 (87%), Gaps = 21/1435 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG E+FSRSSR   +++   LKWAAIEKLPTYLRIRR I A +E  G  +E+DVE 
Sbjct  24    IWRNSGKEIFSRSSRNEDDEEA--LKWAAIEKLPTYLRIRRTIFADKE--GKIREVDVEN  79

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L + E+R+LLERL++ A+EDNE FLLKLK R +RVG+D PTIEVRFEHLNV+AEAYVGSR
Sbjct  80    LDLMERRNLLERLLKTAEEDNEKFLLKLKQRIERVGLDFPTIEVRFEHLNVEAEAYVGSR  139

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF+ N+LE F+NY HILP+RKKPLPIL+DVSGIIKP RMTLLLGPP SGKTTLL
Sbjct  140   ALPTIFNFSINMLEGFLNYFHILPSRKKPLPILNDVSGIIKPRRMTLLLGPPGSGKTTLL  199

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DL +SGRVTYNG  M EFVP+RTSAYI+Q+DLHI EMT+RETLAFSARCQG
Sbjct  200   LALAGKLGRDLTLSGRVTYNGQGMEEFVPQRTSAYISQYDLHIAEMTIRETLAFSARCQG  259

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG  Y+MLAEL RREKE NI PDPDID++MKA ++EGQE +VV DYI+KILGLE+CAD +
Sbjct  260   VGPHYDMLAELLRREKEANITPDPDIDIFMKAAALEGQETNVVVDYIIKILGLEICADTI  319

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQ+KR+TTGEMLVGPA+ALFMDEISTGLD STTFQIV S+RQSIHIL G
Sbjct  320   VGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDCSTTFQIVKSLRQSIHILNG  379

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA++SLLQPAPETY+LFDDIIL+S+GQ+VYQGPR+NVLEFF+HMGFKCPERKGVADFLQE
Sbjct  380   TALVSLLQPAPETYDLFDDIILVSEGQIVYQGPRENVLEFFRHMGFKCPERKGVADFLQE  439

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++  Y F+TV EFSEAFQSF +G+KLGD+L +PFDKSK  PAAL+ K
Sbjct  440   VTSRKDQEQYWANKDTPYRFVTVKEFSEAFQSFPIGQKLGDQLVIPFDKSKGLPAALTTK  499

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV++KELL+AC SRE LLMKRNSFVY FKM QL LMAF+ MTVFLRTEM ++++ DG 
Sbjct  500   KYGVSQKELLRACISREILLMKRNSFVYFFKMFQLTLMAFITMTVFLRTEMHRDTVIDGG  559

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF VI+ M NGFSELA++I+KLP FYKQRDL FFP WAY+LPTWILKIPVT+VE
Sbjct  560   IYFGALFFTVIIIMLNGFSELAMTIMKLPVFYKQRDLLFFPVWAYSLPTWILKIPVTIVE  619

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWV MTYY IG+DP AGRFFKQ FLL+C++QMAS LFRL AA GR+VIVANTFGS  +
Sbjct  620   VAIWVIMTYYVIGYDPYAGRFFKQYFLLLCLHQMASGLFRLIAALGRNVIVANTFGSFGL  679

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +  +VLGGFI+SRDD+K WWIWGYWISP+MY QNAISVNE+LGK WRH+P  ++E LGV 
Sbjct  680   LAFMVLGGFIISRDDIKPWWIWGYWISPMMYGQNAISVNEFLGKQWRHIPPNSTEPLGVL  739

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRGIFPEA WYWIGVGA +GY+FL NFLF +AL YL+P+GKPQA+LS+ETLAE+ A 
Sbjct  740   VLKSRGIFPEARWYWIGVGASIGYIFLFNFLFTVALKYLDPIGKPQAVLSKETLAEKIAS  799

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K GE IEL  +   +S                  V  +  +D N KRGMVLPFEPL I F
Sbjct  800   KNGEVIELSSRSQRSS-----------------SVEGIKDSDLNRKRGMVLPFEPLSIAF  842

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+I+YA+DMP EMKAQG+ EDRL LLKG++GAFR GVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  843   DDIRYAIDMPREMKAQGIPEDRLELLKGVSGAFRTGVLTALMGVSGAGKTTLMDVLAGRK  902

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI G+ITISGYPK+QETFARI+GYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D+ T
Sbjct  903   TGGYINGTITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSKT  962

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+E+VM+L+ELT LREALVGL GVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  963   RKMFIEDVMELIELTPLREALVGLTGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1022

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLK+GGEEIYVGP G+HS 
Sbjct  1023  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKKGGEEIYVGPTGQHSL  1082

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI YFE ING+ +I+DGYNPATWMLE+T+ AQE  LG++  EVYR+S+L+RRNKALI E
Sbjct  1083  HLINYFEGINGVPKIKDGYNPATWMLEVTTAAQEEILGVNLTEVYRSSDLFRRNKALINE  1142

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSKDL+FPT+YSQSFFTQCMACLWKQHWSY RN  YTAVRLLFTTF AL+FGT+
Sbjct  1143  LSTPPPGSKDLHFPTQYSQSFFTQCMACLWKQHWSYERNTAYTAVRLLFTTFIALMFGTI  1202

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KRR QQDLFNAMG MY+AV+F+G QN  SVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1203  FWNLGSKRRNQQDLFNAMGSMYSAVIFIGFQNTKSVQPVVAIERTVFYRERAAGMYSALP  1262

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAF  V+IE+P++F+QT+IYGVIVYAMIGFEWTA+KF W+IF M+FTLL+FTLYGMM+VA
Sbjct  1263  YAFAHVIIEIPYIFIQTVIYGVIVYAMIGFEWTASKFFWYIFCMFFTLLFFTLYGMMSVA  1322

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNIA II+SAF+  WNLFSGFI+P TRIPVWWRWY + CP+ WTLYGL+ASQFGDV
Sbjct  1323  VTPNHNIATIIASAFFAIWNLFSGFIVPHTRIPVWWRWYSWTCPIFWTLYGLVASQFGDV  1382

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K+ LD+ ETV++FV+S+F F HDF+G VA ++VG+ ++ GFIFAFS KAFNFQ R
Sbjct  1383  KDVLDSGETVEEFVRSYFGFRHDFLGVVAIVLVGLSLLSGFIFAFSTKAFNFQKR  1437



>gb|KDP33642.1| hypothetical protein JCGZ_07213 [Jatropha curcas]
Length=1438

 Score =  2184 bits (5660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1083/1435 (75%), Positives = 1258/1435 (88%), Gaps = 25/1435 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ ++VFS+SS    +++   LKWAA+EKLPT+LR+RRGIL  EE  G  +EID+  
Sbjct  29    IWRNTTLDVFSKSSCNDDDEEA--LKWAALEKLPTHLRVRRGILTEEE--GQSREIDINS  84

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ EKR+LLERLV+IA++DNE FLLKLK R  +VG+++PTIEVRFEHL+VDA+AY+GSR
Sbjct  85    LGLIEKRNLLERLVKIAEQDNEKFLLKLKERIIKVGLEMPTIEVRFEHLSVDAQAYIGSR  144

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
              LPTI                     KKPL IL DVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  145   GLPTI---------------------KKPLSILQDVSGIIKPQRMTLLLGPPSSGKTTLL  183

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  +LK+SG VTYNGH M EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  184   LALAGKLSKELKISGNVTYNGHGMDEFVPQRTSAYISQYDLHIGEMTVRETLAFSARCQG  243

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML EL+RREKE NIKPDPDID+YMKA ++EGQE +VVTDYILKILGLEVCADI+
Sbjct  244   VGTRYEMLTELARREKEANIKPDPDIDIYMKAAALEGQETNVVTDYILKILGLEVCADIM  303

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQ+VNS+RQSIHIL G
Sbjct  304   VGDEMIRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQMVNSLRQSIHILNG  363

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVLEFF+++GF+CPERKGVADFLQE
Sbjct  364   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEYIGFRCPERKGVADFLQE  423

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW RR+E Y F++V EF+EAFQSFH+G+KLGDELA PFDKSKSH AAL+ K
Sbjct  424   VTSRKDQEQYWARRDEPYSFVSVKEFAEAFQSFHIGRKLGDELATPFDKSKSHLAALTTK  483

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             K+G +KKELLKAC SRE+LLMKRNSFVYIF M QL+++AF+ MTVFLRTEM +N+  DG 
Sbjct  484   KHGASKKELLKACISREYLLMKRNSFVYIFNMSQLIILAFITMTVFLRTEMHRNTETDGG  543

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +++GALFF VI TMFNGFSELA++I+KLP FYKQRD+ F+P WAYALP+WILKIP+  VE
Sbjct  544   IYLGALFFTVITTMFNGFSELAMTIMKLPVFYKQRDILFYPSWAYALPSWILKIPIAFVE  603

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV MTYY IGFDP+ GRFFKQ  +L+  +QMASALFRLTAA GR++IVANT G  A+
Sbjct  604   VAVWVVMTYYVIGFDPNIGRFFKQYLILMITSQMASALFRLTAALGRNIIVANTIGCFAL  663

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGF++SRD+VKKWWIWGYW SP+MY QN ISVNE+LGKSWRH+   ++E LG+T
Sbjct  664   LAVLVLGGFVISRDNVKKWWIWGYWFSPMMYVQNGISVNEFLGKSWRHLAHNSTEPLGIT  723

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VLRSRG+FPEA+WYWI VGAL GY+FL NFLF LAL YLNP G+ Q +LSE+  A+RNA 
Sbjct  724   VLRSRGLFPEAYWYWIAVGALTGYIFLFNFLFILALKYLNPFGRSQPILSEDVYAQRNAT  783

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             + G+ IEL  KG S  EKG+V  R+ SSR+ S RV   N      KRGMVLPF+PL ITF
Sbjct  784   RTGQVIELSSKGKSFQEKGSVSERNASSRTQSIRVSIFNDDHQKRKRGMVLPFQPLFITF  843

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEI+YAVDMP  MKA+G+TEDRL LLKG+NGAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  844   DEIRYAVDMPQVMKAEGITEDRLELLKGVNGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  903

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+ITISGYPK QETFARI+GYCEQTDIHSPHVTVYESL+YSAWLRLP +++++T
Sbjct  904   TGGYIEGNITISGYPKNQETFARISGYCEQTDIHSPHVTVYESLLYSAWLRLPSKVNSST  963

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             REMF+EEVM+LVEL ++REALVGLPGVNGLS EQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  964   REMFIEEVMELVELNTIREALVGLPGVNGLSIEQRKRLTIAVELVANPSIIFMDEPTSGL  1023

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIYVGP+GRH+ 
Sbjct  1024  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYVGPVGRHAC  1083

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I G  +I+DGYNPATWMLE+T+ AQE ALG++F+++Y+NSELYRRNKALI+E
Sbjct  1084  HLIKYFEDIEGTPKIKDGYNPATWMLEVTTAAQEVALGVNFSDIYKNSELYRRNKALIKE  1143

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LSKP PGS+DL FPT+YSQSF TQCMACLWKQHWSYWRNP Y+AVRLLFTTF AL+FGT+
Sbjct  1144  LSKPPPGSEDLSFPTQYSQSFLTQCMACLWKQHWSYWRNPSYSAVRLLFTTFIALMFGTI  1203

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR ++QD+ NAMG MYAAV+FLG QN+TSVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1204  FWNLGSKRGSRQDILNAMGSMYAAVLFLGFQNSTSVQPVVAIERTVFYRERAAGMYSALP  1263

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV+IELP++ VQT+ YGVIVYAM+GFEW+ +KF W+IFFMYFTLLYFT YGMM+VA
Sbjct  1264  YAFGQVMIELPYILVQTITYGVIVYAMVGFEWSVSKFFWYIFFMYFTLLYFTFYGMMSVA  1323

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPN +IAAIISSAFY  WN+FSGFI+P+ RIPVWWRWYY+ CPV+WTLYGL+ASQ+GD+
Sbjct  1324  ITPNPHIAAIISSAFYAIWNIFSGFIVPRPRIPVWWRWYYWACPVAWTLYGLVASQYGDI  1383

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             KE LD+ ETV+DF++S+F F HDF+G VA ++VGI V+FGFIFAFSIKAFNFQ R
Sbjct  1384  KEPLDSGETVQDFLRSYFGFHHDFLGIVALVLVGIPVLFGFIFAFSIKAFNFQIR  1438



>ref|XP_010254258.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Nelumbo nucifera]
Length=1449

 Score =  2184 bits (5658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1073/1411 (76%), Positives = 1248/1411 (88%), Gaps = 4/1411 (0%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA++KLPTY RIR+G+L+    GG  K++D+E LG+ EK+ LLERL+R+A+EDNE F
Sbjct  43    LKWAALQKLPTYNRIRKGLLSGV--GGETKQVDIESLGLQEKKILLERLLRVAEEDNEKF  100

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVG+D+P IEVRFEHLNVDAE YVGSRALPTIFNF+ N+LE F+NYLHILP
Sbjct  101   LLKLKNRIDRVGLDIPKIEVRFEHLNVDAETYVGSRALPTIFNFSVNMLEEFLNYLHILP  160

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKKPL ILHDVSGIIKP RMTLLLGPP SGKTTLLLALAGKL  DLK SGRVTYNGHEM
Sbjct  161   SRKKPLSILHDVSGIIKPCRMTLLLGPPGSGKTTLLLALAGKLGPDLKFSGRVTYNGHEM  220

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+Q+DLHIGEMTVRETLAFSARCQGVG  YEML ELSRREKE NIKPDP
Sbjct  221   DEFVPQRTAAYISQYDLHIGEMTVRETLAFSARCQGVGTGYEMLVELSRREKEANIKPDP  280

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID++MKA ++EGQEA+VVTDYILKILGLE+CAD LVGDEM RGISGGQ+KR+TTGEMLV
Sbjct  281   DIDIFMKAAALEGQEANVVTDYILKILGLEICADTLVGDEMFRGISGGQKKRVTTGEMLV  340

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQI+NS+RQS+HIL GTA+ISLLQPAPE YELFDDIILLS
Sbjct  341   GPARALFMDEISTGLDSSTTFQILNSLRQSVHILNGTALISLLQPAPEAYELFDDIILLS  400

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             +GQ+VYQGP +NVLEFF+ MGFKCPERKGVADFLQEVTS KDQEQYW R++E Y FI V 
Sbjct  401   EGQIVYQGPCENVLEFFESMGFKCPERKGVADFLQEVTSWKDQEQYWARKDEPYRFIPVK  460

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQSFHVG KLGDELA PF+K+KSHPAAL+ KKYGV+KKELLKAC SRE LLMKRN
Sbjct  461   EFAEAFQSFHVGLKLGDELANPFEKTKSHPAALTTKKYGVSKKELLKACISRELLLMKRN  520

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFKM QL +M F+ MT+FLR +M ++S+ DG +++GALFF ++M MFNG+SEL L+
Sbjct  521   SFVYIFKMTQLTIMGFITMTMFLRVKMHRDSVIDGGIYVGALFFTLLMIMFNGYSELTLT  580

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I+KLP FYKQRDL F+P WAYALPTWILKIP T +EVA+WV MTYY IGFDP+AGRFFKQ
Sbjct  581   IVKLPVFYKQRDLLFYPSWAYALPTWILKIPYTFIEVAVWVFMTYYVIGFDPNAGRFFKQ  640

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+CVNQMAS LFR   A GR++IVANTFG+ ++++++VLGGFILSR+DVKKWWIWGY
Sbjct  641   YLLLLCVNQMASGLFRFIGAVGRNMIVANTFGAFSLLVLMVLGGFILSREDVKKWWIWGY  700

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W SPLMY QNAI+VNE+LG SW HVP  ++E LGV VL+SRGIFP+A+WYW+GVG LVGY
Sbjct  701   WTSPLMYGQNAIAVNEFLGNSWSHVPPNSTEPLGVMVLKSRGIFPKAYWYWLGVGVLVGY  760

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             +FL NFLF LAL+YLNP GKPQ ++SEE+L E+   + GE I+L  +G +++E+      
Sbjct  761   MFLFNFLFTLALSYLNPFGKPQPIISEESLNEKWTNRTGEFIKLSSRGKNSAEE--GNEM  818

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
                  S+S        ++ N KRGMVLPF+PL I FDEI+Y+VDMP E+KAQG+ EDRL 
Sbjct  819   RSMPSSISPGRTDAVNSNQNRKRGMVLPFQPLSIIFDEIRYSVDMPQELKAQGVPEDRLE  878

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEG ITISGYPK+QETFARI
Sbjct  879   LLKGVSGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGCITISGYPKKQETFARI  938

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQ DIHSPHVTVYE+L++SAWLRLP E+ +ATREMF+EEVM+LVELTSLREALVGL
Sbjct  939   SGYCEQDDIHSPHVTVYEALLFSAWLRLPSEVKSATREMFIEEVMELVELTSLREALVGL  998

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGLS EQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  999   PGVNGLSIEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1058

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDELLLLK+GGEEIY+G LGRHS  LI+YFE I G+ +I++GYNPATW
Sbjct  1059  TIHQPSIDIFDAFDELLLLKQGGEEIYMGQLGRHSCHLIKYFEGIPGVNKIKEGYNPATW  1118

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLE+T+  QEAALG++F ++Y+NSELYRRNKALI EL+ P+PGS+DLYFPT+YSQSFFTQ
Sbjct  1119  MLEVTTTEQEAALGVNFTDIYKNSELYRRNKALINELNTPSPGSRDLYFPTRYSQSFFTQ  1178

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
              +ACLWKQ++SYWRNPPYTAVRLLFTTF AL++GT+FW +G +R+ QQDLFNAMG MY+A
Sbjct  1179  SVACLWKQYYSYWRNPPYTAVRLLFTTFIALMYGTIFWDLGSRRKKQQDLFNAMGSMYSA  1238

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
              +FLGVQN TSVQP+VAIERTVFYRERAAGMYSALPYAFGQV++E+PH+F+QTLIYGVIV
Sbjct  1239  ALFLGVQNCTSVQPIVAIERTVFYRERAAGMYSALPYAFGQVMVEVPHIFLQTLIYGVIV  1298

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             Y+MIGFEWT  KF W++FFMY TLLYFT YGMMTVAVTPNHNIAAI+ +AF   WN+FSG
Sbjct  1299  YSMIGFEWTVDKFFWYLFFMYVTLLYFTFYGMMTVAVTPNHNIAAIVCTAFQSIWNIFSG  1358

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             FI+P+TRIP+WWRWYY+  P SWTLYGL+ SQFGDV+EKL++ ETV++F++S+F F HDF
Sbjct  1359  FIVPRTRIPIWWRWYYWANPFSWTLYGLVVSQFGDVQEKLESGETVEEFLRSYFGFRHDF  1418

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VA +IVG  V+FGFIFAFSI+AFNFQTR
Sbjct  1419  IGVVAVVIVGFTVLFGFIFAFSIRAFNFQTR  1449



>ref|XP_011019747.1| PREDICTED: pleiotropic drug resistance protein 1-like [Populus 
euphratica]
Length=1450

 Score =  2178 bits (5644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1072/1435 (75%), Positives = 1252/1435 (87%), Gaps = 5/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+S  EVFSRSSR+  +++   LKWAA+EKLPTYLR+ RGIL  EE  G  +EID+  
Sbjct  21    IWRNSIPEVFSRSSRDEDDEEA--LKWAALEKLPTYLRLTRGILTEEE--GKAREIDIIN  76

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ EKR LLERLV+IA+EDNE FLLKLK R DRV +++PTIEVRFEHLNV+AEAYVG R
Sbjct  77    LGLVEKRDLLERLVKIAEEDNERFLLKLKERIDRVELEMPTIEVRFEHLNVEAEAYVGGR  136

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTI NF+AN+LE F+++LH+LP+RK+  PIL DVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  137   ALPTILNFSANMLEGFLSFLHLLPSRKQTFPILRDVSGIIKPRRMTLLLGPPSSGKTTLL  196

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             +ALAGKL  DL+ SG VTYNGH M EFVP+RTSAYI+Q DLHIGEMTVRETL+FSARCQG
Sbjct  197   MALAGKLGKDLQCSGSVTYNGHGMEEFVPQRTSAYISQFDLHIGEMTVRETLSFSARCQG  256

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML ELSRREKE NIKPDPD+D+YMKA ++EGQE SV T YILKI GL++CAD +
Sbjct  257   VGPRYEMLTELSRREKEANIKPDPDLDIYMKAAALEGQETSVTTYYILKITGLDICADTM  316

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQ+KRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNS+RQ+ HIL G
Sbjct  317   VGDEMIRGISGGQKKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSLRQTTHILNG  376

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             T +ISLLQPAPET+ LFDD+ILLSDG +VY GPR+NVLEFF+ +GFKCPERKGVADFLQE
Sbjct  377   TTLISLLQPAPETFALFDDVILLSDGLIVYHGPRENVLEFFESLGFKCPERKGVADFLQE  436

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  R++ Y F++  EFSEAFQSFH+G+KLGDELA+PFDKSKSHP+ALS +
Sbjct  437   VTSRKDQEQYWASRDQPYSFVSANEFSEAFQSFHIGRKLGDELAIPFDKSKSHPSALSTE  496

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC SREFLLMKRNSFVYIFK  QL+L+A + MT+FLRTEM +N+I DG 
Sbjct  497   KYGVSKKELLKACISREFLLMKRNSFVYIFKFTQLILLASITMTIFLRTEMHRNTITDGG  556

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +++GALFFA+I+ MFNGFSEL ++I+KLP FYKQRDL F+P WAYA+PTWILKIP+T VE
Sbjct  557   IYIGALFFAIIIIMFNGFSELVMTIMKLPVFYKQRDLLFYPSWAYAIPTWILKIPITFVE  616

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIW  MTYYA+GFDP+ GRFFKQ  + +  NQM+S LFRL  A GR+VIVAN  GS A+
Sbjct  617   VAIWTTMTYYAVGFDPNIGRFFKQYLIFVLANQMSSGLFRLMGALGRNVIVANNVGSFAL  676

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLV+GGFILSRD+VK WWIWGYW+SPLMY QNA+SVNE+LG SWRH+P  ++E+LGVT
Sbjct  677   LAVLVMGGFILSRDNVKSWWIWGYWVSPLMYVQNAVSVNEFLGNSWRHIPPNSTESLGVT  736

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRG+FPEA WYWIGVGAL+GY  L NFLF LAL YLNP GKPQA+LS+E LAER+A 
Sbjct  737   LLKSRGVFPEARWYWIGVGALIGYTLLFNFLFTLALKYLNPFGKPQAILSKEALAERDAN  796

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             + G  IEL  +G S+SE+G   +R+ S+R  S R+ S   A+ N KRGM+LPF+PL ITF
Sbjct  797   RTGNFIELSTRGKSSSERGKDSKRNSSARVPSLRIPSPGDANQN-KRGMILPFQPLSITF  855

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             +EI+Y+VDMP EMKAQG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVL+GRK
Sbjct  856   EEIRYSVDMPQEMKAQGIPEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLSGRK  915

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+G I+ISGYPK Q+TFARI+GYCEQTDIHSPHVTVYESLVYSAWLRL P++D+ T
Sbjct  916   TGGYIDGRISISGYPKNQQTFARISGYCEQTDIHSPHVTVYESLVYSAWLRLSPDVDSET  975

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVEL  LRE+LVG PGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  976   RKMFIEEVMELVELNPLRESLVGSPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1035

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMR VRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIYVGP+GRH+ 
Sbjct  1036  DARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYVGPVGRHAC  1095

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I G+ +I+DGYNPATWMLE+TS  QEA L  +F ++++NSE YRRNKALI+E
Sbjct  1096  HLIKYFEEIEGVPKIKDGYNPATWMLEVTSATQEAVLKDNFTDIFKNSEPYRRNKALIKE  1155

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSKDLYFPT+YSQSFF QCMACLWKQHWSYWRNPPY AVRLLFTTF A++FGT+
Sbjct  1156  LSAPQPGSKDLYFPTRYSQSFFAQCMACLWKQHWSYWRNPPYNAVRLLFTTFIAVMFGTI  1215

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR  +QD+FN+MG MYAAV+F+G+QNATSVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1216  FWNLGSKRNRKQDIFNSMGSMYAAVLFIGIQNATSVQPVVAIERTVFYRERAAGMYSALP  1275

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAF QV+IE+P+  VQ LIYGVIVY+MIGFEWT  KF W+IFFMYFTLLY T YGMM VA
Sbjct  1276  YAFAQVMIEIPYTLVQALIYGVIVYSMIGFEWTPIKFFWYIFFMYFTLLYMTFYGMMNVA  1335

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPNHNIA+++SSAFY  WNLFSGFIIP+TR+P+WWRWY + CP SWTLYGLIASQ+GD+
Sbjct  1336  ITPNHNIASLVSSAFYAIWNLFSGFIIPRTRVPIWWRWYCWACPFSWTLYGLIASQYGDL  1395

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             ++ ++ +ETVKDFV+++F F HDFVG  A ++VG+ V+F F FAFSIKAFNFQ R
Sbjct  1396  EDTVEGDETVKDFVRNYFGFRHDFVGICAIVVVGMSVLFAFTFAFSIKAFNFQRR  1450



>emb|CDP04832.1| unnamed protein product [Coffea canephora]
Length=3106

 Score =  2177 bits (5641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1083/1433 (76%), Positives = 1260/1433 (88%), Gaps = 4/1433 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +W ++G+E+FSRS+RE  ED+EEALKWAA+EKLPT+ R++ GIL  +EE G  +EID++K
Sbjct  33    LWTNTGMEIFSRSTREEEEDEEEALKWAALEKLPTFKRVQVGIL--KEEEGHHREIDIKK  90

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EKR+++E+LV+ A+EDNE FLLKL+ R DRVGI LPTIEVRFEHLN++AEAYVGSR
Sbjct  91    LGPLEKRNIVEKLVKTAEEDNERFLLKLRERIDRVGIQLPTIEVRFEHLNIEAEAYVGSR  150

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FNF+ NILE  +N LHILP RKKP  ILHD+SGIIKP RMTLLLGPPSSGKTTLL
Sbjct  151   ALPTVFNFSVNILEGLLNNLHILPKRKKPFVILHDLSGIIKPGRMTLLLGPPSSGKTTLL  210

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LA+AGKL SDLKVSG VTYNGH M EFVP+R+SAYI+QHDLHIGE+TVRET+AFSARCQG
Sbjct  211   LAMAGKLQSDLKVSGTVTYNGHTMDEFVPQRSSAYISQHDLHIGELTVRETIAFSARCQG  270

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYE++ E+ RREKE NIKPDPDID+YMK++++ GQE+   TDY+LKILGL++CAD L
Sbjct  271   VGPRYELMTEMLRREKEANIKPDPDIDIYMKSLALIGQESHAATDYVLKILGLDICADTL  330

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQ+KR+TTGEMLVGP+RALFMDEISTGLDSSTTFQIVN+++Q IHILQG
Sbjct  331   VGDEMIRGISGGQKKRVTTGEMLVGPSRALFMDEISTGLDSSTTFQIVNAMKQYIHILQG  390

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDG++VYQGPR+NVLEFF+HMGFKCPERKGVADFLQE
Sbjct  391   TAVISLLQPAPETYDLFDDIILLSDGEIVYQGPRENVLEFFEHMGFKCPERKGVADFLQE  450

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             V S KDQEQYW RR+E + FI+  EFSEAFQSFHVG KL DE++VPFDKSK HPAAL++K
Sbjct  451   VPSNKDQEQYWFRRDEPFHFISAREFSEAFQSFHVGLKLYDEISVPFDKSKGHPAALTSK  510

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             +YGV   ELLKACASRE+LLMKRN+FV+IFKM QL LMA + MT+FLRTEM KN++ DG 
Sbjct  511   QYGVGTMELLKACASREYLLMKRNAFVHIFKMAQLFLMAIIVMTMFLRTEMHKNTVNDGG  570

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +F+GALFF  +  MFNGFSE+ LSILKLP FYKQRD  FFP WAYALPTWILKIP+TL E
Sbjct  571   IFLGALFFTTVALMFNGFSEVPLSILKLPVFYKQRDFLFFPAWAYALPTWILKIPITLAE  630

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V  WVC+TYY +G+DP+ GRFF+Q+FLLIC++QMA  LFR  AA GR +IVANTFGS A+
Sbjct  631   VVGWVCLTYYVVGYDPEVGRFFRQMFLLICIHQMALGLFRFMAAIGRDMIVANTFGSFAI  690

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVLGGFILSR+++K WWIWGYWISPLMY QNAI+VNE+LGKSWRHVP+G+ ETLGV+
Sbjct  691   LAVLVLGGFILSRENIKAWWIWGYWISPLMYGQNAIAVNEFLGKSWRHVPTGSRETLGVS  750

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRGIF EAHWYW GVG LVGY+FL NFL  LALTYL P+GK QA+LSEE L E N+ 
Sbjct  751   VLKSRGIFAEAHWYWTGVGVLVGYMFLFNFLNILALTYLKPMGKHQAVLSEEQLPE-NSA  809

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K+GE   L  +G S+SE       ++ S+S S   GS + ++ + ++GMVLPFEPLC+TF
Sbjct  810   KKGEVNVLSSEGKSSSEGRTNAGETILSKSRSKGTGSPDQSN-SKRKGMVLPFEPLCMTF  868

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             ++++YAVDMP EMKAQG+ EDRLVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  869   EDLRYAVDMPQEMKAQGIPEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  928

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+ITISGYPK+QETFARIAGYCEQ DIHSPHVTV ESL YSAWLRLP E+D   
Sbjct  929   TGGYIEGTITISGYPKKQETFARIAGYCEQFDIHSPHVTVNESLQYSAWLRLPREVDAEM  988

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM LVELT LREALVGLPG+NGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  989   RKMFIEEVMQLVELTPLREALVGLPGINGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1048

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL+LLKRGGEEIYVG LG HS 
Sbjct  1049  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELVLLKRGGEEIYVGQLGPHSF  1108

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI+YFE ING+ +I+DGYNPATWMLE+TS AQEAALGIDFAEVY++SELYRRNKALI+E
Sbjct  1109  QLIKYFEEINGVSKIKDGYNPATWMLEVTSVAQEAALGIDFAEVYKSSELYRRNKALIKE  1168

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS PAPGSK+LYF  +YS+SF+ Q +ACLWKQHWSYWRNP YTAVRL +TT  AL+FGT+
Sbjct  1169  LSSPAPGSKELYFRAQYSESFYIQFLACLWKQHWSYWRNPRYTAVRLFYTTIIALMFGTI  1228

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KRR QQDLFNAMG MYAAV+F+GVQNATSVQPVVA+ERTVFYRERAAGMYS+L 
Sbjct  1229  FWDLGTKRRKQQDLFNAMGSMYAAVLFMGVQNATSVQPVVAVERTVFYRERAAGMYSSLS  1288

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAF Q+ IELP++ +Q + YG IVYAMIGFEWTA KF W++ FMY TLLY+TLYGMM+VA
Sbjct  1289  YAFAQMAIELPYVLIQAVSYGTIVYAMIGFEWTATKFFWYLCFMYITLLYYTLYGMMSVA  1348

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
              TPNHNIA+++SSAFY  WNLFSGF+IP+TRIPVWWRWYYY+CPVSWTLYGL+ SQFGDV
Sbjct  1349  ATPNHNIASVVSSAFYAIWNLFSGFLIPRTRIPVWWRWYYYLCPVSWTLYGLLVSQFGDV  1408

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQ  4299
             KE+L+T ETV+ F++S+F F HDF+GYV  I++G   +FGF FAFSIK+FNFQ
Sbjct  1409  KEELETGETVEQFMRSYFGFRHDFLGYVTLILLGFVAVFGFTFAFSIKSFNFQ  1461


 Score =  2083 bits (5396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1034/1422 (73%), Positives = 1201/1422 (84%), Gaps = 44/1422 (3%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+E+LPT+ R+R GIL  EEE                             ++   F
Sbjct  1718  LKWAALERLPTFKRLRIGILEEEEE---------------------------VDQNCRGF  1750

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLK + R DRVGI+LPTIEVRFEHLNV+AEAYVGSRALPTIFN++ N+ E F+NYLHILP
Sbjct  1751  LLKFRERIDRVGIELPTIEVRFEHLNVEAEAYVGSRALPTIFNYSVNMFEGFLNYLHILP  1810

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
              RKKP  IL DVSGI+KP RMTLLLGPPSSGKTTLLLALAGKL SDLKVSG VTYNGH M
Sbjct  1811  KRKKPFLILRDVSGIVKPGRMTLLLGPPSSGKTTLLLALAGKLHSDLKVSGTVTYNGHAM  1870

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
               FVP+R+SAYI+QHDLHIGE+TVRET+AFSARCQGVG R E+ AEL RREKE NIKPDP
Sbjct  1871  NGFVPQRSSAYISQHDLHIGELTVRETIAFSARCQGVGPRQEIGAELLRREKEANIKPDP  1930

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             D+D+YMK++ ++GQE+ V T+Y+LKILGL+VCAD LVGD+MIRGISGGQ+KR+TT EMLV
Sbjct  1931  DLDIYMKSLVLKGQESHVATEYVLKILGLDVCADTLVGDQMIRGISGGQKKRVTTAEMLV  1990

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA+ALFMDEISTGLDSSTTFQIVN+I Q IHIL GTAVISLLQP PETYELFDDIILLS
Sbjct  1991  GPAKALFMDEISTGLDSSTTFQIVNAINQFIHILGGTAVISLLQPPPETYELFDDIILLS  2050

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DG++VYQGPR++VLEFF++MGFKCPERKGVADFLQEVTS+KDQEQYW+RR+E Y F++  
Sbjct  2051  DGEIVYQGPREDVLEFFEYMGFKCPERKGVADFLQEVTSKKDQEQYWIRRDEPYNFVSAR  2110

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             +FSEAFQSFHVG KL DEL VPFDKSK HPAAL+ +KYGV + ELL+ACASREFLLMKRN
Sbjct  2111  QFSEAFQSFHVGSKLHDELTVPFDKSKGHPAALTTEKYGVGRMELLRACASREFLLMKRN  2170

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             +FV+IFKM QL+L+A + MT+FLRTEM K++I DG ++MGALFF +   MFN FSEL+LS
Sbjct  2171  AFVHIFKMAQLILIAMIFMTIFLRTEMHKSTITDGGIYMGALFFTLYAIMFNAFSELSLS  2230

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             +LKLP FYKQRDL FFP WAY++PTWILK P+TLV++AIW+ +TYY +GFDPD GRFF+Q
Sbjct  2231  VLKLPVFYKQRDLLFFPAWAYSIPTWILKFPITLVQIAIWISLTYYVVGFDPDGGRFFRQ  2290

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSR-----------  2019
               LLIC++QM+ ALFR  AA GR +IVANTFG+  ++ VLVLGGFILSR           
Sbjct  2291  FILLICIHQMSLALFRFMAALGRDMIVANTFGAFTILAVLVLGGFILSRGFHEKQCVYCS  2350

Query  2020  DDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHW  2199
             DD+K WWIWGYWISPLMY QNAISVNE+LG SWRHVP G  E LGV+VL+SRG+FPEA W
Sbjct  2351  DDIKAWWIWGYWISPLMYGQNAISVNEFLGNSWRHVPEGFREPLGVSVLKSRGVFPEARW  2410

Query  2200  YWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGG  2379
             YWIGVGA+ GYVFL NFL  LALTYLNP+GK QA+LS E     +A K      LE    
Sbjct  2411  YWIGVGAVFGYVFLFNFLNTLALTYLNPIGKHQAVLSLEEKPNSSAGK------LEQYHH  2464

Query  2380  STSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEM  2559
              + +      +S+SSR  S  +G+ +  D + K+GMV+PFEPL +TF++++YAVDMP EM
Sbjct  2465  QSRKTSTDAPKSMSSRLKSPGIGNPDEGDRSKKKGMVIPFEPLAMTFNDLRYAVDMPQEM  2524

Query  2560  KAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISG  2739
             K +G++EDRL+LLKG++GAFRPG+LTALMG+SGAGKTTLMDVLAGRKTGGYIEG+ITISG
Sbjct  2525  KTRGISEDRLLLLKGVSGAFRPGILTALMGVSGAGKTTLMDVLAGRKTGGYIEGTITISG  2584

Query  2740  YPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVE  2919
             YPK+QETF R+AGYCEQ DIHSPHVTV+ESL YSAWLRLPP+ID   R+ F+EEVM LVE
Sbjct  2585  YPKKQETFTRVAGYCEQFDIHSPHVTVHESLQYSAWLRLPPDIDAEARKTFIEEVMKLVE  2644

Query  2920  LTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVR  3099
             LT LREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVR
Sbjct  2645  LTPLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVR  2704

Query  3100  NTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQ  3279
             NTVDTGRTVVCTIHQPSIDIFDAFDEL+LLKRGGEEIYVG LGRHSS LI+YFE IN + 
Sbjct  2705  NTVDTGRTVVCTIHQPSIDIFDAFDELILLKRGGEEIYVGQLGRHSSNLIKYFEGINRVS  2764

Query  3280  RIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYF  3459
             +I+DGYNPATWMLE+TS AQEAALGIDFA++Y+NSELYRRNKALI+ELSKPAPGSK+LYF
Sbjct  2765  KIKDGYNPATWMLEVTSIAQEAALGIDFAQLYKNSELYRRNKALIEELSKPAPGSKELYF  2824

Query  3460  PTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQD  3639
             PT+Y Q F+ Q +A LWKQHWSYWRNP Y+AVRL +T   AL+FGT+FW +G KR+ +QD
Sbjct  2825  PTQYPQPFYNQFLASLWKQHWSYWRNPRYSAVRLFYTVIIALMFGTIFWDLGTKRKKRQD  2884

Query  3640  LFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHL  3819
             LFNAMG MYAAV+F+G+ N+TSVQP+VA ERTVFYRERAAGMYSA+P+A  Q+VIELP++
Sbjct  2885  LFNAMGSMYAAVLFIGILNSTSVQPIVATERTVFYRERAAGMYSAVPHALAQMVIELPYI  2944

Query  3820  FVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISS  3999
              VQ   YG IVYAMIGFEWTA KF W++FFMY TLLY+T YGMM+VAVTPN NIAA++SS
Sbjct  2945  LVQAFSYGAIVYAMIGFEWTATKFFWYLFFMYITLLYYTFYGMMSVAVTPNQNIAAVVSS  3004

Query  4000  AFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdf  4179
             AFY  WNLFSGFIIP+TRIPVWWRWYYY+CPVSWTLYGL+ASQFGD+KE+LDT E V+DF
Sbjct  3005  AFYAIWNLFSGFIIPRTRIPVWWRWYYYLCPVSWTLYGLVASQFGDIKEELDTGERVEDF  3064

Query  4180  vksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             ++S+F F HDF+GYVA IIVG  V+FGFIFA SIK FNFQ R
Sbjct  3065  IRSYFGFRHDFLGYVAVIIVGFAVLFGFIFAISIKLFNFQKR  3106



>gb|KHN08104.1| Pleiotropic drug resistance protein 1 [Glycine soja]
Length=1485

 Score =  2177 bits (5640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1093/1472 (74%), Positives = 1264/1472 (86%), Gaps = 41/1472 (3%)
 Frame = +1

Query  1     VWRSSG-VEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVE  177
             VWRSSG V+VFS SSR   ++ E  LKWAAIEKLPTYLR+ RGIL   E  G P EID+ 
Sbjct  18    VWRSSGGVDVFSGSSRRDDDEQE--LKWAAIEKLPTYLRMTRGILTEAE--GQPTEIDIN  73

Query  178   KLGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGS  357
             KL   ++++L+ERLV+IA++DNE FL KL+ R D VG+++P IEVRFEHLNV+AEA+VGS
Sbjct  74    KLCPLQRKNLVERLVKIAEQDNEKFLFKLRDRIDSVGLEIPAIEVRFEHLNVEAEAHVGS  133

Query  358   RALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttl  537
             RALPTIFNF  N+LE F+N LH++P+RKKP  +L DVSGIIKP RM+LLLGPPSSGKTTL
Sbjct  134   RALPTIFNFCINLLEGFLNSLHLIPSRKKPFTVLDDVSGIIKPKRMSLLLGPPSSGKTTL  193

Query  538   llalagkldsdlKV------------------------------------SGRVTYNGHE  609
             LLALAG+L  DLKV                                    SGRV+YNGH 
Sbjct  194   LLALAGRLGKDLKVRAYEICFCFNNFTDELESESFKAYDSFNSIADELQFSGRVSYNGHG  253

Query  610   MTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPD  789
             M EFVP+RTSAYI+Q DLHIGEMTVRETLAFSARCQG+G R EMLAELSRREK  NIKPD
Sbjct  254   MEEFVPQRTSAYISQTDLHIGEMTVRETLAFSARCQGIGTRNEMLAELSRREKAANIKPD  313

Query  790   PDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEML  969
             PD+D+YMKA ++EGQE +VVTDYI+KILGLE+CAD +VGD+MIRGISGGQ+KR+TTGEML
Sbjct  314   PDLDIYMKAAALEGQETNVVTDYIMKILGLEICADTMVGDDMIRGISGGQKKRVTTGEML  373

Query  970   VGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILL  1149
             VGPARAL MDEISTGLDSSTTFQ+VNS+RQSIHIL GTAVISLLQPAPETYELFDDIILL
Sbjct  374   VGPARALLMDEISTGLDSSTTFQMVNSLRQSIHILNGTAVISLLQPAPETYELFDDIILL  433

Query  1150  SDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITV  1329
             SDGQ+VYQGPR+NVLEFF++MGFKCPERKGVADFLQEVTSRKDQEQYW  ++E Y F+TV
Sbjct  434   SDGQIVYQGPRENVLEFFEYMGFKCPERKGVADFLQEVTSRKDQEQYWANKDEPYSFVTV  493

Query  1330  GEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKR  1509
              EF+EAFQSFHVG+KLGDELA PFD SK HPA L+  KYGV KKELLKAC SREFLLMKR
Sbjct  494   KEFAEAFQSFHVGRKLGDELATPFDMSKGHPAVLTKNKYGVCKKELLKACVSREFLLMKR  553

Query  1510  NSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELAL  1689
             NSFVYIFKM QL+L  F+ MT+FLRTEM +++  DG ++MGALFF +I+ MFNG+SEL++
Sbjct  554   NSFVYIFKMWQLILTGFITMTLFLRTEMHRDTETDGGIYMGALFFVLIVIMFNGYSELSM  613

Query  1690  SILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFK  1869
             SI+KLP FYKQRDL FFP WAY+LPTWILKIP+TLVEV IWV MTYY IGFDP   RF K
Sbjct  614   SIMKLPVFYKQRDLLFFPCWAYSLPTWILKIPITLVEVGIWVVMTYYVIGFDPSIERFIK  673

Query  1870  QLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWG  2049
             Q FLL+C+NQMAS LFR   A GR++IVANT GS A++ V+V+GGFILSR DVKKWW+WG
Sbjct  674   QYFLLVCINQMASGLFRFMGAVGRNIIVANTVGSFALLAVMVMGGFILSRVDVKKWWLWG  733

Query  2050  YWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVG  2229
             YW SP+MY QNA++VNE+LGKSW HVP  ++E LGV VL+SRGIFPEA+WYWIGVGA +G
Sbjct  734   YWFSPMMYGQNALAVNEFLGKSWSHVPPNSTEPLGVKVLKSRGIFPEAYWYWIGVGASIG  793

Query  2230  YVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvr  2409
             Y+ L NFLF LAL YL+P GKPQA++SEE LAERNA +    IEL  +   +S++GN  R
Sbjct  794   YMLLFNFLFPLALHYLDPFGKPQALISEEALAERNAGRNEHIIELSSRIKGSSDRGNESR  853

Query  2410  rsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRL  2589
             R++SSR+LS+RVGS+  ++ N KRGMVLPF PL ITFDEI+Y+V+MP EMK+QG+ EDRL
Sbjct  854   RNMSSRTLSARVGSIGASEHNKKRGMVLPFTPLSITFDEIRYSVEMPQEMKSQGILEDRL  913

Query  2590  VLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFAR  2769
              LLKG+NG FRPGVLTALMG+SGAGKTTLMDVL+GRKT GY++G ITISGYPK+QETFAR
Sbjct  914   ELLKGVNGVFRPGVLTALMGVSGAGKTTLMDVLSGRKTAGYVQGQITISGYPKKQETFAR  973

Query  2770  IAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVG  2949
             IAGYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D+ TR+MF+EEVM+LVELTSLREALVG
Sbjct  974   IAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSVTRQMFIEEVMELVELTSLREALVG  1033

Query  2950  LPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVV  3129
             LPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVV
Sbjct  1034  LPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVV  1093

Query  3130  CTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPAT  3309
             CTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLG+  SQLI YFE ING+ +I+ GYNPAT
Sbjct  1094  CTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGQCCSQLINYFEGINGVPKIKKGYNPAT  1153

Query  3310  WMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFT  3489
             WMLE+TSEAQEAALG++FAE+Y+NS+LYRRNKALI+ELS P  G KDLYFPTKYSQ+F T
Sbjct  1154  WMLEVTSEAQEAALGLNFAEIYKNSDLYRRNKALIRELSTPTTGFKDLYFPTKYSQTFIT  1213

Query  3490  QCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYA  3669
             QCMACLWKQH SYWRNPPY+AVRLLFTT  ALLFGT+FW IG KR+ +QDLFNAMG MYA
Sbjct  1214  QCMACLWKQHLSYWRNPPYSAVRLLFTTIIALLFGTIFWDIGSKRQRKQDLFNAMGSMYA  1273

Query  3670  AVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVI  3849
             AV+F+G+QNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQV IE+P++F+QTL+YGVI
Sbjct  1274  AVLFIGIQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVAIEIPYIFIQTLVYGVI  1333

Query  3850  VYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFS  4029
             VYAMIGF+WT +KF W++FFM+FT LYFT YGMM V +TP+HN+A I+S  FY  WNLFS
Sbjct  1334  VYAMIGFDWTFSKFFWYLFFMFFTFLYFTFYGMMAVGLTPDHNVATIVSFGFYMIWNLFS  1393

Query  4030  GFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhd  4209
             GF+IP+TR+PVWWRWY++ICPVSWTLYGL+ SQFGD+KE++DT ETV++FV+S+F +  D
Sbjct  1394  GFVIPRTRMPVWWRWYFWICPVSWTLYGLVTSQFGDIKERIDTGETVEEFVRSYFGYRDD  1453

Query  4210  fvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             FVG  A ++VG  ++FGF FAFSIKAFNFQ R
Sbjct  1454  FVGVAAAVLVGFTLLFGFTFAFSIKAFNFQKR  1485



>ref|XP_002514351.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF48305.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1438

 Score =  2175 bits (5637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1065/1411 (75%), Positives = 1238/1411 (88%), Gaps = 14/1411 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPTYLRI+RGIL         KEIDV  LG+ E+R L+ERLV+IA++DNE F
Sbjct  42    LKWAALEKLPTYLRIKRGIL-------DEKEIDVNNLGLIERRKLVERLVKIAEDDNEKF  94

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKL++R +RVG+D+PTIEVRFEHLNV+AEAY+GSR LPTIFNF+ N+LE F+NYLHILP
Sbjct  95    LLKLRNRIERVGLDMPTIEVRFEHLNVEAEAYIGSRGLPTIFNFSINLLEGFLNYLHILP  154

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKKPLPIL+DVSGIIKP RMTLLLGPPSSGKTTLLLALAGKL  DL+ SGRVTYNGH M
Sbjct  155   SRKKPLPILNDVSGIIKPRRMTLLLGPPSSGKTTLLLALAGKLGKDLQFSGRVTYNGHGM  214

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI+Q+DLHIGEMTVRETLAFSARCQGVG R EML ELSRREK  NIKPDP
Sbjct  215   EEFVPQRTSAYISQYDLHIGEMTVRETLAFSARCQGVGPRLEMLEELSRREKAANIKPDP  274

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID+YMKA ++EGQE +VVTDYI+KILGLE CAD +VGDEMIRGISGGQ+KRLTTGEMLV
Sbjct  275   DIDIYMKAAALEGQETNVVTDYIIKILGLEACADTVVGDEMIRGISGGQKKRLTTGEMLV  334

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQIVNS+RQSIHIL GTA+ISLLQPAPET++LFDD+ILLS
Sbjct  335   GPARALFMDEISTGLDSSTTFQIVNSLRQSIHILGGTALISLLQPAPETFDLFDDVILLS  394

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             +GQ+VYQGPR NVLEFF++ GFKCPERKG ADFLQEVTSRKDQEQYW R++E Y F++V 
Sbjct  395   EGQIVYQGPRQNVLEFFEYTGFKCPERKGPADFLQEVTSRKDQEQYWARKDEPYSFVSVK  454

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+E FQSFH+G+KLGDELA PFDKSK HP AL+ KKYG++KKELLKAC SRE LLMKRN
Sbjct  455   EFAETFQSFHIGQKLGDELATPFDKSKCHPTALTTKKYGLSKKELLKACISRELLLMKRN  514

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SF YIFKM Q+++MA + +TVFLRTEM +++  D  +++GALFF V+  MFNGF+ELAL+
Sbjct  515   SFFYIFKMTQIIIMAVLTITVFLRTEMRRDTPTDAAIYLGALFFTVVTLMFNGFTELALT  574

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I+KLP FYKQRDL F+P WAYALPTWI+KIP+T VEVAIWV +TYY IGFDP+  RF KQ
Sbjct  575   IMKLPVFYKQRDLLFYPSWAYALPTWIVKIPITFVEVAIWVVLTYYVIGFDPNIRRFLKQ  634

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+C NQMAS LFRL AA GR +IVANT GS A++ +LVLGGFILSRD+VK WW+WGY
Sbjct  635   YLLLLCTNQMASGLFRLMAALGRDIIVANTVGSFALLAILVLGGFILSRDEVKSWWLWGY  694

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             WISPLMY QNAISVNE+LG +WRHVP  ++E LGV+ L+S GIFPEAHWYWIGVGAL+G+
Sbjct  695   WISPLMYVQNAISVNEFLGNTWRHVPPLSTEPLGVSFLKSHGIFPEAHWYWIGVGALIGF  754

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             V L N L+ LAL YL P GKPQ ++S+E LAE+++ +  E  EL   G S+         
Sbjct  755   VVLFNVLYTLALKYLEPFGKPQVIISKEALAEKHSNRSAESFELFTSGKSS-------LG  807

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
             ++SS+ +SS + +   A+PN +RGMVLPF+PL + F+EI+YAVDMP EMKAQG+ +DRL 
Sbjct  808   NISSKIVSSSLNNFTDANPNRRRGMVLPFQPLSMAFNEIRYAVDMPQEMKAQGIPDDRLE  867

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKGI+GAF+PGVLT+LMG+SGAGKTTLMDVLAGRKTGGYIEG I+ISGYPK+QETFARI
Sbjct  868   LLKGISGAFKPGVLTSLMGVSGAGKTTLMDVLAGRKTGGYIEGHISISGYPKKQETFARI  927

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQTDIHSPHVT+YESL+YSAWLRLPPE+D+  R+MF+EEVM+LVEL SLREALVGL
Sbjct  928   SGYCEQTDIHSPHVTLYESLLYSAWLRLPPEVDSYKRKMFIEEVMELVELNSLREALVGL  987

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  988   PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1047

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDEL+LLKRGGEE+YVGP+G HS +LI+YFE I G+ +I+DGYNP+TW
Sbjct  1048  TIHQPSIDIFDAFDELILLKRGGEEVYVGPIGCHSCRLIKYFEDIKGVPKIKDGYNPSTW  1107

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLEITS AQEA LGI+FA++Y+NSELYR+NKALI+ELS P PGSKDLYFPT+YSQ F TQ
Sbjct  1108  MLEITSAAQEAVLGINFADIYKNSELYRKNKALIKELSTPQPGSKDLYFPTQYSQPFLTQ  1167

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQHWSYWRNPPYTAV+LLFTT  AL+FGT+FW +G KRR QQD+FNA+G MY A
Sbjct  1168  CMACLWKQHWSYWRNPPYTAVKLLFTTVIALMFGTIFWDLGCKRRRQQDIFNAIGSMYVA  1227

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             ++F+G+QNA SVQPVVAIERTVFYRERAAGMYSALPYAFGQV+IE+P+ F+QT+IYGVIV
Sbjct  1228  LLFIGIQNAASVQPVVAIERTVFYRERAAGMYSALPYAFGQVMIEVPYAFIQTIIYGVIV  1287

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             YAMIG +WT  KF W++FFMYFT LYF+ YGMMT AVTPNHNIAA+++SAFY  WNLFSG
Sbjct  1288  YAMIGLDWTVRKFFWYMFFMYFTFLYFSFYGMMTTAVTPNHNIAAVVASAFYAIWNLFSG  1347

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             FIIP+ RIPVWWRWYY+ CPV+WT+YGL+ASQFGD+K+ LDT ETV+ F++S+F F HDF
Sbjct  1348  FIIPQPRIPVWWRWYYWCCPVAWTMYGLVASQFGDIKDMLDTGETVEHFLRSYFGFRHDF  1407

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             VG  A +IVG  V+FGF FAFSIKAFNFQ R
Sbjct  1408  VGIAAIVIVGFSVLFGFFFAFSIKAFNFQRR  1438



>ref|XP_008445146.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cucumis 
melo]
Length=1421

 Score =  2160 bits (5597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1051/1411 (74%), Positives = 1243/1411 (88%), Gaps = 6/1411 (0%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIEKLPTYLRIRRGIL  +EE G  +EID+ K+G+ E+R +LERLV+IA+EDNE F
Sbjct  17    LKWAAIEKLPTYLRIRRGIL--KEEQGEAREIDIRKIGLLERRHVLERLVKIAEEDNEEF  74

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKL+ R +RVG+++PTIEVRFEHLNV+AE YVG RALPT+FNF+ NILE  +NYLHILP
Sbjct  75    LLKLRDRIERVGLEIPTIEVRFEHLNVEAEVYVGRRALPTMFNFSLNILEGLLNYLHILP  134

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             ++KK L ILHDVSGIIKP RMTLLLGPPSSGKTTLLLALAGKL  DLK SG+V+YNGH M
Sbjct  135   SKKKSLSILHDVSGIIKPKRMTLLLGPPSSGKTTLLLALAGKLGKDLKFSGKVSYNGHGM  194

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI+QHDLHIGEMTVRETLAFSARCQGVG RYEMLAELSRREK  NIKPDP
Sbjct  195   EEFVPQRTSAYISQHDLHIGEMTVRETLAFSARCQGVGPRYEMLAELSRREKAANIKPDP  254

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             D+D+YMKA ++EGQE +++TDYILKILGLE+CAD LVGDEMIRGISGGQRKRLTTGEMLV
Sbjct  255   DLDIYMKAEALEGQETNIITDYILKILGLEMCADTLVGDEMIRGISGGQRKRLTTGEMLV  314

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEIS GLDSSTT+QIVNS+RQSIHIL GTAVISLLQPAPET++LFDDIILLS
Sbjct  315   GPARALFMDEISNGLDSSTTYQIVNSLRQSIHILNGTAVISLLQPAPETFDLFDDIILLS  374

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DG +VYQGPR++VL FF H+GFKCPERKGVADFLQEVTSRKDQEQYW  R+E Y F++V 
Sbjct  375   DGHIVYQGPREDVLTFFAHVGFKCPERKGVADFLQEVTSRKDQEQYWAIRDEPYRFVSVK  434

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EFS+AFQSFH+G++LGDELA PF++SK HPA L++KKYGV+KKE+LKAC SRE LLMKRN
Sbjct  435   EFSDAFQSFHIGRELGDELATPFNRSKCHPATLTSKKYGVSKKEVLKACISRELLLMKRN  494

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK+ QL++MA + MT+FLRTE+ ++S  DG ++MGALFF +++ MFNGFSELA++
Sbjct  495   SFVYIFKLFQLIIMALITMTLFLRTELHRDSEIDGGIYMGALFFTLVVIMFNGFSELAMT  554

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             ++KLP FYKQRDL F+P WAYALPTWILKIP+T +EV IWV MTYY IGFDP+  RFFKQ
Sbjct  555   VVKLPVFYKQRDLLFYPSWAYALPTWILKIPITCLEVGIWVAMTYYVIGFDPNIERFFKQ  614

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL C+NQMAS LFRL A  GR VIVA T  + A+ +V+VLGGFI++R+DV  WW+WGY
Sbjct  615   FLLLFCINQMASGLFRLAAGLGRDVIVATTCATLALPVVMVLGGFIVAREDVHSWWLWGY  674

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W+SP+MY QNAI+VNE+LG SWRHV   +SE LG+++L+SRGIFPEA+WYWIGVGA +GY
Sbjct  675   WVSPMMYGQNAIAVNEFLGNSWRHVLPNSSEPLGISILKSRGIFPEAYWYWIGVGATIGY  734

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             V L NFLF LAL YL+P G+ QA+LSE+TLAE+NA + G+ IE   K     E+     +
Sbjct  735   VLLFNFLFILALHYLDPFGRAQAVLSEDTLAEKNANRTGK-IEQPKKTNIFFER---ESQ  790

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
             ++ SR+L++ VGS N  + N  RGMVLP+EP  ITFDEI+YAVDMP EMKAQG+ ED+L 
Sbjct  791   NIPSRTLATSVGSTNEVNHNDNRGMVLPYEPHSITFDEIRYAVDMPQEMKAQGVVEDKLE  850

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGGY +G++TISG+PKRQETFARI
Sbjct  851   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYTDGTVTISGFPKRQETFARI  910

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQTDIHSPHVTVYESL+YSAWLRLP ++D+AT+ MF++EVM+L+ELT LR++LVGL
Sbjct  911   SGYCEQTDIHSPHVTVYESLMYSAWLRLPSDVDSATKNMFIKEVMELMELTPLRDSLVGL  970

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGL+TEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  971   PGVNGLTTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1030

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDEL LLKRGGE IYVGP+GRHSS LI YFE I G+ +I+DGYNPATW
Sbjct  1031  TIHQPSIDIFDAFDELFLLKRGGEAIYVGPIGRHSSHLIEYFEGIEGVPKIKDGYNPATW  1090

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             ML+ITS AQEAALG++F ++YRNSEL+RRNKALI+ELS P+PGSKDL FPT+YSQSF  Q
Sbjct  1091  MLDITSPAQEAALGVNFTDIYRNSELHRRNKALIKELSMPSPGSKDLLFPTQYSQSFLNQ  1150

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQH SYWRNPPYT VRL+F TF A+LFGT+FW +G +R+T+QDLFNA+G MY A
Sbjct  1151  CMACLWKQHLSYWRNPPYTVVRLIFATFVAILFGTIFWDLGSRRKTRQDLFNAIGSMYVA  1210

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+F+G QN++SVQPVVAIERTVFYRERAAGMYSALPYAFGQ+VIELP++F+Q+ IY VIV
Sbjct  1211  VLFIGTQNSSSVQPVVAIERTVFYRERAAGMYSALPYAFGQIVIELPYVFIQSTIYSVIV  1270

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             YAMIGFEWTA KF W++FFMYFTLLYFT YGMM VA+TPNH I++I+S++FY  WN+FSG
Sbjct  1271  YAMIGFEWTATKFFWYLFFMYFTLLYFTFYGMMAVAITPNHQISSIVSASFYAIWNVFSG  1330

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             F+IP+TRIP+WWRWY++ CPVSWTLYGL+ASQFGD+KE L + ETV++F+ ++F +  DF
Sbjct  1331  FLIPRTRIPIWWRWYFWACPVSWTLYGLVASQFGDIKETLQSGETVEEFITNYFGYRQDF  1390

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VA + +G+ ++FGFIFAFSIKAFNFQ R
Sbjct  1391  LGVVAVVHIGMSLLFGFIFAFSIKAFNFQKR  1421



>ref|XP_007013788.1| Pleiotropic drug resistance 12 [Theobroma cacao]
 gb|EOY31407.1| Pleiotropic drug resistance 12 [Theobroma cacao]
Length=1490

 Score =  2159 bits (5595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1087/1477 (74%), Positives = 1271/1477 (86%), Gaps = 47/1477 (3%)
 Frame = +1

Query  1     VWR-SSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVE  177
             +WR SS VEVFS+SSRE  +++   L WAAIEKLPTY R+R GILA  EEG   +EID++
Sbjct  19    LWRNSSSVEVFSKSSREEDDEEA--LTWAAIEKLPTYSRVRTGILA--EEGRQLREIDIK  74

Query  178   KLGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGS  357
             KLG+ EKR+LLERLV++A+EDNE+FLLKL+ R +RVGI LPTIEVRFEHLNV+AEAY G+
Sbjct  75    KLGLLEKRNLLERLVKVAEEDNENFLLKLRERIERVGIQLPTIEVRFEHLNVEAEAYEGN  134

Query  358   RALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPAR----MTLLLGPPSsg  525
             RALPT+FNF+ N+ E F+NYLHILP++KK LPIL D+SGIIKP R    MTLLLGPPSSG
Sbjct  135   RALPTMFNFSVNMFEGFLNYLHILPSKKKSLPILSDISGIIKPQRQEGQMTLLLGPPSSG  194

Query  526   kttlllalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFS  705
             KTTLLLALAGKL  DLKVSG +TYNGH + EFVP+RTSAYI+QHDLHIGEMTVRETLAFS
Sbjct  195   KTTLLLALAGKLGKDLKVSGGITYNGHGLKEFVPQRTSAYISQHDLHIGEMTVRETLAFS  254

Query  706   ARCQGVGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEV  885
             ARCQGVG R++ML ELSRREK  NIKPDPDID+YMKA ++EGQEA+VVTDYILKILGLEV
Sbjct  255   ARCQGVGPRFDMLVELSRREKAANIKPDPDIDIYMKAAALEGQEANVVTDYILKILGLEV  314

Query  886   CADILVGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSI  1065
             CAD +VGDEM+RGISGGQ+KR+TTGEMLVGP + LFMDEISTGLDSSTTFQIVNS+RQ I
Sbjct  315   CADAMVGDEMLRGISGGQKKRVTTGEMLVGPTKVLFMDEISTGLDSSTTFQIVNSLRQFI  374

Query  1066  HILQGTAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVA  1245
             HIL GTAVISLLQPAPETY+LFDDIILLSDG++VYQGPR+NVLEFF++MGF+CPERKGVA
Sbjct  375   HILNGTAVISLLQPAPETYDLFDDIILLSDGKIVYQGPRENVLEFFEYMGFRCPERKGVA  434

Query  1246  DFLQEV-------------------------------------TSRKDQEQYWMRREEAY  1314
             DFLQEV                                     TS KDQEQYW  +E+ Y
Sbjct  435   DFLQEVILVLTSNCCPPFLFNNQNVLEYVYKFFLFYALGVQQVTSIKDQEQYWENKEQPY  494

Query  1315  EFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREF  1494
              F+T  +F+EAFQSFH+G+KL DELA PFDKSKSHPAAL+  KYGVNKKELLKAC SRE+
Sbjct  495   HFVTATDFAEAFQSFHIGRKLCDELATPFDKSKSHPAALTKHKYGVNKKELLKACMSREY  554

Query  1495  LLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGF  1674
             LLMKRN FVY+FKMIQL   AFV+MTVFLRTEM +N++ DG ++MGALFF +I+ MFNGF
Sbjct  555   LLMKRNLFVYVFKMIQLCFTAFVSMTVFLRTEMHRNTVTDGGIYMGALFFTLIVIMFNGF  614

Query  1675  SELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDA  1854
             S+L+++ILKLP FYKQRDL F+P WAYALPTW+LKIPVT++EV +WV MTYY IGFDP+ 
Sbjct  615   SDLSMTILKLPVFYKQRDLHFYPSWAYALPTWVLKIPVTVLEVTVWVIMTYYVIGFDPNV  674

Query  1855  GRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKK  2034
             GRFFKQ F+L+C++QMAS LFRL AA GR++IVANT G+ A++ VLV+GGFILS D+VKK
Sbjct  675   GRFFKQYFVLLCLSQMASGLFRLMAALGRNMIVANTCGALALLAVLVMGGFILSHDNVKK  734

Query  2035  WWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGV  2214
             WW+WGYWISPLMY QNAI+VNE+LG SWRH+P+ ++E LGV VL+SRGIFPEAHWYW+GV
Sbjct  735   WWLWGYWISPLMYGQNAIAVNEFLGNSWRHIPANSTEKLGVLVLKSRGIFPEAHWYWLGV  794

Query  2215  GALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEK  2394
             G+L+GY  L NFLF LAL YL+P GK QA++S+ET+ +R+   + EPIEL  +G  TSEK
Sbjct  795   GSLIGYCLLFNFLFALALKYLDPFGKHQAVISKETIPKRSVNTKREPIELSSRG-KTSEK  853

Query  2395  gnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGL  2574
             G   ++S SS+SLS+  GS+N A    K+GMVLPF+PL ITFD+++YAVDMP EMKAQG+
Sbjct  854   GKESQKSGSSKSLSATAGSINEASQLRKQGMVLPFQPLAITFDDMRYAVDMPQEMKAQGV  913

Query  2575  TEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQ  2754
              EDRL LLKG++G FRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYI+G+ITISGYPK+Q
Sbjct  914   LEDRLELLKGVSGTFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGNITISGYPKKQ  973

Query  2755  ETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLR  2934
             ETFARI+GYCEQTDIHSPHVTVYESL++SAWLRL PE++T TR MF+EEVM+LVEL  LR
Sbjct  974   ETFARISGYCEQTDIHSPHVTVYESLLFSAWLRLHPEVNTVTRMMFIEEVMELVELIPLR  1033

Query  2935  EALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  3114
             +ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT
Sbjct  1034  KALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  1093

Query  3115  GRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDG  3294
             GRTVVCTIHQPSIDIFDAFDEL L+KRGGEE+YVGPLGRHS  LI+YFE INGI +I+DG
Sbjct  1094  GRTVVCTIHQPSIDIFDAFDELFLMKRGGEELYVGPLGRHSCHLIKYFEEINGIPKIKDG  1153

Query  3295  YNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYS  3474
             YNPATWMLEITS AQE  LG++F ++Y+NSELYRRNKALI+E S PAPGS+DL+F T+YS
Sbjct  1154  YNPATWMLEITSAAQEEVLGVNFTDIYKNSELYRRNKALIKEHSTPAPGSQDLHFQTRYS  1213

Query  3475  QSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAM  3654
             Q F  QCMACLWKQ+WSYWRNPPYTAVR +FTTF ALL GT+FW +G KR  +QD+ NAM
Sbjct  1214  QPFHIQCMACLWKQYWSYWRNPPYTAVRFIFTTFIALLLGTIFWDLGSKRTRRQDILNAM  1273

Query  3655  GCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTL  3834
             G MYA V+FLG QNA SVQPVVA+ERTVFYRERAAGMYSALPYAFGQ+VIELP+  +Q+ 
Sbjct  1274  GSMYATVMFLGFQNAASVQPVVAVERTVFYRERAAGMYSALPYAFGQLVIELPYTLIQSA  1333

Query  3835  IYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGF  4014
             IYGVIVYAMIGFEWT  KF WF+FFMYFTLLY+T YGMM+VAVTPN NIA+I+S+ FY  
Sbjct  1334  IYGVIVYAMIGFEWTVLKFFWFLFFMYFTLLYYTFYGMMSVAVTPNFNIASIVSTFFYRI  1393

Query  4015  WNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksff  4194
             WN+FSGFIIP+TRIP+WWRWYY++CP++WTLYGL+ASQFGD+++K ++ ETVKDF++S+F
Sbjct  1394  WNVFSGFIIPRTRIPIWWRWYYWMCPIAWTLYGLVASQFGDIEDKFESGETVKDFLRSYF  1453

Query  4195  dfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+  DFV  VA +IVGICV+FGFIFAFSIKAFNFQ R
Sbjct  1454  DYRDDFVWVVAIVIVGICVLFGFIFAFSIKAFNFQKR  1490



>ref|XP_004501294.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cicer 
arietinum]
Length=1451

 Score =  2159 bits (5595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1067/1437 (74%), Positives = 1248/1437 (87%), Gaps = 5/1437 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WRS  V+VFS SSR   ++ E  L+WAAIEKLPTYLR+ RGIL  E +   P +ID+ K
Sbjct  18    IWRSGAVDVFSGSSRREDDEQE--LQWAAIEKLPTYLRLTRGILT-ESQDQQPIQIDINK  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  ++++L+ERLV+IA+EDNE FLLKL+ R DRVG+D+PTIEVRFEHLNV+AEA+VGSR
Sbjct  75    LGPLQRKNLVERLVKIAEEDNEKFLLKLRKRIDRVGLDIPTIEVRFEHLNVEAEAHVGSR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTI NF+ N+ E  +NYLH++P+RKKP  +LHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPTILNFSINLFEGLLNYLHLIPSRKKPFTVLHDVSGIIKPKRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAG+L+ DLK SGRV YNGHEM EFVP+RTSAYI+Q DLHIGEMTVRETLAFSARCQG
Sbjct  195   LALAGRLNKDLKFSGRVVYNGHEMEEFVPQRTSAYISQTDLHIGEMTVRETLAFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             +G RY+MLAELSRREK  NIKPDPD+D+YMKA ++EGQE +VVTDYI+KILGL+ CAD +
Sbjct  255   IGTRYDMLAELSRREKAENIKPDPDLDIYMKAAALEGQETNVVTDYIIKILGLDACADTM  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQ+KR+TTGEMLVGP RALFMDEISTGLDSSTTFQ++NS+RQSIHIL G
Sbjct  315   VGDDMIRGISGGQKKRVTTGEMLVGPERALFMDEISTGLDSSTTFQMINSLRQSIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETYELFDDIILLSDGQ+VYQGPR+NVLEFF+H+GFKCPERKGVADFLQE
Sbjct  375   TALISLLQPAPETYELFDDIILLSDGQIVYQGPRENVLEFFEHIGFKCPERKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++E+Y FITV EF+EAFQSFH+ +KLGDELA PFD SK HPA L+  
Sbjct  435   VTSRKDQEQYWANKDESYTFITVREFAEAFQSFHIARKLGDELATPFDTSKGHPAVLTKN  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKELLKAC SREFLLMKRNSFVYIFKM QL+    V MT+FLRTEM +N+  DG 
Sbjct  495   KYGVSKKELLKACVSREFLLMKRNSFVYIFKMWQLIFTGIVTMTLFLRTEMHRNTETDGG  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFF +I+ MFNG+SEL++ I+KLP FYKQRDL FFP WAY+LPTWILKIP+T +E
Sbjct  555   IYMGALFFILIVIMFNGYSELSMFIMKLPVFYKQRDLLFFPAWAYSLPTWILKIPITFLE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV  TYY IGFDP   RF KQ FLL+C+NQMASALFR   A GR++IVANT GS A+
Sbjct  615   VGIWVVFTYYVIGFDPSFERFIKQYFLLVCINQMASALFRFIGAVGRNIIVANTAGSFAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             I+VLV+GGFILSR DVKKWW+WGYW+SP+MY QNAI+VNE+LG SW HVP  ++E LGV 
Sbjct  675   IVVLVMGGFILSRVDVKKWWLWGYWVSPMMYGQNAIAVNEFLGNSWSHVPPDSTEPLGVQ  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRGIFPEA+WYWIGVGA + Y+ L NFLF LAL YL+   KPQA++SEE LAERNA 
Sbjct  735   ILKSRGIFPEAYWYWIGVGASIAYMLLFNFLFPLALHYLDSYDKPQALISEEALAERNAA  794

Query  2341  KRG--EPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
               G  + IEL  +   +S KGN  R+S  S + S+RVGS++ AD + K GMVLPF PL I
Sbjct  795   TAGNRQIIELSPEYECSSAKGNRSRKSFPSTTASARVGSISAADHSRKHGMVLPFTPLSI  854

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFDEI+Y VDMP EMKA+G+ EDRL LL  +NGAFRPGVLTALMGISGAGKTTLMDVL+G
Sbjct  855   TFDEIRYEVDMPQEMKAKGVLEDRLELLTSVNGAFRPGVLTALMGISGAGKTTLMDVLSG  914

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKT GYI+G ITISGYPK+QETFARI+GYCEQTDIHSPHVTVYES+VYSAWLRLPPE+D+
Sbjct  915   RKTTGYIQGRITISGYPKKQETFARISGYCEQTDIHSPHVTVYESMVYSAWLRLPPEVDS  974

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
             ATR+MF+EEVM+L+ELTS+REALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS
Sbjct  975   ATRKMFIEEVMELIELTSIREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  1034

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLG+H
Sbjct  1035  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGQH  1094

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
              S LI YFE ING+ +I++ YNPATWMLE+TSEAQE A+G++FA++Y+NS+LYRRNKALI
Sbjct  1095  CSNLINYFEGINGVPKIKNSYNPATWMLEVTSEAQEEAIGVNFADLYKNSDLYRRNKALI  1154

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             +ELS P  GSKDL+F T++SQSF TQCMACLWKQH SYWRNPPY+AVRLLFTT  A LFG
Sbjct  1155  KELSTPPEGSKDLFFTTQHSQSFLTQCMACLWKQHLSYWRNPPYSAVRLLFTTVIAFLFG  1214

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW IG KR  +QDLFNAMG MYAAV+F+GVQNATSVQPVVAIERTVFYRERAAGMYSA
Sbjct  1215  TIFWNIGSKRERRQDLFNAMGSMYAAVLFIGVQNATSVQPVVAIERTVFYRERAAGMYSA  1274

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAFGQV +E+P++ +Q+L+YGVIVY MIGFE T AKF W++FFM+FTLLYFT +GMM 
Sbjct  1275  LPYAFGQVAVEIPYILIQSLVYGVIVYTMIGFEMTPAKFFWYLFFMFFTLLYFTFFGMML  1334

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             V  TPNHN+AAI+S  FY  WNLFSGF+IP+TR+P+WWRW+++ICP+SWTLYGL+ +QFG
Sbjct  1335  VGATPNHNVAAIVSFGFYLLWNLFSGFVIPRTRMPIWWRWFFWICPISWTLYGLVTTQFG  1394

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +VKE+++T ETV++FV ++F +  DF G  A ++V   ++FGF FAFSIKAFNFQ R
Sbjct  1395  NVKERMETGETVEEFVMTYFGYRDDFKGVAAAVVVSFSLIFGFTFAFSIKAFNFQKR  1451



>ref|XP_004138743.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cucumis 
sativus]
 ref|XP_004160857.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cucumis 
sativus]
Length=1421

 Score =  2159 bits (5594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1045/1411 (74%), Positives = 1234/1411 (87%), Gaps = 6/1411 (0%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIEKLPTYLRIRRGIL  +EE G  +EID+ K+G+ E+R +LERLV+IA+EDNE F
Sbjct  17    LKWAAIEKLPTYLRIRRGIL--KEEQGEAREIDIRKIGLLERRHVLERLVKIAEEDNEEF  74

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKL+ R +RVG+++PTIEVRFEHLNV+AE YVG RALPT+FNF+ NILE  +NYLHILP
Sbjct  75    LLKLRGRIERVGLEIPTIEVRFEHLNVEAEVYVGRRALPTMFNFSLNILEGLLNYLHILP  134

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             ++KK L +LHDVSGIIKP RMTLLLGPPSSGKTTLLLALAGKL  DLK SG+V+YNGH M
Sbjct  135   SKKKSLSVLHDVSGIIKPKRMTLLLGPPSSGKTTLLLALAGKLGKDLKFSGKVSYNGHGM  194

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI+QHDLHIGEMTVRETLAFSARCQGVG RYEMLAELSRREK  NIKPDP
Sbjct  195   EEFVPQRTSAYISQHDLHIGEMTVRETLAFSARCQGVGPRYEMLAELSRREKAANIKPDP  254

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             D+D+YMKA ++EGQE +++TDYILKILGLE+CAD LVGDEMIRGISGGQRKRLTTGEMLV
Sbjct  255   DLDIYMKAEALEGQETNIITDYILKILGLEMCADTLVGDEMIRGISGGQRKRLTTGEMLV  314

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEIS GLDSSTT+QIVNS+RQSIHIL GTAVISLLQPAPET++LFDDIILLS
Sbjct  315   GPARALFMDEISNGLDSSTTYQIVNSLRQSIHILNGTAVISLLQPAPETFDLFDDIILLS  374

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DG +VYQGPR++VL FF HMGFKCPERKGVADFLQEVTSRKDQEQYW  R+E Y F++V 
Sbjct  375   DGHIVYQGPREDVLTFFAHMGFKCPERKGVADFLQEVTSRKDQEQYWAIRDEPYRFVSVK  434

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EFS+AFQSFH+G++LGDELA PF++SK HPA L++KKYGV+KKE+LKAC SRE LLMKRN
Sbjct  435   EFSDAFQSFHIGRELGDELATPFNRSKCHPATLTSKKYGVSKKEVLKACISRELLLMKRN  494

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK+ QL++MA + MT+FLRTE+ ++S  DG ++MGALFF +++ MFNGFSELA++
Sbjct  495   SFVYIFKLFQLIIMALITMTLFLRTELHRDSEIDGGIYMGALFFTLVVIMFNGFSELAMT  554

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             ++KLP FYKQRDL F+P WAYALPTWILKIP+T +EV IWV MTYY IGFDP+  RFFKQ
Sbjct  555   VVKLPVFYKQRDLLFYPSWAYALPTWILKIPITCLEVGIWVVMTYYVIGFDPNIERFFKQ  614

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL C+NQMAS LFRL A  GR VIVA T  + A+ +V+VLGGFI++R+DV  WW+WGY
Sbjct  615   FLLLFCINQMASGLFRLAAGLGRDVIVATTCATLALPVVMVLGGFIVAREDVHSWWLWGY  674

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W+SP+MY QNAI+VNE+LG SWRHVPS +SE LG+++L+SRGIFPEA+WYWIGVGA +GY
Sbjct  675   WVSPMMYGQNAIAVNEFLGNSWRHVPSNSSEPLGISILKSRGIFPEAYWYWIGVGATIGY  734

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             V + NFLF LAL YL+P G+ QA+LSE+TLAE+NA + G+ IE   K     E  +    
Sbjct  735   VLVFNFLFILALHYLDPFGQAQAVLSEDTLAEKNANRTGK-IEQPKKTNIFFETESQNMP  793

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
             S +  +       V   D    RGMVLP+EP  ITFDEI+YAVDMP EMKAQG+ ED+L 
Sbjct  794   SRTLATSVGSTNEVKHND---NRGMVLPYEPHSITFDEIRYAVDMPQEMKAQGVVEDKLE  850

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGG+ +G +TISG+PKRQETFARI
Sbjct  851   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGFTDGKVTISGFPKRQETFARI  910

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQTDIHSPHVTVYESL+YSAWLRLP ++D+AT+ MF++EVM+L+ELT LR++LVGL
Sbjct  911   SGYCEQTDIHSPHVTVYESLMYSAWLRLPSDVDSATKNMFIKEVMELMELTPLRDSLVGL  970

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGL+TEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  971   PGVNGLTTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1030

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDEL LLKRGGE IYVGP+GRHSS LI YFE I G+ +I+DGYNPATW
Sbjct  1031  TIHQPSIDIFDAFDELFLLKRGGEAIYVGPIGRHSSHLIEYFEGIEGVPKIKDGYNPATW  1090

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             ML+ITS AQEAALG++F ++YRNSELYRRNKALI+ELS P+PGSKDL FPT+YSQSF  Q
Sbjct  1091  MLDITSPAQEAALGVNFTDIYRNSELYRRNKALIKELSMPSPGSKDLLFPTQYSQSFLNQ  1150

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQH SYWRNPPYT VRL+F TF A+LFGT+FW +G +R+T+QD+FNA+G MY A
Sbjct  1151  CMACLWKQHLSYWRNPPYTVVRLIFATFVAILFGTIFWDLGSRRKTRQDVFNAIGSMYVA  1210

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+F+G QN++SVQPVVAIERTVFYRERAAGMYSALPYAFGQ+VIELP++F+Q+ IY VIV
Sbjct  1211  VLFIGTQNSSSVQPVVAIERTVFYRERAAGMYSALPYAFGQIVIELPYVFIQSTIYSVIV  1270

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             YAMIGFEWTA KF W++FFMYFTLLYFT YGMM VA+TPNH I++I+S++FY  WN+FSG
Sbjct  1271  YAMIGFEWTAIKFFWYLFFMYFTLLYFTFYGMMAVAITPNHQISSIVSASFYAIWNVFSG  1330

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             F+IP+TRIP+WWRWY++ CPVSWTLYGL+ASQFGDV+E L + ETV++F++++F +  DF
Sbjct  1331  FLIPRTRIPIWWRWYFWGCPVSWTLYGLVASQFGDVEETLQSGETVEEFIRNYFGYRQDF  1390

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G V  + +G+ ++FGFIFAFSIKAFNFQ R
Sbjct  1391  LGIVGVVHIGMSLLFGFIFAFSIKAFNFQKR  1421



>ref|XP_010648606.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Vitis vinifera]
Length=1442

 Score =  2150 bits (5570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1069/1435 (74%), Positives = 1249/1435 (87%), Gaps = 11/1435 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             + R+S VEVFSRSSRE  +++   LKWAA+EKLPT+LRI+RGIL   EE G  +EI+++ 
Sbjct  19    ILRNSSVEVFSRSSREEDDEEA--LKWAALEKLPTFLRIQRGILT--EEKGQTREINIKS  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+++L++RLV+I   DNE FLLKLK R DRVG+D+PT+EVRFEHL VDAEAYVGSR
Sbjct  75    LGLPERKNLIQRLVKIDGHDNEKFLLKLKERIDRVGLDIPTVEVRFEHLTVDAEAYVGSR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF+ANILE F+NYLHILP+RKKP  ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPTIFNFSANILEGFLNYLHILPSRKKPFSILHDVSGIIKPRRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAG+L SDLKVSGRVTYNGH M EFVP+RTSAY +Q+DLH GEMTVRETL FSARCQG
Sbjct  195   LALAGRLGSDLKVSGRVTYNGHGMDEFVPQRTSAYTSQYDLHAGEMTVRETLDFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG   +MLAELSRREK  NIKPDPDID+YMKA ++EGQ+ SVVT+Y+LKILGLE+CAD L
Sbjct  255   VGGLSDMLAELSRREKAANIKPDPDIDIYMKAAALEGQKTSVVTEYMLKILGLEICADTL  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD M +GISGGQ+KRLTTGE+LVGPARALFMDEISTGLDSST FQIVNS+RQSIHIL G
Sbjct  315   VGDVMKQGISGGQKKRLTTGEILVGPARALFMDEISTGLDSSTAFQIVNSLRQSIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY LFDDIILLSDG++VYQGP +NVLEFF +MGFKCPERKGVADFLQE
Sbjct  375   TALISLLQPAPETYNLFDDIILLSDGKIVYQGPCENVLEFFGYMGFKCPERKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW R++E Y ++TV EF+EAFQSFH+G+KLGDELAVPFDK+K HPAAL+ K
Sbjct  435   VTSRKDQEQYWARKDEPYSYVTVKEFAEAFQSFHIGQKLGDELAVPFDKTKGHPAALTTK  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG++K+ELL+AC SREFLLMKRNSFV  F   QL+++AF+ MT+FLRTEM +N++ DG 
Sbjct  495   KYGISKRELLRACTSREFLLMKRNSFVLFFLFFQLIIVAFINMTLFLRTEMSRNTVEDGG  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +FMGALFFAV+M MFNGF+EL ++I +LP FYKQRDL FFP WAY+LP WILK+P+   E
Sbjct  555   IFMGALFFAVLMIMFNGFTELPMTIFQLPVFYKQRDLLFFPSWAYSLPKWILKMPIAFAE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V  WV MTYY IGFDP+  RFFKQ  LL+C++QMAS L RL AA GR++IVANTFGS A+
Sbjct  615   VGAWVIMTYYVIGFDPNIERFFKQYLLLLCIHQMASGLLRLMAALGRNIIVANTFGSFAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             ++V+VLGGF+LS+DDVK WW WGYW+SPLMY QNAISVNE+LG SWRHVP+ ++E+LGV 
Sbjct  675   LVVMVLGGFVLSKDDVKTWWEWGYWVSPLMYGQNAISVNEFLGNSWRHVPANSTESLGVL  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL++RG+F E HWYW+GVGAL+GYV L NFLF LAL+YLNP GK Q +LS+ETL E+ A 
Sbjct  735   VLKARGVFTEPHWYWLGVGALIGYVLLFNFLFTLALSYLNPFGKSQPILSKETLTEKQAN  794

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             +  E IEL  + G+  + G+    S    S++        AD + KRGMVLPFEPL I+F
Sbjct  795   RTEELIELSPETGARIQSGSSRSLSARVGSITE-------ADQSRKRGMVLPFEPLSISF  847

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEI+YAVDMP EMKAQG+TEDRL LL+G++G+FRPG+LTALMG++GAGKTTLMDVLAGRK
Sbjct  848   DEIRYAVDMPQEMKAQGITEDRLELLRGVSGSFRPGILTALMGVTGAGKTTLMDVLAGRK  907

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             T GYIEG I + GYPK+QETFAR+ GYCEQTDIHSPHVTVYESL+YSAWLRLP E+D+AT
Sbjct  908   TSGYIEGIIKVYGYPKKQETFARVLGYCEQTDIHSPHVTVYESLLYSAWLRLPSEVDSAT  967

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVEL SLREALVGLP  NGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  968   RKMFIEEVMELVELNSLREALVGLPSENGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1027

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIY GP+GRHSS
Sbjct  1028  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYAGPIGRHSS  1087

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE ING+ +I+DGYNP+TWMLE+TS AQE ALG++F E Y+NSELYRRNKALI+E
Sbjct  1088  HLIKYFEGINGVSKIKDGYNPSTWMLEVTSAAQEVALGVNFTEEYKNSELYRRNKALIKE  1147

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSKDLYF T+YSQSFFTQC+ACLWKQHWSYWRNP YTAVRL FTTF AL+ GT+
Sbjct  1148  LSSPPPGSKDLYFSTQYSQSFFTQCLACLWKQHWSYWRNPAYTAVRLFFTTFIALMLGTI  1207

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW  G KR+ QQDLFNAMG MYAAV+ +G+QNA+SVQ VVAIERTVFYRERAAGMYS  P
Sbjct  1208  FWDFGSKRKRQQDLFNAMGSMYAAVISIGIQNASSVQAVVAIERTVFYRERAAGMYSPFP  1267

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV+IELPH+F+QT+IYG+IVYAM+GFEWT  KF W++FFMYFT LYFT YGMM VA
Sbjct  1268  YAFGQVMIELPHIFIQTIIYGLIVYAMVGFEWTVTKFFWYLFFMYFTFLYFTFYGMMAVA  1327

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPN +I+ I+SSAFYG WNLFSGFIIP TRIPVWW+WY++ CPVSWTLYGL+ +QFGD+
Sbjct  1328  ITPNQHISGIVSSAFYGLWNLFSGFIIPHTRIPVWWKWYFWSCPVSWTLYGLLVTQFGDI  1387

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             KE+L++ E V+DFV+S+F + +DFVG VA I+VGI V+FGFIFA+SI+AFNFQ R
Sbjct  1388  KERLESGERVEDFVRSYFGYRNDFVGVVAGIVVGITVLFGFIFAYSIRAFNFQKR  1442



>ref|XP_002309596.1| hypothetical protein POPTR_0006s26460g [Populus trichocarpa]
 gb|EEE93119.1| hypothetical protein POPTR_0006s26460g [Populus trichocarpa]
Length=1414

 Score =  2142 bits (5549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1053/1434 (73%), Positives = 1225/1434 (85%), Gaps = 41/1434 (3%)
 Frame = +1

Query  4     WRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKL  183
             WR+S  EVFSRSSR+  +++   LKWAA+EKLPTYLR+ RGIL  EE  G  +EID+  L
Sbjct  22    WRNSIPEVFSRSSRDEDDEEA--LKWAALEKLPTYLRLTRGILTEEE--GKAREIDIMNL  77

Query  184   GVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRA  363
             G+ EKR LLERLV+IA+EDNE FLLKLK R DRV +++PTIEVRFEHLNV+AEAYVG RA
Sbjct  78    GLVEKRDLLERLVKIAEEDNERFLLKLKERIDRVELEIPTIEVRFEHLNVEAEAYVGGRA  137

Query  364   LPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlll  543
             LPTI NF+AN+LE F+++LH+LP+RK+P PIL DVSGIIKP RMTLLLGPPSSGKTTLL+
Sbjct  138   LPTILNFSANMLEGFLSFLHLLPSRKQPFPILRDVSGIIKPRRMTLLLGPPSSGKTTLLM  197

Query  544   alagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGV  723
             ALAGKL  DL+ SG VTYNGH M EFVP+RTSAYI+Q DLHIGEMTVRETL+FSARCQGV
Sbjct  198   ALAGKLGKDLQCSGSVTYNGHGMEEFVPQRTSAYISQFDLHIGEMTVRETLSFSARCQGV  257

Query  724   GHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILV  903
             G RYEML ELSRREKE NIKPDPD+D+YMKA ++EGQE SV T YILKI GL++CAD +V
Sbjct  258   GPRYEMLTELSRREKEANIKPDPDLDIYMKAAALEGQETSVTTYYILKITGLDICADTMV  317

Query  904   GDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGT  1083
             GDEMIRGISGGQ+KRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNS+RQ+ HIL GT
Sbjct  318   GDEMIRGISGGQKKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSLRQTTHILNGT  377

Query  1084  AVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEV  1263
              +ISLLQPAPETY+LFDD+ILLSDG +VYQGPR+NVLEFF+ +GFKCPERKGVADFLQEV
Sbjct  378   TLISLLQPAPETYDLFDDVILLSDGLIVYQGPRENVLEFFESLGFKCPERKGVADFLQEV  437

Query  1264  TSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKK  1443
             TSRKDQEQYW  R++ Y F++  EFSEAFQSFH+G+KLGDELA+PFDKSKSHP+ALS +K
Sbjct  438   TSRKDQEQYWASRDQPYSFVSAKEFSEAFQSFHIGRKLGDELAIPFDKSKSHPSALSTEK  497

Query  1444  YGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTV  1623
             YGV+KKELLKAC SREFLLMKRNSFVYIFK  QL+L+A +AMTVFLRTEM +N+I DG +
Sbjct  498   YGVSKKELLKACISREFLLMKRNSFVYIFKFTQLILLASIAMTVFLRTEMHRNTITDGGI  557

Query  1624  FMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEV  1803
             ++GALFFA+I+ MFNGFSEL ++I+KLP FYKQRDL F+PPWAYA+PTWILKIP+T VEV
Sbjct  558   YIGALFFAIIVIMFNGFSELVMTIMKLPVFYKQRDLLFYPPWAYAIPTWILKIPITFVEV  617

Query  1804  AIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMI  1983
             AIW  MTYYA+GFDP+ GRFFKQ  + +  NQM+S LFR+  A GR+VIVAN  GS A++
Sbjct  618   AIWTTMTYYAVGFDPNIGRFFKQYLIFVLANQMSSGLFRMMGALGRNVIVANNVGSFALL  677

Query  1984  LVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTV  2163
              VLV+GGFILSRD+VK WWIWGYW+SPLMY QNA+SVNE+LG SWRH+P  ++E+LGVT+
Sbjct  678   AVLVMGGFILSRDNVKSWWIWGYWVSPLMYVQNAVSVNEFLGNSWRHIPPSSTESLGVTL  737

Query  2164  LRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACK  2343
             L+SRG+FPEA WYWIGVGAL+GY  L NFLF LAL YLN  GK          ++ N+  
Sbjct  738   LKSRGVFPEARWYWIGVGALIGYTLLFNFLFTLALKYLNQRGKD---------SKTNSSA  788

Query  2344  RGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFD  2523
             R   + +   G +                               KRGMVLPF+PL ITF+
Sbjct  789   RAPSLRMPSLGDANQN----------------------------KRGMVLPFQPLSITFE  820

Query  2524  EIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKT  2703
             EI+Y+VDMP EMKAQG+ EDRL LLKG++GAFR GVLTALMG+SGAGKTTLMDVL+GRKT
Sbjct  821   EIRYSVDMPQEMKAQGIPEDRLELLKGVSGAFRSGVLTALMGVSGAGKTTLMDVLSGRKT  880

Query  2704  GGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATR  2883
             GGYI+G I+ISGY K Q+TFARI+GYCEQTDIHSPHVTVYESLVYSAWLRL P++D+ TR
Sbjct  881   GGYIDGRISISGYAKNQQTFARISGYCEQTDIHSPHVTVYESLVYSAWLRLSPDVDSETR  940

Query  2884  EMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  3063
             +MF+EEVM+LVEL  LREALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  941   KMFIEEVMELVELNPLREALVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1000

Query  3064  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQ  3243
             ARAAAIVMR VRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIYVGP+GRH+  
Sbjct  1001  ARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYVGPVGRHACH  1060

Query  3244  LIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQEL  3423
             LI+YFE I G+ +I+DGYNPATWMLE+TS AQEA L  +F ++++NSELYRRNKALI+EL
Sbjct  1061  LIKYFEEIEGVPKIKDGYNPATWMLEVTSAAQEAVLNDNFTDIFKNSELYRRNKALIEEL  1120

Query  3424  SKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMF  3603
             S P PGSKDLYFPT+YSQSFFTQCMACLWKQHWSYWRNPPY AVRLL TT  AL+FGT+F
Sbjct  1121  SAPPPGSKDLYFPTRYSQSFFTQCMACLWKQHWSYWRNPPYNAVRLLSTTVIALMFGTIF  1180

Query  3604  WGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPY  3783
             W +G KR  +QD+FN+MG MYAAV+F+GVQNATSVQPVVAIERTVFYRER AGMYSALPY
Sbjct  1181  WNLGSKRNRKQDIFNSMGSMYAAVLFIGVQNATSVQPVVAIERTVFYRERVAGMYSALPY  1240

Query  3784  AFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAV  3963
             AF QV+IE+P+  VQ LIYGVIVY+MIGFEWTA KF W+IFFMYFTLLY T YGMM VA+
Sbjct  1241  AFAQVMIEIPYTLVQALIYGVIVYSMIGFEWTAIKFFWYIFFMYFTLLYMTFYGMMNVAI  1300

Query  3964  TPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVK  4143
             TPNH+IA+++SSAFY  WNLFSGFIIP+TR+P+WWRWY + CP SWTLYGLIASQ+GD++
Sbjct  1301  TPNHSIASLVSSAFYAIWNLFSGFIIPRTRVPIWWRWYCWACPFSWTLYGLIASQYGDLE  1360

Query  4144  EKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +KL+++ETVKDF++++F F HDFVG  A ++VG+ V+F F FAFSI+ FNFQ R
Sbjct  1361  DKLESDETVKDFLRNYFGFRHDFVGICAIVVVGMSVLFAFTFAFSIRTFNFQRR  1414



>ref|XP_003603455.1| Pleiotropic drug resistance protein [Medicago truncatula]
 gb|AES73706.1| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1460

 Score =  2134 bits (5529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1067/1446 (74%), Positives = 1239/1446 (86%), Gaps = 14/1446 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WRS  V+VFS SSR   ++ E  L+WAAIEKLPTYLR+ RGIL  E +   P EID+ K
Sbjct  18    IWRSGAVDVFSGSSRRDDDEQE--LQWAAIEKLPTYLRMTRGILN-ESQSEQPIEIDINK  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  ++++L+ERLV+IA+EDNE FLLKL+ R DRVG+D PTIEVRFEHLNV+AEA+VGSR
Sbjct  75    LGPLQRKNLVERLVKIAEEDNEKFLLKLRQRIDRVGLDFPTIEVRFEHLNVEAEAHVGSR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTI NF+ N+LE F+N LH++P+RKKPL +LHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPTILNFSINLLEGFLNNLHLIPSRKKPLTVLHDVSGIIKPKRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAG+L  DLK SGRV YN H M EFVP+RTSAYI+Q DLHIGE+TVRETLAFSARCQG
Sbjct  195   LALAGRLSRDLKFSGRVAYNDHGMEEFVPQRTSAYISQTDLHIGELTVRETLAFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             +G RY+MLAELSRREK  NIKPDPD+D+YMKA ++EGQE ++VTDYI+KILGL+VCAD +
Sbjct  255   IGTRYDMLAELSRREKAENIKPDPDLDIYMKAEALEGQETNIVTDYIIKILGLDVCADTM  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQ++NS+RQSIHIL G
Sbjct  315   VGDDMIRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQMINSLRQSIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQP PETY+LFDDIILLSDGQ+VYQGPR+NVLEFF+H+GFKCPERKGVADFLQE
Sbjct  375   TALISLLQPTPETYDLFDDIILLSDGQIVYQGPRENVLEFFEHVGFKCPERKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  +++ Y FITV EF+E FQ FHVG+KLGDEL  PFD SK HPA L+  
Sbjct  435   VTSRKDQEQYWSNKDKPYTFITVREFAEEFQLFHVGQKLGDELGTPFDASKGHPAVLTKN  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV++KELLKAC SRE LLMKRNSFVYIFKM QL+    V MT+FLRTEM +N+  DG 
Sbjct  495   KYGVSRKELLKACVSRELLLMKRNSFVYIFKMWQLIFTGIVTMTMFLRTEMHRNTETDGG  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFF +I+ MFNG+SEL++ I+KLP FYKQRDL  FP WAY+LPTWILKIP+T VE
Sbjct  555   IYMGALFFILIVIMFNGYSELSMFIMKLPVFYKQRDLLLFPAWAYSLPTWILKIPITFVE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV +TYY IGFDP   RF KQ FLL+C+NQMASALFR   A GR+VIVANT GS A+
Sbjct  615   VGIWVVLTYYVIGFDPCFERFIKQYFLLVCINQMASALFRFIGAVGRNVIVANTVGSFAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLV+GGFILSR DVKKWW+WGYW+SP+MY QNAI+VNE+LGKSW H+P  ++E LGV 
Sbjct  675   LAVLVMGGFILSRVDVKKWWLWGYWVSPMMYGQNAIAVNEFLGKSWSHIPPDSTEPLGVQ  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNP-----------LGKPQAML  2307
             +L+SRGIFPEA+WYWIGVGA +GY+ L NFLF LAL YL+             GKPQA++
Sbjct  735   ILKSRGIFPEAYWYWIGVGASIGYMLLFNFLFPLALHYLDSKYPIYYMWLSAFGKPQALI  794

Query  2308  SEETLAERNACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGM  2487
             SEE LAERNA   G    +EL        GN  RRS SS +LS++VGS+N AD   KRGM
Sbjct  795   SEEALAERNAATAGSKQIIELSPKLECSSGNASRRSFSSTTLSTKVGSINAADHTRKRGM  854

Query  2488  VLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGK  2667
             VLPF PL ITFDEI YAVDMP EMKA+G+ EDRL LL G+NGAFRPGVLTALMGISGAGK
Sbjct  855   VLPFTPLSITFDEIGYAVDMPQEMKAKGIPEDRLELLTGVNGAFRPGVLTALMGISGAGK  914

Query  2668  TTLMDVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAW  2847
             TTLMDVL+GRKT GY++G ITISGYPK+QETF+RI+GYCEQTDIHSPHVTVYESLVYSAW
Sbjct  915   TTLMDVLSGRKTTGYVQGQITISGYPKKQETFSRISGYCEQTDIHSPHVTVYESLVYSAW  974

Query  2848  LRLPPEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPS  3027
             LRLPPE+DT+TR+MF+EEVM+L+ELTS+REALVGLPGVNGLSTEQRKRLTIAVELVANPS
Sbjct  975   LRLPPEVDTSTRKMFIEEVMELIELTSIREALVGLPGVNGLSTEQRKRLTIAVELVANPS  1034

Query  3028  IIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEE  3207
             IIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEE
Sbjct  1035  IIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEE  1094

Query  3208  IYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSE  3387
             IYVGPLGRH S LI YFE ING+ +I++GYNPATWMLE+TSEAQE ALGI+FAE+Y+NS+
Sbjct  1095  IYVGPLGRHCSHLINYFEGINGVPKIKNGYNPATWMLEVTSEAQEEALGINFAELYKNSD  1154

Query  3388  LYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLF  3567
             LYR NKALI+ELS P  GSKDLYF T++SQSF TQCMACLWKQ+ SYWRNPPY+AVRLLF
Sbjct  1155  LYRTNKALIRELSTPPEGSKDLYFTTQHSQSFLTQCMACLWKQNLSYWRNPPYSAVRLLF  1214

Query  3568  TTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYR  3747
             TT  A LFGT+FW IG KR  +QDLFNAMG MYAAV+F+GVQNATSVQPVVAIERTVFYR
Sbjct  1215  TTVIAFLFGTIFWNIGSKRERRQDLFNAMGSMYAAVLFIGVQNATSVQPVVAIERTVFYR  1274

Query  3748  ERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftll  3927
             E+AAGMYSALPYAFGQV +E+P++ +Q+L+YGVIVY M+GFE T  KF W++FFM+FT L
Sbjct  1275  EKAAGMYSALPYAFGQVAVEIPYILIQSLVYGVIVYTMVGFERTPTKFFWYLFFMFFTFL  1334

Query  3928  yftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTL  4107
             YFT +GMM V  TP+HN+AAI+S  FY  WNLFSGF+IP+TR+PVWWRW+++ICP+SWTL
Sbjct  1335  YFTFFGMMLVGATPDHNVAAIVSFGFYLLWNLFSGFVIPRTRMPVWWRWFFWICPISWTL  1394

Query  4108  YGLIASQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKA  4287
             YGLI +QFGDV E++DT ETV++FV+S+F +  DF    A ++V   ++FG  FAFSIKA
Sbjct  1395  YGLITTQFGDVNERMDTGETVEEFVRSYFGYRDDFKDVAAAVVVSFSLIFGSAFAFSIKA  1454

Query  4288  FNFQTR  4305
             FNFQ R
Sbjct  1455  FNFQKR  1460



>ref|XP_010910610.1| PREDICTED: pleiotropic drug resistance protein 3-like [Elaeis 
guineensis]
Length=1451

 Score =  2129 bits (5517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1058/1413 (75%), Positives = 1220/1413 (86%), Gaps = 5/1413 (0%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPTY R+RRGIL   E  G  KE+D++KLG+ E+ +LLERLVR+A+EDNE F
Sbjct  42    LKWAALEKLPTYDRVRRGILTLAE--GESKEVDIQKLGLQERNALLERLVRVAEEDNERF  99

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKL+ R DRVG+DLPTIEVR+EHLN+ AE YVG+R LPTI N   N+LE+  NY HILP
Sbjct  100   LLKLRDRIDRVGLDLPTIEVRYEHLNIQAETYVGNRGLPTILNSIVNVLESAANYFHILP  159

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK+ LPILHDVSGIIKP RMTLLLGPP SGKTTLLLALAGKLDSDLKVSGRVTYNGH M
Sbjct  160   SRKRSLPILHDVSGIIKPQRMTLLLGPPGSGKTTLLLALAGKLDSDLKVSGRVTYNGHGM  219

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+QHDLHIGEMTVRETLAFSARCQGVG RYEML ELSRREK  NIKPDP
Sbjct  220   EEFVPQRTAAYISQHDLHIGEMTVRETLAFSARCQGVGSRYEMLTELSRREKAANIKPDP  279

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA +++GQ++SVVTDYILK+LGLE+CAD +VGDEM+RGISGGQRKR+TTGEMLV
Sbjct  280   DIDVFMKAAAMDGQKSSVVTDYILKVLGLEICADTMVGDEMLRGISGGQRKRVTTGEMLV  339

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA+ALFMDEISTGLDSSTTFQIVNS+RQSIHIL GTAVISLLQPAPETY+LFDDIILLS
Sbjct  340   GPAKALFMDEISTGLDSSTTFQIVNSLRQSIHILGGTAVISLLQPAPETYDLFDDIILLS  399

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQVVYQGPR++VLEFF+ MGFKCPERKGVADFLQEVTSRKDQ+QYW R  E Y ++ V 
Sbjct  400   DGQVVYQGPREHVLEFFESMGFKCPERKGVADFLQEVTSRKDQQQYWARHHENYRYVPVK  459

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQSFHVG+ +G+EL++P+DKSK+HPAAL+   YGV+K+ELLKA  +RE LLMKRN
Sbjct  460   EFAEAFQSFHVGQDIGNELSIPYDKSKNHPAALTTSNYGVSKEELLKANLARELLLMKRN  519

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK  QL++MA + MT+FLRT M ++S+ DG ++MGALFF ++  MFNGFSELA++
Sbjct  520   SFVYIFKATQLIIMALITMTIFLRTNMHRDSVTDGGIYMGALFFGIVTIMFNGFSELAMT  579

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             ILKLP F+KQRDL F+P W+Y +PTWILKIP++  EV +WV  TYY IGFDP+ GR FKQ
Sbjct  580   ILKLPVFFKQRDLLFYPAWSYTIPTWILKIPISFAEVGVWVFTTYYVIGFDPNVGRLFKQ  639

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ +NQMASALFR  AA GR++IVANTFGS A++++LVLGGFILSR+DVKKWWIWGY
Sbjct  640   YLLLLAINQMASALFRFIAALGRNMIVANTFGSFALLILLVLGGFILSREDVKKWWIWGY  699

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             WISPLMYAQNAIS NE+LGKSW H   G+ ETLGV VL+SRG+FPEA WYWIG GAL+GY
Sbjct  700   WISPLMYAQNAISTNEFLGKSWSH-SLGSKETLGVLVLKSRGVFPEAKWYWIGFGALIGY  758

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKG-GSTSEKgnvvr  2409
             V L N LF +ALTYL P GK Q  +SEETL E++A   GE +E   +G  S     +   
Sbjct  759   VLLFNALFTVALTYLKPFGKAQPAMSEETLKEKHANLTGEVLESSSRGRNSVDHFASGNG  818

Query  2410  rsvssrslssrvgsvnvADPNM-KRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDR  2586
                  RS +S   +  V + N  K+GMVLPF PL ITFD+I+Y+VDMP EMKAQG+TEDR
Sbjct  819   ADEMRRSNTSSNSTNEVVNSNQNKKGMVLPFVPLSITFDDIRYSVDMPQEMKAQGVTEDR  878

Query  2587  LVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFA  2766
             L LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYIEG+ITISGYPK+QETFA
Sbjct  879   LELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFA  938

Query  2767  RIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALV  2946
             R++GYCEQ DIHSPHVTVYESLVYSAWLRLP E+D+ATR++F+EEVM+LVELTSLR+ALV
Sbjct  939   RVSGYCEQNDIHSPHVTVYESLVYSAWLRLPSEVDSATRKIFIEEVMELVELTSLRDALV  998

Query  2947  GLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV  3126
             GLPGVNGLSTEQRKRLTIAVELVANPSII MDEPTSGLDARAAAIVMRTVRNTVDTGRTV
Sbjct  999   GLPGVNGLSTEQRKRLTIAVELVANPSIISMDEPTSGLDARAAAIVMRTVRNTVDTGRTV  1058

Query  3127  VCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPA  3306
             VCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLGRHS  LI YFE I G+ +I+DGYNPA
Sbjct  1059  VCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGRHSCHLISYFEGIEGVSKIKDGYNPA  1118

Query  3307  TWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFF  3486
             TWMLE+T+ AQE  LG++F+E Y+NSELY+RNK LI+ELS P PGS DLYFP++YSQ+FF
Sbjct  1119  TWMLEVTTLAQEEILGVNFSEAYKNSELYQRNKNLIKELSTPPPGSSDLYFPSQYSQNFF  1178

Query  3487  TQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMY  3666
             TQCMA LWKQ+ SYWRNPPYTAVR  FTT  ALLFGT+FW +G KR +QQDLFNAMG MY
Sbjct  1179  TQCMANLWKQNLSYWRNPPYTAVRFFFTTIIALLFGTIFWDLGTKRNSQQDLFNAMGSMY  1238

Query  3667  AAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGV  3846
             AAV+FLGVQNA+SVQPVVAIERTVFYRERAAGMYSALPYAFGQV IE+P++ +Q+LIYGV
Sbjct  1239  AAVLFLGVQNASSVQPVVAIERTVFYRERAAGMYSALPYAFGQVAIEIPYILIQSLIYGV  1298

Query  3847  IVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLF  4026
             IVYAMI FEWTAAKF W++FFMYFTLLYFT YGMM V +TPN NIA+I+SSAFY  WNLF
Sbjct  1299  IVYAMIAFEWTAAKFFWYMFFMYFTLLYFTFYGMMAVGLTPNQNIASIVSSAFYAIWNLF  1358

Query  4027  SGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdh  4206
             SGFIIP+ RIPVWWRWYY+ CPVSWTLYGL+ASQFGDV  +LDT   V DFV+S+F F H
Sbjct  1359  SGFIIPRPRIPVWWRWYYWACPVSWTLYGLVASQFGDVHHQLDTGVEVADFVRSYFGFRH  1418

Query  4207  dfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             DF+G VA ++V   V+F F+F FSIK  NFQ R
Sbjct  1419  DFLGVVAAVVVAFPVLFAFLFGFSIKMLNFQRR  1451



>ref|XP_009334794.1| PREDICTED: pleiotropic drug resistance protein 1-like [Pyrus 
x bretschneideri]
Length=1412

 Score =  2125 bits (5505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1031/1435 (72%), Positives = 1232/1435 (86%), Gaps = 23/1435 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +W+++ +EVFS SSR   +D+E  L WAAIE+LPTYLR RRG+LA EE  G  +EIDV  
Sbjct  1     MWKNTSMEVFSMSSRHEEDDEES-LTWAAIERLPTYLRTRRGLLAEEE--GKAREIDVTN  57

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+++LLERLV+IA+EDNE FLLKLK R +RVG++ PT EVRFEHLNV+AE YVG R
Sbjct  58    LGLLERKNLLERLVKIAEEDNEKFLLKLKDRMNRVGLEYPTTEVRFEHLNVEAETYVGGR  117

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FNF+ N+LE  +NYLHILP+RK+ LPIL+DVSGIIKP RMTLLLGPP SGKTTLL
Sbjct  118   ALPTMFNFSINMLELLLNYLHILPSRKQQLPILNDVSGIIKPKRMTLLLGPPGSGKTTLL  177

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK+SGRVTYNGH M EF+P RTSAYI+QHDLHI E+TVRET+AFSARCQG
Sbjct  178   LALAGKLGKDLKLSGRVTYNGHGMEEFIPERTSAYISQHDLHIPELTVRETMAFSARCQG  237

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYE+L ELSRREK  NIKPDPD+DVYMKA ++EGQE +VVTDYI+K+LGL++CAD +
Sbjct  238   VGPRYEVLVELSRREKAENIKPDPDLDVYMKAAALEGQETNVVTDYIIKVLGLDICADTM  297

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD M RGISGGQRKRLTTGEMLVGPA+ALFMDEISTGLDSSTT+ IVNS+RQSIHIL G
Sbjct  298   VGDHMRRGISGGQRKRLTTGEMLVGPAKALFMDEISTGLDSSTTYHIVNSLRQSIHILNG  357

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSDG +VYQGPR+NVLEFF+HMGFKCPERKGVADFLQE
Sbjct  358   TALISLLQPAPETYDLFDDIILLSDGHIVYQGPRENVLEFFEHMGFKCPERKGVADFLQE  417

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW ++E+ Y F+T  EF+EA QSFH+G++LGDELA+PFDKSK +PA+L+ K
Sbjct  418   VTSRKDQEQYWAQKEKPYSFVTSDEFAEALQSFHIGRELGDELAIPFDKSKGNPASLTTK  477

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKEL KAC SR+ LLMKRNSF+YIFKMIQ  LMA V MT+FLRTEM + S+ DG 
Sbjct  478   KYGVSKKELYKACMSRQILLMKRNSFIYIFKMIQFSLMALVTMTLFLRTEMHRGSVEDGG  537

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MG+LFF +++ MFNG+SELA+++++LP ++KQRDL FFP WAYALP  +++IP+T+VE
Sbjct  538   IYMGSLFFTMLIIMFNGYSELAMTVMRLPVYFKQRDLLFFPSWAYALPNCLIRIPLTIVE  597

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V+IWV +TYY IG+DP  GRFFKQ  LL+C++QMA+ LFRL AA GRS IVANTFGS A+
Sbjct  598   VSIWVTVTYYVIGYDPSIGRFFKQFLLLLCISQMANGLFRLIAAIGRSPIVANTFGSAAL  657

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             ++V VLGGFILSRD++KKW +WGYW+SP+ Y  NA+++NE+LGKSWRHVP+ ++E LGV 
Sbjct  658   VVVFVLGGFILSRDNMKKWLLWGYWLSPMTYGMNALAINEFLGKSWRHVPANSTEPLGVL  717

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             V++SRG+ PEA WYW+GV AL+G++ L NFLF LAL YL+P+ KPQA++S+E LA++ A 
Sbjct  718   VMKSRGVLPEARWYWLGVVALLGFILLFNFLFTLALQYLDPIDKPQAVMSKEALAKKLAK  777

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K G+  EL L    + E  +                    A+ N KRGMVLPFEPL ITF
Sbjct  778   KTGDTTELSLTRNESQENMS--------------------ANRNRKRGMVLPFEPLSITF  817

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             +EI+YAVDMP EMKA+G+TE+RL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  818   NEIRYAVDMPQEMKAEGITENRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  877

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+I ISGYPK QETFARI+GYCEQTDIHSPHVTVYE+LVYSAWLRLPPE+D+ T
Sbjct  878   TGGYIEGNINISGYPKNQETFARISGYCEQTDIHSPHVTVYEALVYSAWLRLPPEVDSPT  937

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELTS++EALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  938   RKMFIEEVMELVELTSIKEALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  997

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIYVGPLG  SS
Sbjct  998   DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYVGPLGHQSS  1057

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI YFE I+G+ ++RD +NPATWMLE+TS  QE ALG+ F+++Y+NSELYR NK LI+E
Sbjct  1058  DLINYFEGISGVSKLRDSHNPATWMLEVTSAGQEEALGVSFSDIYKNSELYRSNKVLIKE  1117

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P P S+DL+F TKYSQSFF QC+ACLWKQHWSYWRNP Y+AVRLL+T   AL+FGT+
Sbjct  1118  LSTPPPNSRDLHFSTKYSQSFFNQCIACLWKQHWSYWRNPSYSAVRLLYTAMMALVFGTI  1177

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FWG+G KR  QQD+ NAMG MY+AV+F+GVQNA+SVQPVV IER VFYRERAAGMYSA+P
Sbjct  1178  FWGLGSKRNNQQDVLNAMGSMYSAVLFIGVQNASSVQPVVGIERIVFYRERAAGMYSAIP  1237

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YA GQ++IELP+   QT+IYG+IVY MIGF+WT +KFLW++FFMYFT LY+TLYGMM V 
Sbjct  1238  YALGQIIIELPYTLFQTIIYGLIVYTMIGFDWTVSKFLWYLFFMYFTFLYYTLYGMMIVG  1297

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPN  IAA+ SSA Y  WN+FSGF+IP+TRIP+WWRW+Y++CPVSWTLYGL+ SQFG +
Sbjct  1298  ITPNTTIAAVASSAVYPLWNVFSGFVIPRTRIPIWWRWFYWVCPVSWTLYGLLTSQFGGI  1357

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K+ LD+ ETV+DF+K +F +   F+G VA + VGI V+FGFIFA SIKAFNFQ R
Sbjct  1358  KDTLDSGETVEDFIKDYFGYREGFLGVVAIVHVGISVLFGFIFALSIKAFNFQKR  1412



>gb|KGN62906.1| hypothetical protein Csa_2G379370 [Cucumis sativus]
Length=1404

 Score =  2123 bits (5501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1021/1365 (75%), Positives = 1197/1365 (88%), Gaps = 6/1365 (0%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIEKLPTYLRIRRGIL  +EE G  +EID+ K+G+ E+R +LERLV+IA+EDNE F
Sbjct  17    LKWAAIEKLPTYLRIRRGIL--KEEQGEAREIDIRKIGLLERRHVLERLVKIAEEDNEEF  74

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKL+ R +RVG+++PTIEVRFEHLNV+AE YVG RALPT+FNF+ NILE  +NYLHILP
Sbjct  75    LLKLRGRIERVGLEIPTIEVRFEHLNVEAEVYVGRRALPTMFNFSLNILEGLLNYLHILP  134

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             ++KK L +LHDVSGIIKP RMTLLLGPPSSGKTTLLLALAGKL  DLK SG+V+YNGH M
Sbjct  135   SKKKSLSVLHDVSGIIKPKRMTLLLGPPSSGKTTLLLALAGKLGKDLKFSGKVSYNGHGM  194

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI+QHDLHIGEMTVRETLAFSARCQGVG RYEMLAELSRREK  NIKPDP
Sbjct  195   EEFVPQRTSAYISQHDLHIGEMTVRETLAFSARCQGVGPRYEMLAELSRREKAANIKPDP  254

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             D+D+YMKA ++EGQE +++TDYILKILGLE+CAD LVGDEMIRGISGGQRKRLTTGEMLV
Sbjct  255   DLDIYMKAEALEGQETNIITDYILKILGLEMCADTLVGDEMIRGISGGQRKRLTTGEMLV  314

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEIS GLDSSTT+QIVNS+RQSIHIL GTAVISLLQPAPET++LFDDIILLS
Sbjct  315   GPARALFMDEISNGLDSSTTYQIVNSLRQSIHILNGTAVISLLQPAPETFDLFDDIILLS  374

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DG +VYQGPR++VL FF HMGFKCPERKGVADFLQEVTSRKDQEQYW  R+E Y F++V 
Sbjct  375   DGHIVYQGPREDVLTFFAHMGFKCPERKGVADFLQEVTSRKDQEQYWAIRDEPYRFVSVK  434

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EFS+AFQSFH+G++LGDELA PF++SK HPA L++KKYGV+KKE+LKAC SRE LLMKRN
Sbjct  435   EFSDAFQSFHIGRELGDELATPFNRSKCHPATLTSKKYGVSKKEVLKACISRELLLMKRN  494

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK+ QL++MA + MT+FLRTE+ ++S  DG ++MGALFF +++ MFNGFSELA++
Sbjct  495   SFVYIFKLFQLIIMALITMTLFLRTELHRDSEIDGGIYMGALFFTLVVIMFNGFSELAMT  554

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             ++KLP FYKQRDL F+P WAYALPTWILKIP+T +EV IWV MTYY IGFDP+  RFFKQ
Sbjct  555   VVKLPVFYKQRDLLFYPSWAYALPTWILKIPITCLEVGIWVVMTYYVIGFDPNIERFFKQ  614

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL C+NQMAS LFRL A  GR VIVA T  + A+ +V+VLGGFI++R+DV  WW+WGY
Sbjct  615   FLLLFCINQMASGLFRLAAGLGRDVIVATTCATLALPVVMVLGGFIVAREDVHSWWLWGY  674

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W+SP+MY QNAI+VNE+LG SWRHVPS +SE LG+++L+SRGIFPEA+WYWIGVGA +GY
Sbjct  675   WVSPMMYGQNAIAVNEFLGNSWRHVPSNSSEPLGISILKSRGIFPEAYWYWIGVGATIGY  734

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             V + NFLF LAL YL+P G+ QA+LSE+TLAE+NA + G+ IE   K     E  +    
Sbjct  735   VLVFNFLFILALHYLDPFGQAQAVLSEDTLAEKNANRTGK-IEQPKKTNIFFETESQNMP  793

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
             S +  +       V   D    RGMVLP+EP  ITFDEI+YAVDMP EMKAQG+ ED+L 
Sbjct  794   SRTLATSVGSTNEVKHND---NRGMVLPYEPHSITFDEIRYAVDMPQEMKAQGVVEDKLE  850

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGG+ +G +TISG+PKRQETFARI
Sbjct  851   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGFTDGKVTISGFPKRQETFARI  910

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQTDIHSPHVTVYESL+YSAWLRLP ++D+AT+ MF++EVM+L+ELT LR++LVGL
Sbjct  911   SGYCEQTDIHSPHVTVYESLMYSAWLRLPSDVDSATKNMFIKEVMELMELTPLRDSLVGL  970

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGL+TEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  971   PGVNGLTTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1030

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDEL LLKRGGE IYVGP+GRHSS LI YFE I G+ +I+DGYNPATW
Sbjct  1031  TIHQPSIDIFDAFDELFLLKRGGEAIYVGPIGRHSSHLIEYFEGIEGVPKIKDGYNPATW  1090

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             ML+ITS AQEAALG++F ++YRNSELYRRNKALI+ELS P+PGSKDL FPT+YSQSF  Q
Sbjct  1091  MLDITSPAQEAALGVNFTDIYRNSELYRRNKALIKELSMPSPGSKDLLFPTQYSQSFLNQ  1150

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQH SYWRNPPYT VRL+F TF A+LFGT+FW +G +R+T+QD+FNA+G MY A
Sbjct  1151  CMACLWKQHLSYWRNPPYTVVRLIFATFVAILFGTIFWDLGSRRKTRQDVFNAIGSMYVA  1210

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+F+G QN++SVQPVVAIERTVFYRERAAGMYSALPYAFGQ+VIELP++F+Q+ IY VIV
Sbjct  1211  VLFIGTQNSSSVQPVVAIERTVFYRERAAGMYSALPYAFGQIVIELPYVFIQSTIYSVIV  1270

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             YAMIGFEWTA KF W++FFMYFTLLYFT YGMM VA+TPNH I++I+S++FY  WN+FSG
Sbjct  1271  YAMIGFEWTAIKFFWYLFFMYFTLLYFTFYGMMAVAITPNHQISSIVSASFYAIWNVFSG  1330

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNET  4167
             F+IP+TRIP+WWRWY++ CPVSWTLYGL+ASQFGDV+E L + ET
Sbjct  1331  FLIPRTRIPIWWRWYFWGCPVSWTLYGLVASQFGDVEETLQSGET  1375


 Score =   120 bits (302),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 137/609 (22%), Positives = 259/609 (43%), Gaps = 54/609 (9%)
 Frame = +1

Query  2587  LVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGY-IEGSITISGYPKRQETF  2763
             L +L  ++G  +P  +T L+G   +GKTTL+  LAG+        G ++ +G+   +   
Sbjct  140   LSVLHDVSGIIKPKRMTLLLGPPSSGKTTLLLALAGKLGKDLKFSGKVSYNGHGMEEFVP  199

Query  2764  ARIAGYCEQTDIHSPHVTVYESLVYSAW----------------------LRLPPEIDTA  2877
              R + Y  Q D+H   +TV E+L +SA                       ++  P++D  
Sbjct  200   QRTSAYISQHDLHIGEMTVRETLAFSARCQGVGPRYEMLAELSRREKAANIKPDPDLDIY  259

Query  2878  TR---------EMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSI  3030
              +          +  + ++ ++ L    + LVG   + G+S  QRKRLT    LV     
Sbjct  260   MKAEALEGQETNIITDYILKILGLEMCADTLVGDEMIRGISGGQRKRLTTGEMLVGPARA  319

Query  3031  IFMDEPTSGLDARAAAIVMRTVRNTVDT-GRTVVCTIHQPSIDIFDAFDELLLLKRGGEE  3207
             +FMDE ++GLD+     ++ ++R ++     T V ++ QP+ + FD FD+++LL   G  
Sbjct  320   LFMDEISNGLDSSTTYQIVNSLRQSIHILNGTAVISLLQPAPETFDLFDDIILLS-DGHI  378

Query  3208  IYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITS-EAQEAALGI-----DFAE  3369
             +Y GP       ++ +F  +      R G   A ++ E+TS + QE    I      F  
Sbjct  379   VYQGP----REDVLTFFAHMGFKCPERKGV--ADFLQEVTSRKDQEQYWAIRDEPYRFVS  432

Query  3370  VYRNSELYRR---NKALIQELSKPAPGSK---DLYFPTKYSQSFFTQCMACLWKQHWSYW  3531
             V   S+ ++     + L  EL+ P   SK         KY  S      AC+ ++     
Sbjct  433   VKEFSDAFQSFHIGRELGDELATPFNRSKCHPATLTSKKYGVSKKEVLKACISRELLLMK  492

Query  3532  RNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQ  3711
             RN      +L      AL+  T+F      R ++ D    MG ++  +V + + N  S  
Sbjct  493   RNSFVYIFKLFQLIIMALITMTLFLRTELHRDSEIDGGIYMGALFFTLVVI-MFNGFSEL  551

Query  3712  PVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKF  3891
              +  ++  VFY++R    Y +  YA    ++++P   ++  I+ V+ Y +IGF+    +F
Sbjct  552   AMTVVKLPVFYKQRDLLFYPSWAYALPTWILKIPITCLEVGIWVVMTYYVIGFDPNIERF  611

Query  3892  LWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWR  4071
                   ++      +    +   +  +  +A   ++       +  GFI+ +  +  WW 
Sbjct  612   FKQFLLLFCINQMASGLFRLAAGLGRDVIVATTCATLALPVVMVLGGFIVAREDVHSWWL  671

Query  4072  WYYYICPVSWTLYGLIASQF-GDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGIC  4248
             W Y++ P+ +    +  ++F G+    + +N +    +            Y   I VG  
Sbjct  672   WGYWVSPMMYGQNAIAVNEFLGNSWRHVPSNSSEPLGISILKSRGIFPEAYWYWIGVGAT  731

Query  4249  VMFGFIFAF  4275
             + +  +F F
Sbjct  732   IGYVLVFNF  740



>ref|XP_009401814.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=1455

 Score =  2123 bits (5500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1054/1441 (73%), Positives = 1229/1441 (85%), Gaps = 9/1441 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR     +FS SSRE  +++   LKWAA+EKLPT+ R+RRGILA  E     +E+DV++
Sbjct  18    IWRRGNESIFSASSREEDDEEA--LKWAALEKLPTFDRLRRGILALPEGSQRLQEVDVQQ  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+++LLERLVR+  EDNE FLLKLK R DRVGIDLPTIEVRFEHLN+ AEA+VGSR
Sbjct  76    LGFRERKALLERLVRVTDEDNERFLLKLKDRVDRVGIDLPTIEVRFEHLNIQAEAHVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
              LPTI N   N LE+  NYLHILP+RK+PL ILHDVSGIIKP RMTLLLGPP SGKTTLL
Sbjct  136   GLPTILNSALNTLESIANYLHILPSRKRPLSILHDVSGIIKPRRMTLLLGPPGSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL SDLK +G+ TYNGHEM EFVP+RT+AYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  196   LALAGKLSSDLKATGKTTYNGHEMNEFVPQRTAAYISQHDLHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML EL+RREKE NIKPDPDIDV+MKA S+ GQE++++TDY+LKILGLEVC+D +
Sbjct  256   VGTRYEMLTELARREKEANIKPDPDIDVFMKAASMGGQESNLITDYVLKILGLEVCSDTM  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQIVNS+RQS+HIL G
Sbjct  316   VGDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSLRQSVHILGG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDDIILLSDGQVVYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  376   TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRENVLEFFESMGFKCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ+QYW R +E Y ++ V EF++AFQSFHVG+ +GDEL+VP+DKSKSHPAAL+  
Sbjct  436   VTSRKDQQQYWTRHDEPYRYVPVREFADAFQSFHVGRVIGDELSVPYDKSKSHPAALTTS  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             +YGV+KKELLKA   RE LLMKRNSFVYIFK  QL +MA +AMTVFLRT M ++S+ +G 
Sbjct  496   RYGVSKKELLKANIDRELLLMKRNSFVYIFKATQLTIMALIAMTVFLRTNMHRDSVTEGG  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFF V+M MFNGFSE A++ILKLP F+KQRDL F+P W+YA+P+WILKIP++  E
Sbjct  556   LYMGALFFGVVMVMFNGFSETAMTILKLPVFFKQRDLLFYPAWSYAIPSWILKIPISFAE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV  TYY IGFDP+ GR FKQ  LL+ +NQMAS+LFR   A GR++IVANTFGS A+
Sbjct  616   VAVWVFTTYYVIGFDPNVGRLFKQYMLLLLINQMASSLFRFIGAVGRNMIVANTFGSFAL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +++LVLGGFILSRD VKKWWIWGYWISPLMYAQNAISVNE+LG SW+H    +SE LGV+
Sbjct  676   LILLVLGGFILSRDQVKKWWIWGYWISPLMYAQNAISVNEFLGHSWQHSLPNSSEPLGVS  735

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRG+FPEA WYWIG GAL+GY+FL N LF +ALTYL P GK Q  +SEE+L E++A 
Sbjct  736   VLKSRGVFPEAKWYWIGFGALIGYIFLFNALFSVALTYLKPFGKSQPPVSEESLKEKHAN  795

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
               GE  E   +G ++ +           R  +S        D N K+GMVLPF PL ITF
Sbjct  796   LTGEVSEQSSRGRNSVDHSQSKSADGLRRDGTSSGSMNVAIDQN-KKGMVLPFTPLSITF  854

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D I+Y+VDMP EMK QG+ EDRL LLKGI+G+FRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  855   DNIRYSVDMPQEMKDQGVVEDRLELLKGISGSFRPGVLTALMGVSGAGKTTLMDVLAGRK  914

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+ITISGYPK+QETFAR++GYCEQ DIHSPHVTVYESLVYSAWLRLP E+++AT
Sbjct  915   TGGYIEGNITISGYPKKQETFARVSGYCEQNDIHSPHVTVYESLVYSAWLRLPAEVNSAT  974

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFV+EVM+LVELT LR+ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  975   RKMFVDEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1034

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLG +S 
Sbjct  1035  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGHNSC  1094

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI YFE ING+ +I+DGYNPATWMLE++S+AQE  LG++F+E+Y+NSELY+RNK LI+E
Sbjct  1095  HLINYFEGINGVSKIKDGYNPATWMLEVSSQAQEDILGVNFSEIYKNSELYQRNKDLIKE  1154

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGS DLYFPT+YSQS   QCMACLWKQH SYWRNPPYTAVR  FT   ALLFGT+
Sbjct  1155  LSTPPPGSSDLYFPTQYSQSILVQCMACLWKQHLSYWRNPPYTAVRFFFTLIIALLFGTI  1214

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR T+QDL NAMG MYAAV+F+GVQN++SVQPVVAIERTVFYRERAAGMYSA+P
Sbjct  1215  FWDLGTKRDTKQDLLNAMGSMYAAVLFIGVQNSSSVQPVVAIERTVFYRERAAGMYSAVP  1274

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV IE+P++ VQ L+YGVIVYAMIGFEWTAAKF W++FFMYFTLLYFT YGMM V 
Sbjct  1275  YAFGQVAIEIPYILVQALLYGVIVYAMIGFEWTAAKFFWYMFFMYFTLLYFTFYGMMAVG  1334

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPN+NIA+I+S+AFY  WNLFSGFIIP+ RIPVWWRWYY+ICPV+WTLYGL+ASQFGD+
Sbjct  1335  LTPNYNIASIVSAAFYAIWNLFSGFIIPRPRIPVWWRWYYWICPVAWTLYGLVASQFGDI  1394

Query  4141  KEKLDTNET------vkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQT  4302
             + +  ++E+      V DFV+++F F H F+G VA ++V   V+F F+FAFSIK  NFQ 
Sbjct  1395  QTRFASDESGEPGEIVADFVRNYFGFKHSFLGVVAVVVVAFPVLFAFLFAFSIKTLNFQK  1454

Query  4303  R  4305
             R
Sbjct  1455  R  1455



>ref|XP_009401806.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=1456

 Score =  2122 bits (5497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1056/1441 (73%), Positives = 1234/1441 (86%), Gaps = 8/1441 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR     +FS SSRE  +++   LKWAA+EKLPT+ R+RRGILA  E     +E+DV++
Sbjct  18    IWRRGNESIFSASSREEDDEEA--LKWAALEKLPTFDRLRRGILALPEGSQRLQEVDVQQ  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+++LLERLVR+  EDNE FLLKLK R DRVGIDLPTIEVRFEHLN+ AEA+VGSR
Sbjct  76    LGFRERKALLERLVRVTDEDNERFLLKLKDRVDRVGIDLPTIEVRFEHLNIQAEAHVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
              LPTI N   N LE+  NYLHILP+RK+PL ILHDVSGIIKP RMTLLLGPP SGKTTLL
Sbjct  136   GLPTILNSALNTLESIANYLHILPSRKRPLSILHDVSGIIKPRRMTLLLGPPGSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL SDLK +G+ TYNGHEM EFVP+RT+AYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  196   LALAGKLSSDLKATGKTTYNGHEMNEFVPQRTAAYISQHDLHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML EL+RREKE NIKPDPDIDV+MKA S+ GQE++++TDY+LKILGLEVC+D +
Sbjct  256   VGTRYEMLTELARREKEANIKPDPDIDVFMKAASMGGQESNLITDYVLKILGLEVCSDTM  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQIVNS+RQS+HIL G
Sbjct  316   VGDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSLRQSVHILGG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDDIILLSDGQVVYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  376   TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRENVLEFFESMGFKCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ+QYW R +E Y ++ V EF++AFQSFHVG+ +GDEL+VP+DKSKSHPAAL+  
Sbjct  436   VTSRKDQQQYWTRHDEPYRYVPVREFADAFQSFHVGRVIGDELSVPYDKSKSHPAALTTS  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             +YGV+KKELLKA   RE LLMKRNSFVYIFK  QL +MA +AMTVFLRT M ++S+ +G 
Sbjct  496   RYGVSKKELLKANIDRELLLMKRNSFVYIFKATQLTIMALIAMTVFLRTNMHRDSVTEGG  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFF V+M MFNGFSE A++ILKLP F+KQRDL F+P W+YA+P+WILKIP++  E
Sbjct  556   LYMGALFFGVVMVMFNGFSETAMTILKLPVFFKQRDLLFYPAWSYAIPSWILKIPISFAE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV  TYY IGFDP+ GR FKQ  LL+ +NQMAS+LFR   A GR++IVANTFGS A+
Sbjct  616   VAVWVFTTYYVIGFDPNVGRLFKQYMLLLLINQMASSLFRFIGAVGRNMIVANTFGSFAL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +++LVLGGFILSRD VKKWWIWGYWISPLMYAQNAISVNE+LG SW+H    +SE LGV+
Sbjct  676   LILLVLGGFILSRDQVKKWWIWGYWISPLMYAQNAISVNEFLGHSWQHSLPNSSEPLGVS  735

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRG+FPEA WYWIG GAL+GY+FL N LF +ALTYL P GK Q  +SEE+L E++A 
Sbjct  736   VLKSRGVFPEAKWYWIGFGALIGYIFLFNALFSVALTYLKPFGKSQPPVSEESLKEKHAN  795

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
               GE  E   +G ++ +     + +   R   +  GS+NVA    K+GMVLPF PL ITF
Sbjct  796   LTGEVSEQSSRGRNSVDHSQSKKGADGLRRDGTSSGSMNVAIDQNKKGMVLPFTPLSITF  855

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D I+Y+VDMP EMK QG+ EDRL LLKGI+G+FRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  856   DNIRYSVDMPQEMKDQGVVEDRLELLKGISGSFRPGVLTALMGVSGAGKTTLMDVLAGRK  915

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+ITISGYPK+QETFAR++GYCEQ DIHSPHVTVYESLVYSAWLRLP E+++AT
Sbjct  916   TGGYIEGNITISGYPKKQETFARVSGYCEQNDIHSPHVTVYESLVYSAWLRLPAEVNSAT  975

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFV+EVM+LVELT LR+ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  976   RKMFVDEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1035

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLG +S 
Sbjct  1036  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGHNSC  1095

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI YFE ING+ +I+DGYNPATWMLE++S+AQE  LG++F+E+Y+NSELY+RNK LI+E
Sbjct  1096  HLINYFEGINGVSKIKDGYNPATWMLEVSSQAQEDILGVNFSEIYKNSELYQRNKDLIKE  1155

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGS DLYFPT+YSQS   QCMACLWKQH SYWRNPPYTAVR  FT   ALLFGT+
Sbjct  1156  LSTPPPGSSDLYFPTQYSQSILVQCMACLWKQHLSYWRNPPYTAVRFFFTLIIALLFGTI  1215

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR T+QDL NAMG MYAAV+F+GVQN++SVQPVVAIERTVFYRERAAGMYSA+P
Sbjct  1216  FWDLGTKRDTKQDLLNAMGSMYAAVLFIGVQNSSSVQPVVAIERTVFYRERAAGMYSAVP  1275

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV IE+P++ VQ L+YGVIVYAMIGFEWTAAKF W++FFMYFTLLYFT YGMM V 
Sbjct  1276  YAFGQVAIEIPYILVQALLYGVIVYAMIGFEWTAAKFFWYMFFMYFTLLYFTFYGMMAVG  1335

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPN+NIA+I+S+AFY  WNLFSGFIIP+ RIPVWWRWYY+ICPV+WTLYGL+ASQFGD+
Sbjct  1336  LTPNYNIASIVSAAFYAIWNLFSGFIIPRPRIPVWWRWYYWICPVAWTLYGLVASQFGDI  1395

Query  4141  KEKLDTNET------vkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQT  4302
             + +  ++E+      V DFV+++F F H F+G VA ++V   V+F F+FAFSIK  NFQ 
Sbjct  1396  QTRFASDESGEPGEIVADFVRNYFGFKHSFLGVVAVVVVAFPVLFAFLFAFSIKTLNFQK  1455

Query  4303  R  4305
             R
Sbjct  1456  R  1456



>ref|XP_008361068.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Malus domestica]
Length=1424

 Score =  2122 bits (5497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1030/1435 (72%), Positives = 1228/1435 (86%), Gaps = 23/1435 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ +EVFS SSR   +D+E  L WAAIE+LPTYLR RRG+LA EE  G  +EIDV  
Sbjct  13    MWRNTSMEVFSMSSRHEEDDEES-LTWAAIERLPTYLRTRRGLLAEEE--GKAREIDVTN  69

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+++LLERL++IA+EDNE FLLKLK R +RVG++ PT EVRFEHLNV+AEAYVG R
Sbjct  70    LGLLERKNLLERLIKIAEEDNEKFLLKLKDRMNRVGLEYPTTEVRFEHLNVEAEAYVGGR  129

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FNF+ N+LE F+NYLHILP+RK+ LPIL+DVSGIIKP RMTLLLGPP SGKTTLL
Sbjct  130   ALPTMFNFSINMLELFLNYLHILPSRKQQLPILNDVSGIIKPKRMTLLLGPPGSGKTTLL  189

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK+SGRVTYNGH M EF+P RTSAYI+QHDLHI E+TVRET+AFSARCQG
Sbjct  190   LALAGKLGKDLKLSGRVTYNGHGMEEFIPERTSAYISQHDLHIPELTVRETMAFSARCQG  249

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML ELSRREK  NIKPDPD+DVYMKA ++EGQE +VVTDYI+K+LGL++CAD L
Sbjct  250   VGPRYEMLVELSRREKAANIKPDPDLDVYMKAAALEGQETNVVTDYIIKVLGLDICADTL  309

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD M RG+SGGQRKRLTTGEMLVGPA+ALFMDEISTGLDSSTT+ IVNS+RQSIHIL G
Sbjct  310   VGDHMRRGVSGGQRKRLTTGEMLVGPAKALFMDEISTGLDSSTTYHIVNSLRQSIHILNG  369

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSDG +VYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  370   TALISLLQPAPETYDLFDDIILLSDGHIVYQGPRENVLEFFEQMGFKCPERKGVADFLQE  429

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  +E+ Y F+T  EF+EA QSFH+G++LGDELA+PFDKSK +PA+L+ K
Sbjct  430   VTSRKDQEQYWAHKEKPYSFVTSDEFAEALQSFHIGRELGDELAIPFDKSKGNPASLTTK  489

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKEL KAC SR+ LLMKRNSF+YIFKMIQ  LMA V MT+FLRTEM + S+ DG 
Sbjct  490   KYGVGKKELYKACMSRQILLMKRNSFIYIFKMIQFSLMALVTMTLFLRTEMHRGSVEDGG  549

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MG+LFF +++ MF+G+SELA+++++LP F+KQRDL FFP WAYALP  +++IP+T+VE
Sbjct  550   IYMGSLFFTIVIIMFSGYSELAMTVMRLPVFFKQRDLLFFPAWAYALPNCLIRIPLTIVE  609

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V+IWV +TYY IG+DP+ GRFFKQ   L+C++QMA+ LFRL AA GRS IVANTFGS A+
Sbjct  610   VSIWVTVTYYVIGYDPNIGRFFKQFLSLLCISQMANGLFRLIAAIGRSPIVANTFGSAAL  669

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             ++V VLGGFILSRD +KKW +WGYW+SP+ Y  NA++VNE+LGKSWRHVP+ ++E LGV 
Sbjct  670   LVVFVLGGFILSRDSMKKWLLWGYWLSPMAYGMNALAVNEFLGKSWRHVPANSTEPLGVL  729

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             V++SRG+ PEA WYW+GV AL+G++ L NFLF LAL YL+P+ KPQA++S+E LA++ A 
Sbjct  730   VMKSRGVLPEARWYWLGVVALLGFILLFNFLFTLALQYLDPIDKPQAVMSKEALAKKLAK  789

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K G+  EL L    + E  +                    A+   KRGMVLPFEPL ITF
Sbjct  790   KTGDTTELSLTRNESQENMS--------------------ANRTRKRGMVLPFEPLSITF  829

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             +EI+YAVDMP EMKA+G+TE+RL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  830   NEIRYAVDMPQEMKAEGITENRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  889

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+ITISGYPK QETFARI+GYCEQTDIHSPHVTVYE+L+YSAWLRLPPE+D+ T
Sbjct  890   TGGYIEGNITISGYPKNQETFARISGYCEQTDIHSPHVTVYEALIYSAWLRLPPEVDSPT  949

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELTS+ EALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  950   RKMFIEEVMELVELTSIXEALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1009

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIYVGPLG HSS
Sbjct  1010  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYVGPLGHHSS  1069

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI YFE I+G+ ++RD +NPATWMLE+TS  Q+ ALG+ F+++Y+NSEL+RRNK LI+E
Sbjct  1070  DLINYFEGISGVSKLRDSHNPATWMLEVTSAGQQEALGVSFSDIYKNSELHRRNKVLIKE  1129

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P P S+DL+F T+YSQSFF QC+ACLWKQHWSYWRNP Y+AVRLL+T   AL+FGT+
Sbjct  1130  LSTPPPNSRDLHFSTQYSQSFFNQCIACLWKQHWSYWRNPSYSAVRLLYTAMMALVFGTI  1189

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FWG+G KR  QQD+ NAMG MY+AV+F+G+QNA+SVQPVV IER VFYRERAAGMYSA P
Sbjct  1190  FWGLGSKRNNQQDVLNAMGSMYSAVLFIGIQNASSVQPVVGIERIVFYRERAAGMYSAFP  1249

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YA GQ++IELP+   QT+IYG+IVY MIGF+WT  KFLW++FFMYFT LY+TLYGMM V 
Sbjct  1250  YALGQIIIELPYTLFQTIIYGLIVYTMIGFDWTVGKFLWYLFFMYFTFLYYTLYGMMIVG  1309

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPN  IAA+ SSA Y  WN+FSGFIIP+TRIP+WWRW+Y++CPVSWTLYGL+ SQFG +
Sbjct  1310  ITPNTTIAAVASSAVYPLWNVFSGFIIPRTRIPIWWRWFYWVCPVSWTLYGLLTSQFGGI  1369

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K+ LD+ ETV+DF+K +F +   F+G VA + VGI V+FGFIFAFSIK  NFQ R
Sbjct  1370  KDTLDSGETVEDFMKDYFGYREGFLGVVAIVHVGISVLFGFIFAFSIKXLNFQKR  1424



>ref|XP_009407444.1| PREDICTED: pleiotropic drug resistance protein 3-like [Musa acuminata 
subsp. malaccensis]
Length=1484

 Score =  2117 bits (5486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1037/1427 (73%), Positives = 1219/1427 (85%), Gaps = 18/1427 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPT+ R+RRGILA  E+GG  +E+++E+LG  EK++L+ERLVR+A EDNE F
Sbjct  40    LKWAALEKLPTFDRVRRGILALAEDGGELQEVNIERLGFREKKALIERLVRVADEDNERF  99

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKL+ R DRVGIDLPTIEVR+EHL+++AE YVG+R LPTIFN T N+LEAF NYL +LP
Sbjct  100   LLKLRDRVDRVGIDLPTIEVRYEHLSIEAETYVGNRGLPTIFNSTLNMLEAFGNYLRVLP  159

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK+PL ILHDVSGIIKP RM LLLGPP SGKTTLLLALAGKL SDLKV+G+VTYNGH+M
Sbjct  160   SRKRPLSILHDVSGIIKPRRMALLLGPPGSGKTTLLLALAGKLSSDLKVTGKVTYNGHDM  219

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
             +EFVP+RT+AYI+Q+DLHIGEMTVRETLAFSARCQGVG RYEML EL+RREK  NIKPDP
Sbjct  220   SEFVPQRTAAYISQYDLHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAANIKPDP  279

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA S++GQEA+V+T+YILKILGLEVCAD +VGDEM+RGISGGQRKR+TTGEMLV
Sbjct  280   DIDVFMKASSMKGQEANVITEYILKILGLEVCADTMVGDEMLRGISGGQRKRVTTGEMLV  339

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQIVNS+RQ+IHIL GTA+ISLLQPAPETY+LFDDIILLS
Sbjct  340   GPARALFMDEISTGLDSSTTFQIVNSLRQTIHILSGTAMISLLQPAPETYDLFDDIILLS  399

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DG +VYQGPRDNVLEFF+ MGF+CPERKGVADFLQEVTSRKDQ+QYW R +E Y ++ V 
Sbjct  400   DGLIVYQGPRDNVLEFFESMGFRCPERKGVADFLQEVTSRKDQQQYWARHDEPYRYVPVR  459

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQSFHVG+ LGDEL+VPFDK+KSHPAAL+  +YGV+KKE+LKA   RE LLMKRN
Sbjct  460   EFAEAFQSFHVGRALGDELSVPFDKTKSHPAALTTTRYGVSKKEVLKANIDRELLLMKRN  519

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVY+FK  QL +MA V+MTVFLRT+MP+ +  DG +++GALFF+V+M MFNGFSELA++
Sbjct  520   SFVYVFKATQLTIMAIVSMTVFLRTKMPRETETDGLIYLGALFFSVVMVMFNGFSELAMT  579

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I+KLP F+KQRDL F+P W+Y +PTWILKIP+  VEVA+WV  TYY IGFDP+ GR FKQ
Sbjct  580   IMKLPVFFKQRDLLFYPAWSYTIPTWILKIPIAFVEVAVWVFTTYYVIGFDPNVGRLFKQ  639

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ + QMASA+FR   A GR++IVANTF S +++++LVLGGFILSR+ VKKWWIWGY
Sbjct  640   YLLLLGITQMASAVFRTIGALGRNMIVANTFASLSLLILLVLGGFILSREQVKKWWIWGY  699

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             WISPL YAQNAISVNE++G +W+H   G++E+LGV VL+SRG+FPEA WYWIG GALVGY
Sbjct  700   WISPLTYAQNAISVNEFMGNNWKHTAPGSNESLGVRVLKSRGVFPEARWYWIGFGALVGY  759

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             V L N LF LAL+YL+P GK Q  +SEETL E++    GE +E   +G  + +      +
Sbjct  760   VLLFNALFTLALSYLDPFGKSQPPISEETLKEKHINLTGEGLESSSRGRKSIDHSASKSK  819

Query  2413  svssrslssrvgsvnvADPNM-----------------KRGMVLPFEPLCITFDEIKYAV  2541
             S               ++  M                 +RGMVLPF PL ITFD+I+Y+V
Sbjct  820   SRGHAKSMLSKSRRAGSENGMRRKDSSLGSMKAAFDQNRRGMVLPFTPLSITFDDIRYSV  879

Query  2542  DMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEG  2721
             DMP EMKAQG+ EDRL LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYIEG
Sbjct  880   DMPQEMKAQGVAEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG  939

Query  2722  SITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEE  2901
             +I ISGYPK+QETFARI+GYCEQ DIHSPHVTVYES+VYSAWLRLPPE+D+ TR+MFV+E
Sbjct  940   NINISGYPKKQETFARISGYCEQNDIHSPHVTVYESIVYSAWLRLPPEVDSETRKMFVDE  999

Query  2902  VMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAI  3081
             VM+LVELT LR+ALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAI
Sbjct  1000  VMELVELTPLRDALVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAI  1059

Query  3082  VMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFE  3261
             VMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL LLKRGGEEIY GPLGRHS  LI YFE
Sbjct  1060  VMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLLKRGGEEIYAGPLGRHSCHLIDYFE  1119

Query  3262  TINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPG  3441
              ING+ +I+DGYNPATWMLE+T++AQE  LG+DF++VY+NSELY+RNK LIQELS P PG
Sbjct  1120  GINGVSKIKDGYNPATWMLEVTTQAQEGILGVDFSQVYKNSELYQRNKRLIQELSIPPPG  1179

Query  3442  SKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPK  3621
             S DLYFPT+YSQ    QCMACLWKQH SYWRNPPYTAVR  FTT  ALLFGT+FW +G K
Sbjct  1180  SSDLYFPTQYSQPMAVQCMACLWKQHLSYWRNPPYTAVRFFFTTIIALLFGTIFWDLGSK  1239

Query  3622  RRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVV  3801
                + DLFNAMG MYAAV+F+GVQN +SVQPVVA+ERTVFYRERAAGMYSALPYAFGQVV
Sbjct  1240  TSKKIDLFNAMGSMYAAVIFIGVQNCSSVQPVVAVERTVFYRERAAGMYSALPYAFGQVV  1299

Query  3802  IELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNI  3981
             IELP++ +Q+++YGVIVYAMI FEWT  KF W+IFFMYFTLLYFT YGMMTV +TPNHNI
Sbjct  1300  IELPYVLIQSILYGVIVYAMIAFEWTVVKFFWYIFFMYFTLLYFTFYGMMTVGITPNHNI  1359

Query  3982  AAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKL-DT  4158
             AAI+S+AFYG WNLFSGFI+P+ RIP+WWRWYY+ CPV+WTLYGL+ SQFGD++E+L DT
Sbjct  1360  AAIVSAAFYGLWNLFSGFIVPRPRIPIWWRWYYWACPVAWTLYGLVTSQFGDIEERLEDT  1419

Query  4159  NETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQ  4299
              E V DF++S+F F H F+G VA ++V   ++F F+FAFSIK  NF+
Sbjct  1420  GEVVSDFLRSYFGFKHSFLGVVAVMVVAFPLLFAFLFAFSIKMLNFK  1466



>ref|XP_007023982.1| Pleiotropic drug resistance 12 [Theobroma cacao]
 gb|EOY26604.1| Pleiotropic drug resistance 12 [Theobroma cacao]
Length=1463

 Score =  2117 bits (5484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1044/1444 (72%), Positives = 1235/1444 (86%), Gaps = 13/1444 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WRS+ VE FSRSSR+  +++   LKWAA+EKLPT  R+R+GIL + +  GG  EIDV  
Sbjct  24    IWRSNTVEAFSRSSRDEDDEEA--LKWAALEKLPTVARLRKGILTSSQ--GGANEIDVHD  79

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EKR+LLERLV++A+EDNE FLLKLK+R DRVGIDLPTIEVRFEHLN+DAEA+VGSR
Sbjct  80    LGWQEKRTLLERLVKVAEEDNEKFLLKLKNRIDRVGIDLPTIEVRFEHLNIDAEAFVGSR  139

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+ NFT +I E F+N + IL +RKK L IL+DVSGIIKP R+TLLLGPPSSGKTTLL
Sbjct  140   ALPTVLNFTTSIFEGFLNEVGILSSRKKHLTILNDVSGIIKPGRLTLLLGPPSSGKTTLL  199

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD  LK SGRVTYNGH M EFVP RT+AYI+Q+DLHIGEMTVRETLAFSARCQG
Sbjct  200   LALAGKLDPALKCSGRVTYNGHGMHEFVPERTAAYISQNDLHIGEMTVRETLAFSARCQG  259

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEMLAELSRREK+ NIKPDPDIDV+MKA++ EGQEA+V+TDYILKILGLE+CAD +
Sbjct  260   VGDRYEMLAELSRREKQANIKPDPDIDVFMKAVATEGQEANVITDYILKILGLEICADTM  319

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKR+TTGEMLVGPA+ALFMDEISTGLDSSTTFQIVNS++Q++HIL G
Sbjct  320   VGDEMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSLKQTVHILNG  379

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDG+VVYQG R++VL FF+ MGF+CPERKGVADFLQE
Sbjct  380   TAVISLLQPAPETYDLFDDIILLSDGRVVYQGRREHVLSFFESMGFRCPERKGVADFLQE  439

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ QYW+RR++ Y F+T  EF+EAFQSFHVG +LGDEL  PF+K+KSHPAAL+ K
Sbjct  440   VTSRKDQMQYWIRRDQPYRFVTANEFAEAFQSFHVGMQLGDELGTPFEKTKSHPAALTTK  499

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV  KEL KAC SRE+LLMKRNSFVYIFK +Q+ +MAF+ MT+FLRTEM ++S+  G 
Sbjct  500   KYGVGLKELAKACISREYLLMKRNSFVYIFKFMQITVMAFITMTLFLRTEMKRDSVEWGQ  559

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFF +I  MFNG SE++++I KLP FYKQRDL FFP WAYALPTWILKIP+T VE
Sbjct  560   IYMGALFFGMITIMFNGMSEISMTIAKLPVFYKQRDLLFFPSWAYALPTWILKIPITFVE  619

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWV +TYY IGFDP+  R F+Q F+L+ VNQMAS LFR  AA GR++IV+NTFGS A+
Sbjct  620   VAIWVFLTYYVIGFDPNVERLFRQYFILVLVNQMASGLFRFIAATGRNMIVSNTFGSFAL  679

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +++  LGGF+LSR+D+KKWWIWGYWISP+MY QNA+ VNE+LG  W HV    +E++G+ 
Sbjct  680   LVLFALGGFVLSREDIKKWWIWGYWISPMMYGQNALMVNEFLGNQWNHVRPNVTESVGIE  739

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLA--ERN  2334
             VL++RG F + HWYWIGVGA++G+  L NF F LALTYLN   KP+A++S+++++  + N
Sbjct  740   VLKARGFFQDPHWYWIGVGAMIGFTLLFNFGFTLALTYLNSFEKPRAVISKDSVSNEQEN  799

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvAD----PNMKRGMVLPFE  2502
                 G  I+L     S+S       +    RS SS+  S+  A      N K+GMVLPFE
Sbjct  800   GVGAGGSIQLSNYESSSSHATKSEIQDDIRRSTSSKSSSMTEATVGALGNKKKGMVLPFE  859

Query  2503  PLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMD  2682
             P  ITFD++ Y+VDMP EMK QG+TEDRLVLLKG++GAFRPGVLTALMG+SGAGKTTLMD
Sbjct  860   PHSITFDDVIYSVDMPQEMKEQGVTEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMD  919

Query  2683  VLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPP  2862
             VLAGRKTGG+I+G+IT+SGYPK+QETFAR++GYCEQ DIHSPHVTVYESL+YSAWLRLP 
Sbjct  920   VLAGRKTGGFIDGNITVSGYPKKQETFARVSGYCEQNDIHSPHVTVYESLLYSAWLRLPA  979

Query  2863  EIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMD  3042
             E++  TR+MF+EEVM+LVEL  LR+ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMD
Sbjct  980   EVNAETRKMFIEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMD  1039

Query  3043  EPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGP  3222
             EPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLL+KRGG+EIYVGP
Sbjct  1040  EPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKRGGQEIYVGP  1099

Query  3223  LGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRN  3402
             LG HS  LI+YFE I G+ +I+DGYNPATWMLE+++ AQE ALG+DFA++Y+NSELYRRN
Sbjct  1100  LGHHSKHLIKYFEGIQGVSKIKDGYNPATWMLEVSTTAQELALGVDFADIYKNSELYRRN  1159

Query  3403  KALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNA  3582
             KALIQ+LSKPAP +K+LYFPT+YSQ F TQC ACLWKQH SYWRNPPYTAVR LFTT  A
Sbjct  1160  KALIQDLSKPAPSTKELYFPTQYSQPFLTQCQACLWKQHLSYWRNPPYTAVRFLFTTVIA  1219

Query  3583  LLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAG  3762
             L+FGT+FW +G K + QQDL NAMG MYAAV+FLG+QNA SVQPVVA+ERTVFYRERAAG
Sbjct  1220  LMFGTLFWDLGTKTKRQQDLTNAMGSMYAAVLFLGIQNAASVQPVVAVERTVFYRERAAG  1279

Query  3763  MYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftly  3942
             MYSA+PYA GQV+IELP++FVQ+ +YG IVYAMIGFEWTAAKF W++FFMYFTLLYFT Y
Sbjct  1280  MYSAMPYAIGQVLIELPYIFVQSAVYGCIVYAMIGFEWTAAKFFWYLFFMYFTLLYFTFY  1339

Query  3943  GMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIA  4122
             GMM VAVTPNH+IAAI+SSAFYG WNLFSGFIIP+  IPVWWRWYY+ICPVSWT YGL+ 
Sbjct  1340  GMMAVAVTPNHHIAAIVSSAFYGLWNLFSGFIIPRPSIPVWWRWYYWICPVSWTFYGLVV  1399

Query  4123  SQFGDVKEKLD---TNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFN  4293
             SQFGD+++ L+     ETV+ ++++ FDF H+F+G VA +I+G  V+FG IF  SIK FN
Sbjct  1400  SQFGDIQDTLEDGSNGETVEQYLRNVFDFKHEFLGVVAAVILGFTVLFGGIFTVSIKVFN  1459

Query  4294  FQTR  4305
             FQ R
Sbjct  1460  FQRR  1463



>ref|XP_007013787.1| Pleiotropic drug resistance 12 [Theobroma cacao]
 gb|EOY31406.1| Pleiotropic drug resistance 12 [Theobroma cacao]
Length=1447

 Score =  2114 bits (5478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1058/1435 (74%), Positives = 1249/1435 (87%), Gaps = 6/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WRS+ +EVFS+S +E  +++   LKWAAIEKLPT+ RIR GILA  EEG   +E+D++ 
Sbjct  19    LWRSNSMEVFSKSFQEEDDEEA--LKWAAIEKLPTFSRIRTGILA--EEGRQLREVDIKN  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+R+L+ERLV++A ED+E FLL+L+ R D+VGI+LPTIEVRFEHLNV+AEAY GSR
Sbjct  75    LGLLERRNLVERLVKVAGEDHEKFLLRLRERIDQVGINLPTIEVRFEHLNVEAEAYEGSR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FN+  N+ E F+NYLHILP++KK LPIL DVSGII+P RM LLLGPPSSGKTTLL
Sbjct  135   ALPTVFNYCVNMFEGFLNYLHILPSKKKTLPILKDVSGIIRPQRMALLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  +LK+SGRVTYNGHEM EFVP+RTSAYI+Q+D+HIGEMTVRETLAFSARCQG
Sbjct  195   LALAGKLRKELKISGRVTYNGHEMEEFVPQRTSAYISQYDVHIGEMTVRETLAFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+ML EL+RREK  NIKPDPDID+YMKA ++EGQE SVVTDYILKILGLEVCAD +
Sbjct  255   VGPRYDMLVELARREKAANIKPDPDIDIYMKAAALEGQETSVVTDYILKILGLEVCADTM  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQ+KR+TTGEMLVGPA+ALFMDEISTGLDSSTTFQIVN++RQSIHIL G
Sbjct  315   VGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNALRQSIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+ YQGPR+NVLEFF++MGFKCPERKGVADFLQE
Sbjct  375   TAVISLLQPAPETYDLFDDIILLSDGQIAYQGPRENVLEFFEYMGFKCPERKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW+ + E Y F+T  +F+E FQSF +G+KL +ELA PFDKS+SHPAAL+ +
Sbjct  435   VTSRKDQEQYWVHKNERYTFVTAKQFAEEFQSFQIGQKLNEELATPFDKSQSHPAALATE  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV++K+LLKAC SR++LLMKRN FVY FK+IQL+  AF+ MT+FL+ +M +NS+ DG 
Sbjct  495   KYGVSQKQLLKACISRDYLLMKRNLFVYAFKVIQLIFTAFITMTLFLKVDMHRNSVIDGG  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +FMGALFF +++ M NG SE++++I+KLP FYKQRD  F+P WAYAL TWI+KIP+TL+E
Sbjct  555   IFMGALFFTLMVIMLNGVSEISMTIIKLPVFYKQRDFLFYPSWAYALTTWIMKIPITLIE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IW+ MTYY IGFDP+ GR  +Q  LL+C+NQMAS LFRL AA GR++IVANT GS A+
Sbjct  615   VTIWIVMTYYVIGFDPNVGRLLRQYLLLLCLNQMASGLFRLLAAVGRNMIVANTCGSLAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + +  +GGFILSRD VKKWW+WGYW+SPLMYAQN+I+VNE+LGKSWRH+P  ++E+LGV 
Sbjct  675   LAISAMGGFILSRDGVKKWWLWGYWVSPLMYAQNSIAVNEFLGKSWRHIPPNSTESLGVL  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRGIFPEAHWYWIGVGAL+GY FL NFLF  AL YLNP  KPQA++S+ETL E ++ 
Sbjct  735   VLKSRGIFPEAHWYWIGVGALIGYAFLFNFLFSSALKYLNPFSKPQAVISKETLPEVDS-  793

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
              R + +EL L+G  +S++G    RS SSR   +R+GS + A    +RG VLPFEP  ITF
Sbjct  794   -RRQSVELSLRGKKSSDQGKESPRSPSSRPPYARMGSFDEASQPSRRGTVLPFEPFSITF  852

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEI+YAVDMP EMK QG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  853   DEIRYAVDMPQEMKEQGVPEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  912

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+GSITISGYPK+QETFARI+GYCEQTD+HSP+VTVYESL++SAWLRLP ++++  
Sbjct  913   TGGYIDGSITISGYPKKQETFARISGYCEQTDVHSPYVTVYESLLFSAWLRLPLKVNSEA  972

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF EEVM+LVELT LREALVG PGV+GLSTEQRKRLTIAVELV+NPSIIFMDEPTSGL
Sbjct  973   RKMFAEEVMELVELTPLREALVGSPGVSGLSTEQRKRLTIAVELVSNPSIIFMDEPTSGL  1032

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMR VRNTVDTGRTVVCTIHQPSIDIFDAFDEL L+KRGGEEIYVGPLGRHS 
Sbjct  1033  DARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLMKRGGEEIYVGPLGRHSC  1092

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             +LI+YFE I GI +I+DGYNPATWMLEITS  QE  +GI+F  +Y+NSELYRRNKALI+E
Sbjct  1093  RLIKYFEEIKGIPKIKDGYNPATWMLEITSATQEEIIGINFTNIYKNSELYRRNKALIKE  1152

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS PAPGSKDL+F T+YSQ F  QCMACLWKQHWSYWRNPPYTAVRL+FTT  ALL GT+
Sbjct  1153  LSTPAPGSKDLHFQTRYSQPFQIQCMACLWKQHWSYWRNPPYTAVRLVFTTVIALLLGTI  1212

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR  QQD+ NA+G MY AV+FLG+QNA SVQPVVA+ERTVFYRE+AAGMYSALP
Sbjct  1213  FWDLGSKRTRQQDILNAVGSMYTAVIFLGLQNAVSVQPVVAVERTVFYREKAAGMYSALP  1272

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQVVIELP+  +QTLIYGVIVYAMIGFEWTA+KF W++FFMYFTLLY+T YGMMTVA
Sbjct  1273  YAFGQVVIELPYTLIQTLIYGVIVYAMIGFEWTASKFFWYLFFMYFTLLYYTFYGMMTVA  1332

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VT N + AAIIS+ FY  WNLFSGFIIP+TRIPVWWRW+Y+ICPVSWTLYGL ASQFG V
Sbjct  1333  VTANQHNAAIISTFFYRIWNLFSGFIIPRTRIPVWWRWFYWICPVSWTLYGLAASQFGGV  1392

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K+K ++ ETV+ FV+++F F  DF+G VA +IVGI V+  FIFAFSIKAFN+Q R
Sbjct  1393  KDKFESGETVEHFVRTYFGFRSDFLGVVAVVIVGIPVLIAFIFAFSIKAFNYQRR  1447



>ref|XP_008795450.1| PREDICTED: pleiotropic drug resistance protein 3-like [Phoenix 
dactylifera]
Length=1450

 Score =  2110 bits (5468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1050/1422 (74%), Positives = 1222/1422 (86%), Gaps = 21/1422 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPTY R+R+GIL   E  G   E+D++ LG+ E+++LL+RLVR+A+EDNE F
Sbjct  39    LKWAALEKLPTYDRVRKGILTLAE--GERIEVDIQSLGLRERKALLDRLVRVAEEDNERF  96

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKL+ R DRVGIDLPTIEVR+EHLN+ AE YVG+R LPTI N T N+LE+  NY HILP
Sbjct  97    LLKLRDRIDRVGIDLPTIEVRYEHLNIHAETYVGNRGLPTILNSTINVLESLANYFHILP  156

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK+ L ILHDVSG+IKP RMTLLLGPP SGKTTLLLALAGKLDSDLKVSGRVTYNGH M
Sbjct  157   SRKRSLSILHDVSGVIKPQRMTLLLGPPGSGKTTLLLALAGKLDSDLKVSGRVTYNGHGM  216

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+QHDLHIGEMTVRETLAFSARCQGVG RYEML ELSRREK  NIKPDP
Sbjct  217   DEFVPQRTAAYISQHDLHIGEMTVRETLAFSARCQGVGSRYEMLTELSRREKAANIKPDP  276

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA++++GQE SV+TDYILK+LGLE+CAD +VGDEM+RGISGGQRKR+TTGEMLV
Sbjct  277   DIDVFMKAVAMDGQETSVITDYILKVLGLEICADTMVGDEMLRGISGGQRKRVTTGEMLV  336

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQIVNS+RQSIHIL GTAVISLLQPAPETY+LFDDIILLS
Sbjct  337   GPARALFMDEISTGLDSSTTFQIVNSLRQSIHILGGTAVISLLQPAPETYDLFDDIILLS  396

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQVVYQGPR +VLEFF+ MGFKCPERKGVADFLQEVTSRKDQ+QYWMR +E Y ++ V 
Sbjct  397   DGQVVYQGPRGHVLEFFESMGFKCPERKGVADFLQEVTSRKDQQQYWMRHDETYRYVPVK  456

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQSFHVG+ +G+EL++P+DKSKSHPAAL+  KYGV+KKEL +A  +RE LLMKR+
Sbjct  457   EFAEAFQSFHVGQDIGNELSIPYDKSKSHPAALTTSKYGVSKKELFRANLARELLLMKRH  516

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIF+  QL ++AF+AMT+FLRTEM ++S+ DG ++MGALFF +I  MFNGFSELA++
Sbjct  517   SFVYIFRATQLTIVAFIAMTIFLRTEMHRDSVTDGGIYMGALFFGIISVMFNGFSELAMT  576

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             +LKLP F+KQRDL F+P W+YALP WILKIP++ +EV +WV  TYY IGFDP+ GR FKQ
Sbjct  577   VLKLPVFFKQRDLLFYPAWSYALPKWILKIPISFIEVGVWVFTTYYVIGFDPNVGRLFKQ  636

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ +NQMA+ALFR  AA GR++IVANTFGS A++++LVLGGFILSR+DVKKWWIWGY
Sbjct  637   YLLLLAINQMATALFRFIAALGRNMIVANTFGSFALLILLVLGGFILSREDVKKWWIWGY  696

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             WISPLMY+QNAIS NE+LG+SW H   G++E LGV VL+SRG+FPEA WYWIG GAL+GY
Sbjct  697   WISPLMYSQNAISTNEFLGRSWSHSLPGSTEPLGVLVLKSRGVFPEAKWYWIGFGALIGY  756

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIEL----------ELKGGS  2382
             + L N LF +AL YLNP GK +  +SEETL E++A   GE +            +   G+
Sbjct  757   MLLFNALFTVALAYLNPFGKARPAISEETLKEKHANLTGEVLGSSSSRGRNSVNDFTSGN  816

Query  2383  TSEKgnvvrrsvssrslssrvgsvnvADPNM-KRGMVLPFEPLCITFDEIKYAVDMPTEM  2559
             ++++          RS SS   +  V  PN  K+GMVLPF PL +TFD I+Y+VDMP EM
Sbjct  817   SADE--------IRRSNSSSKSTNEVVHPNQNKKGMVLPFVPLSMTFDNIRYSVDMPQEM  868

Query  2560  KAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISG  2739
             KAQG+ EDRL LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYIEG+ITISG
Sbjct  869   KAQGVIEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISG  928

Query  2740  YPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVE  2919
             YPK+QETFAR++GYCEQ DIHSPHVTVYESLVYSAWLRL  E+++ATR+MF+EEVM+LVE
Sbjct  929   YPKKQETFARVSGYCEQNDIHSPHVTVYESLVYSAWLRLSSEVNSATRKMFIEEVMELVE  988

Query  2920  LTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVR  3099
             LTSLR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVR
Sbjct  989   LTSLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVR  1048

Query  3100  NTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQ  3279
             +TVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIY+GPLGRHS  LI YFE I G+ 
Sbjct  1049  STVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYIGPLGRHSCHLINYFEGIEGVS  1108

Query  3280  RIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYF  3459
             +I+DGYNPATWMLE+T+ AQE  LG++F+EVY+ SELY+RNK LI+ELS P PGS DL F
Sbjct  1109  KIKDGYNPATWMLEVTTLAQERILGVNFSEVYKTSELYQRNKNLIKELSTPPPGSSDLRF  1168

Query  3460  PTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQD  3639
              T+Y QSFFTQCMA LWKQ+ SYWRNPPYTAVR  FTT  ALLFGT+FW +G KR  QQD
Sbjct  1169  ATQYPQSFFTQCMANLWKQNLSYWRNPPYTAVRFFFTTIIALLFGTIFWDLGTKRDKQQD  1228

Query  3640  LFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHL  3819
             LFNAMG MYAAV+F+GVQNA+SVQPVVAIERTVFYRERAAGMYSALPYAFGQV IE+P++
Sbjct  1229  LFNAMGSMYAAVLFIGVQNASSVQPVVAIERTVFYRERAAGMYSALPYAFGQVAIEIPYI  1288

Query  3820  FVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISS  3999
              +Q+LIYGV+VYAMIGFEWTAAKF W++FFMYFTLLYFT YGMM V +TPNHNIAAI+SS
Sbjct  1289  LIQSLIYGVLVYAMIGFEWTAAKFFWYMFFMYFTLLYFTFYGMMAVGLTPNHNIAAIVSS  1348

Query  4000  AFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdf  4179
             AFY  WNLFSGFIIP+ RIPVWWRWYY+ICPVSWTLYGL+ASQFGDV+ KLDT   V DF
Sbjct  1349  AFYLIWNLFSGFIIPRPRIPVWWRWYYWICPVSWTLYGLVASQFGDVQNKLDTGVAVADF  1408

Query  4180  vksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             V+S+F F HDF+G VA ++V   V+F F+F FSIK  NFQ R
Sbjct  1409  VRSYFGFRHDFLGVVAAVVVAFPVLFAFLFGFSIKMLNFQRR  1450



>ref|XP_009401798.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=1481

 Score =  2109 bits (5465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1058/1466 (72%), Positives = 1232/1466 (84%), Gaps = 33/1466 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR     +FS SSRE  +++   LKWAA+EKLPT+ R+RRGILA  E     +E+DV++
Sbjct  18    IWRRGNESIFSASSREEDDEEA--LKWAALEKLPTFDRLRRGILALPEGSQRLQEVDVQQ  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+++LLERLVR+  EDNE FLLKLK R DRVGIDLPTIEVRFEHLN+ AEA+VGSR
Sbjct  76    LGFRERKALLERLVRVTDEDNERFLLKLKDRVDRVGIDLPTIEVRFEHLNIQAEAHVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
              LPTI N   N LE+  NYLHILP+RK+PL ILHDVSGIIKP RMTLLLGPP SGKTTLL
Sbjct  136   GLPTILNSALNTLESIANYLHILPSRKRPLSILHDVSGIIKPRRMTLLLGPPGSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL SDLK +G+ TYNGHEM EFVP+RT+AYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  196   LALAGKLSSDLKATGKTTYNGHEMNEFVPQRTAAYISQHDLHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML EL+RREKE NIKPDPDIDV+MKA S+ GQE++++TDY+LKILGLEVC+D +
Sbjct  256   VGTRYEMLTELARREKEANIKPDPDIDVFMKAASMGGQESNLITDYVLKILGLEVCSDTM  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQIVNS+RQS+HIL G
Sbjct  316   VGDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSLRQSVHILGG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDDIILLSDGQVVYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  376   TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRENVLEFFESMGFKCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ+QYW R +E Y ++ V EF++AFQSFHVG+ +GDEL+VP+DKSKSHPAAL+  
Sbjct  436   VTSRKDQQQYWTRHDEPYRYVPVREFADAFQSFHVGRVIGDELSVPYDKSKSHPAALTTS  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             +YGV+KKELLKA   RE LLMKRNSFVYIFK  QL +MA +AMTVFLRT M ++S+ +G 
Sbjct  496   RYGVSKKELLKANIDRELLLMKRNSFVYIFKATQLTIMALIAMTVFLRTNMHRDSVTEGG  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFF V+M MFNGFSE A++ILKLP F+KQRDL F+P W+YA+P+WILKIP++  E
Sbjct  556   LYMGALFFGVVMVMFNGFSETAMTILKLPVFFKQRDLLFYPAWSYAIPSWILKIPISFAE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV  TYY IGFDP+ GR FKQ  LL+ +NQMAS+LFR   A GR++IVANTFGS A+
Sbjct  616   VAVWVFTTYYVIGFDPNVGRLFKQYMLLLLINQMASSLFRFIGAVGRNMIVANTFGSFAL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +++LVLGGFILSRD VKKWWIWGYWISPLMYAQNAISVNE+LG SW+H    +SE LGV+
Sbjct  676   LILLVLGGFILSRDQVKKWWIWGYWISPLMYAQNAISVNEFLGHSWQHSLPNSSEPLGVS  735

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRG+FPEA WYWIG GAL+GY+FL N LF +ALTYL P GK Q  +SEE+L E++A 
Sbjct  736   VLKSRGVFPEAKWYWIGFGALIGYIFLFNALFSVALTYLKPFGKSQPPVSEESLKEKHAN  795

Query  2341  KRGEPIE-------------------------LELKGGSTSEKgnvvrrsvssrslssrv  2445
               GE  E                         L   G S   +      +   R   +  
Sbjct  796   LTGEVSEQSSRGRNSVDHSQSKSKAYQHVSLMLHFPGQSHHVEALSAEGADGLRRDGTSS  855

Query  2446  gsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRP  2625
             GS+NVA    K+GMVLPF PL ITFD I+Y+VDMP EMK QG+ EDRL LLKGI+G+FRP
Sbjct  856   GSMNVAIDQNKKGMVLPFTPLSITFDNIRYSVDMPQEMKDQGVVEDRLELLKGISGSFRP  915

Query  2626  GVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHS  2805
             GVLTALMG+SGAGKTTLMDVLAGRKTGGYIEG+ITISGYPK+QETFAR++GYCEQ DIHS
Sbjct  916   GVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARVSGYCEQNDIHS  975

Query  2806  PHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQR  2985
             PHVTVYESLVYSAWLRLP E+++ATR+MFV+EVM+LVELT LR+ALVGLPGVNGLSTEQR
Sbjct  976   PHVTVYESLVYSAWLRLPAEVNSATRKMFVDEVMELVELTPLRDALVGLPGVNGLSTEQR  1035

Query  2986  KRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFD  3165
             KRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+
Sbjct  1036  KRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFE  1095

Query  3166  AFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEA  3345
             AFDEL L+KRGGEEIYVGPLG +S  LI YFE ING+ +I+DGYNPATWMLE++S+AQE 
Sbjct  1096  AFDELFLMKRGGEEIYVGPLGHNSCHLINYFEGINGVSKIKDGYNPATWMLEVSSQAQED  1155

Query  3346  ALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWS  3525
              LG++F+E+Y+NSELY+RNK LI+ELS P PGS DLYFPT+YSQS   QCMACLWKQH S
Sbjct  1156  ILGVNFSEIYKNSELYQRNKDLIKELSTPPPGSSDLYFPTQYSQSILVQCMACLWKQHLS  1215

Query  3526  YWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATS  3705
             YWRNPPYTAVR  FT   ALLFGT+FW +G KR T+QDL NAMG MYAAV+F+GVQN++S
Sbjct  1216  YWRNPPYTAVRFFFTLIIALLFGTIFWDLGTKRDTKQDLLNAMGSMYAAVLFIGVQNSSS  1275

Query  3706  VQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAA  3885
             VQPVVAIERTVFYRERAAGMYSA+PYAFGQV IE+P++ VQ L+YGVIVYAMIGFEWTAA
Sbjct  1276  VQPVVAIERTVFYRERAAGMYSAVPYAFGQVAIEIPYILVQALLYGVIVYAMIGFEWTAA  1335

Query  3886  KFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVW  4065
             KF W++FFMYFTLLYFT YGMM V +TPN+NIA+I+S+AFY  WNLFSGFIIP+ RIPVW
Sbjct  1336  KFFWYMFFMYFTLLYFTFYGMMAVGLTPNYNIASIVSAAFYAIWNLFSGFIIPRPRIPVW  1395

Query  4066  WRWYYYICPVSWTLYGLIASQFGDVKEKLDTNET------vkdfvksffdfdhdfvGYVA  4227
             WRWYY+ICPV+WTLYGL+ASQFGD++ +  ++E+      V DFV+++F F H F+G VA
Sbjct  1396  WRWYYWICPVAWTLYGLVASQFGDIQTRFASDESGEPGEIVADFVRNYFGFKHSFLGVVA  1455

Query  4228  TIIVGICVMFGFIFAFSIKAFNFQTR  4305
              ++V   V+F F+FAFSIK  NFQ R
Sbjct  1456  VVVVAFPVLFAFLFAFSIKTLNFQKR  1481



>ref|XP_008361067.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Malus domestica]
Length=1448

 Score =  2107 bits (5458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1029/1459 (71%), Positives = 1227/1459 (84%), Gaps = 47/1459 (3%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ +EVFS SSR   +D+E  L WAAIE+LPTYLR RRG+LA EE  G  +EIDV  
Sbjct  13    MWRNTSMEVFSMSSRHEEDDEES-LTWAAIERLPTYLRTRRGLLAEEE--GKAREIDVTN  69

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+++LLERL++IA+EDNE FLLKLK R +RVG++ PT EVRFEHLNV+AEAYVG R
Sbjct  70    LGLLERKNLLERLIKIAEEDNEKFLLKLKDRMNRVGLEYPTTEVRFEHLNVEAEAYVGGR  129

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT+FNF+ N+LE F+NYLHILP+RK+ LPIL+DVSGIIKP RMTLLLGPP SGKTTLL
Sbjct  130   ALPTMFNFSINMLELFLNYLHILPSRKQQLPILNDVSGIIKPKRMTLLLGPPGSGKTTLL  189

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK+SGRVTYNGH M EF+P RTSAYI+QHDLHI E+TVRET+AFSARCQG
Sbjct  190   LALAGKLGKDLKLSGRVTYNGHGMEEFIPERTSAYISQHDLHIPELTVRETMAFSARCQG  249

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML ELSRREK  NIKPDPD+DVYMKA ++EGQE +VVTDYI+K+LGL++CAD L
Sbjct  250   VGPRYEMLVELSRREKAANIKPDPDLDVYMKAAALEGQETNVVTDYIIKVLGLDICADTL  309

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD M RG+SGGQRKRLTTGEMLVGPA+ALFMDEISTGLDSSTT+ IVNS+RQSIHIL G
Sbjct  310   VGDHMRRGVSGGQRKRLTTGEMLVGPAKALFMDEISTGLDSSTTYHIVNSLRQSIHILNG  369

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSDG +VYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  370   TALISLLQPAPETYDLFDDIILLSDGHIVYQGPRENVLEFFEQMGFKCPERKGVADFLQE  429

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  +E+ Y F+T  EF+EA QSFH+G++LGDELA+PFDKSK +PA+L+ K
Sbjct  430   VTSRKDQEQYWAHKEKPYSFVTSDEFAEALQSFHIGRELGDELAIPFDKSKGNPASLTTK  489

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKEL KAC SR+ LLMKRNSF+YIFKMIQ  LMA V MT+FLRTEM + S+ DG 
Sbjct  490   KYGVGKKELYKACMSRQILLMKRNSFIYIFKMIQFSLMALVTMTLFLRTEMHRGSVEDGG  549

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MG+LFF +++ MF+G+SELA+++++LP F+KQRDL FFP WAYALP  +++IP+T+VE
Sbjct  550   IYMGSLFFTIVIIMFSGYSELAMTVMRLPVFFKQRDLLFFPAWAYALPNCLIRIPLTIVE  609

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V+IWV +TYY IG+DP+ GRFFKQ   L+C++QMA+ LFRL AA GRS IVANTFGS A+
Sbjct  610   VSIWVTVTYYVIGYDPNIGRFFKQFLSLLCISQMANGLFRLIAAIGRSPIVANTFGSAAL  669

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             ++V VLGGFILSRD +KKW +WGYW+SP+ Y  NA++VNE+LGKSWRHVP+ ++E LGV 
Sbjct  670   LVVFVLGGFILSRDSMKKWLLWGYWLSPMAYGMNALAVNEFLGKSWRHVPANSTEPLGVL  729

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLN--------------------  2280
             V++SRG+ PEA WYW+GV AL+G++ L NFLF LAL YL+                    
Sbjct  730   VMKSRGVLPEARWYWLGVVALLGFILLFNFLFTLALQYLDRKYQLRHFSSHHWRCSNNHT  789

Query  2281  ----PLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvg  2448
                  + KPQA++S+E LA++ A K G+  EL L    + E  +                
Sbjct  790   KFXVAIDKPQAVMSKEALAKKLAKKTGDTTELSLTRNESQENMS----------------  833

Query  2449  svnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPG  2628
                 A+   KRGMVLPFEPL ITF+EI+YAVDMP EMKA+G+TE+RL LLKG++GAFRPG
Sbjct  834   ----ANRTRKRGMVLPFEPLSITFNEIRYAVDMPQEMKAEGITENRLELLKGVSGAFRPG  889

Query  2629  VLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSP  2808
             VLTALMG+SGAGKTTLMDVLAGRKTGGYIEG+ITISGYPK QETFARI+GYCEQTDIHSP
Sbjct  890   VLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKNQETFARISGYCEQTDIHSP  949

Query  2809  HVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRK  2988
             HVTVYE+L+YSAWLRLPPE+D+ TR+MF+EEVM+LVELTS+ EALVGLPGVNGLSTEQRK
Sbjct  950   HVTVYEALIYSAWLRLPPEVDSPTRKMFIEEVMELVELTSIXEALVGLPGVNGLSTEQRK  1009

Query  2989  RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDA  3168
             RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDA
Sbjct  1010  RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDA  1069

Query  3169  FDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAA  3348
             FDEL LLKRGGEEIYVGPLG HSS LI YFE I+G+ ++RD +NPATWMLE+TS  Q+ A
Sbjct  1070  FDELFLLKRGGEEIYVGPLGHHSSDLINYFEGISGVSKLRDSHNPATWMLEVTSAGQQEA  1129

Query  3349  LGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSY  3528
             LG+ F+++Y+NSEL+RRNK LI+ELS P P S+DL+F T+YSQSFF QC+ACLWKQHWSY
Sbjct  1130  LGVSFSDIYKNSELHRRNKVLIKELSTPPPNSRDLHFSTQYSQSFFNQCIACLWKQHWSY  1189

Query  3529  WRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSV  3708
             WRNP Y+AVRLL+T   AL+FGT+FWG+G KR  QQD+ NAMG MY+AV+F+G+QNA+SV
Sbjct  1190  WRNPSYSAVRLLYTAMMALVFGTIFWGLGSKRNNQQDVLNAMGSMYSAVLFIGIQNASSV  1249

Query  3709  QPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAK  3888
             QPVV IER VFYRERAAGMYSA PYA GQ++IELP+   QT+IYG+IVY MIGF+WT  K
Sbjct  1250  QPVVGIERIVFYRERAAGMYSAFPYALGQIIIELPYTLFQTIIYGLIVYTMIGFDWTVGK  1309

Query  3889  FLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWW  4068
             FLW++FFMYFT LY+TLYGMM V +TPN  IAA+ SSA Y  WN+FSGFIIP+TRIP+WW
Sbjct  1310  FLWYLFFMYFTFLYYTLYGMMIVGITPNTTIAAVASSAVYPLWNVFSGFIIPRTRIPIWW  1369

Query  4069  RWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGIC  4248
             RW+Y++CPVSWTLYGL+ SQFG +K+ LD+ ETV+DF+K +F +   F+G VA + VGI 
Sbjct  1370  RWFYWVCPVSWTLYGLLTSQFGGIKDTLDSGETVEDFMKDYFGYREGFLGVVAIVHVGIS  1429

Query  4249  VMFGFIFAFSIKAFNFQTR  4305
             V+FGFIFAFSIK  NFQ R
Sbjct  1430  VLFGFIFAFSIKXLNFQKR  1448



>ref|XP_010654715.1| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis 
vinifera]
Length=1454

 Score =  2105 bits (5455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1048/1443 (73%), Positives = 1249/1443 (87%), Gaps = 16/1443 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG EVFSRSSR+  +++   LKWAA+EKLPTY R+R+G+L      G   E+D+  
Sbjct  20    IWRNSGEEVFSRSSRDEDDEEA--LKWAALEKLPTYNRMRKGLLMGS--AGEASEVDIHN  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EK++L+ERLV+IA+EDNE FLLKL++R DRVGIDLP IEVRFEHL +DAEA+VGSR
Sbjct  76    LGFQEKKNLVERLVKIAEEDNEKFLLKLRNRIDRVGIDLPEIEVRFEHLTIDAEAHVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+      N +E  +N L ILP+RKK L ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  136   ALPSFIYSAFNQIEDILNTLRILPSRKKKLTILHDVSGIIKPRRMTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LAL+GKLDS LKV+G+VTYNGH M EFVP+RT+ YI+QHD HIGEMTVRETLAFSARCQG
Sbjct  196   LALSGKLDSSLKVTGKVTYNGHGMNEFVPQRTATYISQHDTHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+MLAELSRREK  NIKPDPDIDV+MKA++ EGQ+ +V+TDY LKILGLEVCAD L
Sbjct  256   VGDRYDMLAELSRREKAANIKPDPDIDVFMKAVATEGQKENVITDYTLKILGLEVCADTL  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTT+QIVNS+RQ+IHIL G
Sbjct  316   VGDQMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLRQTIHILNG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSD Q+VYQGPR++VL+FF+ MGF+CPERKGVADFLQE
Sbjct  376   TALISLLQPAPETYDLFDDIILLSDSQIVYQGPREDVLDFFESMGFRCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ+QYW R++E Y F+TV EF+EAFQSFH+G+KLG ELA PFDK+KSHPAAL  +
Sbjct  436   VTSRKDQQQYWARKDEPYSFVTVKEFAEAFQSFHIGRKLGHELATPFDKTKSHPAALKTE  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKELL AC SRE+LLMKRNSFVYIFK+ QL++MA ++MT+FLRTEM KNS  DG+
Sbjct  496   KYGVRKKELLDACISREYLLMKRNSFVYIFKLTQLIIMAAISMTIFLRTEMHKNSTDDGS  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF V+M MFNG SELA++I KLP FYKQR L F+P WAYALP+WILKIP+T VE
Sbjct  556   IYTGALFFTVVMIMFNGMSELAMTIAKLPVFYKQRGLLFYPAWAYALPSWILKIPITFVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV M+YY IGFDP+ GR FKQ  LL+ VNQMASALFR  AAAGR++IVANTFGS ++
Sbjct  616   VAVWVFMSYYVIGFDPNVGRLFKQYLLLVLVNQMASALFRFIAAAGRNMIVANTFGSFSL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSW-RHVPSGTSETLGV  2157
             +L+  LGGF+LSR++VKKWWIWGYW SPLMYAQNAI VNE+LGKSW ++  + ++E+LGV
Sbjct  676   LLLFALGGFVLSRENVKKWWIWGYWSSPLMYAQNAIVVNEFLGKSWSKNSSTDSTESLGV  735

Query  2158  TVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNA  2337
              VL+SRG F EA+WYWIG GAL+G++ + NF + +ALTYLN   KPQA+++EE+      
Sbjct  736   AVLKSRGFFTEAYWYWIGAGALLGFILVFNFCYTVALTYLNAFEKPQAVITEES----EN  791

Query  2338  CKRGEPIELE------LKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPF  2499
              K G  IEL       +   +++E+ + + RS+SS S S R  ++  A  N K+GMVLPF
Sbjct  792   SKTGGKIELSSHRRGSIDQTASTERRDEIGRSISSTSSSVRAEAIAEARRNNKKGMVLPF  851

Query  2500  EPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLM  2679
             +PL ITFD+I+Y+VDMP EMK+QG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLM
Sbjct  852   QPLSITFDDIRYSVDMPEEMKSQGVLEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  911

Query  2680  DVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLP  2859
             DVLAGRKTGGYIEG+I ISGYPK+QETFARI+GYCEQ DIHSPHVT++ESL+YSAWLRLP
Sbjct  912   DVLAGRKTGGYIEGNINISGYPKKQETFARISGYCEQNDIHSPHVTIHESLLYSAWLRLP  971

Query  2860  PEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  3039
              ++D+ TR+MF+EEVM+LVELT L+++LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM
Sbjct  972   ADVDSKTRKMFIEEVMELVELTPLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  1031

Query  3040  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVG  3219
             DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLLLKRGG+EIYVG
Sbjct  1032  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQEIYVG  1091

Query  3220  PLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRR  3399
             PLGRHSS LI+YF+ I G+ +I+DGYNPATWMLE+TS AQE  LG+DF E+Y+NS+LYRR
Sbjct  1092  PLGRHSSHLIKYFQGIEGVSKIKDGYNPATWMLEVTSSAQEFLLGVDFTEIYKNSDLYRR  1151

Query  3400  NKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFN  3579
             NK LI+ELS+PAPGSKDLYFPT+YSQSFFTQCMACLWKQ  SYWRNPPYTAVR  FTTF 
Sbjct  1152  NKDLIKELSQPAPGSKDLYFPTQYSQSFFTQCMACLWKQRRSYWRNPPYTAVRFFFTTFI  1211

Query  3580  ALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAA  3759
             AL+FGTMFW +G KR+ QQDL NAMG MYAAV+FLGVQN++SVQPVVA+ERTVFYRERAA
Sbjct  1212  ALIFGTMFWDLGTKRKKQQDLSNAMGSMYAAVLFLGVQNSSSVQPVVAVERTVFYRERAA  1271

Query  3760  GMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftl  3939
             GMYSA+PYAF Q ++E+P++F Q ++YGVIVYAMIGFEWTAAKF W++FFM+FTLLYFT 
Sbjct  1272  GMYSAMPYAFAQALVEIPYVFAQAVVYGVIVYAMIGFEWTAAKFFWYLFFMFFTLLYFTF  1331

Query  3940  yGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLI  4119
             YGMM VA TPN +IAAI+++AFYG WNLFSGFI+P+TRIPVWWRWYY+ CPV+WTLYGL+
Sbjct  1332  YGMMAVAATPNQHIAAIVAAAFYGLWNLFSGFIVPRTRIPVWWRWYYWACPVAWTLYGLV  1391

Query  4120  ASQFGDVKEKL-DTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNF  4296
              SQFGD++++  DT +TV+ ++  +F F+HDF+G VA +IVG  V+F FIFAF+IKAFNF
Sbjct  1392  TSQFGDIQDRFEDTGDTVEQYLNDYFGFEHDFLGVVAAVIVGFTVLFLFIFAFAIKAFNF  1451

Query  4297  QTR  4305
             Q R
Sbjct  1452  QRR  1454



>ref|XP_002512728.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF49231.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1429

 Score =  2105 bits (5454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1052/1435 (73%), Positives = 1226/1435 (85%), Gaps = 25/1435 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WRS+ +E FS+SSR   +DDEEALKWAAIE+LPTY R+++G+L   +  G   EIDV+ 
Sbjct  20    IWRSNAMEGFSKSSRGDEDDDEEALKWAAIERLPTYDRLKKGLLTTSK--GEANEIDVKN  77

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EKR+LL+RLV++A+EDNE FLLKLK+R DRVGI+LP IEVRFEHLNV+ EA+VGSR
Sbjct  78    LGFHEKRTLLDRLVKVAEEDNELFLLKLKNRIDRVGIELPMIEVRFEHLNVETEAHVGSR  137

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT FNF+ +I+E F+N+LHILP+ KK L IL DVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  138   ALPTFFNFSIDIVEGFLNFLHILPSGKKSLSILQDVSGIIKPKRMTLLLGPPSSGKTTLL  197

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD  LK SGRVTYNGHEM EFVP+RT+AYI+QHD HIGEMTVRETLAF+ARCQG
Sbjct  198   LALAGKLDPKLKFSGRVTYNGHEMNEFVPQRTAAYISQHDTHIGEMTVRETLAFAARCQG  257

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VGHRYEM++EL RREK  NIKPDPDIDV+MKA++ EGQEA+VVTDYILKILGLEVCADI+
Sbjct  258   VGHRYEMISELLRREKASNIKPDPDIDVFMKAMATEGQEANVVTDYILKILGLEVCADIM  317

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VG+EM+RG+SGGQRKR+TTGEMLVGPA+ALFMDEISTGLDSSTT+QIVNSI+Q IHIL G
Sbjct  318   VGNEMLRGVSGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTYQIVNSIKQYIHILNG  377

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQP PETY LFDDIILLSDGQ+VYQGPR+NVLEFF++MGFKCPERKGVADFLQE
Sbjct  378   TAVISLLQPPPETYNLFDDIILLSDGQIVYQGPRENVLEFFEYMGFKCPERKGVADFLQE  437

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ QYW  +++ Y F+TV EF+EAFQSF VG++L  EL+ PFDKSKSHPAAL+ K
Sbjct  438   VTSRKDQAQYWADKDKPYSFVTVREFAEAFQSFLVGRRLEAELSTPFDKSKSHPAALTTK  497

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV K ELLKAC SRE LLMKRNSFVYIFK+ QL +MA VAMT+FLRTEM ++S+ +G 
Sbjct  498   KYGVGKMELLKACFSREILLMKRNSFVYIFKLTQLTIMAMVAMTLFLRTEMHRDSVTNGG  557

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +++GALFF+V+  MFNG SE++L+I KLP FYKQR L F+PPWA++LP WI KIP+TLV+
Sbjct  558   IYVGALFFSVVFIMFNGLSEISLTIAKLPVFYKQRSLLFYPPWAFSLPPWITKIPITLVQ  617

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWV +TYY IGFDP+ GRFFKQ  LL  V+QMAS LFR  AAAGR++IVANTFGS A+
Sbjct  618   VAIWVFLTYYVIGFDPNVGRFFKQYLLLALVSQMASGLFRFIAAAGRNMIVANTFGSFAL  677

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + +  LGGFILSRD++KKWWIWGYWISPLMY QNAI VNE+LG SW  V   T+ETLG+ 
Sbjct  678   LALFALGGFILSRDNIKKWWIWGYWISPLMYGQNAIVVNEFLGNSWNKVLPDTTETLGIQ  737

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL SRG F  A+WYWIGVGALVG+  L NF F LALT+L PL KPQA++SE++ A   + 
Sbjct  738   VLESRGFFTHAYWYWIGVGALVGFTLLYNFFFTLALTFLGPLQKPQAVISEDS-ASNTSG  796

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K GE I+L                       S R   +   +   ++GMVLPFEP  ITF
Sbjct  797   KTGEVIQLS----------------------SVRTELIVEENHQKQKGMVLPFEPHSITF  834

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             ++I+Y+VDMP EMK QG TEDRL LL+G++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  835   NDIRYSVDMPQEMKRQGATEDRLELLRGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  894

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG I ISG+PK+QETFARI+GYCEQ DIHSPHVTVYESL+YS+WLRLPPE+++ T
Sbjct  895   TGGYIEGDIRISGFPKKQETFARISGYCEQNDIHSPHVTVYESLLYSSWLRLPPEVNSET  954

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELT LR+ALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  955   RKMFIEEVMELVELTPLRQALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1014

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLL+KRGG+EIYVGPLGRHS 
Sbjct  1015  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKRGGQEIYVGPLGRHSC  1074

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI+YFE I G+  I+DGYNPATWMLE++S AQE  LG+DFA +Y+NSELYRRNKALI+E
Sbjct  1075  QLIKYFEAIEGVPDIKDGYNPATWMLEVSSSAQEMVLGLDFAAIYKNSELYRRNKALIEE  1134

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P  GS DLYFPT+YSQSFFTQCMACLWKQHWSYWRNPPYTAVR LFTT  AL+FGTM
Sbjct  1135  LSTPPLGSNDLYFPTQYSQSFFTQCMACLWKQHWSYWRNPPYTAVRFLFTTVIALMFGTM  1194

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G K   +QDLFNAMG MYAA+VFLG+QNA+SVQPVVA+ERTVFYRERAAGMYS LP
Sbjct  1195  FWDLGSKTTKRQDLFNAMGSMYAAIVFLGIQNASSVQPVVAVERTVFYRERAAGMYSPLP  1254

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAF QVVIELP++F+Q  +YG+IVYAMIGFEW+AAKF W++FFMYFTLL++T YGMM VA
Sbjct  1255  YAFAQVVIELPYIFLQAAVYGLIVYAMIGFEWSAAKFFWYLFFMYFTLLFYTYYGMMAVA  1314

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPN  +A+I+SSAFY  WNLFSGFIIP+ RIPVWWRWY + CPV++TLYGL++SQFGD+
Sbjct  1315  VTPNQQVASIVSSAFYSIWNLFSGFIIPRPRIPVWWRWYAWTCPVAYTLYGLVSSQFGDI  1374

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K  L++ ETV+DFV+S+FDF H+ +G VA  + G   +F F FAFSIK FNFQ R
Sbjct  1375  KHTLESGETVEDFVRSYFDFKHELLGAVAAAVFGFATLFAFTFAFSIKFFNFQRR  1429



>emb|CBI36229.3| unnamed protein product [Vitis vinifera]
Length=3142

 Score =  2102 bits (5447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1048/1443 (73%), Positives = 1249/1443 (87%), Gaps = 16/1443 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG EVFSRSSR+  +++   LKWAA+EKLPTY R+R+G+L      G   E+D+  
Sbjct  1708  IWRNSGEEVFSRSSRDEDDEEA--LKWAALEKLPTYNRMRKGLLMGS--AGEASEVDIHN  1763

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EK++L+ERLV+IA+EDNE FLLKL++R DRVGIDLP IEVRFEHL +DAEA+VGSR
Sbjct  1764  LGFQEKKNLVERLVKIAEEDNEKFLLKLRNRIDRVGIDLPEIEVRFEHLTIDAEAHVGSR  1823

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+      N +E  +N L ILP+RKK L ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  1824  ALPSFIYSAFNQIEDILNTLRILPSRKKKLTILHDVSGIIKPRRMTLLLGPPSSGKTTLL  1883

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LAL+GKLDS LKV+G+VTYNGH M EFVP+RT+ YI+QHD HIGEMTVRETLAFSARCQG
Sbjct  1884  LALSGKLDSSLKVTGKVTYNGHGMNEFVPQRTATYISQHDTHIGEMTVRETLAFSARCQG  1943

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+MLAELSRREK  NIKPDPDIDV+MKA++ EGQ+ +V+TDY LKILGLEVCAD L
Sbjct  1944  VGDRYDMLAELSRREKAANIKPDPDIDVFMKAVATEGQKENVITDYTLKILGLEVCADTL  2003

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTT+QIVNS+RQ+IHIL G
Sbjct  2004  VGDQMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLRQTIHILNG  2063

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSD Q+VYQGPR++VL+FF+ MGF+CPERKGVADFLQE
Sbjct  2064  TALISLLQPAPETYDLFDDIILLSDSQIVYQGPREDVLDFFESMGFRCPERKGVADFLQE  2123

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ+QYW R++E Y F+TV EF+EAFQSFH+G+KLG ELA PFDK+KSHPAAL  +
Sbjct  2124  VTSRKDQQQYWARKDEPYSFVTVKEFAEAFQSFHIGRKLGHELATPFDKTKSHPAALKTE  2183

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKELL AC SRE+LLMKRNSFVYIFK+ QL++MA ++MT+FLRTEM KNS  DG+
Sbjct  2184  KYGVRKKELLDACISREYLLMKRNSFVYIFKLTQLIIMAAISMTIFLRTEMHKNSTDDGS  2243

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF V+M MFNG SELA++I KLP FYKQR L F+P WAYALP+WILKIP+T VE
Sbjct  2244  IYTGALFFTVVMIMFNGMSELAMTIAKLPVFYKQRGLLFYPAWAYALPSWILKIPITFVE  2303

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV M+YY IGFDP+ GR FKQ  LL+ VNQMASALFR  AAAGR++IVANTFGS ++
Sbjct  2304  VAVWVFMSYYVIGFDPNVGRLFKQYLLLVLVNQMASALFRFIAAAGRNMIVANTFGSFSL  2363

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSW-RHVPSGTSETLGV  2157
             +L+  LGGF+LSR++VKKWWIWGYW SPLMYAQNAI VNE+LGKSW ++  + ++E+LGV
Sbjct  2364  LLLFALGGFVLSRENVKKWWIWGYWSSPLMYAQNAIVVNEFLGKSWSKNSSTDSTESLGV  2423

Query  2158  TVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNA  2337
              VL+SRG F EA+WYWIG GAL+G++ + NF + +ALTYLN   KPQA+++EE+      
Sbjct  2424  AVLKSRGFFTEAYWYWIGAGALLGFILVFNFCYTVALTYLNAFEKPQAVITEES----EN  2479

Query  2338  CKRGEPIELE------LKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPF  2499
              K G  IEL       +   +++E+ + + RS+SS S S R  ++  A  N K+GMVLPF
Sbjct  2480  SKTGGKIELSSHRRGSIDQTASTERRDEIGRSISSTSSSVRAEAIAEARRNNKKGMVLPF  2539

Query  2500  EPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLM  2679
             +PL ITFD+I+Y+VDMP EMK+QG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLM
Sbjct  2540  QPLSITFDDIRYSVDMPEEMKSQGVLEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  2599

Query  2680  DVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLP  2859
             DVLAGRKTGGYIEG+I ISGYPK+QETFARI+GYCEQ DIHSPHVT++ESL+YSAWLRLP
Sbjct  2600  DVLAGRKTGGYIEGNINISGYPKKQETFARISGYCEQNDIHSPHVTIHESLLYSAWLRLP  2659

Query  2860  PEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  3039
              ++D+ TR+MF+EEVM+LVELT L+++LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM
Sbjct  2660  ADVDSKTRKMFIEEVMELVELTPLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  2719

Query  3040  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVG  3219
             DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLLLKRGG+EIYVG
Sbjct  2720  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQEIYVG  2779

Query  3220  PLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRR  3399
             PLGRHSS LI+YF+ I G+ +I+DGYNPATWMLE+TS AQE  LG+DF E+Y+NS+LYRR
Sbjct  2780  PLGRHSSHLIKYFQGIEGVSKIKDGYNPATWMLEVTSSAQEFLLGVDFTEIYKNSDLYRR  2839

Query  3400  NKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFN  3579
             NK LI+ELS+PAPGSKDLYFPT+YSQSFFTQCMACLWKQ  SYWRNPPYTAVR  FTTF 
Sbjct  2840  NKDLIKELSQPAPGSKDLYFPTQYSQSFFTQCMACLWKQRRSYWRNPPYTAVRFFFTTFI  2899

Query  3580  ALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAA  3759
             AL+FGTMFW +G KR+ QQDL NAMG MYAAV+FLGVQN++SVQPVVA+ERTVFYRERAA
Sbjct  2900  ALIFGTMFWDLGTKRKKQQDLSNAMGSMYAAVLFLGVQNSSSVQPVVAVERTVFYRERAA  2959

Query  3760  GMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftl  3939
             GMYSA+PYAF Q ++E+P++F Q ++YGVIVYAMIGFEWTAAKF W++FFM+FTLLYFT 
Sbjct  2960  GMYSAMPYAFAQALVEIPYVFAQAVVYGVIVYAMIGFEWTAAKFFWYLFFMFFTLLYFTF  3019

Query  3940  yGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLI  4119
             YGMM VA TPN +IAAI+++AFYG WNLFSGFI+P+TRIPVWWRWYY+ CPV+WTLYGL+
Sbjct  3020  YGMMAVAATPNQHIAAIVAAAFYGLWNLFSGFIVPRTRIPVWWRWYYWACPVAWTLYGLV  3079

Query  4120  ASQFGDVKEKL-DTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNF  4296
              SQFGD++++  DT +TV+ ++  +F F+HDF+G VA +IVG  V+F FIFAF+IKAFNF
Sbjct  3080  TSQFGDIQDRFEDTGDTVEQYLNDYFGFEHDFLGVVAAVIVGFTVLFLFIFAFAIKAFNF  3139

Query  4297  QTR  4305
             Q R
Sbjct  3140  QRR  3142


 Score =  2038 bits (5279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1002/1391 (72%), Positives = 1195/1391 (86%), Gaps = 13/1391 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WRSSG +VFSRSSR+  +++   LKWAA+EKLPTY R+R+G+L   +  G   E+DV+ 
Sbjct  19    MWRSSGADVFSRSSRDEDDEEA--LKWAALEKLPTYNRLRKGLLMGSQ--GAASEVDVDN  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EK+SL+ERLV+IA+EDNE FLL+L++R +RVGI +P IEVRFEHL +DAEA++GSR
Sbjct  75    LGYQEKQSLMERLVKIAEEDNEKFLLRLRNRIERVGITIPEIEVRFEHLTIDAEAFIGSR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  NF  N +E  +  L ILP+R++   ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPSFHNFMFNKIEDALTGLRILPSRRRKFTILHDVSGIIKPQRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LAL+GKLD  LKV+GRVTYNGH M EFVP+RT+AYI+QHD HIGEMTVRETLAFSARCQG
Sbjct  195   LALSGKLDPTLKVTGRVTYNGHGMDEFVPQRTAAYISQHDTHIGEMTVRETLAFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+MLAELSRREK  NIKPDPD+DV+MKA + EGQ+ +VVTDY LKILGL++CAD +
Sbjct  255   VGDRYDMLAELSRREKAANIKPDPDLDVFMKAAATEGQKENVVTDYTLKILGLDICADTM  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTTFQIVN ++Q+IHIL G
Sbjct  315   VGDEMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTFQIVNCLKQTIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY LFDDIILLSDG+++YQGPR++VLEFF+  GF+CPERKGVADFLQE
Sbjct  375   TAVISLLQPAPETYNLFDDIILLSDGRIIYQGPREDVLEFFESTGFRCPERKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW R+EE Y F+TV EF+EAFQSFH G+K+GDELA P+DK+KSHPAAL+ K
Sbjct  435   VTSKKDQQQYWARKEEPYRFVTVKEFAEAFQSFHTGRKVGDELASPYDKTKSHPAALTTK  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGVNKKELL A  SRE+LLMKRNSFVY+FK+ QL +MA + MT+FLRTEM KNS+ DG 
Sbjct  495   KYGVNKKELLDANMSREYLLMKRNSFVYVFKLTQLAIMAVITMTLFLRTEMHKNSVDDGN  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF V+M MFNG +ELA++I KLP FYKQRDL F+P WAYALPTWILKIP+T +E
Sbjct  555   IYTGALFFTVVMIMFNGMAELAMAIAKLPVFYKQRDLLFYPAWAYALPTWILKIPITFIE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V +WV MTYY IGFDP+  R F+Q  LL+ VNQMAS LFRL A+AGR++IV+NTFG+  +
Sbjct  615   VGVWVFMTYYVIGFDPNVERLFRQYLLLLLVNQMASGLFRLIASAGRNMIVSNTFGAFVL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +++L LGGFILS DDVKKWWIWGYW SPLMYAQNAI VNE+LG SW+   +G++E+LGVT
Sbjct  675   LMLLALGGFILSHDDVKKWWIWGYWCSPLMYAQNAIVVNEFLGHSWKKNVTGSTESLGVT  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL +RG F EA+WYWIG GAL G++ L NF + L L +LNP  KPQA++ EE+    +  
Sbjct  735   VLNNRGFFTEAYWYWIGAGALFGFILLFNFGYTLCLNFLNPFDKPQAVIVEES----DNA  790

Query  2341  KRGEPIELELKGGS-----TSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEP  2505
             + G  IEL  +  S     ++E+G  + RS+SS S + R  +V  A+ N K+GMVLPF+P
Sbjct  791   ETGGQIELSQRNSSIDQAASTERGEEIGRSISSTSSAVREEAVAGANHNKKKGMVLPFQP  850

Query  2506  LCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDV  2685
               ITFD+I+Y+VDMP EMK+QG+ ED+L LLKG++GAFRPGVLTALMG+SGAGKTTLMDV
Sbjct  851   YSITFDDIRYSVDMPEEMKSQGVVEDKLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDV  910

Query  2686  LAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPE  2865
             LAGRKTGGYIEG+ITISGYPK+QETFARI+GYCEQ DIHSPHVTVYESL+YSAWLRLP +
Sbjct  911   LAGRKTGGYIEGNITISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSD  970

Query  2866  IDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDE  3045
             + + TR+MF+EEVM+LVELT LR+ALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDE
Sbjct  971   VKSETRQMFIEEVMELVELTPLRDALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDE  1030

Query  3046  PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPL  3225
             PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLLLKRGG+EIYVGPL
Sbjct  1031  PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQEIYVGPL  1090

Query  3226  GRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNK  3405
             GR+S  LI YFE I G+ +I+DGYNPATWMLE T+ AQEA LG+DF E+Y+NS+LYRRNK
Sbjct  1091  GRYSCHLINYFEGIEGVSKIKDGYNPATWMLEATTAAQEATLGVDFTEIYKNSDLYRRNK  1150

Query  3406  ALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNAL  3585
              LI+ELS+P PG+KDLYF T++SQ FFTQ +ACLWKQ WSYWRNPPYTAVR LFTTF AL
Sbjct  1151  DLIKELSQPPPGTKDLYFRTQFSQPFFTQFLACLWKQRWSYWRNPPYTAVRFLFTTFIAL  1210

Query  3586  LFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGM  3765
             +FGTMFW +G K  TQQDLFNAMG MYAAV+FLG+QN+ SVQPVV +ERTVFYRERAAGM
Sbjct  1211  MFGTMFWDLGTKWSTQQDLFNAMGSMYAAVLFLGIQNSQSVQPVVVVERTVFYRERAAGM  1270

Query  3766  YSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyG  3945
             YS L YAF Q ++E+P++F Q ++YG+IVYAMIGF+WTAAKF W++FFM+FTL+YFT YG
Sbjct  1271  YSPLSYAFAQALVEIPYIFSQAVVYGLIVYAMIGFQWTAAKFFWYLFFMFFTLMYFTFYG  1330

Query  3946  MMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIAS  4125
             MM VA TPN NIA+I+++AFYG WNLFSGFI+P+ RIPVWWRWYY+ICPVSWTLYGL+ S
Sbjct  1331  MMAVAATPNQNIASIVAAAFYGLWNLFSGFIVPRNRIPVWWRWYYWICPVSWTLYGLVTS  1390

Query  4126  QFGDVKEKLDT  4158
             QFGD+ E+L+T
Sbjct  1391  QFGDITEELNT  1401



>emb|CAN74185.1| hypothetical protein VITISV_001190 [Vitis vinifera]
Length=1414

 Score =  2100 bits (5442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1050/1442 (73%), Positives = 1219/1442 (85%), Gaps = 53/1442 (4%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             + R+S VEVFSRSSRE  +++   LKWAA+EKLPT+LRI+RGIL   EE G  +EID++ 
Sbjct  19    ILRNSSVEVFSRSSREEDDEEA--LKWAALEKLPTFLRIQRGILT--EEKGQAREIDIKS  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+++L++RLV+I   DNE FLLKLK R DRVG+ +PT+EVRFEHL VDAEAYVGSR
Sbjct  75    LGLXERKNLIQRLVKIDGHDNEKFLLKLKERIDRVGLXIPTVEVRFEHLTVDAEAYVGSR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPAR-------MTLLLGPPS  519
             ALPTIFN +ANIL  F+NYLHILP+RKKP  ILHDVSGIIKP R       M LLLGPPS
Sbjct  135   ALPTIFNXSANILXGFLNYLHILPSRKKPFSILHDVSGIIKPRRFESXFRRMXLLLGPPS  194

Query  520   sgkttlllalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLA  699
             SGKTTLLLALAG+L SDLKVSGRVTYNGH M EFVP+RTSAY +Q+DLH GEMTVRETL 
Sbjct  195   SGKTTLLLALAGRLGSDLKVSGRVTYNGHGMDEFVPQRTSAYTSQYDLHAGEMTVRETLD  254

Query  700   FSARCQGVGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGL  879
             FSARCQGVG   +MLAELSRREK  NIKPDPDID+YMKA ++EGQ+ SVVT+Y+LKILGL
Sbjct  255   FSARCQGVGGLSDMLAELSRREKAANIKPDPDIDIYMKAAALEGQKTSVVTEYMLKILGL  314

Query  880   EVCADILVGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQ  1059
             E+CAD LVGD M RGISGGQ+K LTTGE+LVGPARALFMDEISTGLDSST FQIVNS+RQ
Sbjct  315   EICADTLVGDVMKRGISGGQKKXLTTGEILVGPARALFMDEISTGLDSSTAFQIVNSLRQ  374

Query  1060  SIHILQGTAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKG  1239
             SIHIL GTA+ISLLQPAPETY LFD IILLSDG++VYQGP +NVLEFF +MGFKCPERKG
Sbjct  375   SIHILNGTALISLLQPAPETYNLFDXIILLSDGKIVYQGPCENVLEFFGYMGFKCPERKG  434

Query  1240  VADFLQEVTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSH  1419
             VADFLQEVTSRKDQEQYW  ++E Y ++TV EF+EAFQSFH+G+KLGDELAVPFDK+K H
Sbjct  435   VADFLQEVTSRKDQEQYWAXKDEPYSYVTVKEFAEAFQSFHIGQKLGDELAVPFDKTKGH  494

Query  1420  PAALSNKKYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPK  1599
             PAAL+ KKYG++K+ELL+AC SREFL+MKRNSFVYIFK IQL+++AF++MT+FLRTEM +
Sbjct  495   PAALTTKKYGISKRELLRACTSREFLIMKRNSFVYIFKXIQLIIVAFISMTLFLRTEMSR  554

Query  1600  NSIADGTVFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILK  1779
             N++ DG +FMGALFFAV+  MFNG +EL ++I +LP FYKQRDL FFP WAY+LP WILK
Sbjct  555   NTVEDGGIFMGALFFAVLRIMFNGLTELPMTIFQLPVFYKQRDLLFFPSWAYSLPKWILK  614

Query  1780  IPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVAN  1959
             +P+   EV  WV MTYY IGFDP+  RFFKQ  LL+C++QMAS L RL AA GR++IVA+
Sbjct  615   MPIAFAEVGAWVIMTYYVIGFDPNIERFFKQYLLLLCIHQMASGLLRLMAALGRNIIVAS  674

Query  1960  TFGSCAMILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGT  2139
             TFGS  ++LV+VLGGF+LS+DDVK WW WGYW+SPLMY QNAISVNE+LG SWRHVP+ +
Sbjct  675   TFGSFPLLLVVVLGGFVLSKDDVKPWWEWGYWVSPLMYGQNAISVNEFLGNSWRHVPANS  734

Query  2140  SETLGVTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEET  2319
             +E+LGV VL++RG F E HWYW+GVGAL+GYV L NFLF LAL+YLNP GKPQ +LS+ET
Sbjct  735   TESLGVLVLKARGAFTEPHWYWLGVGALIGYVLLFNFLFTLALSYLNPFGKPQPILSKET  794

Query  2320  LAERNACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPF  2499
             L E+ A + GE  EL   G S++                        AD   KRGMVLPF
Sbjct  795   LTEKQANRTGELNELSPGGKSSA------------------------ADQRRKRGMVLPF  830

Query  2500  EPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLM  2679
             EPL I+FDEI+YAVDMP EMKAQG+TEDRL LLKG++G+FRPG+LTALMG++GAGKTTLM
Sbjct  831   EPLSISFDEIRYAVDMPQEMKAQGVTEDRLELLKGVSGSFRPGILTALMGVTGAGKTTLM  890

Query  2680  DVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLP  2859
             DVLAGRKT GYIEG I +SGYP +Q TFAR+ GYCEQTDIHSPHVTVYESL+YSAWLRLP
Sbjct  891   DVLAGRKTSGYIEGIIKVSGYPXKQXTFARVLGYCEQTDIHSPHVTVYESLIYSAWLRLP  950

Query  2860  PEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  3039
              E+D+ATR+MF+EEVM+LVEL SLREALVGLP  NGLSTEQRKRLTIAVELVANPSIIFM
Sbjct  951   SEVDSATRKMFIEEVMELVELNSLREALVGLPSENGLSTEQRKRLTIAVELVANPSIIFM  1010

Query  3040  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVG  3219
             DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIY G
Sbjct  1011  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYTG  1070

Query  3220  PLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRR  3399
             P+G HSS LI+YFE INGI +I+DGYNP+TWMLE+TS AQEAALG++F E Y+NSELYRR
Sbjct  1071  PIGHHSSHLIKYFEGINGISKIKDGYNPSTWMLELTSAAQEAALGVNFTEEYKNSELYRR  1130

Query  3400  NKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFN  3579
             NKALI+ELS P PGSKDLYF T+YSQSFFTQC+ACLWKQHWSYWRNP YTAVRL FTTF 
Sbjct  1131  NKALIKELSSPPPGSKDLYFSTQYSQSFFTQCLACLWKQHWSYWRNPAYTAVRLFFTTFI  1190

Query  3580  ALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAA  3759
             AL+FGT+FW  G KR+ QQDLFNAMGCMY +V+F+G+QNA SVQ VVAIERTVFYRERAA
Sbjct  1191  ALMFGTIFWDSGSKRKRQQDLFNAMGCMYVSVIFIGIQNAXSVQAVVAIERTVFYRERAA  1250

Query  3760  GMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftl  3939
             GMYSA PYAFGQ +                  +M+GFEWT  KF W++FFMYFT LYFT 
Sbjct  1251  GMYSAFPYAFGQYM------------------SMVGFEWTVTKFFWYLFFMYFTFLYFTF  1292

Query  3940  yGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLI  4119
             YGMM VA+TPN +I+ I+SSAFYG WNLFSGFIIP TRIPVWW+WY++ CPVSWTLYGL+
Sbjct  1293  YGMMAVAITPNQHISGIVSSAFYGLWNLFSGFIIPHTRIPVWWKWYFWSCPVSWTLYGLV  1352

Query  4120  ASQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQ  4299
              +QFGD+KE+L++ E V+DFV+S+F + +DFVG VA I+VGI V+FGFIFA+SI+AFNFQ
Sbjct  1353  VTQFGDIKERLESGERVEDFVRSYFGYRNDFVGVVAGIVVGITVLFGFIFAYSIRAFNFQ  1412

Query  4300  TR  4305
              R
Sbjct  1413  KR  1414



>ref|XP_008219880.1| PREDICTED: putative pleiotropic drug resistance protein 7 [Prunus 
mume]
Length=1430

 Score =  2100 bits (5440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1033/1435 (72%), Positives = 1213/1435 (85%), Gaps = 18/1435 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ +E FS+SS    +D+E  L WAAIE+LPTYLRIRRG+LA EE+G   + IDV  
Sbjct  14    MWRNTSMEAFSKSSHHEEDDEES-LTWAAIERLPTYLRIRRGLLA-EEDGQVREIIDVNN  71

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++SLLERLV+IA+EDNE FLLKLK R +RVG++ PT EVRFEHLNV+AEAYVG R
Sbjct  72    LGLLERKSLLERLVKIAEEDNEKFLLKLKDRMNRVGLEFPTTEVRFEHLNVEAEAYVGGR  131

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP++FNF+ N+LE F+NYLHI+P+RKKPLPILHDVSGIIKP R TLLLGPP SGKTTLL
Sbjct  132   ALPSVFNFSINMLEGFLNYLHIIPSRKKPLPILHDVSGIIKPRRTTLLLGPPGSGKTTLL  191

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRVTYNGH M EF+P RTSAYI+QHDLHI E+TVRETLAFSARCQG
Sbjct  192   LALAGKLGKDLKFSGRVTYNGHGMEEFIPERTSAYISQHDLHIPELTVRETLAFSARCQG  251

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML ELSRREK  NIKPDPD+DVYMKA ++EGQE +VVTDYI+K+LGLEVCAD +
Sbjct  252   VGSRYEMLVELSRREKAANIKPDPDLDVYMKAAALEGQETNVVTDYIIKVLGLEVCADTM  311

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+M RGISGGQ+KRLTTGEMLVGP +ALFMDEISTGLDSSTTF IVN++RQSIHIL G
Sbjct  312   VGDQMRRGISGGQKKRLTTGEMLVGPEKALFMDEISTGLDSSTTFHIVNALRQSIHILNG  371

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETYELFDDIILLSDG +VYQGPR+NVLEFF+HMGFKCPERKGVADFLQE
Sbjct  372   TALISLLQPAPETYELFDDIILLSDGCIVYQGPRENVLEFFEHMGFKCPERKGVADFLQE  431

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  +++ Y F+T  EFSEA QSFH+G++LGDELA PFDKSK +PAAL+  
Sbjct  432   VTSRKDQEQYWADKDKPYSFVTSNEFSEAMQSFHIGRELGDELATPFDKSKGNPAALTTN  491

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKEL KAC SR+ LLMKRNSFVYIFKM Q ++MAF  MT+FLRTEM + ++ DG 
Sbjct  492   KYGVSKKELYKACMSRQVLLMKRNSFVYIFKMTQFIIMAFTTMTLFLRTEMHRRTVEDGG  551

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MG+LF+ +++ MF GFSELAL++++LP F+KQRDL FFP WAY+LPT +++IP+T VE
Sbjct  552   IYMGSLFYTMMIIMFTGFSELALTVMRLPVFFKQRDLLFFPAWAYSLPTCLIRIPLTFVE  611

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
              +IWV MTYY IG+DP   RFFKQ  LL+C++QMA+ LFRL A  GRS +VANTFGS A+
Sbjct  612   ASIWVTMTYYVIGYDPSIERFFKQFILLLCLSQMANGLFRLLAVVGRSPVVANTFGSAAL  671

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +++ VLGGF+LSR+ +++W +WGYW SPL Y  NA++VNE+LGKSWRHVP+ ++E LGV 
Sbjct  672   LVLFVLGGFVLSRESMQEWLLWGYWFSPLTYGMNALAVNEFLGKSWRHVPANSTEPLGVM  731

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRG+ PEA WYWIGV A +G V L NFLF  AL YL+P+ KPQ ++S+E L E+ A 
Sbjct  732   VLKSRGVLPEARWYWIGVVASLGLVLLFNFLFTFALQYLDPIDKPQTVMSKEALEEKLAK  791

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K  E +EL   G S+               + +        +   +RGMVLPFEPL ITF
Sbjct  792   KNEETVELPSMGKSS-------------VGVGNESPESVSTNHTRRRGMVLPFEPLSITF  838

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             +EI+YAVDMP EMKA+G+TEDRL LLKG+NGAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  839   NEIRYAVDMPQEMKAEGITEDRLELLKGVNGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  898

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEGSI +SGYPK+QETFARI+GYCEQTDIHSPHVTVYESLVYSAWLRLPPE+D+ T
Sbjct  899   TGGYIEGSIIVSGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSPT  958

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELTS+REALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  959   RKMFIEEVMELVELTSIREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1018

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIYVGPLG  SS
Sbjct  1019  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYVGPLGHQSS  1078

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI YFE ING+ ++R GYNPATWML  TS  QEAALG++F ++Y+NSE+YRRNKALI+E
Sbjct  1079  QLINYFEGINGVSKLRYGYNPATWMLGGTSAGQEAALGVNFTDIYKNSEVYRRNKALIKE  1138

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P P S         SQSFFTQC+ACLWKQHWSYWRNP Y+AVRLL+T   AL+FG +
Sbjct  1139  LSTPPPNSXXX---XXXSQSFFTQCIACLWKQHWSYWRNPSYSAVRLLYTAVMALVFGII  1195

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR  QQDLFNAMG MY+AV+F+G+QNA+SVQPVV IER VFYRERAAGMYSA P
Sbjct  1196  FWDLGSKRHRQQDLFNAMGSMYSAVLFIGIQNASSVQPVVGIERVVFYRERAAGMYSAFP  1255

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YA GQV+IELP+  +QT+IYGVIVY+MIGFEWT +KFLW IFFMYFT LY+ LYGMM V 
Sbjct  1256  YALGQVLIELPYTSIQTIIYGVIVYSMIGFEWTVSKFLWHIFFMYFTFLYYILYGMMIVG  1315

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPN  IAA++SSAFY  WN+FSGFIIPKTRIP+WWRW+Y++CPVSWTLYGL  SQFG +
Sbjct  1316  ITPNTTIAAVVSSAFYPLWNVFSGFIIPKTRIPIWWRWFYWVCPVSWTLYGLFTSQFGGI  1375

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K+ LD+ ETV DF++++F +  DF+G VA + VGI  +FGFIFAFSIK FNFQ R
Sbjct  1376  KDTLDSGETVDDFIRAYFGYTTDFLGVVAIVHVGISGLFGFIFAFSIKVFNFQKR  1430



>ref|XP_002297807.2| hypothetical protein POPTR_0001s14660g [Populus trichocarpa]
 gb|EEE82612.2| hypothetical protein POPTR_0001s14660g [Populus trichocarpa]
Length=1449

 Score =  2095 bits (5429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1035/1434 (72%), Positives = 1215/1434 (85%), Gaps = 8/1434 (1%)
 Frame = +1

Query  4     WRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKL  183
             WR++ VE FSRSSRE  +++   L WAAIEKLPTY R+R+GIL +  +G    E+D+EKL
Sbjct  24    WRNTTVEAFSRSSREEDDEEA--LTWAAIEKLPTYDRLRKGILTSASKGVA-NEVDIEKL  80

Query  184   GVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRA  363
             GV E++ LLERLV++A+EDNE FL KLK R +RVGID+PTIEVR+++LN++AEAYVGS A
Sbjct  81    GVQERKQLLERLVKVAEEDNEKFLWKLKDRVERVGIDVPTIEVRYDNLNIEAEAYVGSSA  140

Query  364   LPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlll  543
             LP+   FT NI+E  +  L+IL NRKKPL IL DVSGI+KP+R+TLLLGPPSSGKTTLLL
Sbjct  141   LPSFAKFTFNIIEGLLISLNILRNRKKPLTILKDVSGIVKPSRLTLLLGPPSSGKTTLLL  200

Query  544   alagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGV  723
             ALAGKLD +LK SGRVTYNGHEM EFVP+RT+AYI+QHDLHIGEMTVRETLAFSARCQG 
Sbjct  201   ALAGKLDPNLKFSGRVTYNGHEMNEFVPQRTAAYISQHDLHIGEMTVRETLAFSARCQGA  260

Query  724   GHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILV  903
             G+ ++MLAELSRREKE NIKPDPD+DV+MKA++ +G+EA+V+TDY+LKILGLEVCAD +V
Sbjct  261   GYLHDMLAELSRREKEANIKPDPDVDVFMKAVASQGEEANVITDYVLKILGLEVCADTMV  320

Query  904   GDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGT  1083
             GDEMIRGISGGQRKR+TTGEMLVGP+RALFMDEISTGLDSSTT+QIVNS+R ++HIL  T
Sbjct  321   GDEMIRGISGGQRKRVTTGEMLVGPSRALFMDEISTGLDSSTTYQIVNSLRHTVHILNCT  380

Query  1084  AVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEV  1263
             AVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+ VLEFF+HMGF+CPERKGVADFLQEV
Sbjct  381   AVISLLQPAPETYDLFDDIILLSDGQIVYQGPRERVLEFFKHMGFECPERKGVADFLQEV  440

Query  1264  TSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKK  1443
             TSRKDQEQYW R+++   FIT  EF+EAFQSF VG++  +EL++PFDKSK+HPAAL  K 
Sbjct  441   TSRKDQEQYWARKDQPCRFITANEFAEAFQSFSVGRRTAEELSIPFDKSKNHPAALVTKT  500

Query  1444  YGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTV  1623
             +G  KK+LLKA  SRE+LLMKRNSFVYIFK+ QL +MA ++MT+F RTEM ++++ADG +
Sbjct  501   HGAGKKDLLKANFSREYLLMKRNSFVYIFKICQLTIMALISMTLFFRTEMHRDTVADGGI  560

Query  1624  FMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEV  1803
             + GALFF  IM MFNG SEL+++I KLP FYKQRDL FFP WAYA+P WILKIPV  VEV
Sbjct  561   YTGALFFTAIMIMFNGMSELSMTIAKLPVFYKQRDLRFFPSWAYAIPQWILKIPVAFVEV  620

Query  1804  AIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMI  1983
              +WV +TYY IGFDP+ GR FKQ  LL+ +NQMASALFR  AAAGR++IVANTFGS A++
Sbjct  621   GVWVFLTYYVIGFDPNVGRLFKQYLLLLLINQMASALFRFIAAAGRNMIVANTFGSFALL  680

Query  1984  LVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTV  2163
              +  LGGFILSR+ +KKWWIWGYWISPLMY Q AI VNE+LG SW HVP  ++E LG+ V
Sbjct  681   TLFALGGFILSREKIKKWWIWGYWISPLMYGQTAIVVNEFLGNSWSHVPENSTEPLGIQV  740

Query  2164  LRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACK  2343
             L+SRG F EA+WYWIG GA +G++ LLN  F LALT+LN   KPQA++S+E  ++ +  K
Sbjct  741   LKSRGFFTEAYWYWIGAGATIGFILLLNLFFVLALTFLNAFDKPQAVISDEPESDESGRK  800

Query  2344  RGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFD  2523
                 I+L   G S             + S +           N K+GMVLPFEPL ITFD
Sbjct  801   TERAIQLSNHGSSHGTNTEGGVGISRASSEAIGR-----VSNNRKKGMVLPFEPLSITFD  855

Query  2524  EIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKT  2703
             ++ Y+VDMP EMK QG+ EDRLVLL G+NGAFRPGVLTALMG+SGAGKTTLMDVLAGRKT
Sbjct  856   DVIYSVDMPQEMKIQGVVEDRLVLLNGVNGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  915

Query  2704  GGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATR  2883
             GGYI+G I ISGYPK+QETFAR++GYCEQ DIHSP VTVYESL+YSAWLRLPPE+D+ TR
Sbjct  916   GGYIDGEIKISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLYSAWLRLPPEVDSETR  975

Query  2884  EMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  3063
              MF+EEVMDLVEL  LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  976   RMFIEEVMDLVELNPLRHALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1035

Query  3064  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQ  3243
             ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGG+EIYVGPLGRHS+ 
Sbjct  1036  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSTH  1095

Query  3244  LIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQEL  3423
             LI+YFE I G+ +I+DGYNPATWMLEI+S AQE AL +DF+ +Y+NS+L+RRNKALI EL
Sbjct  1096  LIKYFEAIEGVSKIKDGYNPATWMLEISSSAQEMALEVDFSNIYKNSDLFRRNKALIVEL  1155

Query  3424  SKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMF  3603
             S PAPGS DLYFPTKYS SF TQCMACLWKQHWSYWRNPPYTAVR LFTTF AL+FGTMF
Sbjct  1156  STPAPGSTDLYFPTKYSTSFLTQCMACLWKQHWSYWRNPPYTAVRFLFTTFIALMFGTMF  1215

Query  3604  WGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPY  3783
             W +G K  + QDLFNAMG MYAAV+FLGVQNA+SVQPVVA+ERTVFYRERAAGMYSALPY
Sbjct  1216  WDLGSKVDSTQDLFNAMGSMYAAVIFLGVQNASSVQPVVAVERTVFYRERAAGMYSALPY  1275

Query  3784  AFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAV  3963
             AF QV+IELP++FVQ  +YG+IVYAMIGFEWT  KF W++FFMYFTLLYFT YGMM VA+
Sbjct  1276  AFAQVLIELPYIFVQAAVYGIIVYAMIGFEWTVVKFFWYLFFMYFTLLYFTFYGMMAVAM  1335

Query  3964  TPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVK  4143
             TPNH+IAAI+SSAFYG WNLFSGFIIP+  +P+WWRWY + CP++WTLYGL+ SQFGD++
Sbjct  1336  TPNHHIAAIVSSAFYGIWNLFSGFIIPRPSMPIWWRWYSWACPIAWTLYGLVVSQFGDIQ  1395

Query  4144  EKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             + L   +TVK++VK +F FDHDF+G VA  IVG  V+F FIFAF+IKAFNFQ R
Sbjct  1396  KDLTETQTVKEYVKDYFGFDHDFLGVVAAAIVGWTVLFAFIFAFAIKAFNFQRR  1449



>gb|KDP36995.1| hypothetical protein JCGZ_06051 [Jatropha curcas]
Length=1440

 Score =  2094 bits (5426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1022/1417 (72%), Positives = 1203/1417 (85%), Gaps = 26/1417 (2%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPTY R+R+GIL +  +G    EIDV+ LG  E++ LLERL+++A+EDNE F
Sbjct  44    LKWAALEKLPTYDRLRKGILLSASKGVA-SEIDVDNLGFQERKLLLERLIKVAEEDNEKF  102

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVGI++PTIEVRFEHLNV+AEAY  SRALP+  NFT  ILE F+NYLHI+P
Sbjct  103   LLKLKNRIDRVGIEIPTIEVRFEHLNVEAEAYSASRALPSFVNFTFGILEGFLNYLHIIP  162

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +R +PL IL DVSGIIKP+RM LLLGPPSSGKTTLLLALAGKLD +LK SG VTYNGH M
Sbjct  163   SRTRPLHILKDVSGIIKPSRMALLLGPPSSGKTTLLLALAGKLDPNLKFSGTVTYNGHGM  222

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EF+P+RT+AYI+QHD HIGEMTVRETLAFSARCQGVG ++++LAELSRREK  NIKPDP
Sbjct  223   NEFIPQRTAAYISQHDEHIGEMTVRETLAFSARCQGVGTQHDLLAELSRREKAANIKPDP  282

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA + EGQE SV+TDY LKILGLEVCAD LVGDEMIRGISGGQRKR+TTGEMLV
Sbjct  283   DIDVFMKAAATEGQETSVITDYFLKILGLEVCADTLVGDEMIRGISGGQRKRVTTGEMLV  342

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA+ALFMDEISTGLDSSTT+QIVNS+RQSIHIL GTA+ISLLQPAPETY+LFDDIILLS
Sbjct  343   GPAKALFMDEISTGLDSSTTYQIVNSLRQSIHILNGTALISLLQPAPETYDLFDDIILLS  402

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR+ VL FF++MGFKCPERKGVADFLQEVTS+KDQ+QYW RR++ Y FIT  
Sbjct  403   DGQIVYQGPREQVLGFFEYMGFKCPERKGVADFLQEVTSKKDQQQYWARRDQPYRFITAQ  462

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EFSEAFQS+ VG+K+GDEL+ PFD +KSHPAAL+ K+YGV K ELLKAC SRE+LLMKRN
Sbjct  463   EFSEAFQSYEVGRKIGDELSTPFDTTKSHPAALTTKRYGVGKMELLKACISREYLLMKRN  522

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK+ QL++MA V MT+FLRT+M ++++ DG +++GALFFA I+ MFNG SELA++
Sbjct  523   SFVYIFKLTQLIIMALVTMTLFLRTKMHRDTVDDGGIYLGALFFATILIMFNGMSELAMT  582

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQR+L F+P WAY+LPTWILKIP+T VEVA+W+ +TYY IGFDP+ GRFFKQ
Sbjct  583   IAKLPVFYKQRNLLFYPAWAYSLPTWILKIPITFVEVAVWIVLTYYVIGFDPNVGRFFKQ  642

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               +LI VNQMAS LFR  AA GR++IVANTFGS A++ +  LGGFILS+DD+KKWWIWGY
Sbjct  643   YLVLIIVNQMASGLFRFIAATGRNMIVANTFGSFALLALFALGGFILSKDDIKKWWIWGY  702

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W+SPLMY QNAI VNE+LG SW H+P+GT++ LG+ +L +RG FP A+WYW+G GA VG+
Sbjct  703   WVSPLMYGQNAIVVNEFLGHSWSHIPAGTTKPLGIQLLEARGFFPHAYWYWLGFGACVGF  762

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             + L NFLF +ALTYL+P  KPQA++SE++    +  +    I+L   G S     +    
Sbjct  763   MLLFNFLFTVALTYLDPFEKPQAVISEDSETNESGNQTRGSIQLTNYGSSHKSSIDG---  819

Query  2413  svssrslssrvgsvnvADPN------MKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGL  2574
                             AD N       K+GMVLPF P  ITFD+I Y+VDMP EMK+QG+
Sbjct  820   ----------------ADENSEVNHIKKKGMVLPFAPHSITFDDIIYSVDMPQEMKSQGV  863

Query  2575  TEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQ  2754
              ED+LVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYIEGSITISGYPK+Q
Sbjct  864   LEDKLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGSITISGYPKKQ  923

Query  2755  ETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLR  2934
             ETFARI+GYCEQ DIHSPHVTV+ES+VYSAWLRLPPE+D  TR MFVEEVMDLVEL  +R
Sbjct  924   ETFARISGYCEQNDIHSPHVTVHESIVYSAWLRLPPEVDKETRTMFVEEVMDLVELNPIR  983

Query  2935  EALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  3114
              ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT
Sbjct  984   NALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  1043

Query  3115  GRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDG  3294
             GRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLGRHS  LI+YFE I G+++I DG
Sbjct  1044  GRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGRHSCHLIKYFEGIEGVRKITDG  1103

Query  3295  YNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYS  3474
             YNPATWMLE+T  AQE A+ +DFA +YRNSE+YRRNKA+I+ELS PAPGSKDLYFPT+Y+
Sbjct  1104  YNPATWMLEVTGPAQELAMDVDFASIYRNSEVYRRNKAMIKELSVPAPGSKDLYFPTQYA  1163

Query  3475  QSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAM  3654
              SF TQC+AC WKQ WSYWRNPPYTAVR LFTTF AL+FGT+FW +G K   QQDLFNAM
Sbjct  1164  TSFLTQCIACFWKQRWSYWRNPPYTAVRFLFTTFIALMFGTLFWNLGSKSTKQQDLFNAM  1223

Query  3655  GCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTL  3834
             G +YAA +FLGVQN+ +VQPVVAIERTVFYRERAAGMYSA+PYA  QV+IE+P++F Q +
Sbjct  1224  GSLYAATLFLGVQNSGAVQPVVAIERTVFYRERAAGMYSAMPYALAQVMIEIPYIFCQAI  1283

Query  3835  IYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGF  4014
             +YG+I YAMIGF WT AKFLW+++FMY TLLYFT YGMM VAVTPNH+IAAI+SSAFYG 
Sbjct  1284  VYGLITYAMIGFHWTVAKFLWYMYFMYLTLLYFTFYGMMAVAVTPNHHIAAIVSSAFYGL  1343

Query  4015  WNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksff  4194
             WNLF+GFI+P+TRIPVWWRWYY+  P++WTLYG+I SQFGD+K+ LD ++TV +FV+ ++
Sbjct  1344  WNLFAGFIVPRTRIPVWWRWYYWANPIAWTLYGIIGSQFGDIKDILDGDQTVGEFVREYY  1403

Query  4195  dfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              + HDFV  VA +++ + V F FIF  SIKAFNFQ R
Sbjct  1404  GYKHDFVPVVAAVVLALTVGFAFIFGLSIKAFNFQRR  1440



>ref|XP_009416092.1| PREDICTED: pleiotropic drug resistance protein 3-like [Musa acuminata 
subsp. malaccensis]
Length=1452

 Score =  2094 bits (5425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1029/1414 (73%), Positives = 1207/1414 (85%), Gaps = 3/1414 (0%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPT+ R+RRGIL   E+G   +E+DV++LG  E+++L+ERLVR+A+EDNE F
Sbjct  39    LKWAALEKLPTFDRVRRGILTLAEDGKQLQEVDVQRLGFQERKTLMERLVRVAEEDNERF  98

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK R DRVGIDLPTIEVR+EHL+++AE +VG+R LPT+FN  AN+LE   NYLHILP
Sbjct  99    LLKLKDRIDRVGIDLPTIEVRYEHLSIEAETHVGNRGLPTVFNSVANVLETAANYLHILP  158

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKKPL ILHDV+GIIKP RMTLLLGPP SGKTTLLLALAGKL SDLK SG+VTYNGHEM
Sbjct  159   SRKKPLSILHDVNGIIKPRRMTLLLGPPGSGKTTLLLALAGKLSSDLKTSGKVTYNGHEM  218

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+Q+DLHIGEMTVRETLAFSARCQGVG RY+ML EL+RREK  NIKPDP
Sbjct  219   KEFVPQRTAAYISQYDLHIGEMTVRETLAFSARCQGVGTRYDMLTELARREKAANIKPDP  278

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             D+DV+MKA +++GQE +V TDYILKILGLEVCAD +VGDEM+RGISGGQRKR+TTGEMLV
Sbjct  279   DVDVFMKASAMKGQETNVTTDYILKILGLEVCADTMVGDEMLRGISGGQRKRVTTGEMLV  338

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQIVNS+RQ+IHIL GTAVISLLQPAPETY+LFDDIILLS
Sbjct  339   GPARALFMDEISTGLDSSTTFQIVNSLRQTIHILGGTAVISLLQPAPETYDLFDDIILLS  398

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DG +VYQGPR+NV+EFF+ MGFKCPERKGVADFLQEVTSRKDQ+QYW R++E Y ++ V 
Sbjct  399   DGLIVYQGPRENVVEFFESMGFKCPERKGVADFLQEVTSRKDQQQYWSRQDEPYRYVPVR  458

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQ FH+G+ L +EL+VPFDKSKSHPAAL+  +YGV+K E+LKA  +RE LLMKRN
Sbjct  459   EFAEAFQQFHIGRALAEELSVPFDKSKSHPAALTTTRYGVSKTEVLKANMARELLLMKRN  518

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK +QLV+MA +AMTVFLRT+M +N I DG ++ GALF+ ++  MFNGFSELA++
Sbjct  519   SFVYIFKAVQLVIMAVIAMTVFLRTKMHRNDIDDGMIYNGALFYGIVTIMFNGFSELAMT  578

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I+KLP F+KQRDL F+P W+Y +P WILKIP+   EVA+WV  TYY IGFDP+ GR FKQ
Sbjct  579   IMKLPVFFKQRDLLFYPAWSYTIPGWILKIPIAFAEVAVWVFTTYYVIGFDPNVGRLFKQ  638

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+  NQMAS LFR   A GR++IVANTFG+ A++++LVLGGFILSR+ VKKWWIWGY
Sbjct  639   YLLLLVTNQMASGLFRTIGAVGRNMIVANTFGAFALLILLVLGGFILSREKVKKWWIWGY  698

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGT--SETLGVTVLRSRGIFPEAHWYWIGVGALV  2226
             WISPLMY+QNA+SVNE+LG SW H+ S +  +E+LGV +L SRG+FPEA WYWIG GA V
Sbjct  699   WISPLMYSQNAVSVNEFLGHSWSHITSNSNSTESLGVAILESRGVFPEARWYWIGFGATV  758

Query  2227  GYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvv  2406
             GYV L N LF LALTYL+P GK Q  LSEETL E++A   GE +E   +G  +       
Sbjct  759   GYVLLFNALFTLALTYLDPFGKSQPPLSEETLKEKHANLTGEVLENSSRGRRSVRHSASK  818

Query  2407  rrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDR  2586
             + +      SS +GS+  A    K+GMVLPF PL ITFD+++Y+VDMP EMKAQG+ EDR
Sbjct  819   KSASGIGRKSSSLGSMREAFEQNKKGMVLPFTPLSITFDDVRYSVDMPQEMKAQGVAEDR  878

Query  2587  LVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFA  2766
             L LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYIEG I+ISGYPKRQETFA
Sbjct  879   LELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDISISGYPKRQETFA  938

Query  2767  RIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALV  2946
             RI+GYCEQ DIHSPHVTV+ESL YSAWLRLP E+D+ TR+MFVEEVM+LVELT LR+ALV
Sbjct  939   RISGYCEQNDIHSPHVTVHESLAYSAWLRLPSEVDSETRKMFVEEVMELVELTPLRDALV  998

Query  2947  GLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV  3126
             GLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMR VRNTVDTGRTV
Sbjct  999   GLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGRTV  1058

Query  3127  VCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPA  3306
             VCTIHQPSIDIF+AFDEL LLKRGGEEIYVGPLGR SS LI YFE INGI +I+DGYNPA
Sbjct  1059  VCTIHQPSIDIFEAFDELFLLKRGGEEIYVGPLGRDSSHLISYFEGINGISKIKDGYNPA  1118

Query  3307  TWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFF  3486
             TWMLE+TS++QE  LG++F E YRNSELYRRNK+LI++LS P  GS DLYFPT+YSQSF 
Sbjct  1119  TWMLEVTSQSQENILGVNFNETYRNSELYRRNKSLIKDLSIPPAGSSDLYFPTQYSQSFP  1178

Query  3487  TQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMY  3666
              QCMACLWKQH SYWRNPPYTAVR  FTT  ALLFGT+FW +G K  TQQDLFNA+G MY
Sbjct  1179  VQCMACLWKQHLSYWRNPPYTAVRFFFTTVVALLFGTIFWDLGRKTSTQQDLFNAIGSMY  1238

Query  3667  AAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGV  3846
             AAV+F+G+QN +SVQPVVA+ERTVFYRE+AAGMYSALPYAFGQV IELP++ +Q+ +YGV
Sbjct  1239  AAVLFMGIQNCSSVQPVVAVERTVFYREKAAGMYSALPYAFGQVAIELPYILIQSALYGV  1298

Query  3847  IVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLF  4026
             IVYAMIGFEWT AKF W++FFMYFTLLYFT YGMM V +TPNH+IA+I+S+ FY  WNLF
Sbjct  1299  IVYAMIGFEWTVAKFFWYLFFMYFTLLYFTFYGMMAVGITPNHSIASIVSAFFYAIWNLF  1358

Query  4027  SGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKL-DTNETvkdfvksffdfd  4203
              GFIIP+ +IPVWWRWYY+ CPV+WTLYGL ASQFGD++  + D N  V +F++S+F F 
Sbjct  1359  CGFIIPRPKIPVWWRWYYWACPVAWTLYGLAASQFGDIETVMTDKNLPVSEFLRSYFGFK  1418

Query  4204  hdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             H F+G VA ++V   +MF F+FAFSIK  NFQ R
Sbjct  1419  HSFLGVVAAVVVAFPLMFAFLFAFSIKMLNFQKR  1452



>ref|XP_002304712.2| hypothetical protein POPTR_0003s17730g [Populus trichocarpa]
 gb|EEE79691.2| hypothetical protein POPTR_0003s17730g [Populus trichocarpa]
Length=1451

 Score =  2093 bits (5424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1038/1437 (72%), Positives = 1220/1437 (85%), Gaps = 10/1437 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR+S VEVFSRSSRE  +++   LKWAA+EKLPTY R+R+GIL +   G    E+D+E 
Sbjct  23    VWRNSTVEVFSRSSREEDDEEA--LKWAALEKLPTYDRLRKGILTSASRGI-ISEVDIEN  79

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LGV E++ LLERLV++A EDNE FL KLK+R +RVGI+ PTIEVR+E+LN++AEAYVGS 
Sbjct  80    LGVQERKQLLERLVKVADEDNEKFLWKLKNRVERVGIEFPTIEVRYENLNIEAEAYVGSS  139

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+   F  +I+E F   LH+LP+RKKPL IL DVSGIIKP+R+TLLLGPP+SGKTTLL
Sbjct  140   ALPSFAKFIFHIIEGFFIALHVLPSRKKPLTILKDVSGIIKPSRLTLLLGPPNSGKTTLL  199

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LA+AGKLD  LK SG VTYNGHEM EFVP+RT+AY++QHDLHIGEMTVRETL FSARCQG
Sbjct  200   LAMAGKLDPSLKFSGHVTYNGHEMNEFVPQRTAAYVSQHDLHIGEMTVRETLEFSARCQG  259

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VGH +EMLAELSRREKE NIKPD D+DV+MKA++ +GQEASV+TDY+LKILGLEVCAD L
Sbjct  260   VGHLHEMLAELSRREKEANIKPDQDVDVFMKAVATQGQEASVITDYVLKILGLEVCADTL  319

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKR+TTGEMLVGP+RAL MDEISTGLDSSTT+QIVNS++Q+IH+L  
Sbjct  320   VGDEMIRGISGGQRKRVTTGEMLVGPSRALLMDEISTGLDSSTTYQIVNSLKQTIHVLNC  379

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVL FF+HMGFKCP+RKGVADFLQE
Sbjct  380   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLGFFEHMGFKCPDRKGVADFLQE  439

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQYW  +++ Y F+ V EFSEAFQSF+VG+K+ DEL++PFDK+K+HPAAL NK
Sbjct  440   VTSKKDQEQYWAIKDQPYRFVRVNEFSEAFQSFNVGRKIADELSIPFDKTKNHPAALVNK  499

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG  K +LLKA  SRE+LLMKRNSFVYIFK+ QL ++A ++M++F RT+M  +++ADG 
Sbjct  500   KYGAGKMDLLKANFSREYLLMKRNSFVYIFKICQLTVVALISMSLFFRTKMHHDTVADGG  559

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF VI+ MFNG SEL+++I+KLP FYKQR+L FFPPWAY++P WILKIPVT VE
Sbjct  560   IYTGALFFTVIIIMFNGMSELSMTIVKLPVFYKQRELLFFPPWAYSIPPWILKIPVTFVE  619

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA WV +TYY IGFDP+  R  +Q FLL+ +NQMASALFR  AAAGR++IVANTFGS A+
Sbjct  620   VAAWVLLTYYVIGFDPNVERLLRQYFLLLLINQMASALFRFIAAAGRNMIVANTFGSFAL  679

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + +  LGGFILSR+ +KKWWIWGYW+SPLMY QNAI VNE+LG SW H+P  ++E LG+ 
Sbjct  680   LTLFALGGFILSREQIKKWWIWGYWLSPLMYGQNAIVVNEFLGHSWSHIPGTSTEPLGIQ  739

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLN--PLGKPQAMLSEETLAERN  2334
             VL+SR  F EA+WYWIGVGA VG++ L N  F LALT+LN     KPQA + EE+  E +
Sbjct  740   VLKSREFFTEANWYWIGVGATVGFMLLFNICFALALTFLNGKSFEKPQAFIFEESEREGS  799

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
               K G  ++L   G S   K         +   S        A  N KRGMVLPFEP  I
Sbjct  800   VGKTGGAVQLSNHGSSHKNKTENGDEINRNGFASIGE-----ASDNRKRGMVLPFEPHSI  854

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFD++ Y+VDMP EMK QG+ EDRLVLLKG+NGAFRPGVLT LMG+SGAGKTTLMDVLAG
Sbjct  855   TFDDVIYSVDMPQEMKIQGVVEDRLVLLKGVNGAFRPGVLTTLMGVSGAGKTTLMDVLAG  914

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYIEG I ISGYPK+QETFARIAGYCEQ DIHSPHVTVYESL+YSAWLRLPPE+D+
Sbjct  915   RKTGGYIEGDIKISGYPKKQETFARIAGYCEQNDIHSPHVTVYESLLYSAWLRLPPEVDS  974

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
              TR+MF++EVM+LVEL SLR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS
Sbjct  975   ETRKMFIDEVMELVELDSLRNALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  1034

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL L+KRGGEEIYVGPLG H
Sbjct  1035  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLMKRGGEEIYVGPLGHH  1094

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             S+ LI+YFE I G+ +I+DGYNPATWMLE+T+ +QE AL +DFA +Y+NS+L+RRNKALI
Sbjct  1095  STHLIKYFEAIEGVSKIKDGYNPATWMLEVTASSQEMALEVDFANIYKNSDLFRRNKALI  1154

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
              ELS PAPGSKD++FPT+YS SFFTQCMACLWKQHWSYWRNPPYTAVR LFTTF AL+FG
Sbjct  1155  AELSTPAPGSKDVHFPTRYSTSFFTQCMACLWKQHWSYWRNPPYTAVRFLFTTFIALMFG  1214

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             TMFW +G K +T QDL NAMG MYAAV+FLG QN T+VQPVVA+ERTVFYRERAAGMYSA
Sbjct  1215  TMFWDLGSKVKTTQDLSNAMGSMYAAVLFLGFQNGTAVQPVVAVERTVFYRERAAGMYSA  1274

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYAF Q +IELP++FVQ  +YGVIVYAMIGFEWTAAKF W++FFMYFTLLYFT YGMM 
Sbjct  1275  LPYAFAQALIELPYVFVQAAVYGVIVYAMIGFEWTAAKFFWYLFFMYFTLLYFTFYGMMA  1334

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNH+IA I+S+AFY  WNLFSGFIIP+TRIP+WWRWYY+ CPVSW+LYGL+ SQ+G
Sbjct  1335  VAVTPNHHIAGIVSTAFYAIWNLFSGFIIPRTRIPIWWRWYYWGCPVSWSLYGLVVSQYG  1394

Query  4135  DVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D++E +   +TV+ +VK +F FDHDF+G VA +++G  V+F FIFAFSIKAFNFQ R
Sbjct  1395  DIQEPITATQTVEGYVKDYFGFDHDFLGVVAAVVLGWTVLFAFIFAFSIKAFNFQRR  1451



>emb|CAN77690.1| hypothetical protein VITISV_022715 [Vitis vinifera]
Length=1471

 Score =  2090 bits (5416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1045/1460 (72%), Positives = 1246/1460 (85%), Gaps = 33/1460 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG EVFSRSSR+  +++   LKWAA+EKLPTY R+R+G+L      G   E+D+  
Sbjct  20    IWRNSGEEVFSRSSRDEDDEEA--LKWAALEKLPTYNRMRKGLLMGS--AGEASEVDIHN  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EK++L+ERLV+IA+EDNE FLLKL++R DRVGIDLP IEVRFEHL +DAEA+VGSR
Sbjct  76    LGFQEKKNLVERLVKIAEEDNEKFLLKLRNRIDRVGIDLPEIEVRFEHLTIDAEAHVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  N   N +E  +N L ILP+RKK   ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  136   ALPSFINSAFNQIEDILNTLRILPSRKKKXTILHDVSGIIKPRRMTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LAL+GKLDS LKV+G+VTYNGH M EFVP+RT+ YI+QHD HIGEMTVRETLAFSARCQG
Sbjct  196   LALSGKLDSSLKVTGKVTYNGHGMNEFVPQRTATYISQHDTHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMK-----------------AISIEGQEASVV  849
             VG RY+MLAELSRREK  NIKPDPDIDV+MK                 A++ EGQ+ +V+
Sbjct  256   VGDRYDMLAELSRREKAANIKPDPDIDVFMKEQNLLSLEFLKVLIGLMAVATEGQKENVI  315

Query  850   TDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSST  1029
             TDY LKILGLEVCAD LVGD+MIRGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSST
Sbjct  316   TDYTLKILGLEVCADTLVGDQMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSST  375

Query  1030  TFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQH  1209
             T+QIVNS+RQ+IHIL GTA+ISLLQPAPETY+LFDDIILLSD Q+VYQGPR++VL+FF+ 
Sbjct  376   TYQIVNSLRQTIHILNGTALISLLQPAPETYDLFDDIILLSDSQIVYQGPREDVLDFFES  435

Query  1210  MGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDEL  1389
             MGF+CPERKGVADFLQEVTSRKDQ+QYW R++E Y F+TV EF+EAFQSFH+G+KLG EL
Sbjct  436   MGFRCPERKGVADFLQEVTSRKDQQQYWARKDEPYSFVTVKEFAEAFQSFHIGRKLGHEL  495

Query  1390  AVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAM  1569
             A PFDK+KSHPAAL  +KYGV KKELL AC SRE+LLMKRNSFVYIFK+ QL++MA ++M
Sbjct  496   ATPFDKTKSHPAALKTEKYGVRKKELLDACISREYLLMKRNSFVYIFKLTQLIIMAAISM  555

Query  1570  TVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPW  1749
             T+FLRTEM KNS  DG+++ GALFF V+M MFNG SELA++I KLP FYKQR L F+P W
Sbjct  556   TIFLRTEMHKNSTDDGSIYTGALFFTVVMIMFNGMSELAMTIAKLPVFYKQRGLLFYPAW  615

Query  1750  AYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTA  1929
             AYALP+WILKIP+T VEVA+WV M+YY IGFDP+ GR FKQ  LL+ VNQMASALFR  A
Sbjct  616   AYALPSWILKIPITFVEVAVWVFMSYYVIGFDPNVGRLFKQYLLLVLVNQMASALFRFIA  675

Query  1930  AAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLG  2109
             AAGR++IVANTFGS +++L+  LGGF+LSR++VKKWWIWGYW SPLMYAQNAI VNE+LG
Sbjct  676   AAGRNMIVANTFGSFSLLLLFALGGFVLSRENVKKWWIWGYWSSPLMYAQNAIVVNEFLG  735

Query  2110  KSW-RHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPL  2286
             KSW ++  + ++E+LGV VL+SRG F EA+WYWIG GAL+G++ + NF + +ALTYLN  
Sbjct  736   KSWSKNSSTDSTESLGVAVLKSRGFFTEAYWYWIGAGALLGFILVFNFCYTVALTYLNAF  795

Query  2287  GKPQAMLSEETLAERNACKRGEPIELE------LKGGSTSEKgnvvrrsvssrslssrvg  2448
              KPQA+++EE+       K G  IEL       +   +++E+   + RS+SS S S R  
Sbjct  796   EKPQAVITEES----ENSKTGGKIELSSHRRGSIDQTASTERREEIGRSISSTSSSVRAE  851

Query  2449  svnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPG  2628
             ++  A  N K+GMVLPF+PL ITF++I+Y+VDMP EMK+QG+ EDRL LLKG++GAFRPG
Sbjct  852   AIAEARRNNKKGMVLPFQPLSITFEDIRYSVDMPEEMKSQGVLEDRLELLKGVSGAFRPG  911

Query  2629  VLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSP  2808
             VLTALMG+SGAGKTTLMDVLAGRKTGGYIEG+I ISGYPK+QETFARI GYCEQ DIHSP
Sbjct  912   VLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNINISGYPKKQETFARIXGYCEQNDIHSP  971

Query  2809  HVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRK  2988
             HVT++ESL+YSAWLRLP ++D+ TR+MF+EEVM+LVELT L+++LVGLPGVNGLSTEQRK
Sbjct  972   HVTIHESLLYSAWLRLPADVDSKTRKMFIEEVMELVELTPLKDSLVGLPGVNGLSTEQRK  1031

Query  2989  RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDA  3168
             RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+A
Sbjct  1032  RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEA  1091

Query  3169  FDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAA  3348
             FDELLLLKRGG+EIYVGPLGRHSS LI+YFE I G+ +I+ GYNPATWMLE+T+ AQE  
Sbjct  1092  FDELLLLKRGGQEIYVGPLGRHSSHLIKYFEGIEGVSKIKGGYNPATWMLEVTTSAQEFL  1151

Query  3349  LGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSY  3528
             LG+DF E+Y+NS+LYRRNK LI+ELS+PAPGSKDLYFPT+YSQSFFTQCMACLWKQ  SY
Sbjct  1152  LGVDFTEIYKNSDLYRRNKDLIKELSQPAPGSKDLYFPTQYSQSFFTQCMACLWKQRRSY  1211

Query  3529  WRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSV  3708
             WRNPPYTAVR  FTTF AL+FGTMFW +G KR+ QQDL NAMG MYAAV+FLGVQN++SV
Sbjct  1212  WRNPPYTAVRFFFTTFIALIFGTMFWDLGTKRKKQQDLSNAMGSMYAAVLFLGVQNSSSV  1271

Query  3709  QPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAK  3888
             QPVVA+ERTVFYRERAAGMYSA+PYAF Q ++E+P++F Q ++YGVIVYAMIGFEWTAAK
Sbjct  1272  QPVVAVERTVFYRERAAGMYSAMPYAFAQALVEIPYVFAQAVVYGVIVYAMIGFEWTAAK  1331

Query  3889  FLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWW  4068
             F W++FFM+FTLLYFT YGMM VA TPN +IAAI+++AFYG WNLFSGFI+P+TRIPVWW
Sbjct  1332  FFWYLFFMFFTLLYFTFYGMMAVAATPNQHIAAIVAAAFYGLWNLFSGFIVPRTRIPVWW  1391

Query  4069  RWYYYICPVSWTLYGLIASQFGDVKEKL-DTNETvkdfvksffdfdhdfvGYVATIIVGI  4245
             RWYY+ CPV+WTLYGL+ SQFGD++++  DT +TV+ ++  +F F+HDF+G VA +IVG 
Sbjct  1392  RWYYWACPVAWTLYGLVTSQFGDIQDRFEDTGDTVEQYLNDYFGFEHDFLGVVAAVIVGF  1451

Query  4246  CVMFGFIFAFSIKAFNFQTR  4305
              ++F FIFAF+IKAFNFQ R
Sbjct  1452  TILFLFIFAFAIKAFNFQRR  1471



>ref|XP_007226604.1| hypothetical protein PRUPE_ppa023430mg [Prunus persica]
 gb|EMJ27803.1| hypothetical protein PRUPE_ppa023430mg [Prunus persica]
Length=1397

 Score =  2088 bits (5409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1027/1435 (72%), Positives = 1207/1435 (84%), Gaps = 51/1435 (4%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ +E FS+SS    +D+E  L WAAIE+LPTYLRIRRG+LA EE+G   + IDV  
Sbjct  14    MWRNTSMEAFSKSSHHEEDDEES-LTWAAIERLPTYLRIRRGLLA-EEDGQAREIIDVNN  71

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++SLLERLV+IA+EDNE FLLKLK R +RVG++ PT EVRFEHLNV+AEAYVG R
Sbjct  72    LGLLERKSLLERLVKIAEEDNEKFLLKLKDRMNRVGLEFPTTEVRFEHLNVEAEAYVGGR  131

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP++FNF+ N+LE F+NYLHI+P+RKKPLPILHDVSGIIKP RMTLLLGPP SGKTTLL
Sbjct  132   ALPSVFNFSINMLEGFLNYLHIIPSRKKPLPILHDVSGIIKPRRMTLLLGPPGSGKTTLL  191

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK+SGRVTYNGH M EF+P RTSAYI+QHDLHI E+TVRETLAFSARCQG
Sbjct  192   LALAGKLGKDLKLSGRVTYNGHGMEEFIPERTSAYISQHDLHIPELTVRETLAFSARCQG  251

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML ELSRREK  NIKPDPD+DVYMKA ++EGQE +VVTDYI+K+LGLEVCAD +
Sbjct  252   VGPRYEMLVELSRREKAANIKPDPDLDVYMKAAALEGQETNVVTDYIIKVLGLEVCADTM  311

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+M RGISGGQ+KRLTTGEMLVGP +ALFMDEISTGLDSSTTF IVNS+RQSIHIL G
Sbjct  312   VGDQMRRGISGGQKKRLTTGEMLVGPEKALFMDEISTGLDSSTTFHIVNSLRQSIHILNG  371

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETYELFDDIILLSDG++VYQGPR+NVLEFF+H GFKCPERKGVADFLQE
Sbjct  372   TALISLLQPAPETYELFDDIILLSDGRIVYQGPRENVLEFFEHRGFKCPERKGVADFLQE  431

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  +++ Y F+T  EFSEA QSF +G++LGDELA PFDKSK +PAAL+  
Sbjct  432   VTSRKDQEQYWADKDKPYSFVTSNEFSEAMQSFRIGRELGDELATPFDKSKGNPAALTTN  491

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KKEL KAC SR+ LLMKRNSFVYIFKM Q ++MAF  MT+FLRTEM + ++ DG 
Sbjct  492   KYGVSKKELYKACMSRQVLLMKRNSFVYIFKMTQFIIMAFTTMTLFLRTEMHRRTVEDGG  551

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MG+LF+ +++ MF GFSELA+++++LP F+KQRDL FFP WAY+LPT +++IP+T VE
Sbjct  552   IYMGSLFYTMMIIMFTGFSELAMTVMRLPVFFKQRDLLFFPAWAYSLPTCLIRIPLTFVE  611

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
               IWV MTYY IG+DP   RFFKQ  LL+C++QMA+ LFRL AA GRS +VANTFGS A+
Sbjct  612   AFIWVAMTYYVIGYDPSIERFFKQFILLLCISQMANGLFRLLAAVGRSPVVANTFGSAAL  671

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +++ VLGGFILSR+ +++W +WGYW SPL Y  NA++VNE+LGKSWRHVP+ ++E LGV 
Sbjct  672   LVLFVLGGFILSRESMQEWLLWGYWFSPLTYGMNALAVNEFLGKSWRHVPANSTEPLGVM  731

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRG+ PEAHWYWIGV A +G+V L NFLF  AL YL+ +G      S E+++  +  
Sbjct  732   VLKSRGVLPEAHWYWIGVVASLGFVLLFNFLFTFALQYLDRVGNE----SLESVSTNHTR  787

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             +R                                             GMVLPFE L +TF
Sbjct  788   RR---------------------------------------------GMVLPFETLSMTF  802

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             +EI+YAVDMP EMKA+G+TEDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  803   NEIRYAVDMPQEMKAEGITEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  862

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEGSI +SGYPK QETFARI+GYCEQTDIHSPHVTVYESLVYSAWLRLPP +D+ T
Sbjct  863   TGGYIEGSIIVSGYPKNQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPGVDSPT  922

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELTS+REALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  923   RKMFIEEVMELVELTSIREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  982

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIYVGPLG  SS
Sbjct  983   DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYVGPLGHQSS  1042

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI YFE ING+ ++RDGYNPATWMLE+TS  QEAALG++F ++Y+NSE+YRRNKALI+E
Sbjct  1043  QLINYFEGINGVSKLRDGYNPATWMLEVTSAGQEAALGVNFTDIYKNSEVYRRNKALIKE  1102

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P P S+DL+FPT+YSQSFFTQC+ACLWKQHWSYWRNP Y+AVRLL+T   AL+FG +
Sbjct  1103  LSTPPPNSRDLFFPTQYSQSFFTQCIACLWKQHWSYWRNPSYSAVRLLYTAVMALVFGII  1162

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR  QQDLFNAMG MY+AV+F+G+QNA+SVQPVV IER VFYRERAAGMYSA P
Sbjct  1163  FWDLGSKRHRQQDLFNAMGSMYSAVLFIGIQNASSVQPVVGIERVVFYRERAAGMYSAFP  1222

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YA GQV+IELP+  +QT+IYGVIVY+MIGFEWT +KFLW IFFMYFT LY+ LYGMM V 
Sbjct  1223  YALGQVLIELPYTSIQTIIYGVIVYSMIGFEWTVSKFLWHIFFMYFTFLYYILYGMMIVG  1282

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPN  IAA+ SSAFY  WN+FSGFIIPKTRIP+WWRW+Y++CPVSWTLYGL  SQFG +
Sbjct  1283  ITPNTTIAAVASSAFYPLWNVFSGFIIPKTRIPIWWRWFYWVCPVSWTLYGLFTSQFGGI  1342

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K+ LD+ ETV DF++++F +  DF+G VA + VGI  +FGFIFAFSIK FNFQ R
Sbjct  1343  KDTLDSGETVDDFIRAYFGYTKDFLGVVAIVHVGISGLFGFIFAFSIKVFNFQKR  1397



>ref|XP_011034492.1| PREDICTED: pleiotropic drug resistance protein 1-like [Populus 
euphratica]
 ref|XP_011034493.1| PREDICTED: pleiotropic drug resistance protein 1-like [Populus 
euphratica]
Length=1449

 Score =  2087 bits (5407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1033/1434 (72%), Positives = 1215/1434 (85%), Gaps = 8/1434 (1%)
 Frame = +1

Query  4     WRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKL  183
             WR++ VE FSRSSRE  +++   LKWAAIEKLPTY R+R+GIL +  +G    E+D+EKL
Sbjct  24    WRNTTVEAFSRSSREEDDEEA--LKWAAIEKLPTYDRLRKGILTSASKGVA-NEVDIEKL  80

Query  184   GVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRA  363
             GV E++ LLERLV++A+EDNE FL KLK R +RVGID+PTIEVR+++LN++AEAYVGS A
Sbjct  81    GVQERKQLLERLVKVAEEDNEKFLWKLKDRVERVGIDVPTIEVRYDNLNIEAEAYVGSGA  140

Query  364   LPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlll  543
             LP+   FT NI+E  +  L+IL NRKKP  IL DVSGI+KP+R+TLLLGPPSSGKTTLLL
Sbjct  141   LPSFAKFTFNIIEGLLISLNILRNRKKPFTILKDVSGIVKPSRLTLLLGPPSSGKTTLLL  200

Query  544   alagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGV  723
             ALAGKLD +LK SGRVTYNGHEM EFVP+RT+AYI+QHDLHIGEMTVRETLAFSARCQGV
Sbjct  201   ALAGKLDPNLKFSGRVTYNGHEMNEFVPQRTAAYISQHDLHIGEMTVRETLAFSARCQGV  260

Query  724   GHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILV  903
             G+ ++MLAELSRREKE NIKPDPD+DV+MKA++ +G EA+V+TDY++KILGLE+CAD +V
Sbjct  261   GYLHDMLAELSRREKEANIKPDPDVDVFMKAVASQGDEANVITDYVIKILGLEICADTMV  320

Query  904   GDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGT  1083
             GDEMIRGISGGQRKR+TTGEMLVGP+RALFMDEI++GLDSSTT+QIVNS+R ++HIL  T
Sbjct  321   GDEMIRGISGGQRKRVTTGEMLVGPSRALFMDEITSGLDSSTTYQIVNSLRHTVHILNCT  380

Query  1084  AVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEV  1263
             AVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+ VL+FF+HMGF+CPERKGVADFLQEV
Sbjct  381   AVISLLQPAPETYDLFDDIILLSDGQIVYQGPRERVLDFFEHMGFECPERKGVADFLQEV  440

Query  1264  TSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKK  1443
             TSRKDQEQYW R+++ Y FIT  EF+EAFQSF+VG++  +EL++PFDKSK+HPAAL  K 
Sbjct  441   TSRKDQEQYWARKDQPYRFITANEFAEAFQSFNVGRRTAEELSIPFDKSKNHPAALVTKT  500

Query  1444  YGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTV  1623
             +G  KK+LLKA  SRE+LLMKRNSFVYIFK+ QL +MA ++MT+F RTEM ++++ DG +
Sbjct  501   HGAGKKDLLKANFSREYLLMKRNSFVYIFKISQLTIMALISMTLFFRTEMHRDTVTDGGI  560

Query  1624  FMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEV  1803
             + GALFF  IM MFNG SEL+++I KLP FYKQRDL FFP WAYA+P WILKIPV  VEV
Sbjct  561   YTGALFFTAIMIMFNGMSELSMTIAKLPVFYKQRDLRFFPSWAYAIPQWILKIPVAFVEV  620

Query  1804  AIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMI  1983
               WV +TYY IGFDP+  R FKQ FLL+ +NQMASALFR  AAAGR++IVANTFGS A++
Sbjct  621   GAWVFLTYYVIGFDPNVERLFKQYFLLLLINQMASALFRFIAAAGRNMIVANTFGSFALL  680

Query  1984  LVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTV  2163
              +  LGGFILSR+ +KKWWIWGYWISPLMY Q AI VNE+LG SW HVP  ++E LG+ V
Sbjct  681   TLFALGGFILSREKIKKWWIWGYWISPLMYGQTAIVVNEFLGNSWSHVPENSTEPLGIQV  740

Query  2164  LRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACK  2343
             L+SRG F EA+WYWIGVGA +G++ LLN  F LALT+LN   KPQA++SEE  ++ +  K
Sbjct  741   LKSRGFFTEAYWYWIGVGATIGFILLLNLFFVLALTFLNAFDKPQAVISEEPESDESGRK  800

Query  2344  RGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFD  2523
                 I+L   G S             + S +           N K+GMVLPFEP  ITF 
Sbjct  801   TERAIQLSNHGSSHGTNTEGGVGISRASSEAIGG-----VSNNRKKGMVLPFEPHSITFV  855

Query  2524  EIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKT  2703
             ++ Y+VDMP EMK QG+ EDRLVLL G+NGAFRPGVLTALMG+SGAGKTTLMDVLAGRKT
Sbjct  856   DVIYSVDMPQEMKVQGVVEDRLVLLNGVNGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  915

Query  2704  GGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATR  2883
             GGYIEG I ISGYPK+QE+FAR++GYCEQ DIHSP VTVYESL+YSAWLRLPPE+D+ TR
Sbjct  916   GGYIEGEIKISGYPKKQESFARVSGYCEQNDIHSPQVTVYESLLYSAWLRLPPEVDSETR  975

Query  2884  EMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  3063
              MF+EEVMDLVEL  LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  976   RMFIEEVMDLVELNPLRHALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1035

Query  3064  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQ  3243
             ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGG+EIYVGPLGRHS+ 
Sbjct  1036  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSTH  1095

Query  3244  LIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQEL  3423
             LI+YFE I G+ +I+DGYNPATWMLEI+S AQE AL +DF+ +Y+NS+L+RRNKALI EL
Sbjct  1096  LIKYFEAIEGVSKIKDGYNPATWMLEISSSAQEMALEVDFSNIYKNSDLFRRNKALIAEL  1155

Query  3424  SKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMF  3603
             S PAPGS DLYFPTKYS SF TQCMACLWKQHWSYWRNPPYTAVR LFTTF AL+FGTMF
Sbjct  1156  STPAPGSTDLYFPTKYSTSFLTQCMACLWKQHWSYWRNPPYTAVRFLFTTFIALMFGTMF  1215

Query  3604  WGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPY  3783
             W +G K  + QDL NAMG MYAAV+FLGVQNA+SVQPVVA+ERTVFYRERAAGMYSALPY
Sbjct  1216  WDLGSKVNSTQDLLNAMGSMYAAVLFLGVQNASSVQPVVAVERTVFYRERAAGMYSALPY  1275

Query  3784  AFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAV  3963
             AF QVVIELP++FVQ  +YG+IVYAMIGFEWT  KF W++FFMYFTLLYFT YGMM VA+
Sbjct  1276  AFAQVVIELPYIFVQAAVYGIIVYAMIGFEWTVVKFFWYLFFMYFTLLYFTFYGMMAVAM  1335

Query  3964  TPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVK  4143
             TPNH+IAAI+SSAFYG WNLFSGFI+P+  IP+WWRWYY+ CPVSWTLYGL+ SQFGD++
Sbjct  1336  TPNHHIAAIVSSAFYGIWNLFSGFIVPRPSIPIWWRWYYWACPVSWTLYGLVVSQFGDIQ  1395

Query  4144  EKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             ++L   +TV+++VK +F FDHDFVG VA  +VG  V+F FIFAF+IKAFNFQ R
Sbjct  1396  KELSETQTVEEYVKDYFGFDHDFVGVVAAAVVGWTVLFAFIFAFAIKAFNFQRR  1449



>ref|XP_010914974.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X2 [Elaeis guineensis]
Length=1455

 Score =  2087 bits (5407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1030/1417 (73%), Positives = 1205/1417 (85%), Gaps = 12/1417 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWA++EKLPTY R+R+GIL   E  G P+E+D+E L   E+++L+ERLVR+A+EDNE F
Sbjct  45    LKWASLEKLPTYNRLRKGILTITE--GQPREVDIENLSYQERKNLIERLVRVAEEDNEKF  102

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKL++R D+VGIDLPTIEVR+EHLNV+A AYVG+R LP+  N T N+LE   N LHI+P
Sbjct  103   LLKLRNRIDQVGIDLPTIEVRYEHLNVEARAYVGNRGLPSFINATVNVLEGLANLLHIVP  162

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK+PL ILHDVSGIIKP RMTLLLGPP SGKTTLLLALAGKL+SDLK SG VTYNGH M
Sbjct  163   SRKRPLEILHDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGKLESDLKASGTVTYNGHGM  222

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              +FVP+RT+AYI+QHDLHIG+MTVRETL+FSARCQGVG RY+MLAEL+RREK+ NIKPDP
Sbjct  223   DDFVPQRTAAYISQHDLHIGQMTVRETLSFSARCQGVGTRYDMLAELARREKQANIKPDP  282

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA ++  QE +VVTDYILKILGLEVCAD +VGDEM+RGISGGQRKR+TTGEM+V
Sbjct  283   DIDVFMKAAAMGNQETNVVTDYILKILGLEVCADTMVGDEMLRGISGGQRKRVTTGEMIV  342

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQIVNS RQSIHIL GTAVISLLQPAPETY+LFDDIILLS
Sbjct  343   GPARALFMDEISTGLDSSTTFQIVNSFRQSIHILAGTAVISLLQPAPETYDLFDDIILLS  402

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DG VVYQGPR++VLEFF+ MGF+CPERKGVADFLQEVTSRKDQ+QYWMR +E Y F+ V 
Sbjct  403   DGHVVYQGPREHVLEFFESMGFRCPERKGVADFLQEVTSRKDQQQYWMRHDEPYRFVPVR  462

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQSFHVG+KLG EL+VPFDKS SHPAAL++ KYG + KELLKA   RE LLMKRN
Sbjct  463   EFAEAFQSFHVGQKLGHELSVPFDKSSSHPAALASSKYGASSKELLKANIWRELLLMKRN  522

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVY F+  QL+ MA ++MT+FLRT M +++ +DG +++GALFF++IM MFNGFSELAL+
Sbjct  523   SFVYGFRAFQLMFMATISMTLFLRTNMHRDNTSDGGLYLGALFFSMIMIMFNGFSELALA  582

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP F+KQRD  F+P W YALP+WI+KIP+T VEV +WV +TYY IGFDP+ GR FKQ
Sbjct  583   IAKLPVFFKQRDYLFYPAWTYALPSWIIKIPITFVEVGVWVFLTYYVIGFDPNVGRLFKQ  642

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ VNQMAS LFR  AA GR++I+ANTFGS ++++++VLGGFILSR+DVKKWWIWGY
Sbjct  643   YMLLLLVNQMASGLFRFIAALGRNMIIANTFGSFSLLVLVVLGGFILSREDVKKWWIWGY  702

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             WISP+MY+QNA++ NE+LG SW  +    +E LGV VL+SRG F EA WYWIGVGALVGY
Sbjct  703   WISPMMYSQNALATNEFLGHSWSRILPNHTEPLGVEVLKSRGFFHEAKWYWIGVGALVGY  762

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGE-----PIELELKGGSTSEKg  2397
               L NFLF +ALTY+ P GK Q  +SEE L E+ +   GE     P E      STS+K 
Sbjct  763   TILFNFLFTVALTYIKPFGKAQPAVSEEALNEKYSNITGEMKSSSPAERSASRDSTSKKT  822

Query  2398  nvvrrsvssrslssrvgsvnvADPNMKR-GMVLPFEPLCITFDEIKYAVDMPTEMKAQGL  2574
                 R++ + S  +       A+PN K+ GMVLPF PLCITFD+I+Y+VDMP EMKAQG+
Sbjct  823   ANGSRNIEASSSMTDGV----ANPNQKKKGMVLPFTPLCITFDDIRYSVDMPQEMKAQGV  878

Query  2575  TEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQ  2754
               DRL LLKG++G+FRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYI+GSITISGYPK Q
Sbjct  879   EGDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGSITISGYPKNQ  938

Query  2755  ETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLR  2934
             ETFARI+GYCEQ DIHSPHVTVYESLVYSAWLRLP E+D+ATR+MFVEEVM+LVELTSLR
Sbjct  939   ETFARISGYCEQNDIHSPHVTVYESLVYSAWLRLPAEVDSATRKMFVEEVMELVELTSLR  998

Query  2935  EALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  3114
             EALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT
Sbjct  999   EALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  1058

Query  3115  GRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDG  3294
             GRTVVCTIHQPSIDIF+AFDEL LLKRGGEEIYVGPLGRHS  LI YFE I G+ +I+DG
Sbjct  1059  GRTVVCTIHQPSIDIFEAFDELFLLKRGGEEIYVGPLGRHSCHLIDYFEQIEGVSKIKDG  1118

Query  3295  YNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYS  3474
             YNPATWMLE+T++AQE  LG+DF+EVY+NSELYRRNKALI+ELS P PGS DL+FPT+Y+
Sbjct  1119  YNPATWMLEVTTQAQEQILGVDFSEVYKNSELYRRNKALIKELSMPPPGSSDLHFPTQYA  1178

Query  3475  QSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAM  3654
             Q F TQC+ACLWKQ  SYWRNPPYTAVR  FTT  A++FGT+FW +G K   +QDLFNAM
Sbjct  1179  QPFLTQCLACLWKQRLSYWRNPPYTAVRFFFTTAIAVMFGTIFWDLGTKTSNEQDLFNAM  1238

Query  3655  GCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTL  3834
             G MYAAV+F+GV N TSVQPVV+IERTVFYRERAAGMYSALPYAFGQV+IELP++ VQ L
Sbjct  1239  GSMYAAVLFIGVSNGTSVQPVVSIERTVFYRERAAGMYSALPYAFGQVLIELPYVLVQAL  1298

Query  3835  IYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGF  4014
             +YGVIVYAMI FEWTAAKF W+IFFMYFTLLYFT YGMMTV +TPN NIAAIIS+ F G 
Sbjct  1299  VYGVIVYAMIAFEWTAAKFFWYIFFMYFTLLYFTFYGMMTVGMTPNINIAAIISAGFVGL  1358

Query  4015  WNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksff  4194
             WNLFSGFIIP+  +PVWWRWY++  PV+WTLYGL+ SQFGDV+++  T +TV ++V++ F
Sbjct  1359  WNLFSGFIIPRPSMPVWWRWYFWASPVAWTLYGLVTSQFGDVEDRFHTGQTVSEYVRTHF  1418

Query  4195  dfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              F HDF+G VA ++ G  V+F F+F  +IK  NFQ R
Sbjct  1419  GFRHDFLGVVAVVVPGFAVLFAFLFGLTIKILNFQKR  1455



>ref|XP_010249928.1| PREDICTED: putative pleiotropic drug resistance protein 7 [Nelumbo 
nucifera]
Length=1453

 Score =  2087 bits (5407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1026/1439 (71%), Positives = 1233/1439 (86%), Gaps = 10/1439 (1%)
 Frame = +1

Query  4     WRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKL  183
             WR++  +VFSRSS +  +++   LKWAAIEKLPTY RIR+GIL   +  G  KEID++ L
Sbjct  20    WRNATEDVFSRSSYDEDDEEA--LKWAAIEKLPTYDRIRKGILTGLD--GEHKEIDIKNL  75

Query  184   GVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRA  363
             G+ ++R+L+ERL+R+A+EDNE FLLKLK R +RVGI+ PTIEVRFE LN+ AEAY+GSRA
Sbjct  76    GLQDRRNLIERLIRVAEEDNEKFLLKLKDRMERVGIENPTIEVRFEQLNIGAEAYIGSRA  135

Query  364   LPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlll  543
             LPTI NF+ N+LE F+N + I P+RK+P+ ILHD+SGIIKP RMTLLLGPP SGKTTLLL
Sbjct  136   LPTILNFSMNMLETFLNSVRIFPSRKRPISILHDLSGIIKPGRMTLLLGPPGSGKTTLLL  195

Query  544   alagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGV  723
             AL+GKLDS+LKVSG++T+N H + EFVP+RT+AYI+Q+DLHIGEMTVRETLAFSARCQGV
Sbjct  196   ALSGKLDSELKVSGKITFNDHGLDEFVPQRTAAYISQYDLHIGEMTVRETLAFSARCQGV  255

Query  724   GHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILV  903
             G RY+ML ELSRREK  NIKPDPDIDVYMKA S+EGQ+ +V+TDYILKILGLE+CAD +V
Sbjct  256   GTRYDMLTELSRREKAANIKPDPDIDVYMKASSLEGQKENVITDYILKILGLEICADTMV  315

Query  904   GDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGT  1083
             G+EMIRGISGGQRKR+TTGEMLVGPA+ALFMDEISTGLDSSTTFQIVNS++QS HIL GT
Sbjct  316   GNEMIRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSLKQSTHILGGT  375

Query  1084  AVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEV  1263
              +I+LLQPAPETY+LFDDIILLS+GQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQEV
Sbjct  376   TLIALLQPAPETYDLFDDIILLSEGQIVYQGPRENVLEFFESMGFKCPERKGVADFLQEV  435

Query  1264  TSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKK  1443
             TSRKDQ+QYW  ++  Y +++V EF++AFQSFHVG+KLGDEL+V FD+ KSHPAAL+  K
Sbjct  436   TSRKDQQQYWTNKDVPYFYVSVKEFADAFQSFHVGRKLGDELSVSFDRRKSHPAALTTSK  495

Query  1444  YGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTV  1623
             YG++KKELLKAC SRE+LLMKRNSFVYIFKM+QL+++  +AMTV LRT+M   +I DG V
Sbjct  496   YGISKKELLKACFSREWLLMKRNSFVYIFKMMQLIVVGLIAMTVLLRTKMKHGTIDDGNV  555

Query  1624  FMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEV  1803
             +MGALFFA++  MFNGF+E+++++ KLP FYKQRDL F+P WAYALPTWILKIP++ VEV
Sbjct  556   YMGALFFALVTLMFNGFAEISMTVAKLPVFYKQRDLRFYPSWAYALPTWILKIPISFVEV  615

Query  1804  AIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMI  1983
             AIWV MTYY IGFDP+  R F+   LL+ +NQMAS LFR+ A+ GR ++V++TFGS  ++
Sbjct  616   AIWVAMTYYVIGFDPNIQRMFRHYLLLLLINQMASGLFRVVASLGRDMVVSSTFGSFVLL  675

Query  1984  LVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTV  2163
             +VL LGGF+LSR+D+KKWWIWGYW SPL YAQNA++VNE+LG SW HV   +SE LG+ V
Sbjct  676   IVLALGGFVLSREDIKKWWIWGYWSSPLTYAQNAVAVNEFLGHSWSHVLPNSSEPLGIQV  735

Query  2164  LRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACK  2343
             L+SRG F  + W+WIG GAL+GYV L N +F LAL YLNP+GK Q +L+EE L E++A +
Sbjct  736   LKSRGNFTSSSWFWIGAGALIGYVLLFNGIFTLALAYLNPIGKSQVVLTEEALKEKHANR  795

Query  2344  RGE-----PIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPL  2508
              GE     P     +  S S +  +  R  S++S SS + +      N K+GMVLPF P 
Sbjct  796   TGEIGDAEPSPRGKRSSSRSTERGLQIRKNSTKSRSSGIEASFDGSQN-KKGMVLPFVPF  854

Query  2509  CITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVL  2688
              +TFD I+Y+VDMP EMK QG+ EDRLVLL G++G+FRPGVLTALMG SGAGKTTLMDVL
Sbjct  855   SLTFDNIRYSVDMPQEMKDQGVLEDRLVLLNGVSGSFRPGVLTALMGTSGAGKTTLMDVL  914

Query  2689  AGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEI  2868
             AGRKTGGYIEGSITISGYPK+QETFARI+GYCEQ DIHSP+VTVYESL+YSAWLRLPPE+
Sbjct  915   AGRKTGGYIEGSITISGYPKKQETFARISGYCEQNDIHSPYVTVYESLLYSAWLRLPPEV  974

Query  2869  DTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEP  3048
             D+ATREMFV+EVM+LVELTSLR +LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEP
Sbjct  975   DSATREMFVDEVMELVELTSLRGSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEP  1034

Query  3049  TSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLG  3228
             TSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF++FDEL L+KRGGEEIYVGPLG
Sbjct  1035  TSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFESFDELFLMKRGGEEIYVGPLG  1094

Query  3229  RHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKA  3408
              HS  LI+YFE I+G+ +I+DGYNPATWMLE+T+ AQE  LGI FAE+Y+NS+L++RNKA
Sbjct  1095  CHSCHLIKYFEGIDGVPKIKDGYNPATWMLEVTTAAQEEILGIKFAELYKNSDLFQRNKA  1154

Query  3409  LIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALL  3588
             LI+ELSKP PGSKDL FPTKYSQ FFTQC ACLWKQH SYWRNP YTAVRLLFT+F AL+
Sbjct  1155  LIEELSKPPPGSKDLLFPTKYSQPFFTQCKACLWKQHMSYWRNPAYTAVRLLFTSFIALM  1214

Query  3589  FGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMY  3768
             FGTMFW +G K   +QDLFNAMG MYAAV+F+G+QNA+SVQPVVA+ERTVFYRERAAGMY
Sbjct  1215  FGTMFWRLGSKTTRRQDLFNAMGSMYAAVLFIGIQNASSVQPVVAVERTVFYRERAAGMY  1274

Query  3769  SALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGM  3948
             SALPYAF QVVIE+PH+ +Q LIYGV+VYAMI F+WTA KF W++F+MYFT LYFT YGM
Sbjct  1275  SALPYAFAQVVIEIPHILIQALIYGVLVYAMIDFDWTAKKFFWYLFYMYFTFLYFTYYGM  1334

Query  3949  MTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQ  4128
             M V +TPNH  AAI+SSAFY  WNLF+GFIIP+TRIPVWWRWYY+ CPV+WTLYGL+ASQ
Sbjct  1335  MAVGLTPNHAFAAIVSSAFYSIWNLFAGFIIPRTRIPVWWRWYYWSCPVAWTLYGLVASQ  1394

Query  4129  FGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             FG+++ ++DT  TVK+F++S+F F +D +G+++  I+G  V+F F+FAFSIKA NFQ R
Sbjct  1395  FGEIETEMDTGVTVKNFLESYFGFKNDSLGWISAGIIGFTVLFAFVFAFSIKALNFQRR  1453



>ref|XP_011020655.1| PREDICTED: pleiotropic drug resistance protein 1-like [Populus 
euphratica]
Length=1449

 Score =  2085 bits (5403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1036/1435 (72%), Positives = 1217/1435 (85%), Gaps = 8/1435 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR+S VEVFSRSSRE  +++   LKWAA+EKLPTY R+R+GIL +   G    E+D+E 
Sbjct  23    VWRNSTVEVFSRSSREEDDEEA--LKWAALEKLPTYDRLRKGILTSASRGI-ISEVDIEN  79

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LGV E++ LLERLV++A EDNE FL KLK+R +RVGI+ PTIEVR+E+LN++AEAYVGS 
Sbjct  80    LGVQERKQLLERLVKVADEDNEKFLWKLKNRVERVGIEFPTIEVRYENLNIEAEAYVGSS  139

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+   FT NI+E F   LH+L +RKKPL IL DVSGIIKP+R+TLLLGPP+SGKTTLL
Sbjct  140   ALPSFAKFTFNIIEGFFIALHVLRSRKKPLTILKDVSGIIKPSRLTLLLGPPNSGKTTLL  199

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD  LK SG VTYNGHEM EFVP+RT+AY++QHDLHIGEMTVRETL FSARCQG
Sbjct  200   LALAGKLDPSLKFSGHVTYNGHEMNEFVPQRTAAYVSQHDLHIGEMTVRETLEFSARCQG  259

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VGH  EMLAELSRREKE NIKPDPD+DV+MKA++ +GQEA+V+TDY+LKILGLEVCAD L
Sbjct  260   VGHLQEMLAELSRREKEANIKPDPDVDVFMKAVATQGQEANVITDYVLKILGLEVCADTL  319

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKR+TTGEMLVGP+RAL MDEISTGLDSSTT+QIVNS++Q+IH+L  
Sbjct  320   VGDEMIRGISGGQRKRVTTGEMLVGPSRALLMDEISTGLDSSTTYQIVNSLKQTIHVLNC  379

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVL FF+HMGFKCP+RKGVADFLQE
Sbjct  380   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLGFFEHMGFKCPDRKGVADFLQE  439

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQYW  +++ Y F+TV EFSEAFQSF+ G+K+ DEL++PFDK+K+HPAAL NK
Sbjct  440   VTSKKDQEQYWAVKDQPYRFVTVNEFSEAFQSFNGGRKIADELSIPFDKTKNHPAALVNK  499

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG  K +LLKA  SRE+LLMKRNSFVYIFK+ QL ++A ++M++F RT+M  +++ADG 
Sbjct  500   KYGAGKMDLLKANFSREYLLMKRNSFVYIFKICQLTIVALISMSLFFRTKMHHDTVADGG  559

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF VIM MFNG SEL+++I KLP FYKQR+L FFPPWAY++P WILKIP+T VE
Sbjct  560   IYAGALFFTVIMIMFNGMSELSMTIAKLPVFYKQRELLFFPPWAYSIPPWILKIPITFVE  619

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA WV +TYY IGFDP+  R  +Q FLL+ +NQMASALFR  AAAGR++IVANTFGS A+
Sbjct  620   VAAWVFLTYYVIGFDPNVERLLRQYFLLLLINQMASALFRFIAAAGRNMIVANTFGSFAL  679

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + +  LGGFILSR+ +KKWWIWGYW+SPLMY QNAI VNE+LG SW H+P  + E LG+ 
Sbjct  680   LTLFALGGFILSREQIKKWWIWGYWLSPLMYGQNAIVVNEFLGHSWSHIPGTSKEPLGIQ  739

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SR  F EA+WYWIGVGA VG++ L N  F LALT+LN   KPQA + EE+    +  
Sbjct  740   VLKSREFFTEANWYWIGVGATVGFMLLFNIGFVLALTFLNAFEKPQAFIFEESERGGSVG  799

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K G  ++L   G S   K         +   S        A  N KRGMVLPFEP  ITF
Sbjct  800   KTGGAVQLSNHGSSHKNKTENGDEINRNGFASIGE-----ASDNRKRGMVLPFEPHSITF  854

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D++ Y+VDMP EMK QG+ EDRLVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  855   DDVIYSVDMPQEMKIQGVVEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  914

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG I ISGYPK+QETFARIAGYCEQ DIHSPHVTVYESL+YSAWLRLP E+D+ T
Sbjct  915   TGGYIEGDIKISGYPKKQETFARIAGYCEQNDIHSPHVTVYESLLYSAWLRLPHEVDSET  974

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVEL SL  ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  975   RKMFIEEVMELVELDSLSNALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1034

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLG HS+
Sbjct  1035  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGHHST  1094

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I G+ +I+DGYNPATWMLE+T+ +QE AL +DFA++Y+NS+L+RRNKALI E
Sbjct  1095  HLIKYFEGIEGVSKIKDGYNPATWMLEVTASSQEMALEVDFADIYKNSDLFRRNKALIAE  1154

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS PAPGSKD++FPT+YS SFFTQCMACLWKQHWSYWRNPPYTAVR LFTTF AL+FGTM
Sbjct  1155  LSTPAPGSKDVHFPTRYSTSFFTQCMACLWKQHWSYWRNPPYTAVRFLFTTFIALMFGTM  1214

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G K +T QDL NAMG MYAAV+FLG QN T+VQPVVA+ERTVFYRERAAGMYSALP
Sbjct  1215  FWDLGSKVKTTQDLINAMGSMYAAVLFLGFQNGTAVQPVVAVERTVFYRERAAGMYSALP  1274

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAF Q +IELP++FVQ  +YGVIVYAMIGFEWT AKF W++FFMYFTLLYFT YGMM VA
Sbjct  1275  YAFAQALIELPYIFVQAAVYGVIVYAMIGFEWTVAKFFWYLFFMYFTLLYFTFYGMMAVA  1334

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNH+IAAI+S+AFY  WNLFSGFIIP+TRIP+WWRWYY+ CPVSW+LYGL+ SQ+GD+
Sbjct  1335  VTPNHHIAAIVSTAFYAIWNLFSGFIIPRTRIPIWWRWYYWGCPVSWSLYGLVVSQYGDI  1394

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +E +   +TV+++VK +  FDHDF+G VA +++G  V+F FIFAFSIKAFNFQ R
Sbjct  1395  QEPITATQTVEEYVKDYLGFDHDFLGVVAAVVLGWTVLFAFIFAFSIKAFNFQRR  1449



>ref|XP_006368914.1| hypothetical protein POPTR_0001s14650g, partial [Populus trichocarpa]
 gb|ERP65483.1| hypothetical protein POPTR_0001s14650g, partial [Populus trichocarpa]
Length=1457

 Score =  2085 bits (5401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1025/1434 (71%), Positives = 1207/1434 (84%), Gaps = 8/1434 (1%)
 Frame = +1

Query  4     WRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKL  183
             WR++ VE FSRSSRE  +++   LKWAAIEKLPTY R+R+GIL +  +G    E+D+EKL
Sbjct  32    WRNTTVEAFSRSSREEDDEEA--LKWAAIEKLPTYDRLRKGILTSASKGVA-NEVDIEKL  88

Query  184   GVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRA  363
             G+ E++ LLERLV++A+EDNE FL KLK R +RVGID+PTIEVR+++LN++AEAYVGS A
Sbjct  89    GLQERKQLLERLVKVAEEDNEKFLWKLKDRVERVGIDVPTIEVRYDNLNIEAEAYVGSSA  148

Query  364   LPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlll  543
             LP+   FT NI+E  +  L+IL NRKKPL IL DVSGI+KP+R+TLLLGPPSSGKTTLLL
Sbjct  149   LPSFAKFTFNIIEGLLISLNILRNRKKPLTILKDVSGIVKPSRLTLLLGPPSSGKTTLLL  208

Query  544   alagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGV  723
             ALAGKLD +LK SGRVTYNGHEM EFVP+RT+AYI+QHD+HIGEMTVRETLAFSARCQG 
Sbjct  209   ALAGKLDPNLKFSGRVTYNGHEMNEFVPQRTAAYISQHDVHIGEMTVRETLAFSARCQGA  268

Query  724   GHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILV  903
             G+ ++MLAELSRREKE NIKPDPD+DV+MKA++ +G EA+V+TDY+LKILGLE+CAD +V
Sbjct  269   GYLHDMLAELSRREKEANIKPDPDVDVFMKAVASQGDEANVITDYVLKILGLEICADTMV  328

Query  904   GDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGT  1083
             GDEMIRGISGGQRKR+TTGEMLVGP+RALFMDEISTGLDSSTT+QIVNS+R ++HIL  T
Sbjct  329   GDEMIRGISGGQRKRVTTGEMLVGPSRALFMDEISTGLDSSTTYQIVNSLRHTVHILNCT  388

Query  1084  AVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEV  1263
             AVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+ VLEFF+HMGFKCPERKGVADFLQEV
Sbjct  389   AVISLLQPAPETYDLFDDIILLSDGQIVYQGPRERVLEFFEHMGFKCPERKGVADFLQEV  448

Query  1264  TSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKK  1443
             TSRKDQEQYW R+++ Y FIT  EF+EAFQSF VG++  +EL++PFDKSK+HPAAL  K 
Sbjct  449   TSRKDQEQYWARKDQPYRFITANEFAEAFQSFTVGRRTAEELSIPFDKSKNHPAALVTKT  508

Query  1444  YGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTV  1623
             +G  KK+LLKA  SRE+LLMKRNSFVYIFK+ QL +MA ++MT+F RT+M ++++  G +
Sbjct  509   HGAGKKDLLKANFSREYLLMKRNSFVYIFKICQLTIMALISMTLFFRTKMHRDTVRHGGI  568

Query  1624  FMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEV  1803
             + GALFF  IM MFNG SEL+++I KLP FYKQRDL FFP WAYA P WILKIPV+ VEV
Sbjct  569   YTGALFFTAIMIMFNGMSELSMTIAKLPVFYKQRDLRFFPSWAYAFPQWILKIPVSFVEV  628

Query  1804  AIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMI  1983
             A WV +TYY IGFDP+  R FKQ  +L+ +NQ ASALFR  AAAGR++I+ANTFGS A++
Sbjct  629   AAWVFLTYYVIGFDPNVERLFKQYLVLLLINQTASALFRFIAAAGRNMIIANTFGSFALL  688

Query  1984  LVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTV  2163
              +  LGGFILSR+ +KKWWIWGYW SPLMY Q AI VNE+LG SW HVP  ++E LG+ V
Sbjct  689   TLFTLGGFILSREKIKKWWIWGYWSSPLMYGQTAILVNEFLGNSWSHVPENSTEPLGIQV  748

Query  2164  LRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACK  2343
             L+SRG F EA+WYWIG GA +G++ LLN  F LALT+LN   KPQA +SEE  ++ +  K
Sbjct  749   LKSRGFFTEAYWYWIGAGATIGFILLLNLFFVLALTFLNAFDKPQAFISEEPESDESGRK  808

Query  2344  RGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFD  2523
                 I+L   G S             + S             N K+GMVLPFEP  ITFD
Sbjct  809   TERAIQLSNHGSSHGTNTEGGVGISRASSEVIGG-----VSNNRKKGMVLPFEPHSITFD  863

Query  2524  EIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKT  2703
             +I Y+VDMP EMK QG+ +DRLVLL G+NGAFRPGVLTALMG+SGAGKTTLMDVLAGRKT
Sbjct  864   DIIYSVDMPQEMKVQGVVQDRLVLLNGVNGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  923

Query  2704  GGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATR  2883
             GGYI+G I ISGYPK+QETFAR++GYCEQ DIHSP VTVYESL+YSAWLRLPPE+D+ TR
Sbjct  924   GGYIDGEIKISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLYSAWLRLPPEVDSETR  983

Query  2884  EMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  3063
              MF+EEVMDLVEL  LR AL+GLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  984   RMFIEEVMDLVELNPLRHALIGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1043

Query  3064  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQ  3243
             ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGG+EIYVGPLGRHS+ 
Sbjct  1044  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSTH  1103

Query  3244  LIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQEL  3423
             LI+YFE I G+ +I+DGYNPATWMLEI+S AQE AL +DF+ +Y+NS+L+RRNKALI EL
Sbjct  1104  LIKYFEAIEGVSKIKDGYNPATWMLEISSSAQEMALEVDFSNIYKNSDLFRRNKALIVEL  1163

Query  3424  SKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMF  3603
             S PAPGS DLYFPTKYS SF TQCMACLWKQHWSYWRNPPYTAVR +FTTF AL+FGTMF
Sbjct  1164  STPAPGSTDLYFPTKYSTSFLTQCMACLWKQHWSYWRNPPYTAVRFIFTTFIALMFGTMF  1223

Query  3604  WGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPY  3783
             W +G K  + QDL NAMG MYAAV+FLGVQNA+SVQPVVA+ERTVFYRERAAGMYSALPY
Sbjct  1224  WDLGSKVSSTQDLSNAMGSMYAAVLFLGVQNASSVQPVVAVERTVFYRERAAGMYSALPY  1283

Query  3784  AFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAV  3963
             AF QV+IELP++F Q  +YG+IVYAMIGF+WT AKF W++FFMYFTLLYFT YGMM VAV
Sbjct  1284  AFAQVLIELPYIFAQAAVYGIIVYAMIGFDWTVAKFFWYLFFMYFTLLYFTYYGMMAVAV  1343

Query  3964  TPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVK  4143
             TPNH+IA+I+SSAFYG WNLFSGFI+P+  IP+WWRWY + CPV+WTLYGL+ SQFGD++
Sbjct  1344  TPNHHIASIVSSAFYGIWNLFSGFIVPRPSIPIWWRWYSWACPVAWTLYGLVVSQFGDIQ  1403

Query  4144  EKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +KL   +TVK++VK +F F HDF+G VA  IVG  V+F FIFAF+IKAFNFQ R
Sbjct  1404  KKLTETQTVKEYVKDYFGFHHDFLGVVAAAIVGWTVLFAFIFAFAIKAFNFQRR  1457



>ref|XP_010654718.1| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis 
vinifera]
Length=1459

 Score =  2084 bits (5400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1041/1443 (72%), Positives = 1230/1443 (85%), Gaps = 16/1443 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG EVFSRSSR+  +++   LKWAA+EKLPTY R+R+G+L   E  G   E+D+  
Sbjct  25    IWRNSGAEVFSRSSRDEDDEEA--LKWAALEKLPTYNRLRKGLLIGSE--GEASEVDIHN  80

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+++L+ERLV+IA+EDNE FLLKLK+R DRVGIDLP IEVRFEHL +DAEA+VGSR
Sbjct  81    LGPQERKNLVERLVKIAEEDNEKFLLKLKNRMDRVGIDLPEIEVRFEHLTIDAEAHVGSR  140

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  N   N +E  +N L ILP+RKK   ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  141   ALPSFINSVFNQIEDILNTLRILPSRKKKFTILHDVSGIIKPGRMTLLLGPPSSGKTTLL  200

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LAL+GKLDS LKV+GRVTYNGH M EFVP+RT+AYI+Q D HIGEMTVRETLAFSARCQG
Sbjct  201   LALSGKLDSSLKVTGRVTYNGHGMNEFVPQRTAAYISQLDTHIGEMTVRETLAFSARCQG  260

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+ML ELSRREK  NIKPDPDIDV+MKA + EGQ+ +V+TDY LKILGLE+CAD +
Sbjct  261   VGDRYDMLVELSRREKAANIKPDPDIDVFMKAAAAEGQKENVITDYTLKILGLEICADTM  320

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTT+QIVNS+RQ++HIL G
Sbjct  321   VGDEMVRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLRQTVHILNG  380

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSD +++YQGPR++VL FF+ MGF+CPERKGVADFLQE
Sbjct  381   TALISLLQPAPETYDLFDDIILLSDSRIIYQGPREDVLNFFESMGFRCPERKGVADFLQE  440

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++E Y F+T  EF+EAFQSFH G+KLGDELA PFDK+KSHPAAL  +
Sbjct  441   VTSRKDQEQYWAHKDEPYSFVTAKEFAEAFQSFHFGRKLGDELATPFDKTKSHPAALKTE  500

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKELL AC SRE+LLMKRNSFVYIFK+ QL ++A +AMT+FLRTEM KN+  DG 
Sbjct  501   KYGVRKKELLDACISREYLLMKRNSFVYIFKLTQLTIVAMIAMTIFLRTEMHKNTTEDGN  560

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF V+M MFNG SELA++ILKLP FYKQR L F+P WAYALP+W LKIP+T VE
Sbjct  561   IYTGALFFTVMMVMFNGMSELAMTILKLPVFYKQRGLLFYPAWAYALPSWFLKIPITFVE  620

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V +WV +TYY IGFDP+ GR F+Q  LL+ +NQ AS+LFR  AAA RS+IVANTFGS A+
Sbjct  621   VGVWVFITYYVIGFDPNVGRLFRQYLLLLLLNQTASSLFRFIAAACRSMIVANTFGSFAL  680

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSW-RHVPSGTSETLGV  2157
             +L   LGG +LSR++VKKWWIWGYW SP+MYAQNAI VNE+LGKSW ++  + ++E+LGV
Sbjct  681   VLPFALGGIVLSRENVKKWWIWGYWSSPMMYAQNAILVNEFLGKSWSKNASTNSTESLGV  740

Query  2158  TVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNA  2337
              VL++RG F EAHWYWIG GAL+G++F+ NF + +ALTYLNP  KPQA+++ E+    NA
Sbjct  741   AVLKARGFFTEAHWYWIGAGALLGFIFVFNFCYTVALTYLNPFEKPQAVITVES---DNA  797

Query  2338  CKRGEPIEL--ELKGG----STSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPF  2499
                G+ IEL    KG     +++E G  + RS+SS S S R  ++  A  N K+GMVLPF
Sbjct  798   KTEGK-IELSSHRKGSIDQTASTESGEEIGRSISSVSSSVRAEAIAEARRNNKKGMVLPF  856

Query  2500  EPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLM  2679
             +PL ITFD+I+Y+VDMP EMK+QG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLM
Sbjct  857   QPLSITFDDIRYSVDMPEEMKSQGVPEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  916

Query  2680  DVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLP  2859
             DVLAGRKTGGYIEGSI+ISGYPK+QETFARI+GYCEQ DIHSPHVTV+ESL+YSAWLRLP
Sbjct  917   DVLAGRKTGGYIEGSISISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLP  976

Query  2860  PEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  3039
             P +D  TR+MF+EEVM+LVELT LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM
Sbjct  977   PNVDAETRKMFIEEVMELVELTPLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  1036

Query  3040  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVG  3219
             DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGG+EIY+G
Sbjct  1037  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGQEIYMG  1096

Query  3220  PLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRR  3399
             PLGRHSS LI+YFE I G+ +I+DGYNPATWMLE+T+ AQE  LG+DF E+Y  S+LYRR
Sbjct  1097  PLGRHSSHLIKYFEGIEGVSKIKDGYNPATWMLEVTASAQELILGVDFTEIYEKSDLYRR  1156

Query  3400  NKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFN  3579
             NK LI+ELS+P PGSKDLYFPT+YSQSFFTQCMACLWKQ  SYWRNPPYTAVR  FTTF 
Sbjct  1157  NKDLIKELSQPTPGSKDLYFPTQYSQSFFTQCMACLWKQRLSYWRNPPYTAVRFFFTTFV  1216

Query  3580  ALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAA  3759
             AL+FGTMFW +G KR  QQD+ NAMG MYAAV+FLG QN  SVQPVVA+ERTVFYRERAA
Sbjct  1217  ALMFGTMFWDLGTKRTRQQDISNAMGSMYAAVLFLGFQNGQSVQPVVAVERTVFYRERAA  1276

Query  3760  GMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftl  3939
             GMYSA+PYAF Q ++E+P++F Q ++YGVIVYAMIGFEWTAAKF W++FFM+F+LLYFT 
Sbjct  1277  GMYSAMPYAFAQALVEIPYVFSQAVVYGVIVYAMIGFEWTAAKFFWYLFFMFFSLLYFTF  1336

Query  3940  yGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLI  4119
             YGMM VA TPN +IAAI++S+FY  WNLFSGFI+P+ RIPVWWRWYY+ CPV+W+LYGL+
Sbjct  1337  YGMMAVAATPNQHIAAIVASSFYTLWNLFSGFIVPRNRIPVWWRWYYWACPVAWSLYGLV  1396

Query  4120  ASQFGDVKEK-LDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNF  4296
              SQFGD+++  LD+N TVK ++  +F F HDF+G VA +IVG  V+F FIFAF+IKAFNF
Sbjct  1397  TSQFGDIEDTLLDSNVTVKQYLDDYFGFKHDFLGVVAVVIVGFTVLFLFIFAFAIKAFNF  1456

Query  4297  QTR  4305
             Q R
Sbjct  1457  QRR  1459



>ref|XP_002304713.2| hypothetical protein POPTR_0003s17740g [Populus trichocarpa]
 gb|EEE79692.2| hypothetical protein POPTR_0003s17740g [Populus trichocarpa]
Length=1480

 Score =  2083 bits (5397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1036/1461 (71%), Positives = 1218/1461 (83%), Gaps = 29/1461 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWR+S VEVFSRSSR+  +++   LKWAA+EKLPTY R+R+GIL +   G    E+D+E 
Sbjct  23    VWRNSTVEVFSRSSRDEDDEEA--LKWAALEKLPTYDRLRKGILTSASRGI-ISEVDIEN  79

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LGV E++ LLERLV++A EDNE FL KLK+R +RVGI+ PTIEVR+E+LN++AEAYVGS 
Sbjct  80    LGVQERKQLLERLVKVADEDNEKFLWKLKNRVERVGIEFPTIEVRYENLNIEAEAYVGSS  139

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+   F  NI+E F   LH+LP+RKKPL IL DVSGIIKP+R+TLLLGPP+SGKTTLL
Sbjct  140   ALPSFAKFIFNIIEGFFIALHVLPSRKKPLTILKDVSGIIKPSRLTLLLGPPNSGKTTLL  199

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD  LK SG VTYNGHEM EF+P+RT+AY++QHDLHIGEMTVRETL FSARCQG
Sbjct  200   LALAGKLDPSLKFSGHVTYNGHEMNEFIPQRTAAYVSQHDLHIGEMTVRETLEFSARCQG  259

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VGH +EMLAELSRREKE NIKPDPD+DV+MKA++ +GQEA+V+TDY+LKILGLEVCAD L
Sbjct  260   VGHLHEMLAELSRREKEANIKPDPDVDVFMKAVATQGQEANVITDYVLKILGLEVCADTL  319

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKR+TTGEMLVGP+RAL MDEISTGLDSSTT+QIVNS++Q+IH+L  
Sbjct  320   VGDEMIRGISGGQRKRVTTGEMLVGPSRALLMDEISTGLDSSTTYQIVNSLKQTIHVLNC  379

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVL FF+HMGFKCP+RKG ADFLQE
Sbjct  380   TAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLGFFEHMGFKCPDRKGAADFLQE  439

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQEQYW  +++ Y F+ V EFSEAFQSF+VG+K+ DEL++PFDK+K+HPAAL NK
Sbjct  440   VTSKKDQEQYWAIKDQPYRFVRVNEFSEAFQSFNVGRKIADELSIPFDKTKNHPAALVNK  499

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG  K +LLKA  SRE+LLMKRNSFVYIFK+ QL ++A ++M++F RT+M  +++ADG 
Sbjct  500   KYGAGKMDLLKANFSREYLLMKRNSFVYIFKICQLTIVALISMSLFFRTKMHHDTVADGG  559

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF VIM MFNG SEL+++I KLP FYKQR+L FFPPWAY++P WILKIPVT VE
Sbjct  560   IYTGALFFTVIMIMFNGMSELSMTIAKLPVFYKQRELLFFPPWAYSIPPWILKIPVTFVE  619

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA WV +TYY IGFDP+  R  +Q FLL+ +NQMASALFR  AAAGR++IVANTFGS A+
Sbjct  620   VAAWVFLTYYVIGFDPNVERLLRQYFLLLLINQMASALFRFIAAAGRNMIVANTFGSFAL  679

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + +  LGGFILSR+ +KKWWIWGYW+SPLMY QNAI VNE+LG SW H P  ++E LG+ 
Sbjct  680   LTLFALGGFILSREQIKKWWIWGYWLSPLMYGQNAIVVNEFLGHSWSHNPGNSTEPLGIQ  739

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SR  F EA+WYWIGVGA VG++ L N  F LALT+LN   KPQA + EE+  E +  
Sbjct  740   VLKSREFFTEANWYWIGVGATVGFMLLFNICFVLALTFLNAFEKPQAFIFEESEREGSVG  799

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnv--------------------  2460
             K G  ++L     S   K       +      S     +                     
Sbjct  800   KTGGAVQLSNHRSSHKNKTGKRTHLMKRVYGPSLPSLSDTNCQYICNLQAENGDEIIRNG  859

Query  2461  ------ADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFR  2622
                   A    KRGMVLPFEP  ITFD++ Y+VDMP EMK QG+ EDRLVLLKG++GAFR
Sbjct  860   FASIGEASDKRKRGMVLPFEPHSITFDDVIYSVDMPQEMKIQGVVEDRLVLLKGVSGAFR  919

Query  2623  PGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIH  2802
             PGVLTALMG+SGAGKTTLMDVLAGRKTGGYIEG I ISGYPK+QETFARIAGYCEQ DIH
Sbjct  920   PGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIKISGYPKKQETFARIAGYCEQNDIH  979

Query  2803  SPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQ  2982
             SPHVTVYESL+YSAWLRLPPE+D+ TR+MF+EEVM+LVEL SLR ALVGLPGVNGLSTEQ
Sbjct  980   SPHVTVYESLLYSAWLRLPPEVDSETRKMFIEEVMELVELDSLRNALVGLPGVNGLSTEQ  1039

Query  2983  RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF  3162
             RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF
Sbjct  1040  RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF  1099

Query  3163  DAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQE  3342
             +AFDEL L+KRGGEEIYVGPLG HS+ LI+YFE I G+ +I+DGYNPATWMLE+T+ +QE
Sbjct  1100  EAFDELFLMKRGGEEIYVGPLGHHSTHLIKYFEAIEGVSKIKDGYNPATWMLEVTASSQE  1159

Query  3343  AALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHW  3522
              AL +DFA +Y+NS+L+RRNKALI ELS PAPGSKD++FPT+YS SFFTQCMACLWKQHW
Sbjct  1160  MALEVDFANIYKNSDLFRRNKALIAELSTPAPGSKDVHFPTRYSTSFFTQCMACLWKQHW  1219

Query  3523  SYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNAT  3702
             SYWRNPPYTAVR LFTTF AL+FGTMFW +G K +T QDL NAMG MYAAV+FLG QN T
Sbjct  1220  SYWRNPPYTAVRFLFTTFIALMFGTMFWDLGSKVKTTQDLINAMGSMYAAVLFLGFQNGT  1279

Query  3703  SVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTA  3882
             +VQPVVA+ERTVFYRERAAGMYSALPYAF Q +IELP++FVQ  +YGVIVYAMIGFEWTA
Sbjct  1280  AVQPVVAVERTVFYRERAAGMYSALPYAFAQALIELPYVFVQAAVYGVIVYAMIGFEWTA  1339

Query  3883  AKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPV  4062
             AKF W++FFMYFTLLYFT YGMM VAVTPNH+IAAI+S+AFY  WNLFSGFIIP+TRIP+
Sbjct  1340  AKFFWYLFFMYFTLLYFTFYGMMAVAVTPNHHIAAIVSTAFYAIWNLFSGFIIPRTRIPI  1399

Query  4063  WWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVG  4242
             WWRWYY+ CPVSW+LYGL+ SQ+GD++E +   +TV+ +VK +  FDHDF+G VA +++G
Sbjct  1400  WWRWYYWGCPVSWSLYGLVVSQYGDIQEPITATQTVEGYVKDYLGFDHDFLGVVAAVVLG  1459

Query  4243  ICVMFGFIFAFSIKAFNFQTR  4305
               V+F FIFAFSIKAFNFQ R
Sbjct  1460  WTVLFAFIFAFSIKAFNFQRR  1480



>emb|CBI36227.3| unnamed protein product [Vitis vinifera]
Length=1451

 Score =  2080 bits (5390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1039/1440 (72%), Positives = 1232/1440 (86%), Gaps = 13/1440 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG EV   S     EDDEEALKWAA+EKLPTY R+R+G+L      G   E+D+  
Sbjct  20    IWRNSGEEV--SSRSSRDEDDEEALKWAALEKLPTYNRMRKGLLMGS--AGEASEVDIHN  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EK++L+ERLV+IA+EDNE FLLKL++R DRVGIDLP IEVRFEHL +DAEA+VGSR
Sbjct  76    LGFQEKKNLVERLVKIAEEDNEKFLLKLRNRIDRVGIDLPEIEVRFEHLTIDAEAHVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  N   N +E  +N L ILP+RKK   ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  136   ALPSFINSAFNQIEDILNTLRILPSRKKKFTILHDVSGIIKPRRMTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LAL+GKLDS LKV+G+VTYNGH M EFVP+RT+ YI+QHD HIGEMTVRETLAFSARCQG
Sbjct  196   LALSGKLDSSLKVTGKVTYNGHGMNEFVPQRTATYISQHDTHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+MLAELSRREK  NIKPDPDIDV+MKA + EGQ+ +V+TDY LKILGLEVCAD L
Sbjct  256   VGDRYDMLAELSRREKAANIKPDPDIDVFMKAAATEGQKENVITDYTLKILGLEVCADTL  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTT+QIVNS+RQ+IHIL G
Sbjct  316   VGDQMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLRQTIHILNG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSD Q+VYQGPR++VL+FF+ MGF+CPERKGVADFLQE
Sbjct  376   TALISLLQPAPETYDLFDDIILLSDSQIVYQGPREDVLDFFESMGFRCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ+QYW R++E Y F+TV +F+EAFQSFH G+K+GDELA PFDK+KSHPAAL  +
Sbjct  436   VTSRKDQQQYWARKDEPYSFVTVKQFAEAFQSFHSGRKVGDELATPFDKTKSHPAALKTE  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKELL AC SRE+ LMKRNSFVYI ++ QL++MA ++MT+FLRTEM KNS  DG+
Sbjct  496   KYGVRKKELLDACISREYWLMKRNSFVYILQLTQLIIMAAISMTIFLRTEMHKNSTDDGS  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFF V+M MFNG SELA++I KLP FYKQR L F+P WAYAL +WILKIP+T VE
Sbjct  556   IYMGALFFTVVMIMFNGMSELAMTIAKLPVFYKQRGLLFYPAWAYALSSWILKIPITFVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV M+YY IGFDP+ GR FKQ  LL+ VNQMASALFR  AAAGR++IVANTFGS ++
Sbjct  616   VAVWVFMSYYVIGFDPNVGRLFKQYLLLVLVNQMASALFRFIAAAGRNMIVANTFGSFSL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSW-RHVPSGTSETLGV  2157
             +L+  LGGF+LSR++VKKWWIWGYW SPLMYAQNAI VNE+LGKSW ++  + ++E+LGV
Sbjct  676   LLLFALGGFVLSRENVKKWWIWGYWSSPLMYAQNAIVVNEFLGKSWSKNSSTNSTESLGV  735

Query  2158  TVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNA  2337
              VL+SRG F EA+WYWIG GAL+G++ + NF + +ALTYLN   KPQA+++EE+      
Sbjct  736   AVLKSRGFFTEAYWYWIGAGALLGFILVFNFCYTVALTYLNAFEKPQAVITEES----EN  791

Query  2338  CKRGEPIELEL-KGGSTSEKgnvvrrsvssrslssrvgsvnvADP--NMKRGMVLPFEPL  2508
              K G  IEL   + GS  +  +      S  S SS V +  +A+   N KRGMVLPF+PL
Sbjct  792   SKTGGKIELSSHRRGSIDQTASTDEIGRSISSTSSSVRAEAIAEARRNTKRGMVLPFQPL  851

Query  2509  CITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVL  2688
              ITFD+I+Y+VDMP EMK+QG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVL
Sbjct  852   SITFDDIRYSVDMPEEMKSQGVLEDRLKLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVL  911

Query  2689  AGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEI  2868
             AGRKTGGYIEG+I ISGYPK+QETF RI+GYCEQ DIHSPHVT++ESL+YSAWLRLP ++
Sbjct  912   AGRKTGGYIEGNINISGYPKKQETFTRISGYCEQNDIHSPHVTIHESLLYSAWLRLPADV  971

Query  2869  DTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEP  3048
             D+ TR+MF+E+VM+LVELT L+++LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEP
Sbjct  972   DSKTRKMFIEKVMELVELTPLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEP  1031

Query  3049  TSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLG  3228
             TSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLLLKRGG+EIYVG LG
Sbjct  1032  TSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQEIYVGLLG  1091

Query  3229  RHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKA  3408
             RHSS LI+YFE I G+ +I+ GYNPATWMLE+T+ AQE  LG+DF E+Y+NS LYRRNK 
Sbjct  1092  RHSSCLIKYFEGIEGVSKIKGGYNPATWMLEVTTSAQEFLLGVDFTEIYKNSNLYRRNKD  1151

Query  3409  LIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALL  3588
             LI+ELS+PAPGSKDLYFPT+YSQSFFTQCMACLWKQ  SYWRNPPYTAVR  FTTF AL+
Sbjct  1152  LIKELSQPAPGSKDLYFPTQYSQSFFTQCMACLWKQRRSYWRNPPYTAVRFFFTTFIALI  1211

Query  3589  FGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMY  3768
             FGTMFW +G KR  QQDL NAMG MYAAV+FLGVQN++SVQPVVA+ERTVFYRERAAG+Y
Sbjct  1212  FGTMFWDLGTKRTKQQDLSNAMGSMYAAVLFLGVQNSSSVQPVVAVERTVFYRERAAGIY  1271

Query  3769  SALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGM  3948
             SA+PYAF   ++E+P++F Q ++YGVIVYAMIGFEWTAAKF W++FFM+FTLLYFT YGM
Sbjct  1272  SAMPYAFAHALVEIPYVFAQAVVYGVIVYAMIGFEWTAAKFFWYLFFMFFTLLYFTFYGM  1331

Query  3949  MTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQ  4128
             M VA TPN +IAAI+++AFYG WNLFSGFI+P+TRIPVWWRWYY+ CPV+WTLYGL+ SQ
Sbjct  1332  MAVAATPNQHIAAIVAAAFYGLWNLFSGFIVPRTRIPVWWRWYYWACPVAWTLYGLVTSQ  1391

Query  4129  FGDVKEKL-DTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             FGD++++  DT +TV+ ++  +F F+HDF+G VA +IVG  V+F FIFAF+IKAFNFQ R
Sbjct  1392  FGDIQDRFEDTGDTVEQYLNDYFGFEHDFLGVVAAVIVGFTVLFLFIFAFAIKAFNFQRR  1451



>ref|XP_010654716.1| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis 
vinifera]
Length=1454

 Score =  2080 bits (5388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1040/1443 (72%), Positives = 1237/1443 (86%), Gaps = 16/1443 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG EV   S     EDDEEALKWAA+EKLPTY R+R+G+L      G   E+D+  
Sbjct  20    IWRNSGEEV--SSRSSRDEDDEEALKWAALEKLPTYNRMRKGLLMGS--AGEASEVDIHN  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EK++L+ERLV+IA+EDNE FLLKL++R DRVGIDLP IEVRFEHL +DAEA+VGSR
Sbjct  76    LGFQEKKNLVERLVKIAEEDNEKFLLKLRNRIDRVGIDLPEIEVRFEHLTIDAEAHVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  N   N +E  +N L ILP+RKK   ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  136   ALPSFINSAFNQIEDILNTLRILPSRKKKFTILHDVSGIIKPRRMTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LAL+GKLDS LKV+G+VTYNGH M EFVP+RT+ YI+QHD HIGEMTVRETLAFSARCQG
Sbjct  196   LALSGKLDSSLKVTGKVTYNGHGMNEFVPQRTATYISQHDTHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+MLAELSRREK  NIKPDPDIDV+MKA + EGQ+ +V+TDY LKILGLEVCAD L
Sbjct  256   VGDRYDMLAELSRREKAANIKPDPDIDVFMKAAATEGQKENVITDYTLKILGLEVCADTL  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTT+QIVNS+RQ+IHIL G
Sbjct  316   VGDQMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLRQTIHILNG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSD Q+VYQGPR++VL+FF+ MGF+CPERKGVADFLQE
Sbjct  376   TALISLLQPAPETYDLFDDIILLSDSQIVYQGPREDVLDFFESMGFRCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ+QYW R++E Y F+TV +F+EAFQSFH G+K+GDELA PFDK+KSHPAAL  +
Sbjct  436   VTSRKDQQQYWARKDEPYSFVTVKQFAEAFQSFHSGRKVGDELATPFDKTKSHPAALKTE  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKELL AC SRE+ LMKRNSFVYI ++ QL++MA ++MT+FLRTEM KNS  DG+
Sbjct  496   KYGVRKKELLDACISREYWLMKRNSFVYILQLTQLIIMAAISMTIFLRTEMHKNSTDDGS  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFF V+M MFNG SELA++I KLP FYKQR L F+P WAYAL +WILKIP+T VE
Sbjct  556   IYMGALFFTVVMIMFNGMSELAMTIAKLPVFYKQRGLLFYPAWAYALSSWILKIPITFVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV M+YY IGFDP+ GR FKQ  LL+ VNQMASALFR  AAAGR++IVANTFGS ++
Sbjct  616   VAVWVFMSYYVIGFDPNVGRLFKQYLLLVLVNQMASALFRFIAAAGRNMIVANTFGSFSL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSW-RHVPSGTSETLGV  2157
             +L+  LGGF+LSR++VKKWWIWGYW SPLMYAQNAI VNE+LGKSW ++  + ++E+LGV
Sbjct  676   LLLFALGGFVLSRENVKKWWIWGYWSSPLMYAQNAIVVNEFLGKSWSKNSSTNSTESLGV  735

Query  2158  TVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNA  2337
              VL+SRG F EA+WYWIG GAL+G++ + NF + +ALTYLN   KPQA+++EE+      
Sbjct  736   AVLKSRGFFTEAYWYWIGAGALLGFILVFNFCYTVALTYLNAFEKPQAVITEES----EN  791

Query  2338  CKRGEPIELE------LKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPF  2499
              K G  IEL       +   +++E+ + + RS+SS S S R  ++  A  N KRGMVLPF
Sbjct  792   SKTGGKIELSSHRRGSIDQTASTERRDEIGRSISSTSSSVRAEAIAEARRNTKRGMVLPF  851

Query  2500  EPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLM  2679
             +PL ITFD+I+Y+VDMP EMK+QG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLM
Sbjct  852   QPLSITFDDIRYSVDMPEEMKSQGVLEDRLKLLKGVSGAFRPGVLTALMGVSGAGKTTLM  911

Query  2680  DVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLP  2859
             DVLAGRKTGGYIEG+I ISGYPK+QETF RI+GYCEQ DIHSPHVT++ESL+YSAWLRLP
Sbjct  912   DVLAGRKTGGYIEGNINISGYPKKQETFTRISGYCEQNDIHSPHVTIHESLLYSAWLRLP  971

Query  2860  PEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  3039
              ++D+ TR+MF+E+VM+LVELT L+++LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM
Sbjct  972   ADVDSKTRKMFIEKVMELVELTPLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  1031

Query  3040  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVG  3219
             DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLLLKRGG+EIYVG
Sbjct  1032  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQEIYVG  1091

Query  3220  PLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRR  3399
              LGRHSS LI+YFE I G+ +I+ GYNPATWMLE+T+ AQE  LG+DF E+Y+NS LYRR
Sbjct  1092  LLGRHSSCLIKYFEGIEGVSKIKGGYNPATWMLEVTTSAQEFLLGVDFTEIYKNSNLYRR  1151

Query  3400  NKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFN  3579
             NK LI+ELS+PAPGSKDLYFPT+YSQSFFTQCMACLWKQ  SYWRNPPYTAVR  FTTF 
Sbjct  1152  NKDLIKELSQPAPGSKDLYFPTQYSQSFFTQCMACLWKQRRSYWRNPPYTAVRFFFTTFI  1211

Query  3580  ALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAA  3759
             AL+FGTMFW +G KR  QQDL NAMG MYAAV+FLGVQN++SVQPVVA+ERTVFYRERAA
Sbjct  1212  ALIFGTMFWDLGTKRTKQQDLSNAMGSMYAAVLFLGVQNSSSVQPVVAVERTVFYRERAA  1271

Query  3760  GMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftl  3939
             G+YSA+PYAF   ++E+P++F Q ++YGVIVYAMIGFEWTAAKF W++FFM+FTLLYFT 
Sbjct  1272  GIYSAMPYAFAHALVEIPYVFAQAVVYGVIVYAMIGFEWTAAKFFWYLFFMFFTLLYFTF  1331

Query  3940  yGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLI  4119
             YGMM VA TPN +IAAI+++AFYG WNLFSGFI+P+TRIPVWWRWYY+ CPV+WTLYGL+
Sbjct  1332  YGMMAVAATPNQHIAAIVAAAFYGLWNLFSGFIVPRTRIPVWWRWYYWACPVAWTLYGLV  1391

Query  4120  ASQFGDVKEKL-DTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNF  4296
              SQFGD++++  DT +TV+ ++  +F F+HDF+G VA +IVG  V+F FIFAF+IKAFNF
Sbjct  1392  TSQFGDIQDRFEDTGDTVEQYLNDYFGFEHDFLGVVAAVIVGFTVLFLFIFAFAIKAFNF  1451

Query  4297  QTR  4305
             Q R
Sbjct  1452  QRR  1454



>ref|XP_008373537.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Malus domestica]
Length=1437

 Score =  2079 bits (5386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1039/1434 (72%), Positives = 1213/1434 (85%), Gaps = 17/1434 (1%)
 Frame = +1

Query  4     WRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKL  183
             W ++G+EVFSRSSR   E+    LKWAA+EKLPTY R+R+GIL     GG   EID+  L
Sbjct  21    WMNNGMEVFSRSSRGEDEEVA--LKWAALEKLPTYNRLRKGILTMP--GGEASEIDIPNL  76

Query  184   GVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRA  363
             G  E++ L+ER ++   EDNE FLLKLK+R DRVGI LPTIEVRFE LN++AE YVGSRA
Sbjct  77    GFQERKELIERFLKGNDEDNERFLLKLKNRIDRVGIVLPTIEVRFEQLNIEAETYVGSRA  136

Query  364   LPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlll  543
             LPT+FNF  NI+E  +  L IL +RK  L ILH+VSGIIKP+RMTLLLGPPSSGKTTLLL
Sbjct  137   LPTLFNFCVNIIEDILIGLRILSSRKTHLSILHNVSGIIKPSRMTLLLGPPSSGKTTLLL  196

Query  544   alagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGV  723
             ALAGKLD DLK+SGRV+YNGH M EFVP+RT+AYI QHDLHIGEMTVRETLAFSARCQGV
Sbjct  197   ALAGKLDPDLKLSGRVSYNGHGMNEFVPQRTAAYIGQHDLHIGEMTVRETLAFSARCQGV  256

Query  724   GHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILV  903
             G RY+ML+ELSRREKE NIKPDP IDV+MKAIS EGQE +VVTDYILKILGLEVCAD +V
Sbjct  257   GTRYDMLSELSRREKEANIKPDPVIDVFMKAISTEGQEVNVVTDYILKILGLEVCADTIV  316

Query  904   GDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGT  1083
             GDEM+RGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQIVNSI+Q IHIL GT
Sbjct  317   GDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIKQCIHILNGT  376

Query  1084  AVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEV  1263
             AVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR++VLEFF+ MGFKCPERK +ADFLQEV
Sbjct  377   AVISLLQPAPETYDLFDDIILLSDGQIVYQGPREHVLEFFESMGFKCPERKAIADFLQEV  436

Query  1264  TSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKK  1443
             TSRKDQEQYW+R++E Y FITV EFS AFQSF VG+KLGDEL++PFDKS++HPAAL+ K+
Sbjct  437   TSRKDQEQYWVRKDEPYSFITVREFSVAFQSFLVGQKLGDELSIPFDKSRNHPAALTIKE  496

Query  1444  YGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTV  1623
             YG+ K ELLKAC SRE+LL+KRNSFVY+F++ QL++MA + MT+FLRT+MP++S+ DG V
Sbjct  497   YGLKKGELLKACFSREYLLIKRNSFVYVFRLTQLIVMALITMTIFLRTKMPRDSVDDGGV  556

Query  1624  FMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEV  1803
             +MGALFF+V+M MFNG +EL+++I+KLP  YKQRDL FFP WA+ALPTWILKIP+  +EV
Sbjct  557   YMGALFFSVVMVMFNGMAELSMTIMKLPVVYKQRDLLFFPAWAFALPTWILKIPIAFIEV  616

Query  1804  AIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMI  1983
              +WV MTYY IGFDP+  RFF+Q  LL+ VNQMASALFR  AAA R++IVANT GS A++
Sbjct  617   GVWVFMTYYVIGFDPNFDRFFRQYVLLLLVNQMASALFRFLAAACRNLIVANTLGSFALL  676

Query  1984  LVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTV  2163
             ++  LGGF+LSRDD+KKWWIWGYWISP+MYAQNAISVNE LGKSWRHV   ++  LGV  
Sbjct  677   ILFTLGGFVLSRDDIKKWWIWGYWISPMMYAQNAISVNELLGKSWRHVLPNSTVALGVAA  736

Query  2164  LRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACK  2343
             L+S G+FP  +WYWIGVGA+ G+  L N  + +ALTYLNPLGKPQA+ SE++ +  N  +
Sbjct  737   LKSHGVFPHEYWYWIGVGAMAGFALLFNIFYIVALTYLNPLGKPQAVKSEDSQSNENDGR  796

Query  2344  RGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFD  2523
                  +L     S+S++             +        A  N +RGMVLPFEP  ITFD
Sbjct  797   TERTSQLPRSQNSSSQQ-------------TKTESRNQEAIRNNRRGMVLPFEPYSITFD  843

Query  2524  EIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKT  2703
             EI Y+VDMP EMK QG+ ED+LVLL G++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKT
Sbjct  844   EIIYSVDMPQEMKTQGVVEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  903

Query  2704  GGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATR  2883
             GGYIEG + ISGYPK+QETFARI+GYCEQ DIHSPHVTV+ESL+YSAWLRLP E+   TR
Sbjct  904   GGYIEGDVKISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPSEVKAETR  963

Query  2884  EMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  3063
             ++F+EEVM+L+EL  LR+ LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  964   KLFIEEVMELIELKPLRQVLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1023

Query  3064  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQ  3243
             ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLLLKRGG+EIYVGPLGRHS  
Sbjct  1024  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQEIYVGPLGRHSCH  1083

Query  3244  LIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQEL  3423
             LI+YFE I G+ +I+DGYNPATWMLE T+ AQE +LGIDFA+VY+NSELYRRNK LI+E 
Sbjct  1084  LIQYFEGIEGVSKIKDGYNPATWMLEATTSAQELSLGIDFAQVYKNSELYRRNKQLIKEF  1143

Query  3424  SKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMF  3603
             S PAP SKDLYFPT+YSQ F  Q +ACLWKQHWSYWRNP Y AVRLLFTT  AL+ G+MF
Sbjct  1144  STPAPPSKDLYFPTRYSQPFLVQTIACLWKQHWSYWRNPLYNAVRLLFTTIIALMLGSMF  1203

Query  3604  WGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPY  3783
             W +G K R QQDLFNAMG MY AV+FLG+QNATSVQP+VAIERTVFYRE+AAGMYSALPY
Sbjct  1204  WNLGSKTRRQQDLFNAMGSMYTAVLFLGIQNATSVQPIVAIERTVFYREKAAGMYSALPY  1263

Query  3784  AFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAV  3963
             AF QV+IELP++ +Q ++YGVI Y MIGF+ T  KF W++FFMYFTLLYFT YGMMTVAV
Sbjct  1264  AFAQVLIELPYILLQAVVYGVITYVMIGFDMTFVKFFWYLFFMYFTLLYFTFYGMMTVAV  1323

Query  3964  TPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVK  4143
             TPNH++AAI+SSAFY  WNLFSGFIIP+ RIP+WWRWYY+ CPV+WTLYGLIASQFGD+ 
Sbjct  1324  TPNHHVAAIVSSAFYALWNLFSGFIIPRPRIPIWWRWYYWACPVAWTLYGLIASQFGDLN  1383

Query  4144  EKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             + LD  +TV+ F++S+F F HDFVG VA + VG+ V+FGFIFAFSI+AFNFQ R
Sbjct  1384  DMLDNGQTVEQFLRSYFGFRHDFVGVVAVVHVGVTVLFGFIFAFSIRAFNFQMR  1437



>ref|XP_010914973.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X1 [Elaeis guineensis]
Length=1486

 Score =  2078 bits (5383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1031/1444 (71%), Positives = 1207/1444 (84%), Gaps = 35/1444 (2%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWA++EKLPTY R+R+GIL   E  G P+E+D+E L   E+++L+ERLVR+A+EDNE F
Sbjct  45    LKWASLEKLPTYNRLRKGILTITE--GQPREVDIENLSYQERKNLIERLVRVAEEDNEKF  102

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKL++R D+VGIDLPTIEVR+EHLNV+A AYVG+R LP+  N T N+LE   N LHI+P
Sbjct  103   LLKLRNRIDQVGIDLPTIEVRYEHLNVEARAYVGNRGLPSFINATVNVLEGLANLLHIVP  162

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK+PL ILHDVSGIIKP RMTLLLGPP SGKTTLLLALAGKL+SDLK SG VTYNGH M
Sbjct  163   SRKRPLEILHDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGKLESDLKASGTVTYNGHGM  222

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              +FVP+RT+AYI+QHDLHIG+MTVRETL+FSARCQGVG RY+MLAEL+RREK+ NIKPDP
Sbjct  223   DDFVPQRTAAYISQHDLHIGQMTVRETLSFSARCQGVGTRYDMLAELARREKQANIKPDP  282

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA ++  QE +VVTDYILKILGLEVCAD +VGDEM+RGISGGQRKR+TTGEM+V
Sbjct  283   DIDVFMKAAAMGNQETNVVTDYILKILGLEVCADTMVGDEMLRGISGGQRKRVTTGEMIV  342

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQIVNS RQSIHIL GTAVISLLQPAPETY+LFDDIILLS
Sbjct  343   GPARALFMDEISTGLDSSTTFQIVNSFRQSIHILAGTAVISLLQPAPETYDLFDDIILLS  402

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DG VVYQGPR++VLEFF+ MGF+CPERKGVADFLQEVTSRKDQ+QYWMR +E Y F+ V 
Sbjct  403   DGHVVYQGPREHVLEFFESMGFRCPERKGVADFLQEVTSRKDQQQYWMRHDEPYRFVPVR  462

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQSFHVG+KLG EL+VPFDKS SHPAAL++ KYG + KELLKA   RE LLMKRN
Sbjct  463   EFAEAFQSFHVGQKLGHELSVPFDKSSSHPAALASSKYGASSKELLKANIWRELLLMKRN  522

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVY F+  QL+ MA ++MT+FLRT M +++ +DG +++GALFF++IM MFNGFSELAL+
Sbjct  523   SFVYGFRAFQLMFMATISMTLFLRTNMHRDNTSDGGLYLGALFFSMIMIMFNGFSELALA  582

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP F+KQRD  F+P W YALP+WI+KIP+T VEV +WV +TYY IGFDP+ GR FKQ
Sbjct  583   IAKLPVFFKQRDYLFYPAWTYALPSWIIKIPITFVEVGVWVFLTYYVIGFDPNVGRLFKQ  642

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ VNQMAS LFR  AA GR++I+ANTFGS ++++++VLGGFILSR+DVKKWWIWGY
Sbjct  643   YMLLLLVNQMASGLFRFIAALGRNMIIANTFGSFSLLVLVVLGGFILSREDVKKWWIWGY  702

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             WISP+MY+QNA++ NE+LG SW  +    +E LGV VL+SRG F EA WYWIGVGALVGY
Sbjct  703   WISPMMYSQNALATNEFLGHSWSRILPNHTEPLGVEVLKSRGFFHEAKWYWIGVGALVGY  762

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGE-----PIELELKGGSTSEKg  2397
               L NFLF +ALTY+ P GK Q  +SEE L E+ +   GE     P E      STS+  
Sbjct  763   TILFNFLFTVALTYIKPFGKAQPAVSEEALNEKYSNITGEMKSSSPAERSASRDSTSKSK  822

Query  2398  nvvrrsvssrsl---------------------------ssrvgsvnvADPNM-KRGMVL  2493
             +++   V S                              +S   +  VA+PN  K+GMVL
Sbjct  823   SIITLLVCSSISASSFLMSFILIYMFRCAETANGSRNIEASSSMTDGVANPNQKKKGMVL  882

Query  2494  PFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTT  2673
             PF PLCITFD+I+Y+VDMP EMKAQG+  DRL LLKG++G+FRPGVLTALMG+SGAGKTT
Sbjct  883   PFTPLCITFDDIRYSVDMPQEMKAQGVEGDRLELLKGVSGSFRPGVLTALMGVSGAGKTT  942

Query  2674  LMDVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLR  2853
             LMDVLAGRKTGGYI+GSITISGYPK QETFARI+GYCEQ DIHSPHVTVYESLVYSAWLR
Sbjct  943   LMDVLAGRKTGGYIDGSITISGYPKNQETFARISGYCEQNDIHSPHVTVYESLVYSAWLR  1002

Query  2854  LPPEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSII  3033
             LP E+D+ATR+MFVEEVM+LVELTSLREALVGLPGV+GLSTEQRKRLTIAVELVANPSII
Sbjct  1003  LPAEVDSATRKMFVEEVMELVELTSLREALVGLPGVSGLSTEQRKRLTIAVELVANPSII  1062

Query  3034  FMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIY  3213
             FMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL LLKRGGEEIY
Sbjct  1063  FMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLLKRGGEEIY  1122

Query  3214  VGPLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELY  3393
             VGPLGRHS  LI YFE I G+ +I+DGYNPATWMLE+T++AQE  LG+DF+EVY+NSELY
Sbjct  1123  VGPLGRHSCHLIDYFEQIEGVSKIKDGYNPATWMLEVTTQAQEQILGVDFSEVYKNSELY  1182

Query  3394  RRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTT  3573
             RRNKALI+ELS P PGS DL+FPT+Y+Q F TQC+ACLWKQ  SYWRNPPYTAVR  FTT
Sbjct  1183  RRNKALIKELSMPPPGSSDLHFPTQYAQPFLTQCLACLWKQRLSYWRNPPYTAVRFFFTT  1242

Query  3574  FNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRER  3753
               A++FGT+FW +G K   +QDLFNAMG MYAAV+F+GV N TSVQPVV+IERTVFYRER
Sbjct  1243  AIAVMFGTIFWDLGTKTSNEQDLFNAMGSMYAAVLFIGVSNGTSVQPVVSIERTVFYRER  1302

Query  3754  AAGMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyf  3933
             AAGMYSALPYAFGQV+IELP++ VQ L+YGVIVYAMI FEWTAAKF W+IFFMYFTLLYF
Sbjct  1303  AAGMYSALPYAFGQVLIELPYVLVQALVYGVIVYAMIAFEWTAAKFFWYIFFMYFTLLYF  1362

Query  3934  tlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYG  4113
             T YGMMTV +TPN NIAAIIS+ F G WNLFSGFIIP+  +PVWWRWY++  PV+WTLYG
Sbjct  1363  TFYGMMTVGMTPNINIAAIISAGFVGLWNLFSGFIIPRPSMPVWWRWYFWASPVAWTLYG  1422

Query  4114  LIASQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFN  4293
             L+ SQFGDV+++  T +TV ++V++ F F HDF+G VA ++ G  V+F F+F  +IK  N
Sbjct  1423  LVTSQFGDVEDRFHTGQTVSEYVRTHFGFRHDFLGVVAVVVPGFAVLFAFLFGLTIKILN  1482

Query  4294  FQTR  4305
             FQ R
Sbjct  1483  FQKR  1486



>gb|KDP36996.1| hypothetical protein JCGZ_06052 [Jatropha curcas]
Length=1425

 Score =  2076 bits (5380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1027/1436 (72%), Positives = 1217/1436 (85%), Gaps = 18/1436 (1%)
 Frame = +1

Query  4     WRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKL  183
             WR++GV+VFSRSSRE  +++   LKWAA+EKLPTY R+R+GIL +  +GG   EIDV  L
Sbjct  6     WRNTGVDVFSRSSREDDDEEA--LKWAALEKLPTYDRLRKGILVSVSKGG-VNEIDVGDL  62

Query  184   GVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRA  363
             G  E++SLLERLVR+A+EDNE FLLKLK+R DRVGI++PTIEVRFE LN++ EA+VG+RA
Sbjct  63    GFQERKSLLERLVRVAEEDNEKFLLKLKNRIDRVGIEIPTIEVRFERLNIEGEAFVGNRA  122

Query  364   LPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlll  543
             LPT  NF+ NI+E F+N LHILP RKK   IL DVSGIIKP+RMTLLLGPPSSGKTTLLL
Sbjct  123   LPTFVNFSVNIVEGFLNSLHILPGRKKRFTILKDVSGIIKPSRMTLLLGPPSSGKTTLLL  182

Query  544   alagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGV  723
             ALAGKLD +LK SG VTYNGH M EF+P+RT+AYI+QHDLHIGEMTVRETLAFSARCQGV
Sbjct  183   ALAGKLDPNLKFSGSVTYNGHGMNEFIPQRTAAYISQHDLHIGEMTVRETLAFSARCQGV  242

Query  724   GHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILV  903
             G + EMLAELSRREK  NIKPDPDID +MKA +IEGQE SVVTDYILKILGLE+CAD LV
Sbjct  243   GTQQEMLAELSRREKAANIKPDPDIDFFMKAAAIEGQETSVVTDYILKILGLEICADTLV  302

Query  904   GDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGT  1083
             G EM+RGISGGQRKR+TTGEMLVGPARALFMDEISTGLDSSTT+QIVNS++QSI+I  GT
Sbjct  303   GAEMLRGISGGQRKRVTTGEMLVGPARALFMDEISTGLDSSTTYQIVNSLKQSINIFNGT  362

Query  1084  AVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEV  1263
             AVISLLQPA ETY+LFDDIILLSDGQ+VYQGPRD+VL FF++MGFKCPERKGVADFLQEV
Sbjct  363   AVISLLQPATETYDLFDDIILLSDGQIVYQGPRDDVLGFFEYMGFKCPERKGVADFLQEV  422

Query  1264  TSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKK  1443
             TS+KDQ+QYW R++  Y F+TV EFS AFQS+ +G+K+  +L+ PFDK+KSHPAAL+  K
Sbjct  423   TSKKDQQQYWARKDHPYSFVTVPEFSRAFQSYEIGRKIEHDLSTPFDKTKSHPAALATGK  482

Query  1444  YGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTV  1623
             YG  K ELLK+C SRE+LLMKRNSFVYIFK+ QL +MA + MTVFLRT M ++ + DG +
Sbjct  483   YGAGKMELLKSCFSREYLLMKRNSFVYIFKLSQLTIMAIITMTVFLRTNMHRDDVTDGGI  542

Query  1624  FMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEV  1803
             ++GALFF ++  MFNG SE++L+I+KLP FYKQRDL F+P WAY+LPTWI+KIP+T++EV
Sbjct  543   YLGALFFTMVAVMFNGMSEISLTIVKLPVFYKQRDLLFYPAWAYSLPTWIIKIPITILEV  602

Query  1804  AIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMI  1983
             ++WV +TYY IGFDP+ GR FKQ  LL+ VNQM+SALFRL A+ GR++IVANTFGS A++
Sbjct  603   SVWVFITYYVIGFDPNVGRLFKQYLLLLLVNQMSSALFRLIASVGRNMIVANTFGSFALL  662

Query  1984  LVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTV  2163
              +  LGG ILSR+D+KKWWIWGYWISP+MY QNAI VNE+LGKSW H+P  + E LG+ V
Sbjct  663   ALFALGGVILSREDIKKWWIWGYWISPMMYGQNAIIVNEFLGKSWSHIPENSGEPLGIQV  722

Query  2164  LRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACK  2343
             +++RG FP+A+WYW+G+GAL G++ L N  F LAL +LNP  KPQA++S E    R+  +
Sbjct  723   MKTRGFFPQAYWYWLGLGALAGFILLFNLCFTLALHFLNPFEKPQAVIS-EVPEPRDRIE  781

Query  2344  RGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFD  2523
                 I+L     S   K                    +  + N K+GMVLPFEP C+TFD
Sbjct  782   GATAIQLSQAECSHRTK------------TEIGTSGNDEVNYNKKKGMVLPFEPHCLTFD  829

Query  2524  EIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKT  2703
              + Y+VDMP EMK+QG+ ED+LVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKT
Sbjct  830   NVVYSVDMPQEMKSQGVLEDKLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  889

Query  2704  GGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATR  2883
             GGYIEGSI ISGYPK+QET ARI+GYCEQ DIHSPHVTVYESL++SAWLRLPPEID+ TR
Sbjct  890   GGYIEGSIPISGYPKQQETCARISGYCEQKDIHSPHVTVYESLLFSAWLRLPPEIDSGTR  949

Query  2884  EMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  3063
             +MFV+E+M+LVEL  LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  950   DMFVDEIMELVELNPLRHALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1009

Query  3064  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQ  3243
             ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLG HS  
Sbjct  1010  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGGHSYH  1069

Query  3244  LIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQEL  3423
             LI+YFE I G+ +I+DGYNPATWMLE+TS AQE ALG+DF+ +Y+NSELYRRNKA+I+EL
Sbjct  1070  LIKYFEEIEGVSKIKDGYNPATWMLEVTSSAQEMALGVDFSVIYKNSELYRRNKAIIKEL  1129

Query  3424  SKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMF  3603
             S PAPGSKDLYFP +YSQSF TQC+ACLWKQ  SYWRNPPYTAVR LFTTF AL+FGT+F
Sbjct  1130  SVPAPGSKDLYFPAQYSQSFLTQCIACLWKQRLSYWRNPPYTAVRFLFTTFMALMFGTIF  1189

Query  3604  WGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPY  3783
             W +G K   QQDL N+ G +YAAV+FLGVQNA SVQPVVAIERTVFYRERAAGMYSALPY
Sbjct  1190  WNLGSKIGKQQDLINSTGSLYAAVLFLGVQNAASVQPVVAIERTVFYRERAAGMYSALPY  1249

Query  3784  AFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAV  3963
             A+ QV+IELP++F Q ++YG+I YAMIGFEWT+AKF W+IFFMYFTLLYFT YGMMTVAV
Sbjct  1250  AYAQVIIELPYIFCQAIVYGLITYAMIGFEWTSAKFFWYIFFMYFTLLYFTYYGMMTVAV  1309

Query  3964  TPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVK  4143
             +PNH+IA+IISSAFY  WNLFSGF+IP+TR+PVWWRWYY+ CP+SWTLYGLIASQ+GD+K
Sbjct  1310  SPNHHIASIISSAFYAIWNLFSGFVIPRTRMPVWWRWYYWACPLSWTLYGLIASQYGDIK  1369

Query  4144  EKLD--TNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             + L+    + V+D+V+ ++   HDF+G VA +I GI V+F FIFA SI++FNFQ R
Sbjct  1370  DPLEDGARQPVQDYVREYYGVKHDFLGAVAAVIPGIAVLFAFIFAVSIRSFNFQRR  1425



>ref|XP_009347962.1| PREDICTED: pleiotropic drug resistance protein 1-like [Pyrus 
x bretschneideri]
Length=1411

 Score =  2075 bits (5376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1021/1411 (72%), Positives = 1215/1411 (86%), Gaps = 16/1411 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+E+LPT LR+ RG+    E  G  +E+DVE LG+ E+R+LLERLV  A++DNE F
Sbjct  17    LKWAALERLPTCLRVGRGLFIDGE--GQAREVDVENLGLLERRTLLERLVSNAEKDNEKF  74

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVG+++PTIEVRFEHL V+A+ Y+GSRALPT+ NF+ N+L+  ++ L I P
Sbjct  75    LLKLKNRIDRVGLNVPTIEVRFEHLTVEAKVYIGSRALPTLLNFSINMLQGMLHDLRIFP  134

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK PL IL ++SGIIKP RMTLLLGPPSSGKTTLLLALAG+L  DL  SGR+TYNGH M
Sbjct  135   SRKMPLKILQNISGIIKPQRMTLLLGPPSSGKTTLLLALAGRLGRDLNSSGRITYNGHGM  194

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAY++Q+DLHIGE+TV+ET AFSARCQGVG   +ML EL RREKE NIKPDP
Sbjct  195   EEFVPQRTSAYVSQNDLHIGELTVKETFAFSARCQGVGSNCDMLVELCRREKEQNIKPDP  254

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID+Y+KA ++EGQE +VVTDYILKILGLEVCA+ +VGD+M+RGISGG+RKR+T GEMLV
Sbjct  255   DIDIYLKAAALEGQETNVVTDYILKILGLEVCANTMVGDDMVRGISGGERKRVTIGEMLV  314

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GP +ALFMDEISTGLDSSTTFQIVNSIRQSIHIL GTAV+SLLQPAPETY LFDDIILLS
Sbjct  315   GPVKALFMDEISTGLDSSTTFQIVNSIRQSIHILSGTAVVSLLQPAPETYNLFDDIILLS  374

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR+NVLEFF+ MGF CPERKGVADFLQEVTS+KDQEQYW RR++ Y F+TV 
Sbjct  375   DGQIVYQGPRENVLEFFESMGFICPERKGVADFLQEVTSKKDQEQYWARRDKPYRFVTVN  434

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF EAFQSF +G+KLGDELA PFDKS+SH AALS+K+YGVNKKEL +AC SREFLLMKRN
Sbjct  435   EFVEAFQSFPIGQKLGDELATPFDKSRSHRAALSSKRYGVNKKELFRACVSREFLLMKRN  494

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SF Y+FK+  L ++A +  ++FLR +M K+S+ DG V+MGALFFAVI+ MFNG SEL ++
Sbjct  495   SFAYVFKLALLSILASITSSIFLRIKMHKDSVVDGGVYMGALFFAVIVAMFNGISELNMA  554

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I+KLP FYKQRDL FFP WAY+LP WILKIP++L E AIWV +TYY IGFDP   RFFKQ
Sbjct  555   IMKLPVFYKQRDLLFFPSWAYSLPAWILKIPISLGESAIWVVITYYVIGFDPYVERFFKQ  614

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               +L+C+NQMAS LFRL AA GR V VA+T GS A+++++VLGGF+LSRD V KWW+WGY
Sbjct  615   YIVLLCINQMASGLFRLIAALGRDVTVASTTGSFALLIIMVLGGFVLSRDAVPKWWLWGY  674

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W+SPLMY QNAI+VNE+LGKSWR VP  ++E+LGV +L+S GIFPEA  +WIGV AL+GY
Sbjct  675   WVSPLMYGQNAITVNEFLGKSWRQVPPNSTESLGVLILKSHGIFPEAKLFWIGVAALIGY  734

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             +FL N L  LAL YL+PLGKPQ +L++E++AERN  + GE IEL  +G  +SE   V R 
Sbjct  735   IFLFNLLLTLALQYLDPLGKPQTILTKESMAERNFSRNGEFIELIPRGNISSESERVGRT  794

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
                             A+   KRGMVLPF+PL +TF+EI+YA+DMP EMKA+G+ ED+L 
Sbjct  795   DE--------------ANGKRKRGMVLPFQPLSLTFNEIRYAIDMPQEMKAEGVQEDQLE  840

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGG+I+G+ITISGYPKRQ+TFARI
Sbjct  841   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGHIKGNITISGYPKRQQTFARI  900

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQTDIHSPHVTVYESL++SAWLRL PE+D+ATREMF+EEVM+LVELTS R ALVGL
Sbjct  901   SGYCEQTDIHSPHVTVYESLLFSAWLRLLPEVDSATREMFIEEVMELVELTSFRGALVGL  960

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGV GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  961   PGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1020

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDELLLLK GGE+IY GPLG H S LI YFE ING+ +I+DGYNPATW
Sbjct  1021  TIHQPSIDIFDAFDELLLLKLGGEQIYAGPLGSHCSILINYFEGINGVPKIKDGYNPATW  1080

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLE+TS AQEAALG++F + Y NSE+Y+R KA+I+ELS P  GS+DLYFPT+YS+SF TQ
Sbjct  1081  MLEVTSAAQEAALGVNFTDAYNNSEIYKRTKAMIEELSTPPLGSQDLYFPTRYSRSFLTQ  1140

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQHWSYWRNP Y+AVRLLFTTF ALLFG +FW +G KR  QQDLFNAMG MYAA
Sbjct  1141  CMACLWKQHWSYWRNPSYSAVRLLFTTFIALLFGLIFWNLGSKRSKQQDLFNAMGSMYAA  1200

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+F+GVQN  SVQPVVA+ERTVFYRERAAGMYSALPYAFGQ++IE+P++F+QT+IYG IV
Sbjct  1201  VIFIGVQNGASVQPVVAVERTVFYRERAAGMYSALPYAFGQMMIEVPYIFIQTVIYGAIV  1260

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             YAM+GF+W AAKFLW++FFM+FTLLYFT YGMMT+A+TPNHNIAAI SS FY  WNLFSG
Sbjct  1261  YAMMGFDWIAAKFLWYLFFMFFTLLYFTFYGMMTMALTPNHNIAAITSSTFYAIWNLFSG  1320

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             F++P TRIP+WW+WYY++CPVSWTLYG++ASQFGDVKEKL++ E+V+ F++S+F + H+F
Sbjct  1321  FVVPPTRIPIWWKWYYWVCPVSWTLYGMVASQFGDVKEKLESGESVEHFLRSYFGYKHEF  1380

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VA +IVG  ++FGFIFA++I+AFNFQ R
Sbjct  1381  LGIVAVVIVGFSLLFGFIFAYAIRAFNFQKR  1411



>ref|XP_009343426.1| PREDICTED: pleiotropic drug resistance protein 1-like [Pyrus 
x bretschneideri]
Length=1437

 Score =  2074 bits (5373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1037/1434 (72%), Positives = 1209/1434 (84%), Gaps = 17/1434 (1%)
 Frame = +1

Query  4     WRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKL  183
             WR++G+EVFS SSR   ++    LKWAA+EKLPTY R+R+GIL     GG   EID+  L
Sbjct  21    WRNNGMEVFSSSSRGEDDEVA--LKWAALEKLPTYNRLRKGILTMP--GGEASEIDIPNL  76

Query  184   GVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRA  363
             G  E++ L+ER ++   EDNE FLLKLK+R DRVGI LPTIEVRFE LNV+AE YVG RA
Sbjct  77    GFQERKELIERFLKGNDEDNERFLLKLKNRIDRVGIVLPTIEVRFEQLNVEAETYVGGRA  136

Query  364   LPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlll  543
             LPT+FNF  NI+E  +N L IL +RK  L ILH+VSGIIKP+RMTLLLGPPSSGKTTLLL
Sbjct  137   LPTLFNFCVNIIEGILNGLRILSSRKTHLSILHNVSGIIKPSRMTLLLGPPSSGKTTLLL  196

Query  544   alagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGV  723
             ALAGKLD DLK+SGRV+YNGH M EFVP+RT+AYI QHDLHIGEMTVRETLAFSAR QGV
Sbjct  197   ALAGKLDPDLKLSGRVSYNGHGMNEFVPQRTAAYIGQHDLHIGEMTVRETLAFSARFQGV  256

Query  724   GHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILV  903
             G RY+ML+ELSRREKE NI PDP IDV+MKAIS EGQE +VVTDYILKILGLEVCAD +V
Sbjct  257   GTRYDMLSELSRREKEANINPDPVIDVFMKAISTEGQEVNVVTDYILKILGLEVCADTIV  316

Query  904   GDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGT  1083
             GDEM+RGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQIVNSI+Q IHIL GT
Sbjct  317   GDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIKQCIHILNGT  376

Query  1084  AVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEV  1263
             AVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR++VLEFF+ MGFKCP+RK +ADFLQEV
Sbjct  377   AVISLLQPAPETYDLFDDIILLSDGQIVYQGPREHVLEFFESMGFKCPKRKAIADFLQEV  436

Query  1264  TSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKK  1443
             TSRKDQEQYW+R+EE Y FITV EFS AFQSF +G+KLGDEL++PFDKS++HPAAL+ K+
Sbjct  437   TSRKDQEQYWVRKEEPYSFITVKEFSVAFQSFLLGQKLGDELSIPFDKSRNHPAALTIKE  496

Query  1444  YGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTV  1623
             YG+ K ELLKAC SRE+LL+KRNSFVYIF++ QL++MA + MT+FLRT+MP +S+ DG V
Sbjct  497   YGLKKGELLKACFSREYLLIKRNSFVYIFRLTQLIVMALITMTIFLRTKMPHDSVDDGGV  556

Query  1624  FMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEV  1803
             +MGALFF+V+M MFNG +EL+++I+KLP FYKQRDL FFP WA+ALPTWILKIP+ ++EV
Sbjct  557   YMGALFFSVVMVMFNGMAELSMTIMKLPVFYKQRDLLFFPAWAFALPTWILKIPIAIIEV  616

Query  1804  AIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMI  1983
              +WV MTYY IGFDP+  RFF+Q  LL+ VNQMASALFR  AA  R+++VANT GS A++
Sbjct  617   GVWVFMTYYVIGFDPNVDRFFRQYVLLLLVNQMASALFRFLAAVCRNLVVANTLGSFALL  676

Query  1984  LVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTV  2163
             ++  LGGF+LSRDD+KKWWIWGYWISP+MYAQNAISVNE LG SWRHV   ++  LGV  
Sbjct  677   ILFTLGGFVLSRDDIKKWWIWGYWISPMMYAQNAISVNELLGNSWRHVLPNSTVALGVAA  736

Query  2164  LRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACK  2343
             L+S G+FP  +WYWIGVGA+ G+  L N  + +ALTYLNPLGKPQA+ SE++ +  N  +
Sbjct  737   LKSHGVFPHEYWYWIGVGAMAGFALLFNIFYIVALTYLNPLGKPQAVKSEDSQSNENDGR  796

Query  2344  RGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFD  2523
                  +L     S+S++             +        A  N +RGMVLPFEP  ITFD
Sbjct  797   TERTSQLPRSQNSSSQQ-------------TMPESRNQEAICNNRRGMVLPFEPYSITFD  843

Query  2524  EIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKT  2703
             EI Y+VDMP EMK QG+ ED+LVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKT
Sbjct  844   EIIYSVDMPQEMKTQGVLEDKLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  903

Query  2704  GGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATR  2883
             GGYIEG + ISGYPK+QETFARI+GYCEQ DIHSPHVTV+ESL+YSAWLRLPPE+   TR
Sbjct  904   GGYIEGDVKISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPPEVKAETR  963

Query  2884  EMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  3063
             ++F+EEVM+LVEL  LR+ LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  964   KLFIEEVMELVELKPLRQVLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1023

Query  3064  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQ  3243
             ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLLLKRGG+EIYVGPLG HS  
Sbjct  1024  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQEIYVGPLGGHSCH  1083

Query  3244  LIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQEL  3423
             LI+YFE I G+ +I+D YNPATWMLE T+ AQE +LGIDFA+VY+NSELYRRNK LI+E 
Sbjct  1084  LIQYFEGIEGVSKIKDSYNPATWMLEATTSAQELSLGIDFAQVYKNSELYRRNKQLIKEF  1143

Query  3424  SKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMF  3603
             S PA  SKDLYFPT+YSQ F  Q +ACLWKQHWSYWRNP Y AVRLLFTT  AL+ G+MF
Sbjct  1144  STPASPSKDLYFPTRYSQPFLVQTIACLWKQHWSYWRNPLYNAVRLLFTTIIALMLGSMF  1203

Query  3604  WGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPY  3783
             W +G K R QQDLFNAMG MY AV+FLGVQNATSVQP+VAIERTVFYRE+AAGMYSALPY
Sbjct  1204  WNLGSKTRRQQDLFNAMGSMYTAVLFLGVQNATSVQPIVAIERTVFYREKAAGMYSALPY  1263

Query  3784  AFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAV  3963
             AF QV+IELP++ +Q ++YGVI Y MIGF+ T  KF W+IFFMYFTLLYFT YGMMTVAV
Sbjct  1264  AFAQVLIELPYILLQAVVYGVITYVMIGFDMTLVKFFWYIFFMYFTLLYFTFYGMMTVAV  1323

Query  3964  TPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVK  4143
             TPNH++AAI+SSAFY  WNLFSGFIIP+ RIP+WWRWYY+ CPV+WTLYGLIASQFGD+ 
Sbjct  1324  TPNHHVAAIVSSAFYALWNLFSGFIIPRPRIPIWWRWYYWACPVAWTLYGLIASQFGDLN  1383

Query  4144  EKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             + LD  +TV+ F++S+F F HDFVG VA + VG+ V+FGFIFAFSI+AFNFQ R
Sbjct  1384  DMLDNGQTVEQFLRSYFGFRHDFVGVVAVVHVGVTVLFGFIFAFSIRAFNFQMR  1437



>gb|KDP37161.1| hypothetical protein JCGZ_06217 [Jatropha curcas]
Length=1409

 Score =  2073 bits (5371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1021/1411 (72%), Positives = 1198/1411 (85%), Gaps = 17/1411 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIE+LPTY R+R+G+L      GG  EID+  LG+ E+++LLERLVR+A+EDNE F
Sbjct  16    LKWAAIERLPTYDRLRKGVLTTMT--GGASEIDIRSLGLQERKNLLERLVRVAEEDNEKF  73

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVGID+PTIEVRFEHL ++AEAYVGSRALPT FN++ NILE  +NY HIL 
Sbjct  74    LLKLKNRIDRVGIDIPTIEVRFEHLKIEAEAYVGSRALPTFFNYSVNILEGILNYFHILS  133

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKK L IL DVSGIIKP+RMTLLLGPPSSGKTTLLLALAGKLD  LK SGRVTYNGH++
Sbjct  134   SRKKHLHILKDVSGIIKPSRMTLLLGPPSSGKTTLLLALAGKLDPTLKFSGRVTYNGHDL  193

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EF+P+RT+AYI+QHDLHIGEMTVRETLAFSARCQGVG RY++LAELSRREK  NIKPD 
Sbjct  194   DEFIPQRTAAYISQHDLHIGEMTVRETLAFSARCQGVGTRYDLLAELSRREKAANIKPDS  253

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID +MKA + EGQEASV+TDYILK+LGLE CAD +VGDEM+RGISGGQRKR+TTGEMLV
Sbjct  254   DIDAFMKAAATEGQEASVITDYILKVLGLEACADTMVGDEMLRGISGGQRKRVTTGEMLV  313

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA ALFMDEISTGLDSSTT+QIVNS++Q + IL+GTA ISLLQPAPETY+LFDDIILLS
Sbjct  314   GPALALFMDEISTGLDSSTTYQIVNSLKQYVQILKGTAFISLLQPAPETYDLFDDIILLS  373

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DG +VYQGPR+ VLEFF+ MGF+CPERKGVADFLQEVTSRKDQ QYW  ++E Y FITV 
Sbjct  374   DGLIVYQGPREQVLEFFEFMGFRCPERKGVADFLQEVTSRKDQMQYWASKDEPYRFITVK  433

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+E F+SFHVG++LG +L+ PF+K+KSHPAAL+ K YGVNKKELLKAC SREFLLMKRN
Sbjct  434   EFAETFESFHVGRRLGQDLSTPFEKAKSHPAALTTKNYGVNKKELLKACFSREFLLMKRN  493

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFV++FK  QL ++A + MT+FLRTEM +NS+ DG ++ GALFF VI+ +FNG +E++++
Sbjct  494   SFVFVFKFCQLTILALITMTLFLRTEMHRNSVIDGGIYAGALFFIVILVLFNGMAEISMT  553

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQR+L F+P WAYALPTWILKIP+T +EVAI V  TYY IGFDP+ GR F+Q
Sbjct  554   IAKLPVFYKQRELRFYPAWAYALPTWILKIPITFIEVAILVFTTYYVIGFDPNVGRLFRQ  613

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LLI VNQMAS LFR  AA GR++ VANTFGS  ++L+ +LGGFILSRD++KKWW+WGY
Sbjct  614   YLLLIIVNQMASGLFRTIAATGRNMTVANTFGSFILLLLFILGGFILSRDNIKKWWLWGY  673

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             WISP+MY QNAI VNE+LG SW HVP  ++ETLGV VL+SRG F E +WYW+GVGAL+G+
Sbjct  674   WISPMMYGQNAIVVNEFLGHSWSHVPQNSTETLGVQVLKSRGFFTETYWYWLGVGALLGF  733

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
               L NFL+ LALT+LN   KPQA+  +E   E N   R E I L   G S+S + N    
Sbjct  734   TILFNFLYTLALTFLNAFDKPQAVAQKE--PEDNETDRTEDIHLTNHGSSSSNQTNRGFG  791

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
               S             +    K+GMVLPFEP  I FDEI Y+VDMP E+K +G+ E +L+
Sbjct  792   PSS-------------SHNKKKKGMVLPFEPHSIAFDEITYSVDMPQEIKNEGVHEHKLI  838

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYIEGSI ISGYPK+QETFARI
Sbjct  839   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGSIKISGYPKKQETFARI  898

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQ DIHSPH+TVYES+++SAWLRLPPE+D+ TREMFVEEVM+LVEL  LR+ALVGL
Sbjct  899   SGYCEQNDIHSPHITVYESVLFSAWLRLPPEVDSETREMFVEEVMELVELNPLRQALVGL  958

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV+C
Sbjct  959   PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVIC  1018

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIF+ FDEL LLKRGG+EIYVGPLG HS QL++YFE I GI +I+DG NPATW
Sbjct  1019  TIHQPSIDIFETFDELFLLKRGGQEIYVGPLGHHSCQLVKYFEGIEGISKIKDGNNPATW  1078

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLE+T+ AQE ALG+DFA++Y+NSELYRRNK LI++LSKPAPGSKDLYFPT+Y++S+F Q
Sbjct  1079  MLEVTTAAQEVALGVDFADIYKNSELYRRNKELIKDLSKPAPGSKDLYFPTQYARSYFAQ  1138

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
              +ACLWKQH SYW NPPYTAVR LFTTF  L+FGT+FW +G K   QQDLFNAMG MYAA
Sbjct  1139  FLACLWKQHLSYWCNPPYTAVRFLFTTFIGLIFGTVFWNLGSKMTKQQDLFNAMGSMYAA  1198

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+FLG+QNA+SVQPVVA+ERTVFYRERAAGMYSALPYAFGQV IELP++FVQ  +YGVIV
Sbjct  1199  VLFLGIQNASSVQPVVAVERTVFYRERAAGMYSALPYAFGQVAIELPYIFVQAAVYGVIV  1258

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             YAM+GFEW  +KF W++FFMYFTLLYFT YGMM VAV+PNH IA++ISSAFY  WNLFSG
Sbjct  1259  YAMLGFEWNVSKFFWYLFFMYFTLLYFTFYGMMAVAVSPNHQIASVISSAFYAIWNLFSG  1318

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             FIIP+ R+P WW+WY +ICPV+WTLYGL+ASQFGD+KEKL+T ETV+DFV+ +F F H+ 
Sbjct  1319  FIIPRPRMPEWWKWYSWICPVAWTLYGLVASQFGDIKEKLETGETVEDFVREYFGFRHEL  1378

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VAT++ G  V+F F FA SIK FNFQ R
Sbjct  1379  LGVVATVVFGFSVLFAFAFAISIKLFNFQRR  1409



>gb|KDO58233.1| hypothetical protein CISIN_1g000541mg [Citrus sinensis]
Length=1433

 Score =  2072 bits (5369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1021/1411 (72%), Positives = 1210/1411 (86%), Gaps = 23/1411 (2%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPTY R+++GIL +    G   E+DV  LG  E++ ++++LV++A  DNE F
Sbjct  46    LKWAALEKLPTYNRLKKGILTSSR--GEANEVDVCNLGPQERQRIIDKLVKVADVDNEEF  103

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVGI LPTIEVRFEHLNV+AEAYVGSRALPT FNF ANI+E F+N ++ILP
Sbjct  104   LLKLKNRIDRVGISLPTIEVRFEHLNVEAEAYVGSRALPTFFNFCANIIEGFLNSVNILP  163

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKK L IL DVSGII+P RMTLLLGPP+SGKTTLLLALAGKLDS L+VSGRVTYNGH+M
Sbjct  164   SRKKHLTILKDVSGIIRPGRMTLLLGPPASGKTTLLLALAGKLDSSLRVSGRVTYNGHDM  223

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+QHD HIGEMTVRETLAFSARCQGVG R+EML+ELSRREK   IKPDP
Sbjct  224   DEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGSRHEMLSELSRREKAAGIKPDP  283

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA + EGQEASVVTDYILKILGL+VCAD +VGDEM+RGISGGQ+KR+TTGEM+V
Sbjct  284   DIDVFMKAAATEGQEASVVTDYILKILGLDVCADTMVGDEMLRGISGGQKKRVTTGEMMV  343

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA+ALFMDEISTGLDSSTTFQIVNS+RQSIHIL+GT +ISLLQPAPETY+LFDDIIL+S
Sbjct  344   GPAQALFMDEISTGLDSSTTFQIVNSLRQSIHILKGTTLISLLQPAPETYDLFDDIILIS  403

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR++VLEFF+ MGF+CP+RKGVADFLQEVTSRKDQEQYW+ +EE Y F+TV 
Sbjct  404   DGQIVYQGPREHVLEFFKFMGFECPKRKGVADFLQEVTSRKDQEQYWVHKEEPYRFVTVK  463

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF++AFQ F++G+K+GDEL +PFDK KSH AAL+ K YGV+KKELLKAC SRE LLMKRN
Sbjct  464   EFADAFQVFYMGQKVGDELRIPFDKRKSHRAALTTKIYGVSKKELLKACMSRELLLMKRN  523

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK+ QL +M  VAMT+F RT+M ++SI DG ++ GALFF V+M MFNG +E+ ++
Sbjct  524   SFVYIFKLCQLTIMGLVAMTLFFRTKMHRDSITDGVIYTGALFFIVLMIMFNGMAEIPMT  583

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQRDL F+P WAYAL TWILKIP++ +EVA+WV +TYY IGFDP+ GR F+Q
Sbjct  584   IAKLPIFYKQRDLRFYPSWAYALSTWILKIPISYIEVAVWVFLTYYVIGFDPNVGRLFRQ  643

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ +NQMASALFRL AA GR+++VANTFGS A++L+ VLGGF+LSR+D+KKWWIW Y
Sbjct  644   YLLLLFLNQMASALFRLIAATGRNIVVANTFGSFALLLLFVLGGFVLSREDIKKWWIWAY  703

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W SPLMYAQNAI VNE+LG SWR V   T+E LGV VL+SRG F +A+WYW+G+GAL G+
Sbjct  704   WCSPLMYAQNAIVVNEFLGNSWRKVLPNTTEPLGVQVLKSRGFFTDAYWYWLGLGALAGF  763

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             + L NF F LAL++LNP GK QA++S+E+ +  +  + G  I+L   G S +E       
Sbjct  764   ILLFNFGFTLALSFLNPFGKNQAVISQESQSNEHDNRTGGTIQLSTSGRSKAE-------  816

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
                             A+ + KRGMVLPF+P  ITFDEI Y+VDMP EM   G+ ED+LV
Sbjct  817   --------------VKANHHKKRGMVLPFKPHSITFDEIAYSVDMPQEMMRPGVLEDKLV  862

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LL G++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYI GSI ISGYPK+QETFARI
Sbjct  863   LLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYISGSIMISGYPKKQETFARI  922

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQ DIHSP+VTVYESL+YSAWLRLP E+D+ TR+MF+EEVM+LVEL  LR+ALVGL
Sbjct  923   SGYCEQNDIHSPNVTVYESLLYSAWLRLPLEVDSPTRKMFIEEVMELVELNPLRQALVGL  982

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  983   PGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1042

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDI +AFDEL LLKRGG+EIYVG LGRHSS LI+YFE I G+ +I+DGYNPATW
Sbjct  1043  TIHQPSIDIVEAFDELFLLKRGGQEIYVGSLGRHSSHLIKYFEGIRGVSKIKDGYNPATW  1102

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLE+T+ +QE ALGIDFA++Y++SELYRRNKALI+++SKPAPGSKDL+F T+Y+QSFFTQ
Sbjct  1103  MLEVTAPSQETALGIDFADIYKSSELYRRNKALIKDISKPAPGSKDLHFATQYAQSFFTQ  1162

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQHWSYWRNPPY+AVR LFTT  AL FGTMFW +G K + QQDLFNAMG MY A
Sbjct  1163  CMACLWKQHWSYWRNPPYSAVRFLFTTIIALAFGTMFWDMGTKTKKQQDLFNAMGSMYTA  1222

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+FLGVQNA SVQPVV+IERTVFYRERAAGMYSALPYAF Q +IE+P++FVQ++ YGVIV
Sbjct  1223  VLFLGVQNAASVQPVVSIERTVFYRERAAGMYSALPYAFAQALIEIPYIFVQSVTYGVIV  1282

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             YAMIGFEWTAAKFLW+ FFM+FTLLYFT YGMM VA+TPNH+I+ I++ AFYG WN+FSG
Sbjct  1283  YAMIGFEWTAAKFLWYQFFMFFTLLYFTYYGMMAVAMTPNHHISGIVAFAFYGLWNVFSG  1342

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             FIIP+TRIP+WWRWYY+ CPVSWTLYGL+ASQFGD++++L++ ETV+ F++SFF F HDF
Sbjct  1343  FIIPRTRIPIWWRWYYWACPVSWTLYGLVASQFGDIQDRLESGETVEQFLRSFFGFKHDF  1402

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VA ++    V+F  IFA  IK FNFQ R
Sbjct  1403  LGVVAAVVFAFPVLFALIFAVGIKVFNFQKR  1433



>ref|XP_008219877.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Prunus mume]
Length=1421

 Score =  2072 bits (5368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1035/1411 (73%), Positives = 1217/1411 (86%), Gaps = 6/1411 (0%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIE+LPT LRI RG+    E  G  +E+DVEKLG+ +++ LLERLV  A++DNE F
Sbjct  17    LKWAAIERLPTCLRIGRGLFIDGE--GQAREVDVEKLGLLDRKILLERLVSNAEKDNEKF  74

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK R DRV +DLPTIEVRFEHL V+A+ Y+GSRALPT+ NF  N+L+  ++YLHI P
Sbjct  75    LLKLKERIDRVRLDLPTIEVRFEHLTVEAKVYIGSRALPTLLNFAINMLQGMLHYLHIFP  134

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK PL IL  +SGIIKP RMTLLLGPPSSGKTTLLLALAG+L  DLK SGRVTYNGH M
Sbjct  135   SRKTPLTILQKISGIIKPQRMTLLLGPPSSGKTTLLLALAGRLGKDLKSSGRVTYNGHGM  194

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI+Q+DLHIGEMTV+ETLAFSARCQGVG   +MLAEL RREKE NIKPDP
Sbjct  195   EEFVPQRTSAYISQNDLHIGEMTVKETLAFSARCQGVGSNCDMLAELCRREKEENIKPDP  254

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID+Y+KA ++EGQE SVVTDYILKILGLEVCA+ +VGDEM+RGISGG+RKR+T GEMLV
Sbjct  255   DIDIYLKAAALEGQETSVVTDYILKILGLEVCANTMVGDEMVRGISGGERKRVTIGEMLV  314

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GP RALFMDEISTGLDSSTTFQIVNS+RQSIHIL  TAV+SLLQPAPETY LFDDIILLS
Sbjct  315   GPVRALFMDEISTGLDSSTTFQIVNSLRQSIHILSRTAVVSLLQPAPETYNLFDDIILLS  374

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQEVTSRKDQEQYW R +E Y F+TV 
Sbjct  375   DGQIVYQGPRENVLEFFESMGFKCPERKGVADFLQEVTSRKDQEQYWARLDEPYGFVTVN  434

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             +F+EAFQSF VG+KLGDELAVPFDKSKSH AALS KKYGVNK+EL +AC SREFLLMKRN
Sbjct  435   DFAEAFQSFPVGQKLGDELAVPFDKSKSHRAALSAKKYGVNKEELFRACVSREFLLMKRN  494

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SF +IFK   L+++A +  ++FL+ +M K+++ DG V+MGALFFAVI+ MFNG SEL ++
Sbjct  495   SFTFIFKFALLIMLASITASIFLQIKMHKDTVEDGGVYMGALFFAVIVAMFNGISELNMA  554

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I+KLP FYKQRDL FFP WAY+LP WILKIP+TLVE AIWV +TYY IGFDP   R FKQ
Sbjct  555   IMKLPVFYKQRDLLFFPSWAYSLPAWILKIPITLVESAIWVVITYYVIGFDPCVERLFKQ  614

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+C+NQMAS +FR  AA GR VIVA+T GS A+++++VLGGF+LSR+ V KWW+WGY
Sbjct  615   YILLLCINQMASGMFRFMAALGRDVIVASTTGSFALLIIMVLGGFVLSREAVPKWWLWGY  674

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W+SPLMY QNAI+VNE+LGK+WRHVP  ++E+LGV +L+S GIFPEA WYWIGV AL GY
Sbjct  675   WVSPLMYGQNAITVNEFLGKNWRHVPPNSTESLGVLILKSHGIFPEARWYWIGVVALFGY  734

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             +FL N L  LAL YL+P GKPQ +LS+E +AERNA   GE IEL  +G S+SE    +  
Sbjct  735   IFLFNLLLTLALQYLDPFGKPQTVLSKEGMAERNASTTGEFIELLPRGKSSSE----ITE  790

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
                   LS+R G  + A+   KRGMVLPF+PL + FDEI+YA+DMP EMKA+G  ED+L 
Sbjct  791   GQRRLPLSARRGRTDEANGKRKRGMVLPFQPLSLAFDEIRYAIDMPQEMKAEGAQEDQLE  850

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGG+I+GSI +SGYPK+QETFARI
Sbjct  851   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGHIKGSIMVSGYPKKQETFARI  910

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQTDIHSPHVTVYESL++SAWLRL PE+D+ATR+MF+EEVM+LVELTSLR ALVGL
Sbjct  911   SGYCEQTDIHSPHVTVYESLLFSAWLRLLPEVDSATRKMFIEEVMELVELTSLRGALVGL  970

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             P V GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  971   PSVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1030

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDELLLLK GGE+IY GPLG HSS LI+YFE ING+ +I+DGYNPATW
Sbjct  1031  TIHQPSIDIFDAFDELLLLKLGGEQIYGGPLGSHSSHLIKYFEGINGVPKIKDGYNPATW  1090

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLEITS AQEAALG++F EVY+NSE ++ +KA+I+ELS    GS+DLYFPT+YSQSF  Q
Sbjct  1091  MLEITSAAQEAALGVNFTEVYKNSEQFKSSKAMIKELSTHPSGSRDLYFPTRYSQSFLIQ  1150

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQHWSYWRNP Y+AVRLLFTTF ALLFG +FW +G KR  QQDLFNAMG MYAA
Sbjct  1151  CMACLWKQHWSYWRNPSYSAVRLLFTTFIALLFGWIFWNLGSKRTKQQDLFNAMGSMYAA  1210

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+FLGVQN  SVQPVVA+ERTVFYRERAAGMYSALPYAFGQ++IELP++F+QT+IYG IV
Sbjct  1211  VIFLGVQNGASVQPVVAVERTVFYRERAAGMYSALPYAFGQMMIELPYIFIQTVIYGFIV  1270

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             Y+M+GF+W AAKF W++FF+YFTLLY+TLYGMMT+A+TPNHNIAAI SS FY  WNLFSG
Sbjct  1271  YSMMGFDWIAAKFFWYLFFLYFTLLYYTLYGMMTMALTPNHNIAAITSSTFYAIWNLFSG  1330

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             F++P TRIP+WW+WYY++CPV+WTLYG++ASQFGD+K+ +++ E+V+ F++S+F + HDF
Sbjct  1331  FVVPPTRIPIWWKWYYWVCPVAWTLYGMVASQFGDIKDTMESGESVEHFLRSYFGYKHDF  1390

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VA +IVG  ++FGFIFA+ I+AFNFQ R
Sbjct  1391  LGIVAVVIVGFSLLFGFIFAYGIRAFNFQKR  1421



>ref|XP_010914975.1| PREDICTED: putative pleiotropic drug resistance protein 7 [Elaeis 
guineensis]
Length=1446

 Score =  2071 bits (5366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1008/1411 (71%), Positives = 1215/1411 (86%), Gaps = 9/1411 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIEKLPTY R+RRGIL A + GG  +E+D+  LG  E+++LLERLVR A+EDNE F
Sbjct  45    LKWAAIEKLPTYDRMRRGILTAVD-GGEIQEVDIHGLGFQERKNLLERLVRTAEEDNERF  103

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKL++R +RVGID PTIEVRFEHLN+DAEAYVG+R +PT  NF  N +   ++YLH++P
Sbjct  104   LLKLRNRMERVGIDNPTIEVRFEHLNIDAEAYVGNRGVPTFTNFFYNKIMDVLSYLHVVP  163

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             + K+P+ ILHD+SGII+P RMTL LGPP SGKTTLLLALAGKLDS LKVSGRVTYNGH+M
Sbjct  164   SGKRPISILHDISGIIRPCRMTLFLGPPGSGKTTLLLALAGKLDSTLKVSGRVTYNGHDM  223

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI QHDLHIGEMTVRETLAFSARCQGVG RY+ML ELSRREKE +IKPDP
Sbjct  224   DEFVPQRTSAYIGQHDLHIGEMTVRETLAFSARCQGVGTRYDMLTELSRREKEASIKPDP  283

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDVYMKAIS+EGQE SVVTDYILKILGLE+CAD +VGD MIRGISGGQ+KR+TTGEMLV
Sbjct  284   DIDVYMKAISVEGQE-SVVTDYILKILGLEICADTMVGDAMIRGISGGQKKRVTTGEMLV  342

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA+ALFMDEISTGLDSSTT+QIVNS+RQS+HIL GTA+ISLLQPAPETY+LFDDI+LLS
Sbjct  343   GPAKALFMDEISTGLDSSTTYQIVNSLRQSVHILGGTALISLLQPAPETYDLFDDIVLLS  402

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             +GQ+VYQGPR+N+LEFF+ MGFKCPERKGVADFLQEVTSRKDQ QYW  ++E Y++I+V 
Sbjct  403   EGQIVYQGPRENILEFFESMGFKCPERKGVADFLQEVTSRKDQHQYWAHKDEPYKYISVN  462

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EFSEAFQSFHVG+KLG+EL  PFD+S++HPAAL+  KYG++K  LLKAC SRE+LLMKRN
Sbjct  463   EFSEAFQSFHVGRKLGEELGTPFDRSRNHPAALTTSKYGISKMALLKACISREWLLMKRN  522

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK++QL+++  + MTVFLRT+M +N+  DG +F+GA+F  ++  +FNGF+ELA+S
Sbjct  523   SFVYIFKVVQLIILGTIGMTVFLRTKMHRNTAEDGFIFLGAMFLGLVTHLFNGFAELAMS  582

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQRDL F+P WAYALPTWILKIP++ +E A+W+ MTYY IGFDP+  RFF+ 
Sbjct  583   IAKLPIFYKQRDLLFYPSWAYALPTWILKIPISFLECAVWIGMTYYVIGFDPNIERFFRH  642

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ ++QMAS LFRL AA GR ++VA+TFGS A +++L+LGGF++SRDD+KKWWIWGY
Sbjct  643   YLLLVLISQMASGLFRLLAALGREMVVADTFGSFAQLVLLILGGFLISRDDIKKWWIWGY  702

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W SPLMYAQNAI+VNE+LG SW+ +   ++ TLGV VL+SRGIF + +WYWIGVGAL+GY
Sbjct  703   WSSPLMYAQNAIAVNEFLGHSWQKIVDTSNVTLGVQVLKSRGIFVDTNWYWIGVGALLGY  762

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             VFL N LF L L +L+PLGK Q ++SEE L E++A + GE IEL L  G+ S K    + 
Sbjct  763   VFLFNILFVLFLDWLDPLGKGQTVISEEELREKHANRTGESIEL-LPAGTNSSKPTESQG  821

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
             S +    +++         N K+GMVLPF PL ITFD+I+Y+VDMP EMK +G+TEDRL+
Sbjct  822   SGNDIRRTTQN------GDNRKKGMVLPFTPLSITFDDIRYSVDMPQEMKDRGITEDRLM  875

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYIEG+I+ISGYPK+QETFARI
Sbjct  876   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNISISGYPKKQETFARI  935

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQ DIHSPHVTVYESL+YSAWLRLPPE+D+  R+MFVEEVM+LVELTSLR ALVGL
Sbjct  936   SGYCEQNDIHSPHVTVYESLLYSAWLRLPPEVDSDMRKMFVEEVMELVELTSLRGALVGL  995

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  996   PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1055

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIF+AFDEL L+KRGGEEIYVGPLGR+S  LI+YFE I G+++I+DGYNPATW
Sbjct  1056  TIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGRNSCHLIKYFEGIEGVRKIKDGYNPATW  1115

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLE+T+ AQE  LG++FAE+Y+NS+L++RNKALI ELS P PGSKDL+FPTKYSQ F TQ
Sbjct  1116  MLEVTTPAQEEILGVNFAEIYKNSDLFKRNKALISELSSPPPGSKDLFFPTKYSQPFITQ  1175

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQH SYWRNP YTA R+ FT   AL+FGT+FW +G K  T+QDLFN++G MYAA
Sbjct  1176  CMACLWKQHKSYWRNPSYTATRIFFTAVIALIFGTIFWRLGKKVNTRQDLFNSLGSMYAA  1235

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+F+G+QN  +VQP+V +ERTVFYRE+AAGMYSALPYAF QV+IE+PH+F+QT+IYG+IV
Sbjct  1236  VLFIGIQNGQTVQPIVDVERTVFYREKAAGMYSALPYAFAQVLIEIPHIFLQTVIYGLIV  1295

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             Y++IGF+WT  KF W++FFM+FT +YFT YGMM VA+TPN +IAAI+S+AFY  WN+F+G
Sbjct  1296  YSLIGFDWTLEKFFWYLFFMFFTFMYFTFYGMMAVAMTPNSDIAAIVSTAFYAIWNIFAG  1355

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             F+IP+ RIPVWWRWY + CPV+WTLYGL+ASQFGD    ++  ETV+ F++ +F F HDF
Sbjct  1356  FLIPRPRIPVWWRWYSWACPVAWTLYGLVASQFGDYTNPMNNGETVQGFIRRYFGFRHDF  1415

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VA  +VG  ++F F+FAFSIK FNFQ R
Sbjct  1416  LGIVAVAVVGFALLFAFVFAFSIKIFNFQRR  1446



>gb|KCW81450.1| hypothetical protein EUGRSUZ_C02835 [Eucalyptus grandis]
Length=1412

 Score =  2071 bits (5365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1038/1435 (72%), Positives = 1219/1435 (85%), Gaps = 46/1435 (3%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG E+FSRSSR+  E++   LKWAA+E+LPTYLRIR+GILA EE  G  +E+++E 
Sbjct  24    IWRNSGKEIFSRSSRDEDEEEA--LKWAALERLPTYLRIRQGILAEEE--GQIREVNIEN  79

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+R+LLERL+  A+ED+E FLLKLK R +RVG+D PTIEVRFEHLNV+AEAYVGSR
Sbjct  80    LGSIERRNLLERLLNTAEEDHEKFLLKLKKRIERVGLDFPTIEVRFEHLNVEAEAYVGSR  139

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNFTANILE F+NY HILP+RK+PLPIL+ V+GIIKP RMTLLLGPPSSGKTTLL
Sbjct  140   ALPTIFNFTANILEGFLNYFHILPSRKQPLPILNAVNGIIKPCRMTLLLGPPSSGKTTLL  199

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRVTYNGH M EFVP+RTSAYI+Q+DLH GEMTVRETLAFSARCQG
Sbjct  200   LALAGKLSKDLKFSGRVTYNGHGMEEFVPQRTSAYISQYDLHTGEMTVRETLAFSARCQG  259

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VGH Y+ML ELSRRE+E NI+PDPDID++MKA + EGQE ++VTDYILKILGLE+CA+ +
Sbjct  260   VGHHYDMLEELSRREREANIRPDPDIDIFMKAAAQEGQETNIVTDYILKILGLEICANTM  319

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQ+KR+TTGEMLVGP +ALFMDEISTGLDS+TTFQIV+S+RQSIHIL G
Sbjct  320   VGDEMIRGISGGQKKRVTTGEMLVGPVKALFMDEISTGLDSATTFQIVSSLRQSIHILNG  379

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY LFDD+ILL+DGQ+VYQGPR+NVLEFF HMGFKCPERKGVADFLQE
Sbjct  380   TALISLLQPAPETYNLFDDVILLTDGQIVYQGPRENVLEFFDHMGFKCPERKGVADFLQE  439

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++  Y F+TV EFSEAFQSFH+G+K+GD+LA+PFDKSK+HPAAL+ K
Sbjct  440   VTSRKDQEQYWAHKDSPYRFVTVKEFSEAFQSFHIGQKVGDQLAIPFDKSKAHPAALTTK  499

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV++KELL+AC SRE LLMKRN FV+IF M+QL+ +AF+ MTVFLRT+M ++++ DG 
Sbjct  500   KYGVSQKELLRACISRELLLMKRNLFVHIFTMLQLMFIAFITMTVFLRTKMHRDTVMDGG  559

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +++GALFF++ + MFNGFSE+ ++I KLP FYKQRD FFFP WAY+LPT ILKIP TLVE
Sbjct  560   IYIGALFFSLTIVMFNGFSEVGMTITKLPVFYKQRD-FFFPVWAYSLPTCILKIPSTLVE  618

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIWV MTYY IGFDP AGRFFKQ FLL+C++Q+ S LFR   A GR++IVA TFG+  +
Sbjct  619   VAIWVFMTYYVIGFDPCAGRFFKQYFLLLCLHQVTSGLFRFVGAIGRNIIVAGTFGTFGL  678

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + ++V GGFI+SRDDVK WWI GYWISP+MY QNA++VNE+LGK WRH+P  ++E LGV 
Sbjct  679   LSIVVFGGFIISRDDVKPWWICGYWISPMMYGQNAMAVNEFLGKQWRHIPPNSTEPLGVL  738

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRGIFPEAHWYWIGVGA +GY+FL N LF +AL YL+          ++    R + 
Sbjct  739   VLKSRGIFPEAHWYWIGVGASIGYIFLFNILFTVALKYLD----------QKETGRRRST  788

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
               G    L  + G  ++                       +DPN KRGMVL FEPL ITF
Sbjct  789   TSG---TLSPRVGRIND-----------------------SDPNRKRGMVLSFEPLSITF  822

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+IKYA+DMP EMKAQG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  823   DDIKYAIDMPQEMKAQGIPEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  882

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGY +G ITISGYPK+QETF RI+GYCEQTDIHSPHVTV ESLVYSAWLRLPPE+D+ T
Sbjct  883   TGGYFDGIITISGYPKKQETFTRISGYCEQTDIHSPHVTVSESLVYSAWLRLPPEVDSET  942

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+L+ELT LREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  943   RKMFIEEVMELIELTPLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1002

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSI+IFDAFDELLLLKRGGEEIYVGPLG+ S 
Sbjct  1003  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSINIFDAFDELLLLKRGGEEIYVGPLGQRSL  1062

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI YFE I+G+ +I+DGYNPATWMLE+T+  QE  LG+DF  VYRNSEL+RRNKALI+E
Sbjct  1063  HLINYFEGISGVPKIKDGYNPATWMLEVTTAPQEEILGVDFTNVYRNSELFRRNKALIRE  1122

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSKDLYFPT+YSQSF  QC+ACLWKQHWSYWRNP YTAVRLLFTTF AL+FG++
Sbjct  1123  LSTPPPGSKDLYFPTQYSQSFSIQCIACLWKQHWSYWRNPAYTAVRLLFTTFIALMFGSI  1182

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G KR  Q+      G    AV+F+G QN+TSVQPVVAIERTVFYRERAAGMYSALP
Sbjct  1183  FWNLGSKRSLQRH-----GLYVHAVLFIGFQNSTSVQPVVAIERTVFYRERAAGMYSALP  1237

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YA   V+IE+P++ +QT+IYGV+VYAMIGF+WTA+KF W IF M+FTLL +T YGMMTVA
Sbjct  1238  YAIAHVIIEIPYIIIQTIIYGVVVYAMIGFDWTASKFFWDIFCMFFTLLCYTFYGMMTVA  1297

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
              TPN NIA I S+ FY  WNLFSGF++P+TRIP+WWRWYY+ CPVSWT+YGL+ASQFGDV
Sbjct  1298  ATPNLNIAVITSAGFYLIWNLFSGFVVPRTRIPIWWRWYYWACPVSWTMYGLVASQFGDV  1357

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K+KLDT ETV++FV+S+F F HDF+G VA ++VG  V+F F+FAFSI+ FNFQ R
Sbjct  1358  KDKLDTGETVEEFVQSYFGFRHDFLGVVAIVLVGFPVLFVFVFAFSIRTFNFQKR  1412



>ref|XP_004291477.1| PREDICTED: pleiotropic drug resistance protein 1-like [Fragaria 
vesca subsp. vesca]
Length=1429

 Score =  2071 bits (5365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1028/1415 (73%), Positives = 1208/1415 (85%), Gaps = 6/1415 (0%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIE+LPT LRI RG+    E  G  +E+DVE LG+ E+++LLERLV  A++DNE F
Sbjct  17    LKWAAIERLPTGLRIGRGLFIDGE--GQAREVDVENLGLLERKTLLERLVNNAEKDNEKF  74

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVG+D+PTIEVRFEHL V+A+ Y+GSRALPT+ NF  N+++ +++YLHI P
Sbjct  75    LLKLKNRIDRVGLDMPTIEVRFEHLTVEAQVYLGSRALPTLLNFAINMIQGWLHYLHIFP  134

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK  L IL +VSGIIKP RMTLLLGPPSSGKTTLLLALAG+L  DLK SG VTYNGH M
Sbjct  135   SRKASLTILQNVSGIIKPQRMTLLLGPPSSGKTTLLLALAGRLGKDLKSSGDVTYNGHSM  194

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI Q DLHIGEMTV+ETLAFSARCQGVG   EMLAELSRREK+ NIKPDP
Sbjct  195   AEFVPQRTSAYICQKDLHIGEMTVKETLAFSARCQGVGSNCEMLAELSRREKDENIKPDP  254

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID+Y KA ++EGQE+SVV DYILKILGLEVCA+ +VGDEM+RGISGG+RKR+T GEMLV
Sbjct  255   DIDIYQKAAALEGQESSVVADYILKILGLEVCANTMVGDEMVRGISGGERKRVTIGEMLV  314

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GP RALFMDEISTGLDSSTTFQIVNS+RQSIHIL+GT V+SLLQPAPETY LFDDIILLS
Sbjct  315   GPVRALFMDEISTGLDSSTTFQIVNSLRQSIHILRGTGVVSLLQPAPETYNLFDDIILLS  374

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR+ VL FF+ MGFKCPERKGVADFLQEVTSRKDQEQYW R  E Y ++TV 
Sbjct  375   DGQIVYQGPRECVLGFFEFMGFKCPERKGVADFLQEVTSRKDQEQYWARLHEPYRYVTVN  434

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQ+FH+G+KLGDELA PFD+SKSH AAL+ KKYGV+K EL +AC SREFLLMKRN
Sbjct  435   EFAEAFQAFHIGQKLGDELASPFDRSKSHRAALTAKKYGVSKTELFRACVSREFLLMKRN  494

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SF YIFK+  L+++A +  T+F+R EM K S+ DG +++GALFFAVI+ MFNG SEL ++
Sbjct  495   SFAYIFKLALLIILASITTTIFMRVEMHKGSVLDGGIYLGALFFAVIVAMFNGISELNMA  554

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I+KLP FYKQRDL F+P WAY++P WILKIP+TLVE  IWV +TYY IGFDP   RF KQ
Sbjct  555   IMKLPIFYKQRDLLFYPAWAYSIPGWILKIPITLVESFIWVIITYYVIGFDPHIERFLKQ  614

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               +L+C+NQMAS LFR  AA GR VIVA TFG+ A++++LVLGGF+LSR+ + KWW+WGY
Sbjct  615   YMILVCINQMASGLFRAMAAIGRDVIVATTFGTFALLIILVLGGFVLSREAIPKWWLWGY  674

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             WISPLMY QNAI+VNE+LGKSW H P G++E+LGV VL+S GIFPEAHWYWIGV AL+GY
Sbjct  675   WISPLMYGQNAIAVNEFLGKSWSHEPPGSTESLGVMVLKSHGIFPEAHWYWIGVAALIGY  734

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTS----EKgn  2400
              FL N +   AL YL+P GKPQ +LS+E++AERN    GE IEL  +G  +S    +   
Sbjct  735   TFLFNIIITFALQYLDPFGKPQVVLSKESIAERNGNGTGEFIELLSRGNKSSASLHDNAE  794

Query  2401  vvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTE  2580
              +    +S S S+  G  + A+   KRGMVLPF+PL + FDEI+YA+DMP EMKAQG+ E
Sbjct  795   SIVEGATSLSSSTSGGRSDNANGRRKRGMVLPFQPLSLAFDEIRYAIDMPQEMKAQGVKE  854

Query  2581  DRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQET  2760
             DRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGG+I+GSI ISGY KRQET
Sbjct  855   DRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGHIDGSIMISGYSKRQET  914

Query  2761  FARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREA  2940
             FARI+GYCEQTDIHSPHVTVYESL++SAWLRL PE+D ATR+MF+EEVM+LVELTSLR A
Sbjct  915   FARISGYCEQTDIHSPHVTVYESLLFSAWLRLLPEVDPATRKMFIEEVMELVELTSLRGA  974

Query  2941  LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR  3120
             LVGLPGV GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR
Sbjct  975   LVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR  1034

Query  3121  TVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYN  3300
             TVVCTIHQPSIDIF++FDELLLLK GGE IY GPLG HSS LI YFE ING+ +I+DGYN
Sbjct  1035  TVVCTIHQPSIDIFESFDELLLLKLGGEPIYAGPLGLHSSHLIEYFEGINGVPKIKDGYN  1094

Query  3301  PATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQS  3480
             PATWMLEITS AQE ALG++F +VY+ SELY+R K LI+ LS P PGSKDLYFPT+YSQS
Sbjct  1095  PATWMLEITSAAQEEALGVNFTDVYKKSELYKRMKDLIKGLSIPPPGSKDLYFPTRYSQS  1154

Query  3481  FFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGC  3660
             F TQCMACLWKQHWSYWRNP Y+AVRLLFTTF A LFG +FW +G KR  QQD+FNAMG 
Sbjct  1155  FHTQCMACLWKQHWSYWRNPSYSAVRLLFTTFIAFLFGMIFWDLGSKRSKQQDIFNAMGS  1214

Query  3661  MYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIY  3840
             MY+AV+FLGVQN+ SVQP+V +ERTVFYRERAAGMYSALPYAFGQ++IE+P++F+QT+IY
Sbjct  1215  MYSAVIFLGVQNSASVQPIVDVERTVFYRERAAGMYSALPYAFGQMMIEVPYIFIQTIIY  1274

Query  3841  GVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWN  4020
             GVIVY M+GF+WT +KFLW++FFMYFTLLYFT YGMMT+A+TPNHNIAAI SS+FY  WN
Sbjct  1275  GVIVYTMMGFDWTVSKFLWYLFFMYFTLLYFTFYGMMTMALTPNHNIAAITSSSFYAIWN  1334

Query  4021  LFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdf  4200
             LFSGF+IP +RIP+WW+WYY+ICPV+WTLYG+ ASQFGD++ KLDT E V+DF+ S+F +
Sbjct  1335  LFSGFVIPPSRIPIWWKWYYWICPVAWTLYGMAASQFGDIEHKLDTGEAVEDFLTSYFGY  1394

Query  4201  dhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              HDF+  V+ ++VG  V+FGFIFA+SI+AFNFQ R
Sbjct  1395  RHDFLAVVSVVVVGFSVLFGFIFAYSIRAFNFQKR  1429



>ref|XP_010916538.1| PREDICTED: pleiotropic drug resistance protein 3-like [Elaeis 
guineensis]
Length=1447

 Score =  2070 bits (5363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1029/1440 (71%), Positives = 1208/1440 (84%), Gaps = 10/1440 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WRS G ++FSRSS++  ++    LKWAA+EKLPTY R+RRGIL   E  G  KEID+  
Sbjct  13    IWRS-GDDIFSRSSQDEDDEAA--LKWAALEKLPTYNRLRRGILTLAE--GDHKEIDIHS  67

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L + E+++LLERL+R+A++DNE FLLKL+ R DRVGI+LPTIEVR+EHLN+ AE +VGSR
Sbjct  68    LSLQERKTLLERLIRVAEKDNEEFLLKLRDRIDRVGIELPTIEVRYEHLNIQAEIHVGSR  127

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
              LPTI+N T N+LEA  N  HILP+RK+PLPILHD SGIIKP RMTLLLGPP SGKTTLL
Sbjct  128   GLPTIWNSTINVLEAVANKFHILPSRKRPLPILHDASGIIKPRRMTLLLGPPGSGKTTLL  187

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLDSDLKVSGRVTYNGH M EFVP+RT+AYI QHDLHIGEMTVRETLAFSARCQG
Sbjct  188   LALAGKLDSDLKVSGRVTYNGHGMDEFVPQRTAAYIGQHDLHIGEMTVRETLAFSARCQG  247

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEML ELSRREK  NI PDPDIDV+MKA S+ GQE+SVVTDY+LKILGLE+CAD +
Sbjct  248   VGARYEMLTELSRREKAANIMPDPDIDVFMKAASMGGQESSVVTDYMLKILGLEICADTM  307

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM RGISGGQRKR+TTGEMLVG ARALFMDEISTGLDSSTTFQIVNS+RQS+H L  
Sbjct  308   VGDEMRRGISGGQRKRVTTGEMLVGAARALFMDEISTGLDSSTTFQIVNSLRQSVHALSA  367

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETYELFDDIILLS+GQ+VYQGPR++VLEFF+ MGFKCP+RKGVADFLQE
Sbjct  368   TAVISLLQPAPETYELFDDIILLSEGQIVYQGPREHVLEFFESMGFKCPKRKGVADFLQE  427

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ QYW   +E Y ++ V EF+EAFQSFH+G+ +G+EL++PFDKSKSHPA L+  
Sbjct  428   VTSRKDQRQYWAHPDEHYRYVPVREFAEAFQSFHIGQVIGNELSIPFDKSKSHPAVLTTS  487

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGVNKKELLK   +RE LLMKRNSFVYIF+  ++V+++ + MT FLRTEM + S++DG 
Sbjct  488   KYGVNKKELLKTNLARELLLMKRNSFVYIFQATRIVIVSLITMTTFLRTEMHRESVSDGG  547

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALF+ ++  MFNGF+ELA++I+KLP F++QRDL F+P W+Y +P WILKIP+T +E
Sbjct  548   IYMGALFYGLVTIMFNGFAELAMTIVKLPVFFRQRDLLFYPAWSYTIPMWILKIPITFIE  607

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V IWV  TYY IGFDP  GR FKQ  LL+ +NQMAS LFR  AA GR++IVANTFGS  M
Sbjct  608   VGIWVFTTYYVIGFDPKIGRLFKQYQLLLAINQMASGLFRCIAALGRNLIVANTFGSFTM  667

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +++++LGGFI+SR++VKKWWIWGYWISPLMYAQNAIS NE+LGKSW H+  G++E LGV 
Sbjct  668   LILMLLGGFIISRENVKKWWIWGYWISPLMYAQNAISTNEFLGKSWSHMLPGSTEPLGVV  727

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+SRGIFPEA WYWIG GALVGY  L N LF + LTY+ P GK Q  +SEETL E++A 
Sbjct  728   ILKSRGIFPEAKWYWIGFGALVGYTLLFNALFTVVLTYIKPFGKAQPAISEETLKEKHAN  787

Query  2341  KRGEPIELELKGG-----STSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEP  2505
               GE +E    G      STSE  +     +     +S   +  V     ++GMVLPF P
Sbjct  788   LTGEVLEQSSVGKNSLNQSTSESKSESPHEIRRSGTASTSTNEVVDLNQNQKGMVLPFVP  847

Query  2506  LCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDV  2685
             L +TFD I+Y VDMP +MKA+G TEDRL LLKG++G+FRPGVLTALMG+SGAGKTTL+DV
Sbjct  848   LSMTFDNIRYYVDMPQQMKARGATEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLLDV  907

Query  2686  LAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPE  2865
             LAGRKTGGYIEG+ITISGYPK+QETFAR++GYCEQ DIHSP VTVYESLV+S WLRLP E
Sbjct  908   LAGRKTGGYIEGNITISGYPKKQETFARVSGYCEQDDIHSPQVTVYESLVFSTWLRLPAE  967

Query  2866  IDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDE  3045
             +D+  ++MF+EEVM+LVELT LR+ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDE
Sbjct  968   VDSTAKKMFIEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDE  1027

Query  3046  PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPL  3225
             PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLLLK+GGEEIYVGPL
Sbjct  1028  PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKQGGEEIYVGPL  1087

Query  3226  GRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNK  3405
             GRHS  LI YFE I G+ +I+DGYNPATWMLE T+  QE  LG++F+E+Y+ SEL++RNK
Sbjct  1088  GRHSCHLINYFEGIEGVSKIKDGYNPATWMLETTTVFQEEILGVNFSEIYKKSELHQRNK  1147

Query  3406  ALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNAL  3585
              LI+E+S P PGS DLYFPT+YSQSFFTQCMA LWKQH SYWRNP YTAVR L TT  AL
Sbjct  1148  NLIKEMSTPPPGSSDLYFPTQYSQSFFTQCMANLWKQHSSYWRNPSYTAVRFLSTTIMAL  1207

Query  3586  LFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGM  3765
             LFGT+FW +G KR  QQDLFNAMG MYAAV+F+G+QNA+SVQPVV +ERTVFYRERAAGM
Sbjct  1208  LFGTIFWDLGTKRSVQQDLFNAMGSMYAAVLFIGIQNASSVQPVVDVERTVFYRERAAGM  1267

Query  3766  YSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyG  3945
             YSALPYAF QV IE+P++ +QTL YGVIVYAMIGFEWTAAKFLW++FFMYFTLLYFT YG
Sbjct  1268  YSALPYAFAQVAIEIPYILIQTLTYGVIVYAMIGFEWTAAKFLWYMFFMYFTLLYFTFYG  1327

Query  3946  MMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIAS  4125
             MM V +TPNHNI+AI SSA Y  WNLFSGFIIP+ RIP+WWRWYY+ CPV+WTLYGL+AS
Sbjct  1328  MMAVGMTPNHNISAIASSACYVLWNLFSGFIIPRPRIPIWWRWYYWACPVAWTLYGLVAS  1387

Query  4126  QFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             QFGDV+++LD   +V DFV S+F F H F+G VA ++V    +F F+F FSIK  NFQ R
Sbjct  1388  QFGDVQDQLDIGVSVADFVGSYFGFRHSFLGVVAAMVVAFSALFAFLFGFSIKMINFQKR  1447



>ref|XP_008219879.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X3 [Prunus mume]
Length=1417

 Score =  2070 bits (5363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1031/1411 (73%), Positives = 1214/1411 (86%), Gaps = 10/1411 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIE+LPT LRI RG+    E  G  +E+DVEKLG+ +++ LLERLV  A++DNE F
Sbjct  17    LKWAAIERLPTCLRIGRGLFIDGE--GQAREVDVEKLGLLDRKILLERLVSNAEKDNEKF  74

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK R DRV +DLPTIEVRFEHL V+A+ Y+GSRALPT+ NF  N+L+  ++YLHI P
Sbjct  75    LLKLKERIDRVRLDLPTIEVRFEHLTVEAKVYIGSRALPTLLNFAINMLQGMLHYLHIFP  134

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK PL IL  +SGIIKP RMTLLLGPPSSGKTTLLLALAG+L  DLK SGRVTYNGH M
Sbjct  135   SRKTPLTILQKISGIIKPQRMTLLLGPPSSGKTTLLLALAGRLGKDLKSSGRVTYNGHGM  194

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI+Q+DLHIGEMTV+ETLAFSARCQGVG   +MLAEL RREKE NIKPDP
Sbjct  195   EEFVPQRTSAYISQNDLHIGEMTVKETLAFSARCQGVGSNCDMLAELCRREKEENIKPDP  254

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID+Y+KA ++EGQE SVVTDYILKILGLEVCA+ +VGDEM+RGISGG+RKR+T GEMLV
Sbjct  255   DIDIYLKAAALEGQETSVVTDYILKILGLEVCANTMVGDEMVRGISGGERKRVTIGEMLV  314

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GP RALFMDEISTGLDSSTTFQIVNS+RQSIHIL  TAV+SLLQPAPETY LFDDIILLS
Sbjct  315   GPVRALFMDEISTGLDSSTTFQIVNSLRQSIHILSRTAVVSLLQPAPETYNLFDDIILLS  374

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQEVTSRKDQEQYW R +E Y F+TV 
Sbjct  375   DGQIVYQGPRENVLEFFESMGFKCPERKGVADFLQEVTSRKDQEQYWARLDEPYGFVTVN  434

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             +F+EAFQSF VG+KLGDELAVPFDKSKSH AALS KKYGVNK+EL +AC SREFLLMKRN
Sbjct  435   DFAEAFQSFPVGQKLGDELAVPFDKSKSHRAALSAKKYGVNKEELFRACVSREFLLMKRN  494

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SF +IFK   L+++A +  ++FL+ +M K+++ DG V+MGALFFAVI+ MFNG SEL ++
Sbjct  495   SFTFIFKFALLIMLASITASIFLQIKMHKDTVEDGGVYMGALFFAVIVAMFNGISELNMA  554

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I+KLP FYKQRDL FFP WAY+LP WILKIP+TLVE AIWV +TYY IGFDP   R FKQ
Sbjct  555   IMKLPVFYKQRDLLFFPSWAYSLPAWILKIPITLVESAIWVVITYYVIGFDPCVERLFKQ  614

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+C+NQMAS +FR  AA GR VIVA+T GS A+++++VLGGF+LSR+ V KWW+WGY
Sbjct  615   YILLLCINQMASGMFRFMAALGRDVIVASTTGSFALLIIMVLGGFVLSREAVPKWWLWGY  674

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W+SPLMY QNAI+VNE+LGK+WRHVP  ++E+LGV +L+S GIFPEA WYWIGV AL GY
Sbjct  675   WVSPLMYGQNAITVNEFLGKNWRHVPPNSTESLGVLILKSHGIFPEARWYWIGVVALFGY  734

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             +FL N L  LAL YL+P GKPQ +LS+E +AERNA   GE IEL  +G S+S +  +   
Sbjct  735   IFLFNLLLTLALQYLDPFGKPQTVLSKEGMAERNASTTGEFIELLPRGKSSSGQRRLPLS  794

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
             +   R+          A+   KRGMVLPF+PL + FDEI+YA+DMP EMKA+G  ED+L 
Sbjct  795   ARRGRTDE--------ANGKRKRGMVLPFQPLSLAFDEIRYAIDMPQEMKAEGAQEDQLE  846

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGG+I+GSI +SGYPK+QETFARI
Sbjct  847   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGHIKGSIMVSGYPKKQETFARI  906

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQTDIHSPHVTVYESL++SAWLRL PE+D+ATR+MF+EEVM+LVELTSLR ALVGL
Sbjct  907   SGYCEQTDIHSPHVTVYESLLFSAWLRLLPEVDSATRKMFIEEVMELVELTSLRGALVGL  966

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             P V GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  967   PSVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1026

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDELLLLK GGE+IY GPLG HSS LI+YFE ING+ +I+DGYNPATW
Sbjct  1027  TIHQPSIDIFDAFDELLLLKLGGEQIYGGPLGSHSSHLIKYFEGINGVPKIKDGYNPATW  1086

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLEITS AQEAALG++F EVY+NSE ++ +KA+I+ELS    GS+DLYFPT+YSQSF  Q
Sbjct  1087  MLEITSAAQEAALGVNFTEVYKNSEQFKSSKAMIKELSTHPSGSRDLYFPTRYSQSFLIQ  1146

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQHWSYWRNP Y+AVRLLFTTF ALLFG +FW +G KR  QQDLFNAMG MYAA
Sbjct  1147  CMACLWKQHWSYWRNPSYSAVRLLFTTFIALLFGWIFWNLGSKRTKQQDLFNAMGSMYAA  1206

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+FLGVQN  SVQPVVA+ERTVFYRERAAGMYSALPYAFGQ++IELP++F+QT+IYG IV
Sbjct  1207  VIFLGVQNGASVQPVVAVERTVFYRERAAGMYSALPYAFGQMMIELPYIFIQTVIYGFIV  1266

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             Y+M+GF+W AAKF W++FF+YFTLLY+TLYGMMT+A+TPNHNIAAI SS FY  WNLFSG
Sbjct  1267  YSMMGFDWIAAKFFWYLFFLYFTLLYYTLYGMMTMALTPNHNIAAITSSTFYAIWNLFSG  1326

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             F++P TRIP+WW+WYY++CPV+WTLYG++ASQFGD+K+ +++ E+V+ F++S+F + HDF
Sbjct  1327  FVVPPTRIPIWWKWYYWVCPVAWTLYGMVASQFGDIKDTMESGESVEHFLRSYFGYKHDF  1386

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VA +IVG  ++FGFIFA+ I+AFNFQ R
Sbjct  1387  LGIVAVVIVGFSLLFGFIFAYGIRAFNFQKR  1417



>ref|XP_006465411.1| PREDICTED: pleiotropic drug resistance protein 1-like [Citrus 
sinensis]
Length=1445

 Score =  2068 bits (5357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1024/1411 (73%), Positives = 1216/1411 (86%), Gaps = 11/1411 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPTY R+++GIL +    G   E+DV  LG  E++ ++++LV++A  DNE F
Sbjct  46    LKWAALEKLPTYNRLKKGILTSSR--GEANEVDVCNLGPQERQRIIDKLVKVADVDNEEF  103

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVGI LPTIEVRFEHLNV+AEAYVGSRALPT FNF ANI+E F+N ++ILP
Sbjct  104   LLKLKNRIDRVGISLPTIEVRFEHLNVEAEAYVGSRALPTFFNFCANIIEGFLNSVNILP  163

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKK L IL DVSGII+P RMTLLLGPP+SGKTTLLLALAGKLDS L+VSGRVTYNGH+M
Sbjct  164   SRKKHLAILKDVSGIIRPGRMTLLLGPPASGKTTLLLALAGKLDSSLRVSGRVTYNGHDM  223

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+QHD HIGEMTVRETLAFSARCQGVG R+EML+ELSRREK   IKPDP
Sbjct  224   DEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGSRHEMLSELSRREKAAGIKPDP  283

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA + EGQEASVVTDYILKILGL+VCAD +VGDEM+RGISGGQ+KR+TTGEM+V
Sbjct  284   DIDVFMKAAATEGQEASVVTDYILKILGLDVCADTMVGDEMLRGISGGQKKRVTTGEMMV  343

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA+ALFMDEISTGLDSSTTFQIVNS+RQSIHIL+GT +ISLLQPAPETY+LFDDIIL+S
Sbjct  344   GPAQALFMDEISTGLDSSTTFQIVNSLRQSIHILKGTTLISLLQPAPETYDLFDDIILIS  403

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR++VLEFF+ MGF+CP+RKGVADFLQEVTSRKDQEQYW+ +EE Y F+TV 
Sbjct  404   DGQIVYQGPREHVLEFFKFMGFECPKRKGVADFLQEVTSRKDQEQYWVHKEEPYRFVTVK  463

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF++AFQ F++G+K+GDEL +PFDK KSH AAL+ K YGV+KKELLKAC SRE LLMKRN
Sbjct  464   EFADAFQVFYMGQKVGDELRIPFDKRKSHRAALTTKIYGVSKKELLKACMSRELLLMKRN  523

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK+ QL +M  VAMT+F RT+M ++SI DG ++ GALFF V+M MFNG +E+ ++
Sbjct  524   SFVYIFKLCQLTIMGLVAMTLFFRTKMHRDSITDGVIYTGALFFIVLMIMFNGMAEIPMT  583

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQRDL F+P WAYAL TWILKIP++ +EVA+WV +TYY IGFDP+ GR F+Q
Sbjct  584   IAKLPIFYKQRDLRFYPSWAYALSTWILKIPISYIEVAVWVFLTYYVIGFDPNVGRLFRQ  643

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ +NQMASALFRL AA GR+++VANTFGS A++L+ VLGGF+LSR+D+KKWWIW Y
Sbjct  644   YLLLLFLNQMASALFRLIAATGRNIVVANTFGSFALLLLFVLGGFVLSREDIKKWWIWAY  703

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W SPLMYAQNAI VNE+LG SWR V   T+E LGV VL+SRG F +A+WYW+G+GAL G+
Sbjct  704   WCSPLMYAQNAIVVNEFLGNSWRKVLPNTTEPLGVQVLKSRGFFTDAYWYWLGLGALAGF  763

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             + L NF F LAL++LNP GK QA++SEE+ +  +  + G  I+L     STSE    +  
Sbjct  764   ILLFNFGFTLALSFLNPFGKNQAVISEESQSNEHDNRTGGTIQL-----STSE----IGH  814

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
              +     SS + +   A+ + KRGMVLPF+P  ITFDEI Y+VDMP EM   G+ ED+LV
Sbjct  815   DIMGTYSSSLIEAEVKANHHKKRGMVLPFKPHSITFDEITYSVDMPQEMMRPGVLEDKLV  874

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LL G++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYI GSI ISGYPK+QETFARI
Sbjct  875   LLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYISGSIMISGYPKKQETFARI  934

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQ DIHSP+VTVYESL+YSAWLRLP E+D+ T++MF+EEVM+LVEL  LR+ALVGL
Sbjct  935   SGYCEQNDIHSPNVTVYESLLYSAWLRLPLEVDSPTQKMFIEEVMELVELKPLRQALVGL  994

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  995   PGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1054

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDI +AFDEL LLKRGG+EIYVG LGRHSS LI+YFE I G+ +I+DGYNPATW
Sbjct  1055  TIHQPSIDIVEAFDELFLLKRGGQEIYVGSLGRHSSHLIKYFEGIRGVSKIKDGYNPATW  1114

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLE+T+ +QE ALGIDFA++Y++SELYRRNKALI+++SKPAPGSKDL+F T+Y+QSFFTQ
Sbjct  1115  MLEVTAPSQETALGIDFADIYKSSELYRRNKALIKDISKPAPGSKDLHFATQYAQSFFTQ  1174

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQHWSYWRNPPY+AVR LFTT  AL FGTMFW +G K + QQDLFNAMG MY A
Sbjct  1175  CMACLWKQHWSYWRNPPYSAVRFLFTTIIALAFGTMFWDMGTKTKKQQDLFNAMGSMYTA  1234

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+FLGVQNA SVQPVV+IERTVFYRERAAGMYSALPYAF Q +IE+P++FVQ++ YGVIV
Sbjct  1235  VLFLGVQNAASVQPVVSIERTVFYRERAAGMYSALPYAFAQALIEIPYIFVQSVTYGVIV  1294

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             YAMIGFEWTAAKFLW+ FFM+FTLLYFT YGMM VA+TPNH+I+ I++ AFYG WN+FSG
Sbjct  1295  YAMIGFEWTAAKFLWYQFFMFFTLLYFTYYGMMAVAMTPNHHISGIVAFAFYGLWNVFSG  1354

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             FIIP+TRIP+WWRWYY+ CPVSWTLYGL+ASQFGD++++L++ ETV+ F++SFF F HDF
Sbjct  1355  FIIPRTRIPIWWRWYYWACPVSWTLYGLVASQFGDIQDRLESGETVEQFLRSFFGFKHDF  1414

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VA ++    V+F  IFA  IK FNFQ R
Sbjct  1415  LGVVAAVVFAFPVLFALIFAVGIKVFNFQKR  1445



>ref|XP_008219878.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Prunus mume]
Length=1419

 Score =  2067 bits (5356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1036/1411 (73%), Positives = 1216/1411 (86%), Gaps = 8/1411 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIE+LPT LRI RG+    E  G  +E+DVEKLG+ +++ LLERLV  A++DNE F
Sbjct  17    LKWAAIERLPTCLRIGRGLFIDGE--GQAREVDVEKLGLLDRKILLERLVSNAEKDNEKF  74

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK R DRV +DLPTIEVRFEHL V+A+ Y+GSRALPT+ NF  N+L+  ++YLHI P
Sbjct  75    LLKLKERIDRVRLDLPTIEVRFEHLTVEAKVYIGSRALPTLLNFAINMLQGMLHYLHIFP  134

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK PL IL  +SGIIKP RMTLLLGPPSSGKTTLLLALAG+L  DLK SGRVTYNGH M
Sbjct  135   SRKTPLTILQKISGIIKPQRMTLLLGPPSSGKTTLLLALAGRLGKDLKSSGRVTYNGHGM  194

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI+Q+DLHIGEMTV+ETLAFSARCQGVG   +MLAEL RREKE NIKPDP
Sbjct  195   EEFVPQRTSAYISQNDLHIGEMTVKETLAFSARCQGVGSNCDMLAELCRREKEENIKPDP  254

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID+Y+KA ++EGQE SVVTDYILKILGLEVCA+ +VGDEM+RGISGG+RKR+T GEMLV
Sbjct  255   DIDIYLKAAALEGQETSVVTDYILKILGLEVCANTMVGDEMVRGISGGERKRVTIGEMLV  314

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GP RALFMDEISTGLDSSTTFQIVNS+RQSIHIL  TAV+SLLQPAPETY LFDDIILLS
Sbjct  315   GPVRALFMDEISTGLDSSTTFQIVNSLRQSIHILSRTAVVSLLQPAPETYNLFDDIILLS  374

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQEVTSRKDQEQYW R +E Y F+TV 
Sbjct  375   DGQIVYQGPRENVLEFFESMGFKCPERKGVADFLQEVTSRKDQEQYWARLDEPYGFVTVN  434

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             +F+EAFQSF VG+KLGDELAVPFDKSKSH AALS KKYGVNK+EL +AC SREFLLMKRN
Sbjct  435   DFAEAFQSFPVGQKLGDELAVPFDKSKSHRAALSAKKYGVNKEELFRACVSREFLLMKRN  494

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SF +IFK   L+++A +  ++FL+ +M K+++ DG V+MGALFFAVI+ MFNG SEL ++
Sbjct  495   SFTFIFKFALLIMLASITASIFLQIKMHKDTVEDGGVYMGALFFAVIVAMFNGISELNMA  554

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I+KLP FYKQRDL FFP WAY+LP WILKIP+TLVE AIWV +TYY IGFDP   R FKQ
Sbjct  555   IMKLPVFYKQRDLLFFPSWAYSLPAWILKIPITLVESAIWVVITYYVIGFDPCVERLFKQ  614

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+C+NQMAS +FR  AA GR VIVA+T GS A+++++VLGGF+LSR+ V KWW+WGY
Sbjct  615   YILLLCINQMASGMFRFMAALGRDVIVASTTGSFALLIIMVLGGFVLSREAVPKWWLWGY  674

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W+SPLMY QNAI+VNE+LGK+WRHVP  ++E+LGV +L+S GIFPEA WYWIGV AL GY
Sbjct  675   WVSPLMYGQNAITVNEFLGKNWRHVPPNSTESLGVLILKSHGIFPEARWYWIGVVALFGY  734

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             +FL N L  LAL YL+P GKPQ +LS+E +AERNA   GE IEL  +G S+SE    +  
Sbjct  735   IFLFNLLLTLALQYLDPFGKPQTVLSKEGMAERNASTTGEFIELLPRGKSSSE----ITE  790

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
                   LS+R G  + A+   KRGMVLPF+PL + FDEI+YA+DMP EMKA+G  ED+L 
Sbjct  791   GQRRLPLSARRGRTDEANGKRKRGMVLPFQPLSLAFDEIRYAIDMPQEMKAEGAQEDQLE  850

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGG+I+GSI +SGYPK+QETFARI
Sbjct  851   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGHIKGSIMVSGYPKKQETFARI  910

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQTDIHSPHVTVYESL++SAWLRL PE+D+ATR+MF+EEVM+LVELTSLR ALVGL
Sbjct  911   SGYCEQTDIHSPHVTVYESLLFSAWLRLLPEVDSATRKMFIEEVMELVELTSLRGALVGL  970

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             P V GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  971   PSVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1030

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDELLLLK GGE+IY GPLG HSS LI+YFE ING+ +I+DGYNPATW
Sbjct  1031  TIHQPSIDIFDAFDELLLLKLGGEQIYGGPLGSHSSHLIKYFEGINGVPKIKDGYNPATW  1090

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLEITS AQEAALG++F EVY+NSE +  NKA+I+ELS    GS+DLYFPT+YSQSF  Q
Sbjct  1091  MLEITSAAQEAALGVNFTEVYKNSEQF--NKAMIKELSTHPSGSRDLYFPTRYSQSFLIQ  1148

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQHWSYWRNP Y+AVRLLFTTF ALLFG +FW +G KR  QQDLFNAMG MYAA
Sbjct  1149  CMACLWKQHWSYWRNPSYSAVRLLFTTFIALLFGWIFWNLGSKRTKQQDLFNAMGSMYAA  1208

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+FLGVQN  SVQPVVA+ERTVFYRERAAGMYSALPYAFGQ++IELP++F+QT+IYG IV
Sbjct  1209  VIFLGVQNGASVQPVVAVERTVFYRERAAGMYSALPYAFGQMMIELPYIFIQTVIYGFIV  1268

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             Y+M+GF+W AAKF W++FF+YFTLLY+TLYGMMT+A+TPNHNIAAI SS FY  WNLFSG
Sbjct  1269  YSMMGFDWIAAKFFWYLFFLYFTLLYYTLYGMMTMALTPNHNIAAITSSTFYAIWNLFSG  1328

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             F++P TRIP+WW+WYY++CPV+WTLYG++ASQFGD+K+ +++ E+V+ F++S+F + HDF
Sbjct  1329  FVVPPTRIPIWWKWYYWVCPVAWTLYGMVASQFGDIKDTMESGESVEHFLRSYFGYKHDF  1388

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VA +IVG  ++FGFIFA+ I+AFNFQ R
Sbjct  1389  LGIVAVVIVGFSLLFGFIFAYGIRAFNFQKR  1419



>gb|AES58950.2| ABC-2 and plant PDR ABC-type transporter family protein [Medicago 
truncatula]
Length=1447

 Score =  2067 bits (5355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1020/1435 (71%), Positives = 1202/1435 (84%), Gaps = 7/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ + VFS S RE  E+    LKWAAIE+LPTYLRIRR I+  EE  G  +EID++K
Sbjct  20    IWRNNSMNVFSTSEREDDEEA---LKWAAIERLPTYLRIRRSIINNEE--GEGREIDIKK  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++ LLERLV+IA+EDNE FLLKLK R +RVG+D+P +EVRFEH+NV+A+ YVG R
Sbjct  75    LGLTERKVLLERLVKIAEEDNEKFLLKLKERIERVGLDIPIVEVRFEHINVEAQVYVGGR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP++ NF AN+LE F+NYLHI+P+ KKPL IL +VSGIIKP RMTLLLGPP SGKTTLL
Sbjct  135   ALPSLLNFYANVLEGFLNYLHIIPSPKKPLHILQNVSGIIKPQRMTLLLGPPGSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRVTYNG  + EFVP+RTSAYI+QHD HIGEMTVRETLAFSARCQG
Sbjct  195   LALAGKLAKDLKQSGRVTYNGKGLDEFVPQRTSAYISQHDNHIGEMTVRETLAFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VGH Y+ML EL RREKE  IKPDPD+D YMKA ++EGQEASVVTDYILKILGLE+CADI+
Sbjct  255   VGHNYDMLTELLRREKEAKIKPDPDVDAYMKAAALEGQEASVVTDYILKILGLEICADIM  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD MIRGISGGQ+KR+TTGEMLVGP R LFMDEISTGLDSSTTFQI++SIRQSIHIL G
Sbjct  315   VGDGMIRGISGGQKKRVTTGEMLVGPIRVLFMDEISTGLDSSTTFQIISSIRQSIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA++SLLQPAPETYELFDDIILL+DGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  375   TALVSLLQPAPETYELFDDIILLTDGQIVYQGPRENVLEFFESMGFKCPERKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ QYW  ++E Y F+TV +F+EAFQ FH+G+KLGDELA PFDKSK H + L+ K
Sbjct  435   VTSRKDQWQYWANKDEPYSFVTVKDFAEAFQIFHIGQKLGDELANPFDKSKCHASVLTTK  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGVNKKELLKACASREFLLMKRNSFV+IFK+ QL+ +A +  T+FLRT+M K+++ DG 
Sbjct  495   KYGVNKKELLKACASREFLLMKRNSFVHIFKVTQLIYLAIMTTTLFLRTKMHKDTVEDGG  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
              +MGALFF V + MFNG SEL ++++KLP FYKQRDL F+P WAY+LP WILKIP+ L+E
Sbjct  555   AYMGALFFTVTVAMFNGISELNMTLMKLPVFYKQRDLLFYPSWAYSLPPWILKIPIALIE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
               IW  +TYYAIG+DP   R  KQ  +++ +NQMA++LFRL AA GR VIVA+T GS A+
Sbjct  615   AVIWEAITYYAIGYDPSFVRLLKQYLVILLINQMATSLFRLMAALGRDVIVASTVGSFAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             ++VLVLGGF++SR+DV KW++WGYW SPLMY QNAI+VNE+LG SWR V   ++ETLGV 
Sbjct  675   LVVLVLGGFVISREDVHKWFLWGYWSSPLMYGQNAIAVNEFLGHSWRKVTHNSNETLGVL  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             V+++RG FP+A+WYWIGVGAL+GYVFL NFLF LAL YLNP  K QA LSEE L ER+A 
Sbjct  735   VMKTRGFFPQAYWYWIGVGALIGYVFLFNFLFTLALQYLNPFRKDQAGLSEEELLERDAS  794

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
                E  +L  +   +  K        S    +             +RGMVLPF+PL +TF
Sbjct  795   TAVEFTQLPTRKRISETKIAEEGLMPSRSFSARVSKDKTSISG--RRGMVLPFQPLSLTF  852

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEI+YAVDMP EMK QG++EDRL LLKGINGAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  853   DEIRYAVDMPQEMKNQGVSEDRLELLKGINGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  912

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+G+ITISGYPK Q+TFARI+GYCEQ DIHSP+VTVYESL+YSAWLRLPPE+D AT
Sbjct  913   TGGYIDGNITISGYPKNQKTFARISGYCEQFDIHSPNVTVYESLLYSAWLRLPPEVDQAT  972

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVEL SLREALVGLPG  GLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  973   RKMFIEEVMELVELNSLREALVGLPGETGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1032

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLL+K GGE+IY GPLGRH +
Sbjct  1033  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLMKLGGEQIYSGPLGRHCA  1092

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI YFE I G+ +I+DGYNPATWMLE+TS   EA L ++F  VYRNSELYRRNK LIQE
Sbjct  1093  HLIHYFEAIEGVPKIKDGYNPATWMLEVTSAGSEANLKVNFTNVYRNSELYRRNKQLIQE  1152

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P   SK+LYF ++Y+Q+  +QC ACLWKQH SYWRN  YTAVRLLFTT  A LFG +
Sbjct  1153  LSIPPQDSKELYFDSQYTQTMLSQCKACLWKQHLSYWRNTSYTAVRLLFTTLIAFLFGII  1212

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW IG KRR +QDLFNAMG MYA+V+F+GVQN  SVQPV+A+ERTVFYRERAAGMYSALP
Sbjct  1213  FWNIGLKRRKEQDLFNAMGSMYASVIFIGVQNGASVQPVIAVERTVFYRERAAGMYSALP  1272

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YA  QV+IELPH+ VQTL+YG+IVYAM+GFEWTA+KF W+IFF YFT LY+T YGMMT+A
Sbjct  1273  YAAAQVIIELPHILVQTLVYGIIVYAMMGFEWTASKFFWYIFFNYFTFLYYTFYGMMTMA  1332

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPN ++AAI+SS+FY  WNLFSGFIIP ++IP+WW+W+Y++CPV+WTLYGL+ SQ+GD 
Sbjct  1333  ITPNPHVAAILSSSFYAIWNLFSGFIIPLSKIPIWWKWFYWVCPVAWTLYGLVTSQYGDN  1392

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              +KL+  + V++FVKS+F F+HDF+G VA ++V   V F  IF F IKAFNFQ R
Sbjct  1393  MQKLENGQRVEEFVKSYFGFEHDFLGVVAIVVVSFSVFFALIFTFGIKAFNFQKR  1447



>ref|XP_008373544.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Malus domestica]
Length=1432

 Score =  2065 bits (5349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1034/1434 (72%), Positives = 1208/1434 (84%), Gaps = 22/1434 (2%)
 Frame = +1

Query  4     WRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKL  183
             W ++G+EVFSRSSR   E+    LKWAA+EKLPTY R+R+GIL     GG   EID+  L
Sbjct  21    WMNNGMEVFSRSSRGEDEEVA--LKWAALEKLPTYNRLRKGILTMP--GGEASEIDIPNL  76

Query  184   GVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRA  363
             G  E++ L+ER ++   EDNE FLLKLK+R DRVGI LPTIEVRFE LN++AE YVGSRA
Sbjct  77    GFQERKELIERFLKGNDEDNERFLLKLKNRIDRVGIVLPTIEVRFEQLNIEAETYVGSRA  136

Query  364   LPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlll  543
             LPT+FNF  NI+E  +  L IL +RK  L ILH+VSGIIKP+RMTLLLGPPSSGKTTLLL
Sbjct  137   LPTLFNFCVNIIEDILIGLRILSSRKTHLSILHNVSGIIKPSRMTLLLGPPSSGKTTLLL  196

Query  544   alagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGV  723
             ALAGKLD DLK+SGRV+YNGH M EFVP+RT+AYI QHDLHIGEMTVRETLAFSARCQGV
Sbjct  197   ALAGKLDPDLKLSGRVSYNGHGMNEFVPQRTAAYIGQHDLHIGEMTVRETLAFSARCQGV  256

Query  724   GHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILV  903
             G RY+ML+ELSRREKE NIKPDP IDV+MKAIS EGQE +VVTDYILKILGLEVCAD +V
Sbjct  257   GTRYDMLSELSRREKEANIKPDPVIDVFMKAISTEGQEVNVVTDYILKILGLEVCADTIV  316

Query  904   GDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGT  1083
             GDEM+RGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQIVNSI+Q IHIL GT
Sbjct  317   GDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIKQCIHILNGT  376

Query  1084  AVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEV  1263
             AVISLLQPAPETY+LFDDIILLSDGQ+VYQGPR++VLEFF+ MGFKCPERK +ADFLQEV
Sbjct  377   AVISLLQPAPETYDLFDDIILLSDGQIVYQGPREHVLEFFESMGFKCPERKAIADFLQEV  436

Query  1264  TSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKK  1443
             TSRKDQEQYW+R++E Y FITV EFS AFQSF VG+KLGDEL++PFDKS++HPAAL+ K+
Sbjct  437   TSRKDQEQYWVRKDEPYSFITVREFSVAFQSFLVGQKLGDELSIPFDKSRNHPAALTIKE  496

Query  1444  YGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTV  1623
             YG+ K ELLKAC SRE+LL+KRNSFVY+F++ QL++MA + MT+FLRT+MP++S+ DG V
Sbjct  497   YGLKKGELLKACFSREYLLIKRNSFVYVFRLTQLIVMALITMTIFLRTKMPRDSVDDGGV  556

Query  1624  FMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEV  1803
             +MGALFF+V+M MFNG +EL+++I+KLP  YKQRDL FFP WA+ALPTWILKIP+  +EV
Sbjct  557   YMGALFFSVVMVMFNGMAELSMTIMKLPVVYKQRDLLFFPAWAFALPTWILKIPIAFIEV  616

Query  1804  AIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMI  1983
              +WV MTYY IGFDP+  RFF+Q  LL+ VNQMASALFR  AAA R++IVANT GS A++
Sbjct  617   GVWVFMTYYVIGFDPNFDRFFRQYVLLLLVNQMASALFRFLAAACRNLIVANTLGSFALL  676

Query  1984  LVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTV  2163
             ++  LGGF+LSRDD+KKWWIWGYWISP+MYAQNAISVNE LGKSWRHV   ++  LGV  
Sbjct  677   ILFTLGGFVLSRDDIKKWWIWGYWISPMMYAQNAISVNELLGKSWRHVLPNSTVALGVAA  736

Query  2164  LRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACK  2343
             L+S G+FP  +WYWIGVGA+ G+  L N  + +ALTYLNPLGKPQA+ SE++ +  N  +
Sbjct  737   LKSHGVFPHEYWYWIGVGAMAGFALLFNIFYIVALTYLNPLGKPQAVKSEDSQSNENDGR  796

Query  2344  RGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFD  2523
                  +L     S+S++             +        A  N +RGMVLPFEP  ITFD
Sbjct  797   TERTSQLPRSQNSSSQQ-------------TKTESRNQEAIRNNRRGMVLPFEPYSITFD  843

Query  2524  EIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKT  2703
             EI Y+VDMP EMK QG+ ED+LVLL G++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKT
Sbjct  844   EIIYSVDMPQEMKTQGVVEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  903

Query  2704  GGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATR  2883
             GGYIEG + ISGYPK+QETFARI+GYCEQ DIHSPHVTV+ESL+YSAWLRLP E+   TR
Sbjct  904   GGYIEGDVKISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPSEVKAETR  963

Query  2884  EMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  3063
             ++F+EEVM+L+EL  LR+ LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  964   KLFIEEVMELIELKPLRQVLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1023

Query  3064  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQ  3243
             ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDE     RGG+EIYVGPLGRHS  
Sbjct  1024  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDE-----RGGQEIYVGPLGRHSCH  1078

Query  3244  LIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQEL  3423
             LI+YFE I G+ +I+DGYNPATWMLE T+ AQE +LGIDFA+VY+NSELYRRNK LI+E 
Sbjct  1079  LIQYFEGIEGVSKIKDGYNPATWMLEATTSAQELSLGIDFAQVYKNSELYRRNKQLIKEF  1138

Query  3424  SKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMF  3603
             S PAP SKDLYFPT+YSQ F  Q +ACLWKQHWSYWRNP Y AVRLLFTT  AL+ G+MF
Sbjct  1139  STPAPPSKDLYFPTRYSQPFLVQTIACLWKQHWSYWRNPLYNAVRLLFTTIIALMLGSMF  1198

Query  3604  WGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPY  3783
             W +G K R QQDLFNAMG MY AV+FLG+QNATSVQP+VAIERTVFYRE+AAGMYSALPY
Sbjct  1199  WNLGSKTRRQQDLFNAMGSMYTAVLFLGIQNATSVQPIVAIERTVFYREKAAGMYSALPY  1258

Query  3784  AFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAV  3963
             AF QV+IELP++ +Q ++YGVI Y MIGF+ T  KF W++FFMYFTLLYFT YGMMTVAV
Sbjct  1259  AFAQVLIELPYILLQAVVYGVITYVMIGFDMTFVKFFWYLFFMYFTLLYFTFYGMMTVAV  1318

Query  3964  TPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVK  4143
             TPNH++AAI+SSAFY  WNLFSGFIIP+ RIP+WWRWYY+ CPV+WTLYGLIASQFGD+ 
Sbjct  1319  TPNHHVAAIVSSAFYALWNLFSGFIIPRPRIPIWWRWYYWACPVAWTLYGLIASQFGDLN  1378

Query  4144  EKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             + LD  +TV+ F++S+F F HDFVG VA + VG+ V+FGFIFAFSI+AFNFQ R
Sbjct  1379  DMLDNGQTVEQFLRSYFGFRHDFVGVVAVVHVGVTVLFGFIFAFSIRAFNFQMR  1432



>ref|XP_010925283.1| PREDICTED: putative pleiotropic drug resistance protein 7 isoform 
X2 [Elaeis guineensis]
Length=1449

 Score =  2063 bits (5346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1003/1411 (71%), Positives = 1214/1411 (86%), Gaps = 9/1411 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIEKLPTY R+R+GILAA E GG  +E+D+ +LG  E+++LLERLVR A+EDNE F
Sbjct  48    LKWAAIEKLPTYDRMRKGILAAAE-GGEIQEVDIHELGFQERKNLLERLVRTAEEDNERF  106

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKL++R +RVGID PTIE+RFEHLN+DAEAYVG+R +PT  NF  N +   ++YLHI+P
Sbjct  107   LLKLRNRMERVGIDNPTIELRFEHLNIDAEAYVGNRGVPTFTNFFYNKIMDVLSYLHIVP  166

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
               KKP+ ILHD+SGII+P RMTLLLGPP SGKTTLLLALAGKLDS LKVSGRVTYNGH+M
Sbjct  167   TGKKPISILHDISGIIRPCRMTLLLGPPGSGKTTLLLALAGKLDSTLKVSGRVTYNGHDM  226

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI QHD+HIGEMTVRETL FSARCQGVG RY+ML ELSRREKE NIKPDP
Sbjct  227   DEFVPQRTSAYIGQHDIHIGEMTVRETLNFSARCQGVGTRYDMLTELSRREKEANIKPDP  286

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDVYMKAIS+EGQE SVVTDYILKILGLE+CAD +VGD MIRGISGGQ+KR+TTGEMLV
Sbjct  287   DIDVYMKAISVEGQE-SVVTDYILKILGLEICADTMVGDAMIRGISGGQKKRVTTGEMLV  345

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA+ALFMDEISTGLDSSTT+QIVNS+RQS+HIL GTA I+LLQPAPETY+LFDDI+LLS
Sbjct  346   GPAKALFMDEISTGLDSSTTYQIVNSLRQSVHILGGTAFIALLQPAPETYDLFDDIVLLS  405

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             +GQ+VYQGPR+N+LEFF+ +GFKCPERKGVADFLQEVTSRKDQ QYW R++E Y +I+V 
Sbjct  406   EGQIVYQGPRENILEFFESVGFKCPERKGVADFLQEVTSRKDQHQYWARKDEPYRYISVN  465

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EFSEAFQSFH+G+KLG+EL  PFD+S++HPAAL+  KYG++K ELLKAC SRE+LLMKRN
Sbjct  466   EFSEAFQSFHIGRKLGEELGAPFDRSRNHPAALTTSKYGISKMELLKACMSREWLLMKRN  525

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK++QL+++  + MTVFLRT+M + S+ DG +F+GA+F  ++  +FNGF+ELA+S
Sbjct  526   SFVYIFKVVQLIILGTIGMTVFLRTKMHRKSVEDGAIFLGAMFLGLVTHLFNGFAELAMS  585

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQRDL F+P WAYALPTWILKIP++ +E A+W+ MTYY IGFDP+  RFF+Q
Sbjct  586   IAKLPIFYKQRDLLFYPSWAYALPTWILKIPISFLECAVWIGMTYYVIGFDPNIQRFFRQ  645

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ ++QMAS LFRL AA GR ++VA+TFGS A +++L+LGGF++SRDD+KKWWIWGY
Sbjct  646   YLLLVLISQMASGLFRLLAALGREMVVADTFGSFAQLVLLILGGFLISRDDIKKWWIWGY  705

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W SPLMYAQNAI+VNE+LG SW+   +G++  LGV VL  RGIF +A+WYWIGVGAL+GY
Sbjct  706   WSSPLMYAQNAIAVNEFLGHSWQKHVNGSNVPLGVLVLEGRGIFVDANWYWIGVGALLGY  765

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             +FL N LF   L +L+PLGK Q ++SE  L E++A + GE IEL L  G+ S K    + 
Sbjct  766   IFLFNILFVFFLDWLDPLGKGQTVISEAELKEKHANRTGESIEL-LPAGTDSSKPTASQE  824

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
               S  + + +         + K+GMVLPF PL +TFD+I+Y+VDMP EMK +G+TEDRL+
Sbjct  825   RNSDITRAPQN------GESRKKGMVLPFTPLSLTFDDIRYSVDMPQEMKDRGVTEDRLM  878

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGG IEG+++ISGYPK+QETFARI
Sbjct  879   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGCIEGNVSISGYPKKQETFARI  938

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQ DIHSPHVTVYESL++SAWLRLPPE+D+ TR+MFVEEVM+LVELTSLR ALVGL
Sbjct  939   SGYCEQNDIHSPHVTVYESLLFSAWLRLPPEVDSNTRKMFVEEVMELVELTSLRGALVGL  998

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  999   PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1058

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIF++FDEL L+KRGGEEIYVGPLGR+S  LI+YFE I GI+RI+DGYNPATW
Sbjct  1059  TIHQPSIDIFESFDELFLMKRGGEEIYVGPLGRNSCHLIKYFEEIEGIRRIKDGYNPATW  1118

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLE+T++AQE  LG++FAE+Y+NS+LYRRNKALI ELS P PGSKDL+FPTKYSQ F TQ
Sbjct  1119  MLEVTTQAQEEILGVNFAEIYKNSDLYRRNKALISELSTPPPGSKDLFFPTKYSQPFLTQ  1178

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWKQH SYWRNP YTA R+ FTT  A +FGT+FW +G K   +QDLFN++G MYAA
Sbjct  1179  CMACLWKQHKSYWRNPSYTATRIFFTTVIAFIFGTIFWRLGKKVTKRQDLFNSLGSMYAA  1238

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+F+G+QN  +VQP+V +ERTVFYRE+AAGMYSALPYA+ QV+IE+PH+F+QT+IYG+IV
Sbjct  1239  VLFIGIQNGQTVQPIVDVERTVFYREKAAGMYSALPYAYAQVLIEIPHIFLQTVIYGLIV  1298

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             Y++IGF+WT  KF W++FFM+FT +YFT YGMM VA+TPN +IAAI+S+AFY  WN+F+G
Sbjct  1299  YSLIGFDWTLQKFFWYLFFMFFTFMYFTFYGMMAVAMTPNSDIAAIVSTAFYAIWNIFAG  1358

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             ++IP+ RIPVWWRWY + CPV+WTLYGL+ASQFGD K  L+    V+D+++++F F HDF
Sbjct  1359  YLIPRPRIPVWWRWYSWACPVAWTLYGLVASQFGDYKHNLENGSKVQDYIETYFGFRHDF  1418

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VA  +VG  ++F F+FAFSIK FNFQ R
Sbjct  1419  LGVVAAAVVGFTLLFAFVFAFSIKVFNFQRR  1449



>ref|XP_009385804.1| PREDICTED: putative pleiotropic drug resistance protein 7 [Musa 
acuminata subsp. malaccensis]
Length=1457

 Score =  2063 bits (5344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1011/1435 (70%), Positives = 1228/1435 (86%), Gaps = 11/1435 (1%)
 Frame = +1

Query  4     WRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKL  183
             WR+S  +VF RS RE  +++   LKWAA+EKLPTY R+R+G++   E  GG +E+D++ L
Sbjct  33    WRASSTDVFGRSGREEDDEEA--LKWAALEKLPTYDRMRKGMMTTGE-AGGRQEVDIQDL  89

Query  184   GVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRA  363
             G+ +++ LLERLVR A+EDNE FLLKL++R +RVGID PTIEVRFEHLNVDAEAYVG+R 
Sbjct  90    GIQDRKKLLERLVRTAEEDNERFLLKLRNRMERVGIDNPTIEVRFEHLNVDAEAYVGNRG  149

Query  364   LPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlll  543
             +PT  NF  N +   ++YLHILP+ K+PL ILHD+SGII+P RMTLLLGPP SGKTTLLL
Sbjct  150   VPTFVNFFYNKIMGVLSYLHILPSGKQPLSILHDISGIIRPCRMTLLLGPPGSGKTTLLL  209

Query  544   alagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGV  723
             ALAGKLDS L+VSGRVTYNGH+M EFVP+RTSAYI QHDLHIGEMTVRETLAFSARCQGV
Sbjct  210   ALAGKLDSTLRVSGRVTYNGHDMDEFVPQRTSAYIGQHDLHIGEMTVRETLAFSARCQGV  269

Query  724   GHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILV  903
             G RY+ML ELSRREKE NIKPDPDIDVYMKAIS+EGQE SVVTDYILKILGLE+CAD +V
Sbjct  270   GTRYDMLKELSRREKEANIKPDPDIDVYMKAISVEGQE-SVVTDYILKILGLEICADTMV  328

Query  904   GDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGT  1083
             GD MIRGISGGQ+KR+TTGEMLVGPA+ALFMDEISTGLDSSTT+QIVNS+RQS+HIL GT
Sbjct  329   GDAMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSSTTYQIVNSLRQSVHILGGT  388

Query  1084  AVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEV  1263
             A+I+LLQPAPETYELFDDI+LLSDGQ+VYQGPR+NVL+FF+ MGFKCPERKG ADFLQEV
Sbjct  389   ALIALLQPAPETYELFDDIVLLSDGQIVYQGPRENVLQFFEAMGFKCPERKGAADFLQEV  448

Query  1264  TSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKK  1443
             TSRKDQ QYW  ++E Y +I+V EF+EAFQSFH G KLG+EL++PFD+ ++HPAAL+   
Sbjct  449   TSRKDQHQYWANKDEPYRYISVNEFAEAFQSFHTGCKLGEELSIPFDRRRNHPAALTTTT  508

Query  1444  YGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTV  1623
             YG++K ELLK C SRE+LLMKRNSFVYIFK++QL+++  +AMTVFLRT+M +NS+ DG +
Sbjct  509   YGISKMELLKTCISREWLLMKRNSFVYIFKVVQLIILGAIAMTVFLRTKMHRNSVEDGVI  568

Query  1624  FMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEV  1803
             F+GA+F  ++  +FNGF+ELA+SI KLP FYKQRDL F+P WAYALPTWILKIP++ +E 
Sbjct  569   FLGAMFLGLVTHLFNGFAELAMSIAKLPIFYKQRDLRFYPSWAYALPTWILKIPISFLEC  628

Query  1804  AIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMI  1983
             A+W+ MTYY IGFDP+  RFF+   LL+ ++QMAS LFRL AA GR ++VA+TFGS A +
Sbjct  629   AVWIGMTYYVIGFDPNIERFFRHYLLLVLISQMASGLFRLLAAVGREMVVADTFGSFAQL  688

Query  1984  LVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHV-PSGTSETLGVT  2160
             ++L+LGGF++SR+++KKWWIWGYW SPLMYAQNAI+VNE+LG SW+ V P+G+++TLGV 
Sbjct  689   VLLILGGFLISRENIKKWWIWGYWSSPLMYAQNAIAVNEFLGHSWQKVIPTGSNDTLGVQ  748

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L+ RGIF +++WYWIGVGAL+GY+F+ N LF   L +L+PLGK QA++SEE L E+ A 
Sbjct  749   ILKKRGIFVDSNWYWIGVGALLGYIFMFNILFVFFLDWLDPLGKGQAVISEEALREKQAN  808

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             + GE +E  L G ++ + G    R       +        +  N ++GM+LPF PL ITF
Sbjct  809   RTGEGVEPSLAGTNSPKHGTTKGREGGRARQNEI------STQNKRKGMMLPFAPLSITF  862

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D ++Y+VDMP EMK +G+ +DRLVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  863   DNVRYSVDMPQEMKDKGIEDDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  922

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+G+I ISGYPK+QETFARI+GYCEQ DIHSPHVTVYESL+YSAWLRLPPE+D+ T
Sbjct  923   TGGYIDGNICISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPPEVDSET  982

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELTSLR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  983   RKMFIEEVMELVELTSLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1042

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLGR+S 
Sbjct  1043  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGRNSC  1102

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I G+++IRDGYNPATWMLE+T+ AQE  LG+DFAE+YRNS+LYRRNK LI E
Sbjct  1103  HLIKYFEGIEGVRKIRDGYNPATWMLEVTTLAQEEILGVDFAEIYRNSDLYRRNKTLISE  1162

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSKDL+FPTKYSQSF TQCMACLWKQH SYWRNP YTA R+ FTT  A +FGT+
Sbjct  1163  LSAPPPGSKDLFFPTKYSQSFLTQCMACLWKQHKSYWRNPSYTATRIFFTTVIAFIFGTI  1222

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G K  T QDLFN++G MYAAV+F+G+QN  +VQP+V +ERTVFYRE+AAGMYSALP
Sbjct  1223  FWRLGKKVTTSQDLFNSLGSMYAAVLFIGIQNGQTVQPIVDVERTVFYREKAAGMYSALP  1282

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAF QV+IE+PH+F+QT+IYG+IVY++IGF+WT  KF W++FFM+FT +YFT YGMM VA
Sbjct  1283  YAFSQVLIEIPHIFLQTVIYGLIVYSLIGFDWTVEKFFWYLFFMFFTFMYFTYYGMMAVA  1342

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPN +IAAI+S+AFY  WN+F+GF++P+ +IPVWWRWY + CPV+WTLYGL+ASQFGD 
Sbjct  1343  MTPNSDIAAIVSTAFYAIWNIFAGFLVPRPKIPVWWRWYSWACPVAWTLYGLVASQFGDY  1402

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
               K+D +ETV+DF++ FF F HDF+G VA  +VG  V+F F+FAFSI+ FNFQ R
Sbjct  1403  TYKMDNDETVQDFIRRFFGFRHDFLGVVAVAVVGFTVLFAFVFAFSIRVFNFQRR  1457



>ref|XP_002298123.2| ABC transporter family protein [Populus trichocarpa]
 gb|EEE82928.2| ABC transporter family protein [Populus trichocarpa]
Length=1449

 Score =  2062 bits (5343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1021/1411 (72%), Positives = 1202/1411 (85%), Gaps = 8/1411 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPTY R+R+GIL      G   E++V+ LG  E+++L+ERLV +A+EDNE F
Sbjct  47    LKWAALEKLPTYDRLRKGILTTST--GAASEVEVQNLGFQERKNLVERLVNVAEEDNEKF  104

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVGI +PTIEVRFEHLNV+AEAYVGSRALPT FN++ N+LE  +NYLHIL 
Sbjct  105   LLKLKNRIDRVGIHVPTIEVRFEHLNVEAEAYVGSRALPTFFNYSVNMLEGVLNYLHILS  164

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKK + IL DVSGIIKP+RMTLLLGPPSSGKTTLLLALAGKLD  LK SGRVTYNGHEM
Sbjct  165   SRKKHMWILKDVSGIIKPSRMTLLLGPPSSGKTTLLLALAGKLDHALKFSGRVTYNGHEM  224

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+QHDLHIGEMTVRETLAFSARCQGVG RY+MLAELSRREKE  IKPDP
Sbjct  225   DEFVPQRTAAYISQHDLHIGEMTVRETLAFSARCQGVGSRYDMLAELSRREKEAGIKPDP  284

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA + EGQE SVV DYILK+LGLEVCAD LVGDEM+RGISGGQ+KR+TTGEMLV
Sbjct  285   DIDVFMKAAATEGQEDSVVIDYILKVLGLEVCADTLVGDEMLRGISGGQKKRVTTGEMLV  344

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA+ALFMDEISTGLDSSTT+QIVNSI+Q + IL+GTA+ISLLQPAPETY+LFDDIILLS
Sbjct  345   GPAKALFMDEISTGLDSSTTYQIVNSIKQYVQILEGTALISLLQPAPETYDLFDDIILLS  404

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DG++VYQGPR++VL FF++MGFKCP RKGVADFLQEVTSRKDQ QYW RR+  Y F+TV 
Sbjct  405   DGEIVYQGPREHVLRFFEYMGFKCPARKGVADFLQEVTSRKDQMQYWARRDVPYRFVTVK  464

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAF SFH GK+LG+ELAVPFDKSK+HPAAL+ KKYGVNK+EL KA  SREFLLMKRN
Sbjct  465   EFAEAFYSFHEGKRLGNELAVPFDKSKNHPAALTTKKYGVNKRELCKASFSREFLLMKRN  524

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVY FK IQL ++A +AMT+FLRTEM ++S+ DG +++GA+FF V++ MFNG +E++++
Sbjct  525   SFVYAFKFIQLTIVAVIAMTLFLRTEMHRDSVTDGGIYVGAMFFIVVVIMFNGMAEISMT  584

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             + KLP FYKQRDL FFP W YALPTWILKIP+T +EVAI V +TY+ IGFDP+ GR FK 
Sbjct  585   LAKLPVFYKQRDLLFFPAWIYALPTWILKIPITFIEVAIMVFITYFVIGFDPNVGRLFKH  644

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               +L+  NQMAS LFR  AA GR+++VANTFGS  ++L+ VLGGF+LSRDD+KKWWIWG+
Sbjct  645   YLVLLLTNQMASGLFRTIAAVGRNMVVANTFGSFVLLLLFVLGGFVLSRDDIKKWWIWGF  704

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W SP+MYAQNA+ VNE+LGKSW HV   ++E LG+ VL+SRG F EA+WYW+ V AL G+
Sbjct  705   WTSPMMYAQNAVVVNEFLGKSWNHVLPNSTEPLGIEVLKSRGFFTEAYWYWLAVAALFGF  764

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
               L NFL+ LAL +LNPLGKPQ     E     N  + GE I L   G ++S   +    
Sbjct  765   TLLYNFLYILALAFLNPLGKPQQAGISEEPQSNNVGRIGEAIHLMNPGINSSLHTSAESI  824

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
                 RS SSR         N +RG+++PFEP  ITFD++ Y+VDMP EMK+ G+ ED+LV
Sbjct  825   DEIGRSKSSRFTC------NKQRGVIIPFEPHSITFDKVMYSVDMPQEMKSHGVHEDKLV  878

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMGISGAGKTT+MDVLAGRKTGGYIEG+ITISGYPK+QETFARI
Sbjct  879   LLKGVSGAFRPGVLTALMGISGAGKTTMMDVLAGRKTGGYIEGNITISGYPKKQETFARI  938

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQ DIHSPH+TVYESL+YSAWLRLP E+D  TR+MFVEEVM+LVEL  LR+ALVGL
Sbjct  939   SGYCEQNDIHSPHITVYESLLYSAWLRLPTEVDIETRKMFVEEVMELVELNPLRQALVGL  998

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  999   PGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1058

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIF+AFDEL LLKRGG+EIYVGPLGR S  LI+YFE I G+ +I+DGYNPATW
Sbjct  1059  TIHQPSIDIFEAFDELFLLKRGGQEIYVGPLGRLSCHLIKYFEGIEGVNKIKDGYNPATW  1118

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLE+TS A+E ALG+DFAE+YR+SEL+RRN+ALI++LS PAPGSKDLYF T+YS+SFFTQ
Sbjct  1119  MLEVTSTAEELALGVDFAEIYRSSELFRRNRALIKDLSTPAPGSKDLYFSTQYSRSFFTQ  1178

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             C+ACLWKQHWSYWRNPPYTA+R L TT   L+FGTMFW IG K   +QDLFNAMG MY A
Sbjct  1179  CLACLWKQHWSYWRNPPYTAIRFLSTTVIGLIFGTMFWDIGSKITKRQDLFNAMGSMYTA  1238

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+FLGVQNA SVQPVVA+ERTVFYRERAAGMYSALPYAF QV+IELP++FVQ  +YGVIV
Sbjct  1239  VLFLGVQNAASVQPVVAVERTVFYRERAAGMYSALPYAFAQVLIELPYIFVQAAVYGVIV  1298

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             Y+MIGF WT +KF W+++FMYFTLLYFT YGMM VAV+PNH IA++IS+AFYG WN+FSG
Sbjct  1299  YSMIGFGWTISKFFWYLYFMYFTLLYFTFYGMMAVAVSPNHQIASVISAAFYGIWNVFSG  1358

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             F+IP++R+P+WWRWY +ICPV WTLYGL+ASQFGD+K++L+T ETV+ FV  + DF HDF
Sbjct  1359  FVIPRSRMPLWWRWYSWICPVFWTLYGLVASQFGDMKDRLETGETVEQFVTIYLDFKHDF  1418

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G VA +I+G  V+F   FA SIK FNFQ R
Sbjct  1419  LGVVAAVILGFTVLFAITFAISIKLFNFQRR  1449



>emb|CDO98093.1| unnamed protein product [Coffea canephora]
Length=1422

 Score =  2061 bits (5341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1004/1436 (70%), Positives = 1204/1436 (84%), Gaps = 34/1436 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++G+EVFSRSSR+  +++   LKWA++EKLPT+ R+R+G+L      G   E+DVE 
Sbjct  20    LWRNTGLEVFSRSSRDEDDEEA--LKWASLEKLPTFDRLRKGLLFGSR--GEVNEVDVEN  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
              G  E+++LLERLV++A+EDNE FL+KL++R DRVGIDLPTIEVRFEHL VDAEAYVGS 
Sbjct  76    FGFQERKTLLERLVKVAEEDNEKFLMKLRNRIDRVGIDLPTIEVRFEHLKVDAEAYVGSS  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT  NF  N++E  +N LHILP+RKK + IL DVSGIIKP+R+TLLLGPP SGKTTLL
Sbjct  136   ALPTFLNFATNMIEGVLNNLHILPSRKKNIKILRDVSGIIKPSRLTLLLGPPGSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             +ALAGKLD DLK SGR+TYNGH M EFVP+RT+AY++QHDLHIGEMTVRETLAFSARCQG
Sbjct  196   MALAGKLDPDLKSSGRITYNGHGMNEFVPQRTAAYVSQHDLHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEMLAELSRREK  NIKPDPDID+YMK+ + EGQEA+VVTDY+L+ILGLE+CAD L
Sbjct  256   VGSRYEMLAELSRREKAANIKPDPDIDIYMKSAATEGQEATVVTDYVLRILGLEICADTL  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQ+KR+TTGEMLVGP  ALFMDEISTGLDSSTTFQIVNS+RQ +HI++G
Sbjct  316   VGDEMLRGISGGQKKRVTTGEMLVGPTNALFMDEISTGLDSSTTFQIVNSLRQYVHIMKG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA ISLLQPAPETY+LFDDI+LLSDG +VYQGPR+NV+EFFQ MGF+CP+RKGVADFLQE
Sbjct  376   TAFISLLQPAPETYDLFDDIVLLSDGLIVYQGPRENVVEFFQSMGFRCPDRKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ QYW RR+E Y +I   EF+E+FQSFHVG+ L +ELA PFDKSKSHPAAL+ +
Sbjct  436   VTSKKDQRQYWARRDEPYRYIAATEFAESFQSFHVGRTLSNELATPFDKSKSHPAALTTQ  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
              YGVN KE+ KA ++RE LL+KRNSF+YIFK+ QL++M  + MTVF RT+MP+  + DG 
Sbjct  496   TYGVNNKEIFKANSARELLLIKRNSFIYIFKLSQLIIMGLIGMTVFFRTKMPRRDVTDGG  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +++GALFF V+  MFNG +ELA++ILKLP F+KQRD  FFP W+YALPTWILKIP+T +E
Sbjct  556   IYLGALFFVVVQVMFNGMAELAMTILKLPVFFKQRDFLFFPAWSYALPTWILKIPITFLE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV MTYY IGFDP   RFFK   +L+ +NQ+ASALFR   AA R++IVANTFG+ A+
Sbjct  616   VAVWVVMTYYVIGFDPSPARFFKHYLILVAINQVASALFRFIGAASRNMIVANTFGTFAL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +L+  LGGF+LSRD VKKWW+WGYW SPLMYAQNAI VNE+ GK WR +   T+ETLG  
Sbjct  676   MLLFALGGFVLSRDQVKKWWLWGYWSSPLMYAQNAILVNEFTGKHWRQIVPNTTETLGTQ  735

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+S+G FP+++WYWIG+GA  G++ LLNF + LALTYL PLGKPQA+L EE+    N+ 
Sbjct  736   VLKSKGFFPQSYWYWIGLGACGGFILLLNFFYTLALTYLQPLGKPQAVLPEESENTENSG  795

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             +R   ++                             ++  ++ N +RGM+LPFEP  ITF
Sbjct  796   QRDGSVD-----------------------------AITESNENQRRGMILPFEPHSITF  826

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+I+Y+VDMP  MK QG  ED+L+LLKGI+GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  827   DDIRYSVDMPQAMKDQGAVEDKLMLLKGISGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  886

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG++TISGYPK QETFARI+GYCEQ DIHSPHVTVYESLVYSAWLRLP E+D  T
Sbjct  887   TGGYIEGNVTISGYPKNQETFARISGYCEQNDIHSPHVTVYESLVYSAWLRLPAEVDAKT  946

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R MFV+EVM+LVELTSLR+ LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  947   RMMFVDEVMELVELTSLRDGLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1006

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL LLKRGG+EIYVGPLG +S 
Sbjct  1007  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLLKRGGQEIYVGPLGHNSI  1066

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             +LI+YFE I+G+ +I+DGYNPATWMLE+T+ AQE  LG+DFAE+Y+NS+LYRRNKALI E
Sbjct  1067  ELIKYFEAIHGVSKIKDGYNPATWMLEVTASAQELMLGVDFAEIYKNSDLYRRNKALIHE  1126

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             L  P PG+KDLYFPTKYSQ+F  QCMAC WKQ  SYWRNPPYTAVR LFT+F AL FGT+
Sbjct  1127  LDSPRPGTKDLYFPTKYSQAFPVQCMACFWKQRISYWRNPPYTAVRFLFTSFIALSFGTI  1186

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G ++ T QDLFNAMG MYAAV+FLGVQN+++VQPVVAIERTVFYRERAAGMYSALP
Sbjct  1187  FWKLGKRKDTTQDLFNAMGSMYAAVLFLGVQNSSAVQPVVAIERTVFYRERAAGMYSALP  1246

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAF QV IE+ ++  Q + Y VI YAMIGFEWTA+KFLW++F MYFTLLYFT YGMM V+
Sbjct  1247  YAFAQVGIEILYILKQAVFYSVITYAMIGFEWTASKFLWYLFLMYFTLLYFTFYGMMVVS  1306

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHNI+A+++SAFY  WNLFSGF+IP+ RIP+WWRWYY+ CPV+WTLYGL  SQ+GD+
Sbjct  1307  VTPNHNISAVVASAFYAGWNLFSGFLIPRPRIPIWWRWYYWGCPVAWTLYGLFVSQWGDL  1366

Query  4141  KEKLDTN-ETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              ++L+ N E +KD+++ +F F HDF+  VA ++VG+ V+F FIFA+ IK FNFQ R
Sbjct  1367  SDRLEDNGELIKDYLRRYFGFKHDFLPVVAGVVVGLPVVFAFIFAYGIKTFNFQRR  1422



>ref|XP_002527332.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF35084.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1443

 Score =  2061 bits (5340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1014/1414 (72%), Positives = 1204/1414 (85%), Gaps = 17/1414 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+E+LPTY R+R+GIL +    G   EIDV  LG  E++ LLERL+R+ +EDNE F
Sbjct  44    LKWAALERLPTYDRLRKGILFSASRNGA-NEIDVGSLGFHERKLLLERLLRVVEEDNEEF  102

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVGI+LPTIEVRFE+LN++AEA+VGSRALPT  NF+ N+ E F+N LHILP
Sbjct  103   LLKLKNRIDRVGIELPTIEVRFENLNIEAEAFVGSRALPTFVNFSINLFEGFLNSLHILP  162

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKK L IL DVSG+IKP+RMTLLLGPPSSGKTTLLLALAGKLD +LK SG VTYNGH M
Sbjct  163   SRKKQLTILKDVSGVIKPSRMTLLLGPPSSGKTTLLLALAGKLDPNLKFSGNVTYNGHGM  222

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EF+P+ T+AYI+QHDLHIGEMTVRETL+FS RCQGVG R +ML ELSRREK  NIKPDP
Sbjct  223   NEFIPQSTAAYISQHDLHIGEMTVRETLSFSVRCQGVGTRNDMLVELSRREKAANIKPDP  282

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA++ EGQE +VVTDY+LKILGLEVCAD LVGDEM+RGISGGQRKR+TTGEMLV
Sbjct  283   DIDVFMKAVATEGQETNVVTDYVLKILGLEVCADTLVGDEMLRGISGGQRKRVTTGEMLV  342

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTT+QIVNS++Q+IHIL GTAVISLLQPAPETY+LFDDIILLS
Sbjct  343   GPARALFMDEISTGLDSSTTYQIVNSLKQTIHILDGTAVISLLQPAPETYDLFDDIILLS  402

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR++VLEFF++MGFKCPERKGVADFLQEVTS+ DQ+QYW+++++ Y F+TV 
Sbjct  403   DGQIVYQGPREHVLEFFEYMGFKCPERKGVADFLQEVTSKNDQKQYWVQKDQPYSFVTVQ  462

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EFSEAFQS+ VG+ +G EL+ PFDKSKSHPAAL+ +KYGV+K ELLKAC +RE+LLMKRN
Sbjct  463   EFSEAFQSYDVGQIIGQELSTPFDKSKSHPAALAARKYGVDKMELLKACFAREYLLMKRN  522

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK+ QLV+MA ++MT+FLRTEM +  + D  V++GALFF++I  MFNG SEL+++
Sbjct  523   SFVYIFKLTQLVVMAIISMTLFLRTEMHREDLTDAGVYLGALFFSLIAIMFNGMSELSMT  582

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQRDL F+PPWAYALPTWILKIP+T  EV +WV +TYY IGFDP+  R FKQ
Sbjct  583   IAKLPVFYKQRDLQFYPPWAYALPTWILKIPITFFEVGVWVFITYYVIGFDPNVERLFKQ  642

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
              FLL+ VNQMAS LFR  AA GR++IVANTFGS A++ V  LGG +LSRDD+KKWW WGY
Sbjct  643   YFLLLIVNQMASGLFRFIAAVGRNMIVANTFGSFALLTVFALGGIVLSRDDIKKWWTWGY  702

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVP--SGTSETLGVTVLRSRGIFPEAHWYWIGVGALV  2226
             WISP+MY QNA+  NE+LG+SW HVP  S ++++LGV  ++SRG FP A+WYWIG+GAL 
Sbjct  703   WISPMMYGQNALVANEFLGESWNHVPANSTSTDSLGVQFIKSRGFFPHAYWYWIGIGALT  762

Query  2227  GYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvv  2406
             G+  L N  F LALT+LNP  KP A++S+E   ER+  + G  I+L   G S        
Sbjct  763   GFTILFNLCFTLALTHLNPYEKPHAVISDE--PERSD-RTGGAIQLSQNGSS--------  811

Query  2407  rrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDR  2586
                 +       +   + A+ N K+GMVLPFEP  ITF+++ Y+VDMP EMK+QG+ +D+
Sbjct  812   --HRTITENGVGIRMTDEANQNKKKGMVLPFEPHSITFNDVMYSVDMPQEMKSQGIADDK  869

Query  2587  LVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFA  2766
             LVLLKG++GAF+PGVLTALMG+SGAGKTTLMDVLAGRKTGGYIEG I ISGYPK+Q+TFA
Sbjct  870   LVLLKGVSGAFKPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGYPKKQDTFA  929

Query  2767  RIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALV  2946
             RI+GYCEQ DIHSPHVTVYESL+YSAWLRL PE+D  TR+MFV EVM+LVEL  LR+ALV
Sbjct  930   RISGYCEQNDIHSPHVTVYESLIYSAWLRLAPEVDPETRKMFVNEVMELVELNPLRQALV  989

Query  2947  GLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV  3126
             GLPGVNGLSTEQRKRLTI+VELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV
Sbjct  990   GLPGVNGLSTEQRKRLTISVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV  1049

Query  3127  VCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPA  3306
             VCTIHQPSID+F+AFDEL L+KRGGEEIYVGPLGRHS  +I YFE I G  +++DGYNPA
Sbjct  1050  VCTIHQPSIDLFEAFDELFLMKRGGEEIYVGPLGRHSCHMIDYFEVIEGASKVKDGYNPA  1109

Query  3307  TWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFF  3486
             TWMLE+TS AQE +LG+DFA +Y+NSELYRRNKA+I+ELS   PGSKDLYFPT+YSQSF 
Sbjct  1110  TWMLEVTSSAQELSLGVDFATIYKNSELYRRNKAIIKELSTSVPGSKDLYFPTQYSQSFL  1169

Query  3487  TQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMY  3666
             TQC+ACLWKQ  SYWRNPPYTAVR LFTTF AL+FGTMFW +G K RTQQD+FN+ G MY
Sbjct  1170  TQCIACLWKQRLSYWRNPPYTAVRFLFTTFIALMFGTMFWDLGSKTRTQQDIFNSAGSMY  1229

Query  3667  AAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGV  3846
             AAVVFLG QNA SVQPVVAIERTVFYRERAAGMYSALPYA+ QV++E+P++F Q ++YG+
Sbjct  1230  AAVVFLGTQNAASVQPVVAIERTVFYRERAAGMYSALPYAYAQVLVEIPYIFAQAVVYGL  1289

Query  3847  IVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLF  4026
             + Y+MIGFEWTAAKF W+IFFMYFTL+YFT YGMM VAVTPNH+IA+++SSAFYG WNLF
Sbjct  1290  LTYSMIGFEWTAAKFFWYIFFMYFTLMYFTYYGMMAVAVTPNHHIASVVSSAFYGIWNLF  1349

Query  4027  SGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLD-TNETvkdfvksffdfd  4203
             SGFI+P+TR+PVWWRWYY++CPVSWTLYGLI SQF D+K+  +  ++TV+DFV+ ++   
Sbjct  1350  SGFIVPRTRMPVWWRWYYWVCPVSWTLYGLIGSQFSDIKDAFEGGSQTVEDFVREYYGIR  1409

Query  4204  hdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             HDF+G VA +IVG  V+F FIFA SIK+FNFQ R
Sbjct  1410  HDFLGVVAAVIVGTTVLFAFIFAVSIKSFNFQRR  1443



>ref|XP_006427144.1| hypothetical protein CICLE_v10024707mg [Citrus clementina]
 gb|ESR40384.1| hypothetical protein CICLE_v10024707mg [Citrus clementina]
Length=1454

 Score =  2061 bits (5339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 996/1418 (70%), Positives = 1203/1418 (85%), Gaps = 10/1418 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             L WAA+EKLPTY R+++GIL A    G   E+DV KLG+ E++ L+++LV++A  DNE  
Sbjct  40    LIWAALEKLPTYNRLKKGILTAST--GAANEVDVHKLGLLERQRLIDKLVKVADVDNEQL  97

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVGI LP IEVRFEHLNV+AEAYVG RALPT FNF AN++E F+N LHILP
Sbjct  98    LLKLKNRVDRVGISLPEIEVRFEHLNVEAEAYVGGRALPTFFNFCANLIEGFLNCLHILP  157

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKK   IL DV+GI+KP+R+TLLLGPP+SGKTTLLLALAGKLD  LK+SGRVTYNGH M
Sbjct  158   SRKKKFTILKDVNGIVKPSRLTLLLGPPASGKTTLLLALAGKLDPSLKLSGRVTYNGHNM  217

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+QHD+HIGEMTVRETLAFSARCQGVG RY+ML ELSRREK+ NIKPDP
Sbjct  218   DEFVPQRTAAYISQHDVHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKDANIKPDP  277

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA++ EGQEASVVTDY++K+LGL+VCAD +VGDEM+RGISGGQRKR+TTGEMLV
Sbjct  278   DIDVFMKALATEGQEASVVTDYVIKVLGLDVCADTMVGDEMLRGISGGQRKRVTTGEMLV  337

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA ALFMDEISTGLDSSTTFQIV S+RQ IHIL GTAVISLLQPAPETY+LFDDIIL+S
Sbjct  338   GPALALFMDEISTGLDSSTTFQIVTSLRQIIHILNGTAVISLLQPAPETYDLFDDIILIS  397

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             +GQ+V+QGPR++VLEFF+ MGF+CP+RKGVADFLQEVTS+KDQ+QYW+R+EE Y F+TV 
Sbjct  398   EGQIVFQGPREHVLEFFKSMGFECPKRKGVADFLQEVTSKKDQQQYWVRKEEPYRFVTVK  457

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EFS+AFQ+FHVG+KLGD L  PFDKSKSHPAAL+ K YG+NKKELLKAC SRE LLMKRN
Sbjct  458   EFSDAFQAFHVGQKLGDGLRTPFDKSKSHPAALTTKSYGINKKELLKACISRELLLMKRN  517

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK+IQL +   ++MT+F RT+M ++S+ +G +++GALFF +IM  FNG +EL++S
Sbjct  518   SFVYIFKLIQLTITGVISMTLFFRTKMHRDSVTNGGIYVGALFFTIIMITFNGMAELSMS  577

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQRDL F+P WAY LPTWILK+P+  VEVA+WV + YY IGFDP+ GR FKQ
Sbjct  578   IAKLPVFYKQRDLRFYPAWAYGLPTWILKVPIAFVEVAVWVILNYYVIGFDPNVGRAFKQ  637

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ VNQM+S LFRL AA GRS++VANTFGS AM+++  LGGF+LSR+D+KKWW W Y
Sbjct  638   YLLLVLVNQMSSGLFRLMAATGRSMVVANTFGSFAMLVLFALGGFVLSREDIKKWWKWAY  697

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W SPLMYAQN ++VNE+LG SW+ V   ++E LGV VL+SRG F +A+WYW+G+  L G 
Sbjct  698   WCSPLMYAQNGLAVNEFLGNSWQKVLPNSTEPLGVEVLKSRGFFTDAYWYWLGMAGLAGS  757

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTS------EK  2394
             + L NF F LAL++LNP G  QA++SEE+ +     + G  ++L   G S+S      E 
Sbjct  758   ILLFNFCFILALSFLNPFGS-QAVISEESQSNECDNRTGGTLQLSTHGSSSSHLTQSDES  816

Query  2395  gnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGL  2574
              + +RR  S+    S       A+   + GMVLPFEPL +TF+++ Y+VDMP EMK QG+
Sbjct  817   RDNIRRRNSTSQSLSLTEEDIAANQPKRSGMVLPFEPLSLTFEDVVYSVDMPQEMKLQGV  876

Query  2575  TEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQ  2754
              +D+LVLL G++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYI G+I ISGYPK+Q
Sbjct  877   LDDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNIKISGYPKKQ  936

Query  2755  ETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLR  2934
             ETFARI+GYCEQ DIHSP+VTVYESL+YSAWLRLPP++D+ TR MF+EE+M+LVEL  LR
Sbjct  937   ETFARISGYCEQNDIHSPNVTVYESLLYSAWLRLPPDVDSETRRMFLEEIMELVELNPLR  996

Query  2935  EALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  3114
             ++LVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT
Sbjct  997   QSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  1056

Query  3115  GRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDG  3294
             GRTVVCTIHQPSIDIF+AFDEL L+KRGG EIYVGPLGRHSS LI YFE I G+ +I+DG
Sbjct  1057  GRTVVCTIHQPSIDIFEAFDELFLMKRGGYEIYVGPLGRHSSHLISYFEAIPGVNKIKDG  1116

Query  3295  YNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYS  3474
             YNPATWMLE++S +QE ALG+DF ++Y+ SELYRRNKALI+ELSKPAPGS+DLYFPT+YS
Sbjct  1117  YNPATWMLEVSSSSQELALGVDFTDIYKGSELYRRNKALIEELSKPAPGSRDLYFPTQYS  1176

Query  3475  QSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAM  3654
             QSFFTQCMACLWKQHWSYWRNPPYTAVR LFTT  AL+FG++FW +G K   +QDLFNAM
Sbjct  1177  QSFFTQCMACLWKQHWSYWRNPPYTAVRFLFTTAIALMFGSLFWDLGTKTSKRQDLFNAM  1236

Query  3655  GCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTL  3834
             G MY AV FLGVQN++SVQPVVA+ER VFYRE+AAGMYS++ YAF QV+IE+PH+FVQ +
Sbjct  1237  GSMYTAVQFLGVQNSSSVQPVVAVERAVFYREKAAGMYSSMAYAFAQVLIEIPHVFVQAV  1296

Query  3835  IYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGF  4014
             +YGVIVYAMIGFEWTA KF+W+IFFM+++ L FT YGMM VA+TPN +IA ++S AFYG 
Sbjct  1297  VYGVIVYAMIGFEWTAVKFIWYIFFMFWSFLLFTFYGMMCVAMTPNLHIATVVSIAFYGI  1356

Query  4015  WNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKE-KLDTNETvkdfvksf  4191
             WN+FSGFIIP+TRIP+WWRWYY+  P++WTLYGL+ASQFGD+ + +L++ ETVK F++S+
Sbjct  1357  WNVFSGFIIPRTRIPIWWRWYYWANPIAWTLYGLVASQFGDIDDTRLESGETVKQFLRSY  1416

Query  4192  fdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             F F HDF+G +A + V   V+F F+FA  IKAFNFQ R
Sbjct  1417  FGFKHDFLGVIAAVHVAFTVLFVFVFALGIKAFNFQRR  1454



>gb|KDP36994.1| hypothetical protein JCGZ_06050 [Jatropha curcas]
Length=1438

 Score =  2060 bits (5337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1017/1440 (71%), Positives = 1209/1440 (84%), Gaps = 28/1440 (2%)
 Frame = +1

Query  4     WRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKL  183
             WR++G+EVFSRSSRE  +++   LKWAA+EKLPTY R+R+GIL +  +GG   EIDV+ L
Sbjct  21    WRNNGLEVFSRSSREEDDEEA--LKWAALEKLPTYDRLRKGILVSASKGGA-NEIDVDNL  77

Query  184   GVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGS-R  360
             G+ E+++L+ERL+R+A+EDNE FLLKLK+R DRVGI++PTIEVR+EHLN++AEA+VGS R
Sbjct  78    GLQERKTLIERLIRVAEEDNEKFLLKLKNRIDRVGIEVPTIEVRYEHLNIEAEAFVGSSR  137

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT  N T   +E  + ++ I P+RK+PL IL DVSG+IKP+R+TLLLGPPSSGKTTLL
Sbjct  138   ALPTFINATVGAIEGLLRFIPIFPSRKRPLTILKDVSGVIKPSRLTLLLGPPSSGKTTLL  197

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD  LKVSG VTYNGH + EFVP+RT+AYI+Q DLHIGEMTVRETLAFSARCQG
Sbjct  198   LALAGKLDPSLKVSGSVTYNGHTLNEFVPQRTAAYISQQDLHIGEMTVRETLAFSARCQG  257

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG ++EMLAELSRREK  NIKPDPDIDV+MKA + EGQE SVVTDY+LKILGLEVCAD L
Sbjct  258   VGTQHEMLAELSRREKAANIKPDPDIDVFMKAAATEGQETSVVTDYVLKILGLEVCADTL  317

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VG+EMIRGISGGQRKR+TTGEMLVGPA+ALFMDEISTGLDSSTT+QIVNS+RQSIHIL G
Sbjct  318   VGNEMIRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTYQIVNSLRQSIHILNG  377

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY LFDDIIL+SDGQ+VY GPR+ VLEFF+HMGFKCP+RKGVADFLQE
Sbjct  378   TAVISLLQPAPETYNLFDDIILISDGQIVYHGPRERVLEFFEHMGFKCPDRKGVADFLQE  437

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW R+ + Y ++ V EF+EAFQSF VG+K+ ++L+ P+D++KSHPAALS +
Sbjct  438   VTSKKDQQQYWARKNQPYRYVEVNEFAEAFQSFEVGRKIAEDLSTPYDRTKSHPAALSTR  497

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
              YGV K ELLKA  SRE+LLMKRNSFVY FK+ QLV+MA V+MT+F RTEM  N + DG 
Sbjct  498   PYGVGKMELLKANFSREYLLMKRNSFVYYFKLFQLVMMAIVSMTLFFRTEMKHNDVTDGG  557

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFFA  + MFNG SEL+++I KLP FYKQRD  FFP WAYALP+W+LKIP++ VE
Sbjct  558   IYTGALFFAATLIMFNGMSELSMTIAKLPVFYKQRDFRFFPAWAYALPSWVLKIPISFVE  617

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV +TYY IGFDP+ GR FKQ  LL+ VNQMAS LFRL A+ GR++IVANTFGS A+
Sbjct  618   VAVWVALTYYVIGFDPNVGRLFKQYLLLLLVNQMASGLFRLIASIGRNMIVANTFGSFAL  677

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSG--TSETLG  2154
             + +  LGGF+LSR+D+KKWWIWGYWISPLMY QNAI VNE+LG SW H+P G  T+ETLG
Sbjct  678   LTLFALGGFVLSREDIKKWWIWGYWISPLMYGQNAIVVNEFLGHSWSHIPEGSSTNETLG  737

Query  2155  VTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERN  2334
             V VL+SRG F +AHWYWIGVGA VG++F+ N L+ +AL   +   KPQA++S+E     +
Sbjct  738   VQVLKSRGFFTDAHWYWIGVGAQVGFMFVFNILYAIALAVFDEFDKPQAVISDE---PES  794

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPN-MKRGMVLPFEPLC  2511
             + + G  I+L    GS                           +PN  KRGMVLPFEP  
Sbjct  795   SVRPGGAIQLSQIEGSHRTDTGTSGID----------------EPNNKKRGMVLPFEPHS  838

Query  2512  ITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLA  2691
             +TFD + Y+VDMP EMK+QG+ ED+LVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLA
Sbjct  839   LTFDNVVYSVDMPQEMKSQGVLEDKLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLA  898

Query  2692  GRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEID  2871
             GRKTGGYIEG ITISGYPK+QETFARI+GYCEQ DIHSP+VTVYESLV+SAWLRLPP++D
Sbjct  899   GRKTGGYIEGDITISGYPKKQETFARISGYCEQNDIHSPNVTVYESLVFSAWLRLPPDVD  958

Query  2872  TATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPT  3051
               TR+MFVEEVM+LVEL  LR +LVGLPG+ GL+TEQRKRLTIAVELVANPSIIFMDEPT
Sbjct  959   ADTRKMFVEEVMELVELNPLRNSLVGLPGLTGLTTEQRKRLTIAVELVANPSIIFMDEPT  1018

Query  3052  SGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGR  3231
             SGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLGR
Sbjct  1019  SGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGR  1078

Query  3232  HSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKAL  3411
             HS+ L+ YFE I G+ +I DGYNPATWMLE+T+ AQE ALG+DF ++Y+ S+LYRRNKA+
Sbjct  1079  HSTHLVNYFEGIEGVSKITDGYNPATWMLEVTTPAQELALGVDFTDLYKKSDLYRRNKAM  1138

Query  3412  IQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLF  3591
             IQELSKPAPG+KDLYFPT+Y+ SFFTQ +ACLWKQ WSYWRNPPYTAVR  FTTF AL+F
Sbjct  1139  IQELSKPAPGTKDLYFPTQYATSFFTQTLACLWKQQWSYWRNPPYTAVRFWFTTFVALMF  1198

Query  3592  GTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYS  3771
             GT+FW IG     QQDL NAMG +YAA  FLGVQNA+SVQPVVAIERTVFYRERAAG+YS
Sbjct  1199  GTIFWDIGSTVTRQQDLANAMGALYAATFFLGVQNASSVQPVVAIERTVFYRERAAGLYS  1258

Query  3772  ALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMM  3951
             A+PYA+ Q +IELP++F Q++ Y +I Y+MI FEWTAAKF W++F +YFTLLYFT YGMM
Sbjct  1259  AMPYAYAQALIELPYVFAQSVAYSLITYSMIAFEWTAAKFFWYLFLLYFTLLYFTFYGMM  1318

Query  3952  TVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQF  4131
             TVAVTPNH+IAAI+SSAFY  WN+F+GFI+P+ R+PVWWRWYY+ CP++WTLYGLIASQF
Sbjct  1319  TVAVTPNHHIAAIVSSAFYSIWNIFAGFIVPRPRMPVWWRWYYWACPIAWTLYGLIASQF  1378

Query  4132  GDVKEKLD--TNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             GDV   L+    +TV +F+KS +   HDF+G VA +IVGI V+F FIFA SIKAFNFQ R
Sbjct  1379  GDVHTILEDGNGQTVAEFLKSSYGMKHDFLGAVAGVIVGITVLFAFIFAISIKAFNFQRR  1438



>ref|XP_004498643.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cicer 
arietinum]
Length=1431

 Score =  2060 bits (5337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1024/1435 (71%), Positives = 1206/1435 (84%), Gaps = 23/1435 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ ++VFS S RE  E+    LKWAAIE+LPTYLRIRR I+  EE  G  +E+D++K
Sbjct  20    IWRNNSMDVFSTSERENDEEA---LKWAAIERLPTYLRIRRSIINNEE--GKGREVDIKK  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++ LLERLV+IA+EDNE FLLKLK R DRVG+D+PT+EVRFEH+NV+A+ YVG R
Sbjct  75    LGLTERKILLERLVKIAEEDNEKFLLKLKERMDRVGLDIPTVEVRFEHINVEAQVYVGGR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP++ NF  N+LE F+N+LHILP+ KKPL IL +VSGIIKP RMTLLLGPP SGKTTLL
Sbjct  135   ALPSLLNFFVNVLEGFLNFLHILPSPKKPLHILQNVSGIIKPQRMTLLLGPPGSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL+ DLK  GRVTYNG  + EFVP+RTSAYI+QHD HIGEMTVRETLAFSARCQG
Sbjct  195   LALAGKLEKDLKHFGRVTYNGEVLEEFVPQRTSAYISQHDNHIGEMTVRETLAFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VGH YEMLAEL RREKE  IKPDPDID YMKA ++EGQ+ASVVTDYILKILGLE+CADI+
Sbjct  255   VGHNYEMLAELLRREKEAKIKPDPDIDAYMKAAALEGQQASVVTDYILKILGLEICADIM  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD MIRGISGGQ+KR+TTGEMLVGP R LFMDEISTGLDSSTTFQI++SIRQSIHIL G
Sbjct  315   VGDGMIRGISGGQKKRVTTGEMLVGPIRVLFMDEISTGLDSSTTFQIISSIRQSIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA++SLLQPAPETYELFDDIILL+DGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  375   TALVSLLQPAPETYELFDDIILLTDGQIVYQGPRENVLEFFESMGFKCPERKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ QYW  ++  Y F+TV +F+EAFQ FH+G+KLGDELA PFDKSK H   L+ K
Sbjct  435   VTSRKDQWQYWANKDVPYSFVTVKDFAEAFQIFHIGQKLGDELANPFDKSKCHANILTKK  494

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGVN KELLKACASREFLLMKRNSFVYIFK+ QL+ +A +  T+FLRT+M K ++ DG 
Sbjct  495   KYGVNMKELLKACASREFLLMKRNSFVYIFKITQLIYLAIMTTTLFLRTKMHKKTVEDGG  554

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
              +MGALFF V + MFNG SEL ++I+KLP FYKQRDL F+P WAY+LP WILKIP+TL+E
Sbjct  555   TYMGALFFTVTVAMFNGISELNMTIMKLPVFYKQRDLLFYPSWAYSLPPWILKIPITLIE  614

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIW  +TYYAIG+DP+  RF KQ  +++C+NQMAS+LFR+ AA GR VIVANT G+ A+
Sbjct  615   VAIWEAITYYAIGYDPNFVRFLKQYLIILCINQMASSLFRMMAALGRDVIVANTVGAFAL  674

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             ++VLVLGGF++SR+DV KW++WGYW SPLMY QNAI+VNE+LG SWR V   ++ETLGV 
Sbjct  675   LVVLVLGGFVISREDVHKWFLWGYWSSPLMYGQNAIAVNEFLGHSWRKVTRNSNETLGVL  734

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L++RG FP+A+WYWIGVGAL GYV L NFLF LAL YL+P  K QA LSE+ L ER+  
Sbjct  735   ILKTRGFFPQAYWYWIGVGALTGYVLLYNFLFTLALQYLSPFRKDQAGLSEDKLLERDGS  794

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
                E I+L  +   +  +                   V+ A  +  RGMVLPF+P+ +TF
Sbjct  795   TDEEFIQLPSQKSISETR------------------MVDEASRSGSRGMVLPFQPVSLTF  836

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEI+YAVDMP EMK+QG+ EDRL LLKGI+GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  837   DEIRYAVDMPQEMKSQGVFEDRLELLKGISGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  896

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+ITISGYPK Q+TFARI+GYCEQ DIHSP+VTVYESL+YSAWLRLPPE+D AT
Sbjct  897   TGGYIEGNITISGYPKNQKTFARISGYCEQFDIHSPNVTVYESLLYSAWLRLPPEVDQAT  956

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVEL SLREALVGLPG NGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  957   RKMFIEEVMELVELNSLREALVGLPGENGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1016

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLK GGE+IY GPLGRH S
Sbjct  1017  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKLGGEQIYAGPLGRHCS  1076

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I G+ +I+DGYNPATWMLE+TS   EA L ++F  VYRNSELYRRNK LIQE
Sbjct  1077  HLIQYFEAIEGVPKIKDGYNPATWMLEVTSAGSEANLKVNFTNVYRNSELYRRNKQLIQE  1136

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS     SKDLYF T+YSQ+  TQC ACLWKQH SYWRN  YTAVRLLFTT  A LFG +
Sbjct  1137  LSIHPQHSKDLYFDTQYSQTMVTQCKACLWKQHLSYWRNTSYTAVRLLFTTLIAFLFGVI  1196

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW IG KRR +QDLFNAMG MYA+V+F+GVQN  SVQP++A+ERTVFYRERAAGMYSALP
Sbjct  1197  FWNIGLKRRKEQDLFNAMGSMYASVIFIGVQNGASVQPIIAVERTVFYRERAAGMYSALP  1256

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YA  QV+IELPH+  QTLIYG+IVYAM+G +WT +KFLW++FFMYFT LY+T YGMMT+A
Sbjct  1257  YALAQVIIELPHILAQTLIYGIIVYAMMGLDWTTSKFLWYLFFMYFTFLYYTFYGMMTMA  1316

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             ++PN ++AAI+SSAFY  W+LFSGF+IP +RIP+WW+WYY++CPV+WTLYGL+ASQ+GD 
Sbjct  1317  ISPNPHVAAILSSAFYAIWSLFSGFVIPLSRIPIWWKWYYWVCPVAWTLYGLVASQYGDN  1376

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              + L+  + V++FVKS+F F+HDF+G VA ++ G  V+F  +F FSIK FNFQ R
Sbjct  1377  MDTLENGQRVEEFVKSYFGFEHDFLGVVAIVVAGFSVLFALVFTFSIKVFNFQKR  1431



>ref|XP_009616095.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nicotiana 
tomentosiformis]
Length=1426

 Score =  2060 bits (5336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1011/1435 (70%), Positives = 1204/1435 (84%), Gaps = 38/1435 (3%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++GVEVFSRS+R+  +++   LKWAA+EKLPT+ R+R+G+L   +  G   E+D+  
Sbjct  30    IWRNNGVEVFSRSARDEDDEEA--LKWAALEKLPTFDRLRKGLLFGSK--GAAAEVDIND  85

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+++LLERLV++A EDNE FLLKLK+R DRVGIDLP+IEVR+EHLN++A+AYVGSR
Sbjct  86    LGFQERKTLLERLVKVADEDNEKFLLKLKNRIDRVGIDLPSIEVRYEHLNIEADAYVGSR  145

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT  NF  N +E F+N LHIL ++K+ + IL+DVSG+IKP RMTLLLGPPSSGKTTLL
Sbjct  146   ALPTFINFMTNFVETFLNSLHILRSKKRQITILNDVSGMIKPCRMTLLLGPPSSGKTTLL  205

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLDS LKV+G+VTYNGHE+ EFVP+RT+ YI+QHDLHIGEMTVRETL FSARCQG
Sbjct  206   LALAGKLDSALKVTGKVTYNGHELHEFVPQRTAVYISQHDLHIGEMTVRETLEFSARCQG  265

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEMLAELSRREK  NIKPDPDIDVYMKA + EGQEA+VVTDY+LKILGL++CAD +
Sbjct  266   VGSRYEMLAELSRREKAANIKPDPDIDVYMKASATEGQEANVVTDYVLKILGLDICADTM  325

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQ+KR+TTGEMLVGPA+ALFMDEISTGLDSSTTF IVNS+RQS+ +L+G
Sbjct  326   VGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSSTTFSIVNSLRQSVQLLKG  385

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY LFDDIILLSDG +VYQGPR+ VL+F + MGFKCPERKGVADFLQE
Sbjct  386   TAVISLLQPAPETYNLFDDIILLSDGYIVYQGPREAVLDFLESMGFKCPERKGVADFLQE  445

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW +R+E Y FIT  EF+EA+QSFHVG+KLGDELA+P+DKSKSHPAALS +
Sbjct  446   VTSKKDQQQYWAKRDEPYRFITSKEFAEAYQSFHVGRKLGDELAIPYDKSKSHPAALSTQ  505

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG+  K+LLK CA RE+LLMKRNSFVYIFK+ QL +MA + MTVF RT+MP++ + DG 
Sbjct  506   KYGIGTKQLLKVCAEREYLLMKRNSFVYIFKLSQLAIMALITMTVFFRTKMPRDDMDDGG  565

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF V+M MFNG +E+AL+I KLP ++K RDL FFP WAYALPTWILKIPVT VE
Sbjct  566   IYAGALFFVVVMIMFNGMAEIALTIFKLPVYFKHRDLLFFPSWAYALPTWILKIPVTFVE  625

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V +W  +TYY +GFDP+  R FKQ  LLI V+QMASALFR   A GR++ VA+TFG+ A+
Sbjct  626   VGLWTFLTYYVMGFDPNVSRLFKQFLLLILVHQMASALFRFIGAVGRTMGVASTFGAFAL  685

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +L   LGGF+L+RDDVKKWWIWGYW SPLMY+ N+I VNE+ GK+W+H+  G +E LG  
Sbjct  686   LLQFALGGFVLARDDVKKWWIWGYWTSPLMYSVNSILVNEFDGKNWKHIAQGGTEPLGAA  745

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             V+R+RG F +A+WYWIG+GALVG+  + N  + +AL YLNP GKPQAM+SE++    NA 
Sbjct  746   VVRARGFFTDAYWYWIGIGALVGFTMIFNLFYSIALAYLNPFGKPQAMISEDS---ENA-  801

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
                E ++      S SE                          N K+GMVLPFEP  ITF
Sbjct  802   DSTEGVD------SVSE------------------------GENKKKGMVLPFEPHSITF  831

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D++ Y+VDMP EMK QG TEDRLVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  832   DDVVYSVDMPPEMKEQGSTEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  891

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+GSI ISGYPK QETFARI+GYCEQ DIHSP+VTVYESLVYSAWLRLP ++D   
Sbjct  892   TGGYIDGSIKISGYPKIQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPQDVDENK  951

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFVEEVM+LVELT LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  952   RKMFVEEVMELVELTPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1011

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMR VRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGG+EIYVGPLGRHS 
Sbjct  1012  DARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSC  1071

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE++ G+ +I++ YNPATWMLE+T+ +QE  LG+DFA++Y+ S+LY+RNKALI E
Sbjct  1072  HLIKYFESMPGVSKIKEAYNPATWMLEVTASSQEMMLGVDFADLYKKSDLYKRNKALIAE  1131

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PG+KDLYF T++SQ F+TQCMACLWKQHWSYWRNP YTAVR LFTTF  L+FGTM
Sbjct  1132  LSTPRPGTKDLYFETQFSQPFWTQCMACLWKQHWSYWRNPAYTAVRFLFTTFIGLVFGTM  1191

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G K    QDLFNAMG MYAA +FLGVQN++SVQPVVA+ERTVFYRERAAGMYSA+P
Sbjct  1192  FWDLGTKVSRSQDLFNAMGSMYAACLFLGVQNSSSVQPVVAVERTVFYRERAAGMYSAIP  1251

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQ+VIE+P++FVQ  +YG+IVYAMIGFEWTAAKF W+ FFMYFTLLYFT YGMMTVA
Sbjct  1252  YAFGQIVIEIPYVFVQAAVYGLIVYAMIGFEWTAAKFFWYFFFMYFTLLYFTFYGMMTVA  1311

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             ++PN N+A+I+++ FY  WNLFSGFI+P+ RIP+WWRWYY+ CPV+WTLYGL+ASQFGD+
Sbjct  1312  ISPNQNVASIVAAFFYAAWNLFSGFIVPRPRIPIWWRWYYWACPVAWTLYGLVASQFGDL  1371

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +  L  NETV+ F+  +F F HDF+G VA +IV + VMF   FA +IKAFNFQ R
Sbjct  1372  QNDLGNNETVEQFLDRYFGFKHDFLGVVAAVIVALPVMFALTFALAIKAFNFQKR  1426



>ref|XP_003588699.1| Pleiotropic drug resistance ABC transporter family protein [Medicago 
truncatula]
Length=1454

 Score =  2058 bits (5333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1020/1442 (71%), Positives = 1202/1442 (83%), Gaps = 14/1442 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ + VFS S RE  E+    LKWAAIE+LPTYLRIRR I+  EE  G  +EID++K
Sbjct  20    IWRNNSMNVFSTSEREDDEEA---LKWAAIERLPTYLRIRRSIINNEE--GEGREIDIKK  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++ LLERLV+IA+EDNE FLLKLK R +RVG+D+P +EVRFEH+NV+A+ YVG R
Sbjct  75    LGLTERKVLLERLVKIAEEDNEKFLLKLKERIERVGLDIPIVEVRFEHINVEAQVYVGGR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP++ NF AN+LE F+NYLHI+P+ KKPL IL +VSGIIKP RMTLLLGPP SGKTTLL
Sbjct  135   ALPSLLNFYANVLEGFLNYLHIIPSPKKPLHILQNVSGIIKPQRMTLLLGPPGSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRVTYNG  + EFVP+RTSAYI+QHD HIGEMTVRETLAFSARCQG
Sbjct  195   LALAGKLAKDLKQSGRVTYNGKGLDEFVPQRTSAYISQHDNHIGEMTVRETLAFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VGH Y+ML EL RREKE  IKPDPD+D YMKA ++EGQEASVVTDYILKILGLE+CADI+
Sbjct  255   VGHNYDMLTELLRREKEAKIKPDPDVDAYMKAAALEGQEASVVTDYILKILGLEICADIM  314

Query  901   VGDEMIRGISGGQRKRLTTG-------EMLVGPARALFMDEISTGLDSSTTFQIVNSIRQ  1059
             VGD MIRGISGGQ+KR+TTG       EMLVGP R LFMDEISTGLDSSTTFQI++SIRQ
Sbjct  315   VGDGMIRGISGGQKKRVTTGILFIRTGEMLVGPIRVLFMDEISTGLDSSTTFQIISSIRQ  374

Query  1060  SIHILQGTAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKG  1239
             SIHIL GTA++SLLQPAPETYELFDDIILL+DGQ+VYQGPR+NVLEFF+ MGFKCPERKG
Sbjct  375   SIHILNGTALVSLLQPAPETYELFDDIILLTDGQIVYQGPRENVLEFFESMGFKCPERKG  434

Query  1240  VADFLQEVTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSH  1419
             VADFLQEVTSRKDQ QYW  ++E Y F+TV +F+EAFQ FH+G+KLGDELA PFDKSK H
Sbjct  435   VADFLQEVTSRKDQWQYWANKDEPYSFVTVKDFAEAFQIFHIGQKLGDELANPFDKSKCH  494

Query  1420  PAALSNKKYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPK  1599
              + L+ KKYGVNKKELLKACASREFLLMKRNSFV+IFK+ QL+ +A +  T+FLRT+M K
Sbjct  495   ASVLTTKKYGVNKKELLKACASREFLLMKRNSFVHIFKVTQLIYLAIMTTTLFLRTKMHK  554

Query  1600  NSIADGTVFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILK  1779
             +++ DG  +MGALFF V + MFNG SEL ++++KLP FYKQRDL F+P WAY+LP WILK
Sbjct  555   DTVEDGGAYMGALFFTVTVAMFNGISELNMTLMKLPVFYKQRDLLFYPSWAYSLPPWILK  614

Query  1780  IPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVAN  1959
             IP+ L+E  IW  +TYYAIG+DP   R  KQ  +++ +NQMA++LFRL AA GR VIVA+
Sbjct  615   IPIALIEAVIWEAITYYAIGYDPSFVRLLKQYLVILLINQMATSLFRLMAALGRDVIVAS  674

Query  1960  TFGSCAMILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGT  2139
             T GS A+++VLVLGGF++SR+DV KW++WGYW SPLMY QNAI+VNE+LG SWR V   +
Sbjct  675   TVGSFALLVVLVLGGFVISREDVHKWFLWGYWSSPLMYGQNAIAVNEFLGHSWRKVTHNS  734

Query  2140  SETLGVTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEET  2319
             +ETLGV V+++RG FP+A+WYWIGVGAL+GYVFL NFLF LAL YLNP  K QA LSEE 
Sbjct  735   NETLGVLVMKTRGFFPQAYWYWIGVGALIGYVFLFNFLFTLALQYLNPFRKDQAGLSEEE  794

Query  2320  LAERNACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPF  2499
             L ER+A    E  +L  +   +  K        S    +             +RGMVLPF
Sbjct  795   LLERDASTAVEFTQLPTRKRISETKIAEEGLMPSRSFSARVSKDKTSISG--RRGMVLPF  852

Query  2500  EPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLM  2679
             +PL +TFDEI+YAVDMP EMK QG++EDRL LLKGINGAFRPGVLTALMG+SGAGKTTLM
Sbjct  853   QPLSLTFDEIRYAVDMPQEMKNQGVSEDRLELLKGINGAFRPGVLTALMGVSGAGKTTLM  912

Query  2680  DVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLP  2859
             DVLAGRKTGGYI+G+ITISGYPK Q+TFARI+GYCEQ DIHSP+VTVYESL+YSAWLRLP
Sbjct  913   DVLAGRKTGGYIDGNITISGYPKNQKTFARISGYCEQFDIHSPNVTVYESLLYSAWLRLP  972

Query  2860  PEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  3039
             PE+D ATR+MF+EEVM+LVEL SLREALVGLPG  GLSTEQRKRLTIAVELVANPSIIFM
Sbjct  973   PEVDQATRKMFIEEVMELVELNSLREALVGLPGETGLSTEQRKRLTIAVELVANPSIIFM  1032

Query  3040  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVG  3219
             DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLL+K GGE+IY G
Sbjct  1033  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLMKLGGEQIYSG  1092

Query  3220  PLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRR  3399
             PLGRH + LI YFE I G+ +I+DGYNPATWMLE+TS   EA L ++F  VYRNSELYRR
Sbjct  1093  PLGRHCAHLIHYFEAIEGVPKIKDGYNPATWMLEVTSAGSEANLKVNFTNVYRNSELYRR  1152

Query  3400  NKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFN  3579
             NK LIQELS P   SK+LYF ++Y+Q+  +QC ACLWKQH SYWRN  YTAVRLLFTT  
Sbjct  1153  NKQLIQELSIPPQDSKELYFDSQYTQTMLSQCKACLWKQHLSYWRNTSYTAVRLLFTTLI  1212

Query  3580  ALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAA  3759
             A LFG +FW IG KRR +QDLFNAMG MYA+V+F+GVQN  SVQPV+A+ERTVFYRERAA
Sbjct  1213  AFLFGIIFWNIGLKRRKEQDLFNAMGSMYASVIFIGVQNGASVQPVIAVERTVFYRERAA  1272

Query  3760  GMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftl  3939
             GMYSALPYA  QV+IELPH+ VQTL+YG+IVYAM+GFEWTA+KF W+IFF YFT LY+T 
Sbjct  1273  GMYSALPYAAAQVIIELPHILVQTLVYGIIVYAMMGFEWTASKFFWYIFFNYFTFLYYTF  1332

Query  3940  yGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLI  4119
             YGMMT+A+TPN ++AAI+SS+FY  WNLFSGFIIP ++IP+WW+W+Y++CPV+WTLYGL+
Sbjct  1333  YGMMTMAITPNPHVAAILSSSFYAIWNLFSGFIIPLSKIPIWWKWFYWVCPVAWTLYGLV  1392

Query  4120  ASQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQ  4299
              SQ+GD  +KL+  + V++FVKS+F F+HDF+G VA ++V   V F  IF F IKAFNFQ
Sbjct  1393  TSQYGDNMQKLENGQRVEEFVKSYFGFEHDFLGVVAIVVVSFSVFFALIFTFGIKAFNFQ  1452

Query  4300  TR  4305
              R
Sbjct  1453  KR  1454



>ref|XP_010925282.1| PREDICTED: putative pleiotropic drug resistance protein 7 isoform 
X1 [Elaeis guineensis]
Length=1477

 Score =  2058 bits (5332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1005/1433 (70%), Positives = 1213/1433 (85%), Gaps = 25/1433 (2%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAAIEKLPTY R+R+GILAA E GG  +E+D+ +LG  E+++LLERLVR A+EDNE F
Sbjct  48    LKWAAIEKLPTYDRMRKGILAAAE-GGEIQEVDIHELGFQERKNLLERLVRTAEEDNERF  106

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKL++R +RVGID PTIE+RFEHLN+DAEAYVG+R +PT  NF  N +   ++YLHI+P
Sbjct  107   LLKLRNRMERVGIDNPTIELRFEHLNIDAEAYVGNRGVPTFTNFFYNKIMDVLSYLHIVP  166

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
               KKP+ ILHD+SGII+P RMTLLLGPP SGKTTLLLALAGKLDS LKVSGRVTYNGH+M
Sbjct  167   TGKKPISILHDISGIIRPCRMTLLLGPPGSGKTTLLLALAGKLDSTLKVSGRVTYNGHDM  226

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI QHD+HIGEMTVRETL FSARCQGVG RY+ML ELSRREKE NIKPDP
Sbjct  227   DEFVPQRTSAYIGQHDIHIGEMTVRETLNFSARCQGVGTRYDMLTELSRREKEANIKPDP  286

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDVYMKAIS+EGQE SVVTDYILKILGLE+CAD +VGD MIRGISGGQ+KR+TTGEMLV
Sbjct  287   DIDVYMKAISVEGQE-SVVTDYILKILGLEICADTMVGDAMIRGISGGQKKRVTTGEMLV  345

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA+ALFMDEISTGLDSSTT+QIVNS+RQS+HIL GTA I+LLQPAPETY+LFDDI+LLS
Sbjct  346   GPAKALFMDEISTGLDSSTTYQIVNSLRQSVHILGGTAFIALLQPAPETYDLFDDIVLLS  405

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             +GQ+VYQGPR+N+LEFF+ +GFKCPERKGVADFLQEVTSRKDQ QYW R++E Y +I+V 
Sbjct  406   EGQIVYQGPRENILEFFESVGFKCPERKGVADFLQEVTSRKDQHQYWARKDEPYRYISVN  465

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EFSEAFQSFH+G+KLG+EL  PFD+S++HPAAL+  KYG++K ELLKAC SRE+LLMKRN
Sbjct  466   EFSEAFQSFHIGRKLGEELGAPFDRSRNHPAALTTSKYGISKMELLKACMSREWLLMKRN  525

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK++QL+++  + MTVFLRT+M + S+ DG +F+GA+F  ++  +FNGF+ELA+S
Sbjct  526   SFVYIFKVVQLIILGTIGMTVFLRTKMHRKSVEDGAIFLGAMFLGLVTHLFNGFAELAMS  585

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQRDL F+P WAYALPTWILKIP++ +E A+W+ MTYY IGFDP+  RFF+Q
Sbjct  586   IAKLPIFYKQRDLLFYPSWAYALPTWILKIPISFLECAVWIGMTYYVIGFDPNIQRFFRQ  645

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ ++QMAS LFRL AA GR ++VA+TFGS A +++L+LGGF++SRDD+KKWWIWGY
Sbjct  646   YLLLVLISQMASGLFRLLAALGREMVVADTFGSFAQLVLLILGGFLISRDDIKKWWIWGY  705

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W SPLMYAQNAI+VNE+LG SW+   +G++  LGV VL  RGIF +A+WYWIGVGAL+GY
Sbjct  706   WSSPLMYAQNAIAVNEFLGHSWQKHVNGSNVPLGVLVLEGRGIFVDANWYWIGVGALLGY  765

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             +FL N LF   L +L+PLGK Q ++SE  L E++A + GE IEL L  G+ S K    + 
Sbjct  766   IFLFNILFVFFLDWLDPLGKGQTVISEAELKEKHANRTGESIEL-LPAGTDSSKPTASQG  824

Query  2413  svssrslssr----------vgsvnvADPN------------MKRGMVLPFEPLCITFDE  2526
                S                      A+ N             K+GMVLPF PL +TFD+
Sbjct  825   QSQSIFDFKSIYSLLEPRHLKQIKTNAERNSDITRAPQNGESRKKGMVLPFTPLSLTFDD  884

Query  2527  IKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTG  2706
             I+Y+VDMP EMK +G+TEDRL+LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTG
Sbjct  885   IRYSVDMPQEMKDRGVTEDRLMLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTG  944

Query  2707  GYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATRE  2886
             G IEG+++ISGYPK+QETFARI+GYCEQ DIHSPHVTVYESL++SAWLRLPPE+D+ TR+
Sbjct  945   GCIEGNVSISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLFSAWLRLPPEVDSNTRK  1004

Query  2887  MFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDA  3066
             MFVEEVM+LVELTSLR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDA
Sbjct  1005  MFVEEVMELVELTSLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDA  1064

Query  3067  RAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQL  3246
             RAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF++FDEL L+KRGGEEIYVGPLGR+S  L
Sbjct  1065  RAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFESFDELFLMKRGGEEIYVGPLGRNSCHL  1124

Query  3247  IRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELS  3426
             I+YFE I GI+RI+DGYNPATWMLE+T++AQE  LG++FAE+Y+NS+LYRRNKALI ELS
Sbjct  1125  IKYFEEIEGIRRIKDGYNPATWMLEVTTQAQEEILGVNFAEIYKNSDLYRRNKALISELS  1184

Query  3427  KPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFW  3606
              P PGSKDL+FPTKYSQ F TQCMACLWKQH SYWRNP YTA R+ FTT  A +FGT+FW
Sbjct  1185  TPPPGSKDLFFPTKYSQPFLTQCMACLWKQHKSYWRNPSYTATRIFFTTVIAFIFGTIFW  1244

Query  3607  GIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYA  3786
              +G K   +QDLFN++G MYAAV+F+G+QN  +VQP+V +ERTVFYRE+AAGMYSALPYA
Sbjct  1245  RLGKKVTKRQDLFNSLGSMYAAVLFIGIQNGQTVQPIVDVERTVFYREKAAGMYSALPYA  1304

Query  3787  FGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVT  3966
             + QV+IE+PH+F+QT+IYG+IVY++IGF+WT  KF W++FFM+FT +YFT YGMM VA+T
Sbjct  1305  YAQVLIEIPHIFLQTVIYGLIVYSLIGFDWTLQKFFWYLFFMFFTFMYFTFYGMMAVAMT  1364

Query  3967  PNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKE  4146
             PN +IAAI+S+AFY  WN+F+G++IP+ RIPVWWRWY + CPV+WTLYGL+ASQFGD K 
Sbjct  1365  PNSDIAAIVSTAFYAIWNIFAGYLIPRPRIPVWWRWYSWACPVAWTLYGLVASQFGDYKH  1424

Query  4147  KLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              L+    V+D+++++F F HDF+G VA  +VG  ++F F+FAFSIK FNFQ R
Sbjct  1425  NLENGSKVQDYIETYFGFRHDFLGVVAAAVVGFTLLFAFVFAFSIKVFNFQRR  1477



>ref|XP_010654717.1| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis 
vinifera]
Length=1454

 Score =  2058 bits (5332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1034/1443 (72%), Positives = 1228/1443 (85%), Gaps = 16/1443 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG EVFSR+S +  +++   LKWAA+EKLPTY R+R+G+L   E  G   E+D+  
Sbjct  20    IWRNSGAEVFSRTSGDEDDEEA--LKWAALEKLPTYNRMRKGLLMGSE--GEANEVDIHN  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+++L+ERLV+IA EDNE FLLKLK+R DRVGIDLP IEVRFEHL +DAEAYVGSR
Sbjct  76    LGLQERKNLVERLVKIADEDNEKFLLKLKNRIDRVGIDLPEIEVRFEHLTIDAEAYVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  N   N +E  +N L ILP+RKK   ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  136   ALPSFINSAFNQIEDILNALRILPSRKKKFTILHDVSGIIKPRRMTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LAL+GKLDS LKV G VTYNGH M EFVP+RT+AYI+Q D HIGEMTVRETLAFSARCQG
Sbjct  196   LALSGKLDSSLKVMGSVTYNGHGMNEFVPQRTAAYISQLDTHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+MLAELSRREK  NIKPDPDIDV+MKA++ EGQ+ +V+TDY LKILGLEVCAD +
Sbjct  256   VGDRYDMLAELSRREKSANIKPDPDIDVFMKAVAAEGQKENVITDYTLKILGLEVCADTM  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTT+QIVNS+RQ+IHI +G
Sbjct  316   VGDEMVRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLRQNIHIFKG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY LFDDIILLSD Q+VYQGPR++VL+FF+ MGF+CPERKGVADFLQE
Sbjct  376   TALISLLQPAPETYNLFDDIILLSDSQIVYQGPREDVLDFFESMGFRCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW+ ++E Y F+TV EF+EAFQSFH+G+KLGDELA PFDK+KSHPAA+  +
Sbjct  436   VTSRKDQEQYWICKDEPYSFVTVKEFAEAFQSFHIGRKLGDELATPFDKTKSHPAAMKTE  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKELL AC +RE+LLMKRNSFVYIFK+ QL +MA + MT+FLRTEM KN+  DG 
Sbjct  496   KYGVRKKELLDACIAREYLLMKRNSFVYIFKLTQLTIMAVIGMTIFLRTEMHKNTTEDGN  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF VI  MFNG SELA++I+KLP FYKQR L F+P WAYALP+W LKIP+T VE
Sbjct  556   IYTGALFFIVITVMFNGMSELAMTIVKLPVFYKQRGLLFYPAWAYALPSWFLKIPITFVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V +WV +TYY IGFDP+ GR F+Q  LL+ +NQ+AS+LFR  AAA R++I+ANTFG+ A+
Sbjct  616   VGVWVFITYYVIGFDPNVGRLFRQYLLLLLLNQVASSLFRFIAAASRNMIIANTFGTFAL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTS-ETLGV  2157
             +L+  LGGF+LSR+++KKWWIW YW SPLMYAQNAI VNE+LGKSW    S TS E+LGV
Sbjct  676   LLLFALGGFVLSRENIKKWWIWVYWSSPLMYAQNAIVVNEFLGKSWSKNASTTSTESLGV  735

Query  2158  TVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNA  2337
             TVL+SRG F EAHW WIG GAL+G++F+ NF + +ALTYLNP  KPQA+++EE+    + 
Sbjct  736   TVLKSRGFFTEAHWCWIGAGALLGFIFVFNFFYTVALTYLNPFEKPQAVITEES----DN  791

Query  2338  CKRGEPIEL--ELKGG----STSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPF  2499
              K G  IEL    KG     +++++G  + RS+SS        ++  A+ N K+GMVLPF
Sbjct  792   AKTGGKIELSSHRKGSIDQTASTKRGGEIGRSISSTFSYVTEEAIAEANHNKKKGMVLPF  851

Query  2500  EPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLM  2679
             +P  ITFD+I+Y+VDMP EMK+QG+ ED+L LLKG++GAFRPGVLTALMG+SGAGKTTLM
Sbjct  852   QPHSITFDDIRYSVDMPEEMKSQGVLEDKLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  911

Query  2680  DVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLP  2859
             DVLAGRKTGGYIEG+I+ISGYPK+QETFARI GYCEQ DIHSPHVT++ESL+YSAWLRL 
Sbjct  912   DVLAGRKTGGYIEGNISISGYPKKQETFARICGYCEQNDIHSPHVTIHESLLYSAWLRLS  971

Query  2860  PEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  3039
             P++D  TR MF+EEVM+LVELT LR+ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM
Sbjct  972   PDVDAETRMMFIEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  1031

Query  3040  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVG  3219
             DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLLLKRGG+EIYVG
Sbjct  1032  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQEIYVG  1091

Query  3220  PLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRR  3399
             PLGRHSS LI+YFE I G+ +I+DGYNPATWMLE+T+ AQE  LG+DF E+Y+NS+LYR 
Sbjct  1092  PLGRHSSHLIKYFEGIEGVSKIKDGYNPATWMLEVTTSAQELILGVDFTEIYKNSDLYRN  1151

Query  3400  NKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFN  3579
             NK L++ELS+P PGSKDLYFPT+YSQSFFTQCMACLWKQ WSYWRNPPYTAVR  FTTF 
Sbjct  1152  NKDLLKELSQPTPGSKDLYFPTQYSQSFFTQCMACLWKQRWSYWRNPPYTAVRFFFTTFI  1211

Query  3580  ALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAA  3759
             AL+FGTMFW +G +R  QQDL NAMG MYAAV+FLG QN  SVQPVV +ERTVFYRERAA
Sbjct  1212  ALMFGTMFWDLGTQRTRQQDLSNAMGSMYAAVIFLGFQNGQSVQPVVVVERTVFYRERAA  1271

Query  3760  GMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftl  3939
             GMYSA+PYAF Q ++E+P++F Q ++YG IVYAMIGFEWT AKF W+IFF +F+LLYFT 
Sbjct  1272  GMYSAMPYAFAQALVEIPYVFSQAVVYGAIVYAMIGFEWTTAKFFWYIFFTFFSLLYFTF  1331

Query  3940  yGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLI  4119
             +GMM VA TPN +IAAII++AFY  WNLFSGFIIP+TRIPVWWRWYY+ CPV+WTLYGL+
Sbjct  1332  FGMMAVAATPNQHIAAIIAAAFYALWNLFSGFIIPRTRIPVWWRWYYWACPVAWTLYGLV  1391

Query  4120  ASQFGDVKEK-LDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNF  4296
              SQ+GD++++ LDTN TVK ++  +F F+HDF+G VA +IVG  V+F FIFAFSIKAFNF
Sbjct  1392  TSQYGDIEDRLLDTNVTVKQYLDDYFGFEHDFLGVVAAVIVGFTVLFLFIFAFSIKAFNF  1451

Query  4297  QTR  4305
             Q R
Sbjct  1452  QRR  1454



>emb|CBI36226.3| unnamed protein product [Vitis vinifera]
Length=1537

 Score =  2058 bits (5332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1034/1443 (72%), Positives = 1228/1443 (85%), Gaps = 16/1443 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG EVFSR+S +  +++   LKWAA+EKLPTY R+R+G+L   E  G   E+D+  
Sbjct  103   IWRNSGAEVFSRTSGDEDDEEA--LKWAALEKLPTYNRMRKGLLMGSE--GEANEVDIHN  158

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+++L+ERLV+IA EDNE FLLKLK+R DRVGIDLP IEVRFEHL +DAEAYVGSR
Sbjct  159   LGLQERKNLVERLVKIADEDNEKFLLKLKNRIDRVGIDLPEIEVRFEHLTIDAEAYVGSR  218

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  N   N +E  +N L ILP+RKK   ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  219   ALPSFINSAFNQIEDILNALRILPSRKKKFTILHDVSGIIKPRRMTLLLGPPSSGKTTLL  278

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LAL+GKLDS LKV G VTYNGH M EFVP+RT+AYI+Q D HIGEMTVRETLAFSARCQG
Sbjct  279   LALSGKLDSSLKVMGSVTYNGHGMNEFVPQRTAAYISQLDTHIGEMTVRETLAFSARCQG  338

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+MLAELSRREK  NIKPDPDIDV+MKA++ EGQ+ +V+TDY LKILGLEVCAD +
Sbjct  339   VGDRYDMLAELSRREKSANIKPDPDIDVFMKAVAAEGQKENVITDYTLKILGLEVCADTM  398

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTT+QIVNS+RQ+IHI +G
Sbjct  399   VGDEMVRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLRQNIHIFKG  458

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY LFDDIILLSD Q+VYQGPR++VL+FF+ MGF+CPERKGVADFLQE
Sbjct  459   TALISLLQPAPETYNLFDDIILLSDSQIVYQGPREDVLDFFESMGFRCPERKGVADFLQE  518

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW+ ++E Y F+TV EF+EAFQSFH+G+KLGDELA PFDK+KSHPAA+  +
Sbjct  519   VTSRKDQEQYWICKDEPYSFVTVKEFAEAFQSFHIGRKLGDELATPFDKTKSHPAAMKTE  578

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKELL AC +RE+LLMKRNSFVYIFK+ QL +MA + MT+FLRTEM KN+  DG 
Sbjct  579   KYGVRKKELLDACIAREYLLMKRNSFVYIFKLTQLTIMAVIGMTIFLRTEMHKNTTEDGN  638

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF VI  MFNG SELA++I+KLP FYKQR L F+P WAYALP+W LKIP+T VE
Sbjct  639   IYTGALFFIVITVMFNGMSELAMTIVKLPVFYKQRGLLFYPAWAYALPSWFLKIPITFVE  698

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V +WV +TYY IGFDP+ GR F+Q  LL+ +NQ+AS+LFR  AAA R++I+ANTFG+ A+
Sbjct  699   VGVWVFITYYVIGFDPNVGRLFRQYLLLLLLNQVASSLFRFIAAASRNMIIANTFGTFAL  758

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTS-ETLGV  2157
             +L+  LGGF+LSR+++KKWWIW YW SPLMYAQNAI VNE+LGKSW    S TS E+LGV
Sbjct  759   LLLFALGGFVLSRENIKKWWIWVYWSSPLMYAQNAIVVNEFLGKSWSKNASTTSTESLGV  818

Query  2158  TVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNA  2337
             TVL+SRG F EAHW WIG GAL+G++F+ NF + +ALTYLNP  KPQA+++EE+    + 
Sbjct  819   TVLKSRGFFTEAHWCWIGAGALLGFIFVFNFFYTVALTYLNPFEKPQAVITEES----DN  874

Query  2338  CKRGEPIEL--ELKGG----STSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPF  2499
              K G  IEL    KG     +++++G  + RS+SS        ++  A+ N K+GMVLPF
Sbjct  875   AKTGGKIELSSHRKGSIDQTASTKRGGEIGRSISSTFSYVTEEAIAEANHNKKKGMVLPF  934

Query  2500  EPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLM  2679
             +P  ITFD+I+Y+VDMP EMK+QG+ ED+L LLKG++GAFRPGVLTALMG+SGAGKTTLM
Sbjct  935   QPHSITFDDIRYSVDMPEEMKSQGVLEDKLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  994

Query  2680  DVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLP  2859
             DVLAGRKTGGYIEG+I+ISGYPK+QETFARI GYCEQ DIHSPHVT++ESL+YSAWLRL 
Sbjct  995   DVLAGRKTGGYIEGNISISGYPKKQETFARICGYCEQNDIHSPHVTIHESLLYSAWLRLS  1054

Query  2860  PEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  3039
             P++D  TR MF+EEVM+LVELT LR+ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM
Sbjct  1055  PDVDAETRMMFIEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  1114

Query  3040  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVG  3219
             DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLLLKRGG+EIYVG
Sbjct  1115  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQEIYVG  1174

Query  3220  PLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRR  3399
             PLGRHSS LI+YFE I G+ +I+DGYNPATWMLE+T+ AQE  LG+DF E+Y+NS+LYR 
Sbjct  1175  PLGRHSSHLIKYFEGIEGVSKIKDGYNPATWMLEVTTSAQELILGVDFTEIYKNSDLYRN  1234

Query  3400  NKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFN  3579
             NK L++ELS+P PGSKDLYFPT+YSQSFFTQCMACLWKQ WSYWRNPPYTAVR  FTTF 
Sbjct  1235  NKDLLKELSQPTPGSKDLYFPTQYSQSFFTQCMACLWKQRWSYWRNPPYTAVRFFFTTFI  1294

Query  3580  ALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAA  3759
             AL+FGTMFW +G +R  QQDL NAMG MYAAV+FLG QN  SVQPVV +ERTVFYRERAA
Sbjct  1295  ALMFGTMFWDLGTQRTRQQDLSNAMGSMYAAVIFLGFQNGQSVQPVVVVERTVFYRERAA  1354

Query  3760  GMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftl  3939
             GMYSA+PYAF Q ++E+P++F Q ++YG IVYAMIGFEWT AKF W+IFF +F+LLYFT 
Sbjct  1355  GMYSAMPYAFAQALVEIPYVFSQAVVYGAIVYAMIGFEWTTAKFFWYIFFTFFSLLYFTF  1414

Query  3940  yGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLI  4119
             +GMM VA TPN +IAAII++AFY  WNLFSGFIIP+TRIPVWWRWYY+ CPV+WTLYGL+
Sbjct  1415  FGMMAVAATPNQHIAAIIAAAFYALWNLFSGFIIPRTRIPVWWRWYYWACPVAWTLYGLV  1474

Query  4120  ASQFGDVKEK-LDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNF  4296
              SQ+GD++++ LDTN TVK ++  +F F+HDF+G VA +IVG  V+F FIFAFSIKAFNF
Sbjct  1475  TSQYGDIEDRLLDTNVTVKQYLDDYFGFEHDFLGVVAAVIVGFTVLFLFIFAFSIKAFNF  1534

Query  4297  QTR  4305
             Q R
Sbjct  1535  QRR  1537



>emb|CBI36210.3| unnamed protein product [Vitis vinifera]
Length=1642

 Score =  2058 bits (5332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1020/1436 (71%), Positives = 1214/1436 (85%), Gaps = 35/1436 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WRSSG +VFSRSSR+  +++   LKWAA+EKLPTY R+RRG+L   E  G   EID+  
Sbjct  241   IWRSSGADVFSRSSRDEDDEEA--LKWAALEKLPTYNRLRRGLLMGSE--GEASEIDIHN  296

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EK++L+ERLV++A+EDNE FLLKLK+R DRVGID+P IEVRFEHL +DAEA+VGSR
Sbjct  297   LGFQEKKNLVERLVKVAEEDNEKFLLKLKNRIDRVGIDVPEIEVRFEHLTIDAEAFVGSR  356

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  NF  N LE  +N + ILP++K+   IL+DVSGIIKP R+TLLLGPPSSGKTTLL
Sbjct  357   ALPSFHNFIFNKLEGILNAVRILPSKKRKFTILNDVSGIIKPRRLTLLLGPPSSGKTTLL  416

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD +LKV GRVTYNGH M EFVP+RT+AYI+QHD HIGEMTVRETLAFSARCQG
Sbjct  417   LALAGKLDPNLKVMGRVTYNGHGMNEFVPQRTAAYISQHDTHIGEMTVRETLAFSARCQG  476

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+MLAELSRREK  NIKPDPD+DV+MKA + EGQ+ +VVTDY LKILGL++CAD +
Sbjct  477   VGDRYDMLAELSRREKAANIKPDPDLDVFMKAAATEGQKENVVTDYTLKILGLDICADTM  536

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTTFQI+NS++Q+IHIL G
Sbjct  537   VGDEMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTFQIINSLKQTIHILNG  596

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY LFDDIILLSD Q+VYQGPR++VLEFF+ +GFKCPERKG ADFLQE
Sbjct  597   TAVISLLQPAPETYNLFDDIILLSDSQIVYQGPREDVLEFFESIGFKCPERKGEADFLQE  656

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ QYW R++  Y F+TV EF+EAFQSFH+G+K+ DELA PFD++KSHPAAL+ K
Sbjct  657   VTSRKDQAQYWARKDVPYSFVTVKEFAEAFQSFHIGRKVADELASPFDRAKSHPAALTTK  716

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKELL A  SRE+LLMKRNSFVYIFK+ QL ++A +AMT+FLRTEM KNS  DG+
Sbjct  717   KYGVRKKELLDANMSREYLLMKRNSFVYIFKLTQLAVVAVIAMTLFLRTEMNKNSTEDGS  776

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF V+M MFNG +ELA++I KLP FYKQRD  F+P WAYALPTW+LKIP+T VE
Sbjct  777   IYTGALFFTVVMIMFNGMAELAMTIAKLPVFYKQRDFLFYPAWAYALPTWVLKIPITFVE  836

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV +TYY IGFDP+  R F+Q  LL+ VNQMAS LFR  AAAGR++IVA+TFG+ A+
Sbjct  837   VAVWVFITYYVIGFDPNVERLFRQYLLLLLVNQMASGLFRFIAAAGRNMIVASTFGAFAV  896

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             ++++ LGGFILS D+VKKWWIWGYW SPLMYAQNAI VNE+LGKSW    + ++E+LG+T
Sbjct  897   LMLMALGGFILSHDNVKKWWIWGYWSSPLMYAQNAIVVNEFLGKSWSKNVTNSTESLGIT  956

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL+SRG F +AHWYWIG GAL+G++F+ NF + L L YLNP  KPQA+++EE+   + A 
Sbjct  957   VLKSRGFFTDAHWYWIGAGALLGFIFVFNFFYTLCLNYLNPFEKPQAVITEESDNAKTA-  1015

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
                           T+E                 V ++   + N K+GMVLPF+P  ITF
Sbjct  1016  --------------TTEH---------------MVEAIAEGNHNKKKGMVLPFQPHSITF  1046

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+I+Y+VDMP EMK+QG  EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  1047  DDIRYSVDMPEEMKSQGALEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  1106

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+I+ISGYPK+QETFARI+GYCEQ DIHSPHVTV+ESL+YSAWLRLP ++++ T
Sbjct  1107  TGGYIEGNISISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPSDVNSET  1166

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELT LR+ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  1167  RKMFIEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1226

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLL+KRGG+EIYVGPLGRHSS
Sbjct  1227  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKRGGQEIYVGPLGRHSS  1286

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI YFE I G+ +I+DGYNPATWMLE+T+ AQE  LG+DF E+Y+NS+LYRRNK LI+E
Sbjct  1287  HLINYFEGIEGVSKIKDGYNPATWMLEVTTGAQEGTLGVDFTEIYKNSDLYRRNKDLIKE  1346

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS+PAPG+KDLYF T+YSQ FFTQ +ACLWKQ WSYWRNPPYTAVR LFTTF AL+FG +
Sbjct  1347  LSQPAPGTKDLYFATQYSQPFFTQFLACLWKQRWSYWRNPPYTAVRFLFTTFIALMFGLI  1406

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G +R  QQDL NAMG MYAAV+FLGVQNA SVQPV+ +ERTVFYRERAAGMYSALP
Sbjct  1407  FWDLGTRRTRQQDLLNAMGSMYAAVLFLGVQNAQSVQPVIVVERTVFYRERAAGMYSALP  1466

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQ ++E+P++F Q ++YGVIVY MIGFEWTA KF W++FFM+ TLLYFT YGMM VA
Sbjct  1467  YAFGQALVEIPYVFAQAVVYGVIVYGMIGFEWTATKFFWYLFFMFCTLLYFTFYGMMAVA  1526

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
              TPN +IA+II++ FY  WNLFSGFI+P+ RIPVWWRWY +ICPV+WTLYGL+ASQFGD+
Sbjct  1527  ATPNQHIASIIAATFYTLWNLFSGFIVPRNRIPVWWRWYCWICPVAWTLYGLVASQFGDI  1586

Query  4141  KEK-LDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +   L+ N+TVK F+  +F F HDF+G VA ++VG  V+F FIFA++IKAFNFQ R
Sbjct  1587  QSTLLENNQTVKQFLDDYFGFKHDFLGVVAAVVVGFVVLFLFIFAYAIKAFNFQKR  1642


 Score =   238 bits (606),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 143/182 (79%), Gaps = 3/182 (2%)
 Frame = +1

Query  739   MLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMI  918
             MLAEL+RREK  NIKPDPDIDV+MK       + SVVTD+I+KILGL++CADI+VGDEMI
Sbjct  1     MLAELARREKAANIKPDPDIDVFMKVRQKLLSKKSVVTDHIMKILGLDICADIMVGDEMI  60

Query  919   RGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISL  1098
             RGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTT+QIVNS+RQ+IHIL GTAVISL
Sbjct  61    RGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLRQTIHILNGTAVISL  120

Query  1099  LQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADF---LQEVTS  1269
             LQP  ETY+LFDDIILLSD + +  G ++N +E      F   E K    F   L EV +
Sbjct  121   LQPPLETYDLFDDIILLSDRKTLIGGGKENEVEENDEKFFTVSEGKDEKSFYRKLNEVEN  180

Query  1270  RK  1275
              K
Sbjct  181   EK  182


 Score = 62.4 bits (150),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 68/127 (54%), Gaps = 10/127 (8%)
 Frame = +1

Query  2839  SAWLRLPPEIDT---------ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKR  2991
             +A ++  P+ID          + + +  + +M ++ L    + +VG   + G+S  QRKR
Sbjct  11    AANIKPDPDIDVFMKVRQKLLSKKSVVTDHIMKILGLDICADIMVGDEMIRGISGGQRKR  70

Query  2992  LTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT-GRTVVCTIHQPSIDIFDA  3168
             +T    LV     +FMDE ++GLD+     ++ ++R T+     T V ++ QP ++ +D 
Sbjct  71    VTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLRQTIHILNGTAVISLLQPPLETYDL  130

Query  3169  FDELLLL  3189
             FD+++LL
Sbjct  131   FDDIILL  137



>ref|XP_010654722.1| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis 
vinifera]
Length=1424

 Score =  2058 bits (5331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1021/1437 (71%), Positives = 1215/1437 (85%), Gaps = 34/1437 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WRSSG +VFSRSSR+  +++   LKWAA+EKLPTY R+RRG+L   E  G   EID+  
Sbjct  20    IWRSSGADVFSRSSRDEDDEEA--LKWAALEKLPTYNRLRRGLLMGSE--GEASEIDIHN  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  EK++L+ERLV++A+EDNE FLLKLK+R DRVGID+P IEVRFEHL +DAEA+VGSR
Sbjct  76    LGFQEKKNLVERLVKVAEEDNEKFLLKLKNRIDRVGIDVPEIEVRFEHLTIDAEAFVGSR  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  NF  N LE  +N + ILP++K+   IL+DVSGIIKP R+TLLLGPPSSGKTTLL
Sbjct  136   ALPSFHNFIFNKLEGILNAVRILPSKKRKFTILNDVSGIIKPRRLTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD +LKV GRVTYNGH M EFVP+RT+AYI+QHD HIGEMTVRETLAFSARCQG
Sbjct  196   LALAGKLDPNLKVMGRVTYNGHGMNEFVPQRTAAYISQHDTHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+MLAELSRREK  NIKPDPD+DV+MKA + EGQ+ +VVTDY LKILGL++CAD +
Sbjct  256   VGDRYDMLAELSRREKAANIKPDPDLDVFMKAAATEGQKENVVTDYTLKILGLDICADTM  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTTFQI+NS++Q+IHIL G
Sbjct  316   VGDEMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTFQIINSLKQTIHILNG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY LFDDIILLSD Q+VYQGPR++VLEFF+ +GFKCPERKG ADFLQE
Sbjct  376   TAVISLLQPAPETYNLFDDIILLSDSQIVYQGPREDVLEFFESIGFKCPERKGEADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQ QYW R++  Y F+TV EF+EAFQSFH+G+K+ DELA PFD++KSHPAAL+ K
Sbjct  436   VTSRKDQAQYWARKDVPYSFVTVKEFAEAFQSFHIGRKVADELASPFDRAKSHPAALTTK  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKELL A  SRE+LLMKRNSFVYIFK+ QL ++A +AMT+FLRTEM KNS  DG+
Sbjct  496   KYGVRKKELLDANMSREYLLMKRNSFVYIFKLTQLAVVAVIAMTLFLRTEMNKNSTEDGS  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF V+M MFNG +ELA++I KLP FYKQRD  F+P WAYALPTW+LKIP+T VE
Sbjct  556   IYTGALFFTVVMIMFNGMAELAMTIAKLPVFYKQRDFLFYPAWAYALPTWVLKIPITFVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV +TYY IGFDP+  R F+Q  LL+ VNQMAS LFR  AAAGR++IVA+TFG+ A+
Sbjct  616   VAVWVFITYYVIGFDPNVERLFRQYLLLLLVNQMASGLFRFIAAAGRNMIVASTFGAFAV  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             ++++ LGGFILS D+VKKWWIWGYW SPLMYAQNAI VNE+LGKSW    + ++E+LG+T
Sbjct  676   LMLMALGGFILSHDNVKKWWIWGYWSSPLMYAQNAIVVNEFLGKSWSKNVTNSTESLGIT  735

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNA-  2337
             VL+SRG F +AHWYWIG GAL+G++F+ NF + L L YLNP  KPQA+++EE+   + A 
Sbjct  736   VLKSRGFFTDAHWYWIGAGALLGFIFVFNFFYTLCLNYLNPFEKPQAVITEESDNAKTAT  795

Query  2338  CKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCIT  2517
              +RGE +   +  G                            + N K+GMVLPF+P  IT
Sbjct  796   TERGEHMVEAIAEG----------------------------NHNKKKGMVLPFQPHSIT  827

Query  2518  FDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGR  2697
             FD+I+Y+VDMP EMK+QG  EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGR
Sbjct  828   FDDIRYSVDMPEEMKSQGALEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGR  887

Query  2698  KTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTA  2877
             KTGGYIEG+I+ISGYPK+QETFARI+GYCEQ DIHSPHVTV+ESL+YSAWLRLP ++++ 
Sbjct  888   KTGGYIEGNISISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPSDVNSE  947

Query  2878  TREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSG  3057
             TR+MF+EEVM+LVELT LR+ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSG
Sbjct  948   TRKMFIEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSG  1007

Query  3058  LDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHS  3237
             LDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDELLL+KRGG+EIYVGPLGRHS
Sbjct  1008  LDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKRGGQEIYVGPLGRHS  1067

Query  3238  SQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQ  3417
             S LI YFE I G+ +I+DGYNPATWMLE+T+ AQE  LG+DF E+Y+NS+LYRRNK LI+
Sbjct  1068  SHLINYFEGIEGVSKIKDGYNPATWMLEVTTGAQEGTLGVDFTEIYKNSDLYRRNKDLIK  1127

Query  3418  ELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGT  3597
             ELS+PAPG+KDLYF T+YSQ FFTQ +ACLWKQ WSYWRNPPYTAVR LFTTF AL+FG 
Sbjct  1128  ELSQPAPGTKDLYFATQYSQPFFTQFLACLWKQRWSYWRNPPYTAVRFLFTTFIALMFGL  1187

Query  3598  MFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSAL  3777
             +FW +G +R  QQDL NAMG MYAAV+FLGVQNA SVQPV+ +ERTVFYRERAAGMYSAL
Sbjct  1188  IFWDLGTRRTRQQDLLNAMGSMYAAVLFLGVQNAQSVQPVIVVERTVFYRERAAGMYSAL  1247

Query  3778  PYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTV  3957
             PYAFGQ ++E+P++F Q ++YGVIVY MIGFEWTA KF W++FFM+ TLLYFT YGMM V
Sbjct  1248  PYAFGQALVEIPYVFAQAVVYGVIVYGMIGFEWTATKFFWYLFFMFCTLLYFTFYGMMAV  1307

Query  3958  AVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGD  4137
             A TPN +IA+II++ FY  WNLFSGFI+P+ RIPVWWRWY +ICPV+WTLYGL+ASQFGD
Sbjct  1308  AATPNQHIASIIAATFYTLWNLFSGFIVPRNRIPVWWRWYCWICPVAWTLYGLVASQFGD  1367

Query  4138  VKEK-LDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             ++   L+ N+TVK F+  +F F HDF+G VA ++VG  V+F FIFA++IKAFNFQ R
Sbjct  1368  IQSTLLENNQTVKQFLDDYFGFKHDFLGVVAAVVVGFVVLFLFIFAYAIKAFNFQKR  1424



>emb|CBI20980.3| unnamed protein product [Vitis vinifera]
Length=1379

 Score =  2058 bits (5331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1033/1435 (72%), Positives = 1201/1435 (84%), Gaps = 74/1435 (5%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             + R+S VEVFSRSSRE  +++   LKWAA+EKLPT+LRI+RGIL   EE G  +EI+++ 
Sbjct  19    ILRNSSVEVFSRSSREEDDEEA--LKWAALEKLPTFLRIQRGILT--EEKGQTREINIKS  74

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E+++L++RLV+I   DNE FLLKLK R DRVG+D+PT+EVRFEHL VDAEAYVGSR
Sbjct  75    LGLPERKNLIQRLVKIDGHDNEKFLLKLKERIDRVGLDIPTVEVRFEHLTVDAEAYVGSR  134

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPTIFNF+ANILE F+NYLHILP+RKKP  ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  135   ALPTIFNFSANILEGFLNYLHILPSRKKPFSILHDVSGIIKPRRMTLLLGPPSSGKTTLL  194

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAG+L SDLKVSGRVTYNGH M EFVP+RTSAY +Q+DLH GEMTVRETL FSARCQG
Sbjct  195   LALAGRLGSDLKVSGRVTYNGHGMDEFVPQRTSAYTSQYDLHAGEMTVRETLDFSARCQG  254

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG   +MLAELSRREK  NIKPDPDID+YMKA ++EGQ+ SVVT+Y+LKILGLE+CAD L
Sbjct  255   VGGLSDMLAELSRREKAANIKPDPDIDIYMKAAALEGQKTSVVTEYMLKILGLEICADTL  314

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD M +GISGGQ+KRLTTGE+LVGPARALFMDEISTGLDSST FQIVNS+RQSIHIL G
Sbjct  315   VGDVMKQGISGGQKKRLTTGEILVGPARALFMDEISTGLDSSTAFQIVNSLRQSIHILNG  374

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY LFDDIILLSDG++VYQGP +NVLEFF +MGFKCPERKGVADFLQE
Sbjct  375   TALISLLQPAPETYNLFDDIILLSDGKIVYQGPCENVLEFFGYMGFKCPERKGVADFLQE  434

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW R++E Y ++TV EF+EAFQSFH+G+KLG  L                 
Sbjct  435   VTSRKDQEQYWARKDEPYSYVTVKEFAEAFQSFHIGQKLGIHL-----------------  477

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
                                  KRNSF        L+++AF+ MT+FLRTEM +N++ DG 
Sbjct  478   ---------------------KRNSF--------LIIVAFINMTLFLRTEMSRNTVEDGG  508

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             +FMGALFFAV+M MFNGF+EL ++I +LP FYKQRDL FFP WAY+LP WILK+P+   E
Sbjct  509   IFMGALFFAVLMIMFNGFTELPMTIFQLPVFYKQRDLLFFPSWAYSLPKWILKMPIAFAE  568

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V  WV MTYY IGFDP+  RFFKQ  LL+C++QMAS L RL AA GR++IVANTFGS A+
Sbjct  569   VGAWVIMTYYVIGFDPNIERFFKQYLLLLCIHQMASGLLRLMAALGRNIIVANTFGSFAL  628

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             ++V+VLGGF+LS+DDVK WW WGYW+SPLMY QNAISVNE+LG SWRHVP+ ++E+LGV 
Sbjct  629   LVVMVLGGFVLSKDDVKTWWEWGYWVSPLMYGQNAISVNEFLGNSWRHVPANSTESLGVL  688

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             VL++RG+F E HWYW+GVGAL+GYV L NFLF LAL+YLNP GK Q +LS+ETL E+ A 
Sbjct  689   VLKARGVFTEPHWYWLGVGALIGYVLLFNFLFTLALSYLNPFGKSQPILSKETLTEKQAN  748

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             +  E IEL   G  T                         AD + KRGMVLPFEPL I+F
Sbjct  749   RTEELIELSPVGSITE------------------------ADQSRKRGMVLPFEPLSISF  784

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEI+YAVDMP EMKAQG+TEDRL LL+G++G+FRPG+LTALMG++GAGKTTLMDVLAGRK
Sbjct  785   DEIRYAVDMPQEMKAQGITEDRLELLRGVSGSFRPGILTALMGVTGAGKTTLMDVLAGRK  844

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             T GYIEG I + GYPK+QETFAR+ GYCEQTDIHSPHVTVYESL+YSAWLRLP E+D+AT
Sbjct  845   TSGYIEGIIKVYGYPKKQETFARVLGYCEQTDIHSPHVTVYESLLYSAWLRLPSEVDSAT  904

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVEL SLREALVGLP  NGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  905   RKMFIEEVMELVELNSLREALVGLPSENGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  964

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIY GP+GRHSS
Sbjct  965   DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYAGPIGRHSS  1024

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE ING+ +I+DGYNP+TWMLE+TS AQE ALG++F E Y+NSELYRRNKALI+E
Sbjct  1025  HLIKYFEGINGVSKIKDGYNPSTWMLEVTSAAQEVALGVNFTEEYKNSELYRRNKALIKE  1084

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PGSKDLYF T+YSQSFFTQC+ACLWKQHWSYWRNP YTAVRL FTTF AL+ GT+
Sbjct  1085  LSSPPPGSKDLYFSTQYSQSFFTQCLACLWKQHWSYWRNPAYTAVRLFFTTFIALMLGTI  1144

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW  G KR+ QQDLFNAMG MYAAV+ +G+QNA+SVQ VVAIERTVFYRERAAGMYS  P
Sbjct  1145  FWDFGSKRKRQQDLFNAMGSMYAAVISIGIQNASSVQAVVAIERTVFYRERAAGMYSPFP  1204

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV+IELPH+F+QT+IYG+IVYAM+GFEWT  KF W++FFMYFT LYFT YGMM VA
Sbjct  1205  YAFGQVMIELPHIFIQTIIYGLIVYAMVGFEWTVTKFFWYLFFMYFTFLYFTFYGMMAVA  1264

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPN +I+ I+SSAFYG WNLFSGFIIP TRIPVWW+WY++ CPVSWTLYGL+ +QFGD+
Sbjct  1265  ITPNQHISGIVSSAFYGLWNLFSGFIIPHTRIPVWWKWYFWSCPVSWTLYGLLVTQFGDI  1324

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             KE+L++ E V+DFV+S+F + +DFVG VA I+VGI V+FGFIFA+SI+AFNFQ R
Sbjct  1325  KERLESGERVEDFVRSYFGYRNDFVGVVAGIVVGITVLFGFIFAYSIRAFNFQKR  1379



>ref|XP_002514347.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF48301.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1448

 Score =  2058 bits (5331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1019/1441 (71%), Positives = 1228/1441 (85%), Gaps = 10/1441 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ +E FS+SSR   +++   L WAA+EKLPTY R+RRGIL   E+ G  +EI+V  
Sbjct  12    IWRNNSMEAFSKSSRHEDDEEA--LLWAALEKLPTYSRVRRGILC--EKDGQSREIEVNS  67

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             L + EKR+LL+RLV+IA+EDNE+FLLKLK R  +VG+++P IEVRFE LNV+AEAYVGSR
Sbjct  68    LDLIEKRNLLDRLVKIAEEDNENFLLKLKDRIHKVGLEMPKIEVRFEDLNVEAEAYVGSR  127

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
              LP+++N + N+LE  ++YLHILP+RKK LPIL  V+GIIKP R+TLLLGPPSSGKTTLL
Sbjct  128   GLPSMYNLSVNMLEGLLDYLHILPSRKKTLPILRGVTGIIKPQRITLLLGPPSSGKTTLL  187

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SG+VTYNGH M EFVP+RTSAYI+Q+DLHIGE+TVRETLAFSARCQG
Sbjct  188   LALAGKLGKDLKFSGKVTYNGHGMQEFVPQRTSAYISQYDLHIGELTVRETLAFSARCQG  247

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
              G RY+ML EL+RREK  NIKPD DID+YMKA ++EGQ  ++VTDY+LKILGLEVCAD +
Sbjct  248   TGTRYDMLEELARREKAANIKPDSDIDIYMKAAALEGQGTNLVTDYVLKILGLEVCADTM  307

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQ+KR+TTGEMLVGPARALFMDEISTGLDSSTTFQIVNS+RQSI  L G
Sbjct  308   VGDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSLRQSIQFLNG  367

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETYELFD+II LS+GQ+VYQGPR+ VLEFF++MGFKCP RKGVADFLQE
Sbjct  368   TALISLLQPAPETYELFDEIIFLSEGQIVYQGPREKVLEFFEYMGFKCPVRKGVADFLQE  427

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS +DQEQYW  +++ Y F++V EF+EAFQSFH+G+KL DELA PFDKSKSHPAAL+ K
Sbjct  428   VTSMQDQEQYWAWKDQPYRFVSVKEFAEAFQSFHIGQKLVDELATPFDKSKSHPAALTTK  487

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+KK+LLKAC SREFLLMKRNSF YIFK +QL+LMAF+ MT+FLRTEM +N+ ADG+
Sbjct  488   KYGVSKKQLLKACMSREFLLMKRNSFAYIFKTLQLILMAFLTMTMFLRTEMHRNTQADGS  547

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF V+ TMFNGFSELA++++KLP FYKQRDL F+P WAYALP WILKIP+T  E
Sbjct  548   IYFGALFFGVMTTMFNGFSELAMTVVKLPIFYKQRDLLFYPSWAYALPAWILKIPITFAE  607

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             +AIWV +TYY +GFDP+  RFFKQ  +L+  NQMAS+LFRL AA GR++IV NT    ++
Sbjct  608   IAIWVILTYYVVGFDPNIERFFKQYLILVMTNQMASSLFRLIAAVGRNIIVVNTVAIFSL  667

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             + VLVL GFILSRDDVKKWWIWGYWISP+MY QN I+VNEYLGKSW H P  ++E LGV 
Sbjct  668   LAVLVLSGFILSRDDVKKWWIWGYWISPMMYVQNGITVNEYLGKSWNHFPPNSTEALGVA  727

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
              L+SRGIFPEA+WYWIGVGAL GY FL NFL  LAL YL+P  K +A ++EE  + ++  
Sbjct  728   FLKSRGIFPEAYWYWIGVGALTGYTFLFNFLVALALNYLDPFEKLKAKVAEEGFSGKDIS  787

Query  2341  KRGEPIELEL------KGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFE  2502
               GE +EL         G   + +G  ++R++SSR  S+RV +    + ++K+G +LPF+
Sbjct  788   GNGEFMELSRGRKNPSNGSHDTGRGKTIQRNISSRIASARVSNFTNGNQDLKQGKILPFQ  847

Query  2503  PLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMD  2682
             PL ITF++IKYAVDMP EMKAQG+TEDRL LLKG++GAFRPGVLTALMG SGAGKTTLMD
Sbjct  848   PLSITFEDIKYAVDMPQEMKAQGITEDRLQLLKGVSGAFRPGVLTALMGASGAGKTTLMD  907

Query  2683  VLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPP  2862
             VLAGRKTGGYIEG I ISGYPK+QETF RI+GYCEQTDIHSPHVTVYESLVYSAWLRLP 
Sbjct  908   VLAGRKTGGYIEGKIMISGYPKKQETFTRISGYCEQTDIHSPHVTVYESLVYSAWLRLPA  967

Query  2863  EIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMD  3042
             E++++ R+MF+EEVM LVELT +R+ LVGLPGVNGLS EQRKRLTIAVELVANPSIIFMD
Sbjct  968   EVNSSARKMFIEEVMALVELTPIRKELVGLPGVNGLSIEQRKRLTIAVELVANPSIIFMD  1027

Query  3043  EPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGP  3222
             EPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDEL LLKRGGEEIYVGP
Sbjct  1028  EPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKRGGEEIYVGP  1087

Query  3223  LGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRN  3402
             +G+H+  LIRYFE I G+ +I+DGYNPATWMLE+T+ AQE A G++F+ +Y+NSELYRRN
Sbjct  1088  VGQHAHHLIRYFEEIEGVPKIKDGYNPATWMLEVTTAAQEVAFGVNFSNIYKNSELYRRN  1147

Query  3403  KALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNA  3582
             KA ++ELS+P PGSKDL+FP++++Q   TQC+ACLWKQH SYWRNP Y +VRLLFTT  A
Sbjct  1148  KAFLKELSRPPPGSKDLHFPSQFAQPLLTQCIACLWKQHLSYWRNPTYASVRLLFTTLIA  1207

Query  3583  LLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAG  3762
             L+ GT+FW +G KR  Q ++FNAMG MY+AV+FLG  N + VQPVV +ERT++YR+RAAG
Sbjct  1208  LMMGTVFWNLGSKRGRQLEIFNAMGSMYSAVLFLGFLNTSLVQPVVDMERTIYYRDRAAG  1267

Query  3763  MYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftly  3942
             MYSA PYAFGQVVIE P++ VQT+IYGVIVYAM+GFEWT +KF W++FFMYFT LY TLY
Sbjct  1268  MYSAFPYAFGQVVIEFPYILVQTIIYGVIVYAMMGFEWTVSKFFWYLFFMYFTFLYLTLY  1327

Query  3943  GMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIA  4122
             GM+T AV+PN+NIAAIIS++FY  WN+FSGF++P+TR+PVWWRW Y++CP++WTLYGL+A
Sbjct  1328  GMITAAVSPNYNIAAIISNSFYFMWNMFSGFVVPRTRMPVWWRWNYWLCPIAWTLYGLVA  1387

Query  4123  SQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQT  4302
             SQ+GDVKE LDT ETV++F++S+F F HDFVG VA ++VG+ V+FGFIFAFSIK  NFQ 
Sbjct  1388  SQYGDVKEPLDTGETVEEFLRSYFGFRHDFVGVVAAVLVGMNVLFGFIFAFSIKLLNFQN  1447

Query  4303  R  4305
             R
Sbjct  1448  R  1448



>ref|XP_006465412.1| PREDICTED: pleiotropic drug resistance protein 1-like [Citrus 
sinensis]
Length=1454

 Score =  2057 bits (5330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 996/1418 (70%), Positives = 1201/1418 (85%), Gaps = 10/1418 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             L WAA+EKLPTY R+++GIL A    G   E+DV KLG+ E++ L+++LV++A  DNE  
Sbjct  40    LIWAALEKLPTYNRLKKGILTAST--GAANEVDVHKLGLLERQRLIDKLVKVADVDNEQL  97

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVGI LP IEVRFEHLNV+AEAYVG RALPT FNF AN++E F+N LHILP
Sbjct  98    LLKLKNRVDRVGISLPEIEVRFEHLNVEAEAYVGGRALPTFFNFCANLIEGFLNSLHILP  157

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKK   IL DV+GI+KP+R+TLLLGPP+SGKTTLLLALAGKLD  LK+SGRVTYNGH M
Sbjct  158   SRKKKFTILKDVNGIVKPSRLTLLLGPPASGKTTLLLALAGKLDPSLKLSGRVTYNGHNM  217

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+QHD+HIGEMTVRETLAFSARCQGVG RY+ML ELSRREK+ NIKPDP
Sbjct  218   DEFVPQRTAAYISQHDVHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKDANIKPDP  277

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA++ EGQEASVVTDY++K+LGL+VCAD +VGDEM+RGISGGQRKR+TTGEMLV
Sbjct  278   DIDVFMKALATEGQEASVVTDYVIKVLGLDVCADTMVGDEMLRGISGGQRKRVTTGEMLV  337

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA  LFMDEISTGLDSSTTFQIV S+RQ IHIL GTAVISLLQPAPETY+LFDDIIL+S
Sbjct  338   GPALVLFMDEISTGLDSSTTFQIVTSLRQIIHILNGTAVISLLQPAPETYDLFDDIILIS  397

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             +GQ+VYQGPR++VLEFF+ MGF+CP+RKGVADFLQEVTS+KDQ+QYW+R+EE Y F+TV 
Sbjct  398   EGQIVYQGPREHVLEFFKSMGFECPKRKGVADFLQEVTSKKDQQQYWVRKEEPYRFVTVK  457

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EFS+AFQ FHVG+KLGD L  PFDKSKSHPAAL+ K YG+NKKELLKAC SRE LLMKRN
Sbjct  458   EFSDAFQEFHVGQKLGDGLGTPFDKSKSHPAALTTKSYGINKKELLKACISRELLLMKRN  517

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK+IQL +   ++MT+F RT+M ++S+ +G +++GALFF +IM  FNG +EL++S
Sbjct  518   SFVYIFKLIQLTITGVISMTLFFRTKMHRDSVTNGGIYVGALFFTIIMITFNGMAELSMS  577

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQRDL F+P WAY LPTWILK+P+  VEVA+WV + YY IGFDP+ GR FKQ
Sbjct  578   IAKLPVFYKQRDLRFYPAWAYGLPTWILKVPIAFVEVAVWVILNYYVIGFDPNIGRAFKQ  637

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ VNQM+S LFRL AA GRS++VANTFGS AM+++  LGGF+LSR+D+KKWW W Y
Sbjct  638   YLLLVLVNQMSSGLFRLMAATGRSMVVANTFGSFAMLVLFALGGFVLSREDIKKWWKWAY  697

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W SPLMYAQN ++VNE+LG SW+ V   ++E LGV VL+SRG F +A+WYW+G+  L G 
Sbjct  698   WCSPLMYAQNGLAVNEFLGNSWQKVLPNSTEPLGVEVLKSRGFFTDAYWYWLGMAGLAGS  757

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTS------EK  2394
             + L NF F LAL++LNP G  QA++SEE+ +     + G  ++L   G S+S      E 
Sbjct  758   ILLFNFGFILALSFLNPFGS-QAVISEESQSNECDNRTGGTLQLSTCGSSSSHLTQSDES  816

Query  2395  gnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGL  2574
              + +RR  S+    S       A+   + GMVLPFEPL +TF+++ Y+VDMP EMK QG+
Sbjct  817   RDNIRRRNSTSQSLSLTEEDIAANQPKRSGMVLPFEPLSLTFEDVVYSVDMPQEMKLQGV  876

Query  2575  TEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQ  2754
              +D+LVLL G++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYI G+I ISGYPK+Q
Sbjct  877   LDDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNIKISGYPKKQ  936

Query  2755  ETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLR  2934
             ETFARI+GYCEQ DIHSP+VTVYESL+YSAWLRLPP++D+ TR MF+EE+M+LVEL  LR
Sbjct  937   ETFARISGYCEQNDIHSPNVTVYESLLYSAWLRLPPDVDSETRRMFLEEIMELVELNPLR  996

Query  2935  EALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  3114
             ++LVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT
Sbjct  997   QSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  1056

Query  3115  GRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDG  3294
             GRTVVCTIHQPSIDIF+AFDEL L+KRGG EIYVGPLGRHSS LI YFE I G+ +I+DG
Sbjct  1057  GRTVVCTIHQPSIDIFEAFDELFLMKRGGYEIYVGPLGRHSSHLISYFEAIPGVNKIKDG  1116

Query  3295  YNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYS  3474
             YNPATWMLE++S +QE ALG+DF ++Y+ SELYRRNKALI+ELSKPAPGS+DLYFPT+YS
Sbjct  1117  YNPATWMLEVSSSSQELALGVDFTDIYKGSELYRRNKALIEELSKPAPGSRDLYFPTQYS  1176

Query  3475  QSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAM  3654
             QSFFTQCMACLWKQHWSYWRNPPYTAVR LFTT  AL+FG++FW +G K   +QDLFNAM
Sbjct  1177  QSFFTQCMACLWKQHWSYWRNPPYTAVRFLFTTAIALMFGSLFWDLGTKTSKRQDLFNAM  1236

Query  3655  GCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTL  3834
             G MY AV FLGVQN++SVQPVVA+ER VFYRE+AAGMYS++ YAF QV+IE+PH+FVQ +
Sbjct  1237  GSMYTAVQFLGVQNSSSVQPVVAVERAVFYREKAAGMYSSMAYAFAQVLIEIPHVFVQAV  1296

Query  3835  IYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGF  4014
             +YGVIVYAMIGFEWTA KF+W+IFFM+++ L FT YGMM VA+TPN +IA ++S AFYG 
Sbjct  1297  VYGVIVYAMIGFEWTAVKFIWYIFFMFWSFLLFTFYGMMCVAMTPNLHIATVVSIAFYGI  1356

Query  4015  WNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKE-KLDTNETvkdfvksf  4191
             WN+FSGFIIP+TRIP+WWRWYY+  P++WTLYGL+ASQFGD+ + +L++ ETVK F++S+
Sbjct  1357  WNVFSGFIIPRTRIPIWWRWYYWANPIAWTLYGLVASQFGDIDDTRLESGETVKQFLRSY  1416

Query  4192  fdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             F F HDF+G +A + V   V+F F+FA  IKAFNFQ R
Sbjct  1417  FGFKHDFLGVIAAVHVAFTVLFVFVFALGIKAFNFQRR  1454



>ref|XP_004506879.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cicer 
arietinum]
Length=1434

 Score =  2056 bits (5327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1026/1437 (71%), Positives = 1212/1437 (84%), Gaps = 24/1437 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDV-E  177
             VWR+S ++ FS+SSR   +D+E  LKWAA+EKLPTY R+R+G+LA     G   EID+  
Sbjct  20    VWRNSTMDAFSKSSRHEEDDEEA-LKWAALEKLPTYNRLRKGLLATSR--GVVHEIDILT  76

Query  178   KLGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGS  357
              LG  E++ LL+RL+ +A+EDNE FLLKLK R DRVGI++PTIEVR+EHL ++AEAYVG 
Sbjct  77    DLGFQERQKLLDRLINVAEEDNEKFLLKLKERIDRVGIEIPTIEVRYEHLIIEAEAYVGG  136

Query  358   RALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttl  537
             RALPT  N   N LE+    LHIL ++KK + IL DVSGI+KP RMTLLLGPPSSGKTTL
Sbjct  137   RALPTFMNSITNTLESIFTSLHILKSKKKHMTILKDVSGIVKPQRMTLLLGPPSSGKTTL  196

Query  538   llalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQ  717
             LLAL+GKLD +LKVSGRVTYNGHEM EFVP+RT+AYI+QHD+HIGEMTVRETLAFSARCQ
Sbjct  197   LLALSGKLDPNLKVSGRVTYNGHEMEEFVPQRTAAYISQHDVHIGEMTVRETLAFSARCQ  256

Query  718   GVGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADI  897
             GVG RY++L+ELSRREKE  IKPD DIDV+MKA+S  GQ+ SVVTDY+LK+LGL+VCAD 
Sbjct  257   GVGSRYDLLSELSRREKEAKIKPDQDIDVFMKAVSTGGQQESVVTDYVLKLLGLDVCADT  316

Query  898   LVGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQ  1077
             +VGDEM+RGISGGQRKR+TTGEMLVGPA ALFMDEISTGLDSSTTFQIV S++Q +HIL 
Sbjct  317   MVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDSSTTFQIVRSLKQYVHILN  376

Query  1078  GTAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQ  1257
             GTAVISLLQPAPETYELFDDI+LLSDG++VYQGPR+ VL+FF+ +GFKCP+RKGVADFLQ
Sbjct  377   GTAVISLLQPAPETYELFDDIVLLSDGEIVYQGPRELVLDFFESLGFKCPDRKGVADFLQ  436

Query  1258  EVTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSN  1437
             EVTS+KDQEQYW+ +E+ Y F+TV +F+EAFQSFHVG+++GDELA+PFDKSKSHPAAL+ 
Sbjct  437   EVTSKKDQEQYWVHKEKPYRFVTVTQFAEAFQSFHVGRRIGDELAIPFDKSKSHPAALNT  496

Query  1438  KKYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADG  1617
             KKYGVNKKELLKA  SRE+LLMKRNSFVYIFK+ QL+LMA V MT+FLRTEM ++++ DG
Sbjct  497   KKYGVNKKELLKANFSREYLLMKRNSFVYIFKICQLILMATVTMTLFLRTEMHRDTLNDG  556

Query  1618  TVFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLV  1797
              V+ GA+FF V+M MFNG SEL+++I KLP+FYKQRDL FFPPWAYA+PTWILKIPVT V
Sbjct  557   GVYAGAIFFTVVMLMFNGLSELSMTIAKLPSFYKQRDLLFFPPWAYAIPTWILKIPVTFV  616

Query  1798  EVAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCA  1977
             EVA+WV +TYY IGFDP+  RF KQ  LL+ +NQMAS LFR  AA GR++IVANTFGS A
Sbjct  617   EVAVWVFLTYYVIGFDPNVARFLKQYILLLLINQMASGLFRAIAALGRNMIVANTFGSFA  676

Query  1978  MILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGV  2157
             ++ +L LGGFILS+ D+K WWIWGYWISPLMY QNAI VNE+LG SW H    +++TLG+
Sbjct  677   LLALLTLGGFILSKKDIKGWWIWGYWISPLMYGQNAIMVNEFLGDSWNHFTPNSNKTLGI  736

Query  2158  TVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNA  2337
              +L SRG F +A+WYWIG+GAL G++ L N  F +ALTYLNP  KPQA ++EE+     +
Sbjct  737   QILESRGFFTDAYWYWIGIGALTGFMLLFNVAFTVALTYLNPFDKPQATINEES---EGS  793

Query  2338  CKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCIT  2517
                G   E+EL   ++S +   V                  +    KRGMVLPFEP  IT
Sbjct  794   TPNGIAQEVELPQLASSGESYNVVD----------------SSQKKKRGMVLPFEPHSIT  837

Query  2518  FDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGR  2697
             FDE+ Y+VDMP EMK QG+ EDRLVLLKG+NGAFRPGVLTALMG+SGAGKTTLMDVLAGR
Sbjct  838   FDEVVYSVDMPQEMKVQGVIEDRLVLLKGVNGAFRPGVLTALMGVSGAGKTTLMDVLAGR  897

Query  2698  KTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTA  2877
             KTGGYI+GSI ISGY KRQETFARI+GYCEQ DIHSPHVTVYESL+YSAWLRL  E+D+ 
Sbjct  898   KTGGYIDGSIKISGYLKRQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLSAEVDSN  957

Query  2878  TREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSG  3057
             TR+MF+EEVM+LVEL  LR +LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSG
Sbjct  958   TRKMFIEEVMELVELNPLRNSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSG  1017

Query  3058  LDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHS  3237
             LDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGG+EIYVGPLGRHS
Sbjct  1018  LDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHS  1077

Query  3238  SQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQ  3417
             SQLI+YFE+I G+ +I+DGYNPATWMLE+TS AQE  LG+DF ++YRNSELYRRNK LI+
Sbjct  1078  SQLIKYFESIEGVHKIKDGYNPATWMLEVTSSAQELTLGVDFHDIYRNSELYRRNKQLIE  1137

Query  3418  ELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGT  3597
             EL KPA GSKDL+F T+YSQSF  QC+ACLWKQHWSYWRNPPYTAVR  FTTF AL+FGT
Sbjct  1138  ELGKPAIGSKDLHFSTQYSQSFLVQCLACLWKQHWSYWRNPPYTAVRFFFTTFIALMFGT  1197

Query  3598  MFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSAL  3777
             MFW +G K   +QDLFNA+G MY +V+FLGVQN++SVQPVVA+ER+VFYRERAAGMYSAL
Sbjct  1198  MFWNLGRKYSNRQDLFNALGSMYTSVLFLGVQNSSSVQPVVAVERSVFYRERAAGMYSAL  1257

Query  3778  PYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTV  3957
             PYAF QV+IELP++F Q   YGVIVYAMIGFEWT AKF W+IFFMYFTL YFT YGMM V
Sbjct  1258  PYAFAQVIIELPYIFAQATSYGVIVYAMIGFEWTLAKFFWYIFFMYFTLCYFTFYGMMAV  1317

Query  3958  AVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGD  4137
             AVTPNH++A+I++SAFY  WNLFSGFI+P+  IPVWWRWYY+ CPVSWT+YGL+ASQFGD
Sbjct  1318  AVTPNHHVASIVASAFYAIWNLFSGFIVPRPMIPVWWRWYYWACPVSWTIYGLVASQFGD  1377

Query  4138  VKEKLDT-NETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             + + +++ N+ V++F++S+FDF HDF+G  A ++VG  V+F  IFA SIK FNFQ R
Sbjct  1378  INKIMESENKPVQEFLRSYFDFKHDFIGVCAVVVVGTAVLFACIFAVSIKVFNFQKR  1434



>ref|XP_008775867.1| PREDICTED: pleiotropic drug resistance protein TUR2-like isoform 
X2 [Phoenix dactylifera]
Length=1447

 Score =  2056 bits (5326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 998/1414 (71%), Positives = 1202/1414 (85%), Gaps = 10/1414 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPTY R+R+GIL      G   EIDVE LG  E+++L+ERLVR+A+EDNE F
Sbjct  41    LKWAALEKLPTYNRMRKGILTGAT--GERMEIDVENLGFQERKNLMERLVRVAEEDNEKF  98

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK R DRVGI+ PTIEVRFE+L V AEA VG+  +PT+ NF AN +E  +N L+ILP
Sbjct  99    LLKLKSRLDRVGIENPTIEVRFENLEVHAEALVGNSGVPTVINFFANNIEGLLNSLYILP  158

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK+P+ IL+D+SG+IKP+RMTLLLGPPSSGKTT+L ALAGKLD+ LKVSGRVTYNGH M
Sbjct  159   SRKRPMTILNDISGVIKPSRMTLLLGPPSSGKTTMLRALAGKLDTSLKVSGRVTYNGHGM  218

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI+QHDLH+GEMTVRETLAFSARCQGVG RYEML ELSRREK  NIKPDP
Sbjct  219   DEFVPQRTSAYISQHDLHLGEMTVRETLAFSARCQGVGTRYEMLTELSRREKAANIKPDP  278

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDVYMKAIS+EGQE SVVTDYILKILGL++CAD +VGD M+RGISGGQ+KR+TTGEMLV
Sbjct  279   DIDVYMKAISVEGQE-SVVTDYILKILGLDICADTMVGDAMLRGISGGQKKRVTTGEMLV  337

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQIVNS+RQS+HIL GTA+I+LLQPAPETY+LFDDIILLS
Sbjct  338   GPARALFMDEISTGLDSSTTFQIVNSLRQSVHILGGTALIALLQPAPETYDLFDDIILLS  397

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             +GQ+VYQGPR++VLEFF+ MGF+CPERKGVADFLQEVTSRKDQ+QYW RR+E Y FI V 
Sbjct  398   EGQIVYQGPREHVLEFFESMGFRCPERKGVADFLQEVTSRKDQQQYWARRDEPYRFIPVK  457

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF++AF SFHVG++L  EL+ PFDKS++HPAAL+  +YG++K+ELLKAC +REFLLMKRN
Sbjct  458   EFADAFLSFHVGRRLEIELSTPFDKSRNHPAALTTSRYGISKRELLKACMAREFLLMKRN  517

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK+ QL L+A +AMTVFLRT+M  +   DG V+MGALF  +I  +FNGF+ELA+S
Sbjct  518   SFVYIFKLFQLCLIATIAMTVFLRTKMGHSDTEDGLVYMGALFIGIITHLFNGFAELAMS  577

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQRDL F+P WAYALP WILKIP++ +E  ++V MTYY IGFDP+  R F+Q
Sbjct  578   IAKLPVFYKQRDLLFYPGWAYALPAWILKIPISFLECGLYVAMTYYVIGFDPNVQRMFRQ  637

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               +   V+QMAS LFRL AA GR ++VANTFGS A ++++VLGGF++SR D++KWWIWGY
Sbjct  638   FLIFALVSQMASGLFRLLAACGREMVVANTFGSFAQLVLIVLGGFVISRKDIRKWWIWGY  697

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGT--SETLGVTVLRSRGIFPEAHWYWIGVGALV  2226
             W SPLMYAQNAI+VNE+LGK WR+V + T  +ETLGV VL SRG+FP+A WYWIGVGAL+
Sbjct  698   WSSPLMYAQNAIAVNEFLGKKWRYVVNATASTETLGVQVLESRGLFPQAKWYWIGVGALL  757

Query  2227  GYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvv  2406
             GY+ + NF F +AL+YL+P+GK Q ++SEE L E+ A + GE +EL  +  ++S      
Sbjct  758   GYIVVFNFFFTVALSYLDPIGKGQTVISEEALKEKQANRTGESVELPTRERNSSHPSEAR  817

Query  2407  rrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDR  2586
                  +  +         A+ N ++GMVLPF PL +TFD++KY+VDMP EMKAQG+TEDR
Sbjct  818   GSGSRTTGMEISTE----ANQNRRKGMVLPFVPLSLTFDDVKYSVDMPQEMKAQGVTEDR  873

Query  2587  LVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFA  2766
             L LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYIEGSI ISGYPK+QETFA
Sbjct  874   LELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGSIKISGYPKKQETFA  933

Query  2767  RIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALV  2946
             RI+GYCEQ DIHSPHVT+YESLVYSAWLRLPPE+D++ R+MF+EEVM+LVELT LR+A+V
Sbjct  934   RISGYCEQNDIHSPHVTIYESLVYSAWLRLPPEVDSSRRKMFIEEVMELVELTPLRKAMV  993

Query  2947  GLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV  3126
             GLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV
Sbjct  994   GLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV  1053

Query  3127  VCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPA  3306
             VCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLG +S +LI+YFE I+G+ +I+DGYNPA
Sbjct  1054  VCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGHNSCELIKYFEGISGVAKIKDGYNPA  1113

Query  3307  TWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFF  3486
             TWMLE+TS AQE  LG++F EVY+NS+L+RRNKALIQELS P PGSKDLYFP +Y+Q   
Sbjct  1114  TWMLEVTSMAQEEILGVNFVEVYKNSDLFRRNKALIQELSTPPPGSKDLYFPAQYAQPSL  1173

Query  3487  TQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMY  3666
              QC+AC WKQ+ SYWRNP Y A+RL FTT  AL+FGT+FW +G K  TQQDLFNA G MY
Sbjct  1174  IQCIACFWKQYKSYWRNPSYNAIRLFFTTVIALMFGTIFWRLGSKTTTQQDLFNATGSMY  1233

Query  3667  AAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGV  3846
              AV+F+G+QN+ +VQP+V +ERTVFYRE+AAGMYSALPYAF QV IE+P+ F+QT++YG+
Sbjct  1234  CAVMFIGIQNSQTVQPIVDVERTVFYREKAAGMYSALPYAFAQVAIEIPYTFLQTVVYGL  1293

Query  3847  IVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLF  4026
             +VY+MI F+WTAAKF+W+IFFM+FT LYFT YGMM VA+TPN NIAAI+S+AFY  WNLF
Sbjct  1294  LVYSMINFDWTAAKFMWYIFFMFFTFLYFTYYGMMAVALTPNSNIAAIVSTAFYAIWNLF  1353

Query  4027  SGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKE-KLDTNETvkdfvksffdfd  4203
             +GF+IP+ RIPVWWRWYY+ CP+SWTLYGL+ASQFGD+ +  +DT ETVK FV+ +F ++
Sbjct  1354  AGFVIPRPRIPVWWRWYYWACPISWTLYGLLASQFGDMGDTTMDTGETVKHFVRRYFGYE  1413

Query  4204  hdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             HDF+G VA  ++   V+F  +F+F +K  NFQ R
Sbjct  1414  HDFLGAVAAAVIAFPVLFATVFSFGVKVLNFQRR  1447



>ref|XP_003545503.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Glycine max]
Length=1447

 Score =  2056 bits (5326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1027/1436 (72%), Positives = 1222/1436 (85%), Gaps = 8/1436 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ ++VFS S RE  ED    LKWAAIE+LPTYLRI+R IL  E+  G  +E+D+++
Sbjct  19    IWRNNNMDVFSTSEREDDEDA---LKWAAIERLPTYLRIQRSILNNED--GKGREVDIKQ  73

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++ LLERLV+IA+EDNE FLLKL+ R DRVG+D+PTIEVRFEH+NV+A+ YVG R
Sbjct  74    LGLTERKILLERLVKIAEEDNERFLLKLRERMDRVGLDIPTIEVRFEHINVEAQVYVGGR  133

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP++ NF AN+LE F+NYLHI+P+ KKPL IL ++SGIIKP RMTLLLGPP SGKTTLL
Sbjct  134   ALPSMLNFFANVLEGFLNYLHIIPSPKKPLRILQNISGIIKPRRMTLLLGPPGSGKTTLL  193

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKL  DLK SGRVTYNGHE+ EFVP+RTSAYI+Q+D HIGEMTVRETLAFSARCQG
Sbjct  194   LALAGKLGKDLKHSGRVTYNGHELEEFVPQRTSAYISQYDNHIGEMTVRETLAFSARCQG  253

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG  YE+LAEL RREK+  IKPDPDID YMKA ++  Q  SVVTDYILKILGLEVCADI+
Sbjct  254   VGQNYEILAELLRREKQAKIKPDPDIDSYMKAAALGRQRTSVVTDYILKILGLEVCADIM  313

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD MIRGISGGQ+KR+TTGEMLVGP + LFMDEISTGLDSSTTFQI+NSIRQSIHIL G
Sbjct  314   VGDGMIRGISGGQKKRVTTGEMLVGPIKVLFMDEISTGLDSSTTFQIINSIRQSIHILNG  373

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA++SLLQPAPETYELFDDIILL+DGQ+VYQGPR+NVLEFF+ MGFKCPERKGVADFLQE
Sbjct  374   TALVSLLQPAPETYELFDDIILLTDGQIVYQGPRENVLEFFESMGFKCPERKGVADFLQE  433

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ QYW+R++E Y F+TV +F+EAFQ FH+G+ LG+ELA PFD+SKSHP  L+ K
Sbjct  434   VTSKKDQWQYWVRKDEPYSFVTVKDFAEAFQLFHIGQNLGEELASPFDRSKSHPNVLTTK  493

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGVNKKELL+ACASREFLLMKRNSFVYIFK+ QL+ +A +  T+FLRT+M ++++ DG 
Sbjct  494   KYGVNKKELLRACASREFLLMKRNSFVYIFKVTQLIYLAIITTTLFLRTKMHRDTVEDGG  553

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
              +MGALFFAV + MFNG SEL ++I+KLP FYKQRDL F+P WAY+LP WILKIP+TL+E
Sbjct  554   AYMGALFFAVTVAMFNGISELNMAIMKLPVFYKQRDLLFYPAWAYSLPPWILKIPITLIE  613

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIW  ++YYAIGFDP   R  KQ  +++C+NQMAS+LFRL AA GR VIVANT GS A+
Sbjct  614   VAIWEGISYYAIGFDPSLVRLLKQYLIILCINQMASSLFRLMAAFGRDVIVANTAGSFAL  673

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             ++VLVLGGF++SR++V KW++WGYW SPLMY QNAI+VNE+LG SWR V   ++ETLGV 
Sbjct  674   LIVLVLGGFVISRENVHKWFLWGYWSSPLMYGQNAIAVNEFLGHSWRKVTPNSNETLGVL  733

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAM-LSEETLAERNA  2337
             +L++RG FPEA+WYWIGVGAL+GYVFL NFLF LAL YL+P  K QA  LS+E L ERNA
Sbjct  734   ILKTRGFFPEAYWYWIGVGALIGYVFLYNFLFTLALQYLSPFRKDQASGLSQEKLLERNA  793

Query  2338  CKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCIT  2517
                 E I+L  KG S+SE  N+V  +       S   S + A  + +RGMVLPF+PL +T
Sbjct  794   STAEELIQLP-KGNSSSE-TNIVEEANIPSRSFSGRISDDKASGSGRRGMVLPFQPLSLT  851

Query  2518  FDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGR  2697
             FDE+KY+VDMP EMK QG+ E+RL LLKG++G FRPGVLTALMG+SGAGKTTLMDVLAGR
Sbjct  852   FDEMKYSVDMPQEMKKQGVFEERLELLKGVSGVFRPGVLTALMGVSGAGKTTLMDVLAGR  911

Query  2698  KTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTA  2877
             KTGGYIEGSITISGYPKRQETFARI+GYCEQ DIHSP+VTVYESL+YSAWLRLP E+D A
Sbjct  912   KTGGYIEGSITISGYPKRQETFARISGYCEQFDIHSPNVTVYESLLYSAWLRLPREVDRA  971

Query  2878  TREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSG  3057
             TR+MF+EEVM+LVEL S+REALVGLPG NGLSTEQRKRLTIAVELVANPSIIFMDEPTSG
Sbjct  972   TRKMFIEEVMELVELNSIREALVGLPGENGLSTEQRKRLTIAVELVANPSIIFMDEPTSG  1031

Query  3058  LDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHS  3237
             LDARAAAIVMRTVRNTV+TGRTVVCTIHQPSIDIFDAFDELLLLK GGE+IY GPLGRH 
Sbjct  1032  LDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFDAFDELLLLKLGGEQIYAGPLGRHC  1091

Query  3238  SQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQ  3417
             S LI+YFE I G+ +I++GYNPATWMLE+TS   EA++ ++F  VYRNSELY RNK LIQ
Sbjct  1092  SHLIQYFEAIQGVPKIKEGYNPATWMLEVTSAGTEASIKVNFTNVYRNSELYGRNKQLIQ  1151

Query  3418  ELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGT  3597
             ELS P  GS+DL+F ++YSQ+  TQC ACLWKQH SYWRN  YTAVRLLFT   ALLFG 
Sbjct  1152  ELSIPPQGSRDLHFDSQYSQTLVTQCKACLWKQHLSYWRNTSYTAVRLLFTMLIALLFGI  1211

Query  3598  MFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSAL  3777
             +FW IG KR  +QDLFNAMG MYAAV F+GVQN  SVQP++A+ERTVFYRERAAGMYSAL
Sbjct  1212  IFWDIGLKRSKEQDLFNAMGSMYAAVTFIGVQNGASVQPIIAVERTVFYRERAAGMYSAL  1271

Query  3778  PYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTV  3957
             PYA  QV+IELPH+ VQ L+YG+IVYAM+GF+WT +KFLW++FFMYFT LY+T YGMMT+
Sbjct  1272  PYALAQVIIELPHILVQALMYGIIVYAMMGFDWTTSKFLWYLFFMYFTFLYYTFYGMMTM  1331

Query  3958  AVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGD  4137
             A+TPN ++AAI+SSAFY  W+LFSGF+IP +RIP+WW+WYY+ICPV+WTL GL+ASQ+GD
Sbjct  1332  AITPNAHVAAILSSAFYAIWSLFSGFVIPLSRIPIWWKWYYWICPVAWTLNGLVASQYGD  1391

Query  4138  VKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              ++KL+  + V++FVKS+F F+HDF+G VA+++ G  ++F FIFAF IK  NFQ R
Sbjct  1392  NRDKLENGQRVEEFVKSYFGFEHDFLGVVASVVAGFSLLFAFIFAFGIKVLNFQKR  1447



>gb|KDO58232.1| hypothetical protein CISIN_1g047682mg, partial [Citrus sinensis]
Length=1425

 Score =  2055 bits (5325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 996/1418 (70%), Positives = 1203/1418 (85%), Gaps = 10/1418 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             L WAA+EKLPTY R+++GIL A    G   E+DV KLG+ E++ L+++LV++A  DNE  
Sbjct  11    LIWAALEKLPTYNRLKKGILTAST--GAANEVDVHKLGLLERQRLIDKLVKVADVDNEQL  68

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVGI LP IEVRFEHLNV+AEAYVG RALPT FNF AN++E F+N LHILP
Sbjct  69    LLKLKNRVDRVGISLPEIEVRFEHLNVEAEAYVGGRALPTFFNFCANLIEGFLNCLHILP  128

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKK   IL DV+GI+KP+R+TLLLGPP+SGKTTLLLALAGKLD  LK+SGRVTYNGH M
Sbjct  129   SRKKKFTILKDVNGIVKPSRLTLLLGPPASGKTTLLLALAGKLDPSLKLSGRVTYNGHNM  188

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RT+AYI+QHD+HIGEMTVRETLAFSARCQGVG RY+ML ELSRREK+ NIKPDP
Sbjct  189   DEFVPQRTAAYISQHDVHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKDANIKPDP  248

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA++ EGQEASVVTDY++K+LGL+VCAD +VGDEM+RGISGGQRKR+TTGEMLV
Sbjct  249   DIDVFMKALATEGQEASVVTDYVIKVLGLDVCADTMVGDEMLRGISGGQRKRVTTGEMLV  308

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPA ALFMDEISTGLDSSTTFQIV S+RQ IHIL GTAVISLLQPAPETY+LFDDIIL+S
Sbjct  309   GPALALFMDEISTGLDSSTTFQIVTSLRQIIHILNGTAVISLLQPAPETYDLFDDIILIS  368

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             +GQ+V+QGPR++VLEFF+ MGF+CP+RKGVADFLQEVTS+KDQ+QYW+R+EE Y F+TV 
Sbjct  369   EGQIVFQGPREHVLEFFKSMGFECPKRKGVADFLQEVTSKKDQQQYWVRKEEPYRFVTVK  428

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EFS+AFQ+FHVG+KLGD L  PFDKSKSHPAAL+ K YG+NKKELLKAC SRE LLMKRN
Sbjct  429   EFSDAFQAFHVGQKLGDGLRTPFDKSKSHPAALTTKSYGINKKELLKACISRELLLMKRN  488

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK+IQL +   ++MT+F RT+M ++S+ +G +++GALFF +IM  FNG +EL++S
Sbjct  489   SFVYIFKLIQLTITGVISMTLFFRTKMHRDSVTNGGIYVGALFFTIIMITFNGMAELSMS  548

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQRDL F+P WAY LPTWILK+P+  VEVA+WV + YY IGFDP+ GR FKQ
Sbjct  549   IAKLPVFYKQRDLRFYPAWAYGLPTWILKVPIAFVEVAVWVILNYYVIGFDPNVGRAFKQ  608

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ VNQM+S LFRL AA GRS++VANTFGS AM+++  LGGF+LSR+D+KKWW W Y
Sbjct  609   YLLLVLVNQMSSGLFRLMAATGRSMVVANTFGSFAMLVLFALGGFVLSREDIKKWWKWAY  668

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W SPLMYAQN ++VNE+LG SW+ V   ++E LGV VL+SRG F +A+WYW+G+  L G 
Sbjct  669   WCSPLMYAQNGLAVNEFLGNSWQKVLPNSTEPLGVEVLKSRGFFTDAYWYWLGMAGLAGS  728

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTS------EK  2394
             + L NF F LAL++LNP G  QA++SEE+ +     + G  ++L   G S+S      E 
Sbjct  729   ILLFNFGFILALSFLNPFGS-QAVISEESQSNECDNRTGGTLQLSTCGSSSSHLTQSDES  787

Query  2395  gnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGL  2574
              + +RR  S+    S       A+   + GMVLPFEPL +TF+++ Y+VDMP EMK QG+
Sbjct  788   RDNIRRRNSTSQSLSLTEEDIAANQPKRSGMVLPFEPLSLTFEDVVYSVDMPQEMKLQGV  847

Query  2575  TEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQ  2754
              +D+LVLL G++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKTGGYI G+I ISGYPK+Q
Sbjct  848   LDDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNIKISGYPKKQ  907

Query  2755  ETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLR  2934
             ETFARI+GYCEQ DIHSP+VTVYESL+YSAWLRLPP++D+ TR MF+EE+M+LVEL  LR
Sbjct  908   ETFARISGYCEQNDIHSPNVTVYESLLYSAWLRLPPDVDSETRRMFLEEIMELVELNPLR  967

Query  2935  EALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  3114
             ++LVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT
Sbjct  968   QSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT  1027

Query  3115  GRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDG  3294
             GRTVVCTIHQPSIDIF+AFDEL L+KRGG EIYVGPLGRHSS LI YFE I G+ +I+DG
Sbjct  1028  GRTVVCTIHQPSIDIFEAFDELFLMKRGGYEIYVGPLGRHSSHLISYFEAIPGVNKIKDG  1087

Query  3295  YNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYS  3474
             YNPATWMLE++S +QE ALG+DF ++Y+ SELYRRNKALI+ELSKPAPGS+DLYFPT+YS
Sbjct  1088  YNPATWMLEVSSSSQELALGVDFTDIYKGSELYRRNKALIEELSKPAPGSRDLYFPTQYS  1147

Query  3475  QSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAM  3654
             QSFFTQCMACLWKQHWSYWRNPPYTAVR LFTT  AL+FG++FW +G K   +QDLFNAM
Sbjct  1148  QSFFTQCMACLWKQHWSYWRNPPYTAVRFLFTTAIALMFGSLFWDLGTKTSKRQDLFNAM  1207

Query  3655  GCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTL  3834
             G MY AV FLGVQN++SVQPVVA+ER VFYRE+AAGMYS++ YAF QV+IE+PH+FVQ +
Sbjct  1208  GSMYTAVQFLGVQNSSSVQPVVAVERAVFYREKAAGMYSSMAYAFAQVLIEIPHVFVQAV  1267

Query  3835  IYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGF  4014
             +YGVIVYAMIGFEWTA KF+W+IFFM+++ L FT YGMM VA+TPN +IA ++S AFYG 
Sbjct  1268  VYGVIVYAMIGFEWTAVKFIWYIFFMFWSFLLFTFYGMMCVAMTPNLHIATVVSIAFYGI  1327

Query  4015  WNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKE-KLDTNETvkdfvksf  4191
             WN+FSGFIIP+TRIP+WWRWYY+  P++WTLYGL+ASQFGD+ + +L++ ETVK F++S+
Sbjct  1328  WNVFSGFIIPRTRIPIWWRWYYWANPIAWTLYGLVASQFGDIDDTRLESGETVKQFLRSY  1387

Query  4192  fdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             F F HDF+G +A + V   V+F F+FA  IKAFNFQ R
Sbjct  1388  FGFKHDFLGVIAAVHVAFTVLFVFVFALGIKAFNFQRR  1425



>ref|XP_002514348.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF48302.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1447

 Score =  2055 bits (5325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1015/1411 (72%), Positives = 1196/1411 (85%), Gaps = 2/1411 (0%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+E+LPTY R+RRG+L   E+ G  KEID++ LG+ +KR+LLERLV+  +EDNE F
Sbjct  39    LKWAALERLPTYSRLRRGLLT--EKDGHSKEIDIKSLGLTQKRNLLERLVKNVEEDNEKF  96

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK RTDRVG+ +PTIEVRFEHL+V+AEAYVGS+ALPT+FNF  N  + FMNYLHILP
Sbjct  97    LLKLKDRTDRVGLHMPTIEVRFEHLSVEAEAYVGSKALPTLFNFLINYFQGFMNYLHILP  156

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RKKPL IL+D+SGIIKP R+TLLLGPPSSGKTT LLALAGKL  +LK SGRVTYNGHEM
Sbjct  157   SRKKPLRILNDISGIIKPQRLTLLLGPPSSGKTTFLLALAGKLSKELKFSGRVTYNGHEM  216

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAY++Q+DLHI EMTVRETLAFS+RCQGVG RYEML ELSRREK  NIKPD 
Sbjct  217   EEFVPQRTSAYVSQYDLHIAEMTVRETLAFSSRCQGVGTRYEMLEELSRREKAANIKPDH  276

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DID++MKA +++GQE +VV DYILKILGLE CAD +VGDEM RGISGG+++R+T GEMLV
Sbjct  277   DIDIFMKAAAVDGQEINVVVDYILKILGLEACADTMVGDEMRRGISGGEKRRVTIGEMLV  336

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEIS GLDS+TTFQIVNS+RQ IHIL GTA+ISLLQPAPETYELFDD+ILL+
Sbjct  337   GPARALFMDEISAGLDSTTTFQIVNSLRQLIHILNGTALISLLQPAPETYELFDDVILLT  396

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR NVLEFF+HMGF+CPERKGVADFLQEVTSRKDQEQYW R+ E   F++  
Sbjct  397   DGQIVYQGPRGNVLEFFEHMGFRCPERKGVADFLQEVTSRKDQEQYWARKNEPRGFVSAK  456

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF+EAFQSFH+G+KLGDELA PFDKSKSHPAA++ ++YGV+KKELLKAC SREFLLMKRN
Sbjct  457   EFAEAFQSFHIGRKLGDELANPFDKSKSHPAAVAVERYGVSKKELLKACVSREFLLMKRN  516

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SF YIFKM+QLV+ AF+  T+FLRTEM +N++AD  V+ GALFF+VI  M NG SEL+++
Sbjct  517   SFAYIFKMVQLVVRAFIITTIFLRTEMHQNTLADCGVYFGALFFSVISLMLNGVSELSMT  576

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             +LKLP FYKQRD  FFP WAYALP W+LKIP+T +EV +WV +TYYAIG+D +  R FKQ
Sbjct  577   VLKLPVFYKQRDHLFFPSWAYALPAWVLKIPITFIEVLMWVIVTYYAIGYDRNIQRVFKQ  636

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               +LI  NQMAS+LFRL AA GR++IVANT G  ++I V+ LGGF+L RD +KK WIWGY
Sbjct  637   YLILIMTNQMASSLFRLAAALGRNLIVANTIGVLSIITVIALGGFVLPRDALKKGWIWGY  696

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W SP+MYAQ  ISVNE+LGK+W H P  + ETLGVT L+SR I P+++WYWI VGAL GY
Sbjct  697   WSSPMMYAQIGISVNEFLGKNWNHFPLNSIETLGVTFLKSRAISPKSYWYWIAVGALTGY  756

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
              FL NFLF LAL YLNP GKP A+LS E L+ ++  +  + I L     S+  KGN   R
Sbjct  757   TFLFNFLFTLALKYLNPFGKPHAVLSAEALSVQHDDRIVDCIGLSRDRKSSLGKGNASNR  816

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
             +  S S S  VGS + A+   + G+VLPF+P  I+FDEI Y+V+MP EMKAQG+TE+RL 
Sbjct  817   NALSMSRSVNVGSSSDANKGRRVGLVLPFQPRSISFDEITYSVNMPKEMKAQGITEERLQ  876

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             +LKG++GAFRPG+LTALMG SGAGKTTL+DVLAGRKTGGYIEGSITISG+PK+QETFARI
Sbjct  877   ILKGVSGAFRPGILTALMGASGAGKTTLLDVLAGRKTGGYIEGSITISGHPKKQETFARI  936

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQ DIHSP+VTV ESLVYSAWLRLP E+ +  R++F+EEVM+LVEL+ LREALVGL
Sbjct  937   SGYCEQADIHSPNVTVLESLVYSAWLRLPTEVKSNARKLFIEEVMNLVELSPLREALVGL  996

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGLS EQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  997   PGVNGLSVEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1056

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIFDAFDELLLLKRGGEEIY GP+GRH+  LIRYFE I G+  I+DGYNPATW
Sbjct  1057  TIHQPSIDIFDAFDELLLLKRGGEEIYAGPIGRHAYHLIRYFEGIKGVPGIKDGYNPATW  1116

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLE+T+ AQEA +GI+F ++YRNS+LYRRNKALI+ELS+P  GSKDLYFPT+YSQ F TQ
Sbjct  1117  MLEVTTVAQEATIGINFTDIYRNSQLYRRNKALIEELSRPPSGSKDLYFPTRYSQPFLTQ  1176

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             CMACLWK H SYWRNPPY+AVRLLFTT  AL+ GT+FW +G KR  QQD+ NAMG MY +
Sbjct  1177  CMACLWKHHRSYWRNPPYSAVRLLFTTLVALMMGTIFWDLGSKRSRQQDILNAMGSMYVS  1236

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+FLG  N + VQP+V IERTV YRERAAG YSALPYA GQV+IELP++ VQT+IYGV++
Sbjct  1237  VLFLGYMNTSLVQPIVTIERTVIYRERAAGFYSALPYAIGQVLIELPYVLVQTIIYGVLM  1296

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             YAMIGFEWT +K  WF+FFMYFT LYF+ YGMMTVA TPNHNIAAI+S  F+  W+ FSG
Sbjct  1297  YAMIGFEWTVSKCFWFLFFMYFTFLYFSFYGMMTVAFTPNHNIAAIVSIFFFTIWSTFSG  1356

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             F+IP T+IP WWRWYY+ CPV+WTLYGLIASQ+GD+KE LDT ET++ F+K++F F HDF
Sbjct  1357  FVIPLTKIPKWWRWYYWACPVAWTLYGLIASQYGDIKEPLDTGETIEHFLKNYFGFRHDF  1416

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +G +A  +VG  ++FGFIFAFSIKAFNFQ R
Sbjct  1417  IGIIAVALVGFNLLFGFIFAFSIKAFNFQKR  1447



>ref|XP_011082498.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Sesamum indicum]
Length=1449

 Score =  2053 bits (5320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1027/1436 (72%), Positives = 1218/1436 (85%), Gaps = 17/1436 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++G+EVFSRSSRE  +++   LKWAA+EKLPT+ R+R+G+L   +   G  E+DV+ 
Sbjct  30    IWRNTGIEVFSRSSREEDDEEA--LKWAALEKLPTFDRLRKGLLFGSK---GANEVDVQS  84

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  +KR+L+ERLV   +EDNE FLLKL++R DRVGID+PTIEVR+EHLNVDAEAY  SR
Sbjct  85    LGFQDKRNLVERLVNTVEEDNEKFLLKLRNRIDRVGIDIPTIEVRYEHLNVDAEAYTASR  144

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT  NF  N++E  +N+LH+LP+RKKP  IL DVSGIIKP R+TLLLGPPSSGKTTLL
Sbjct  145   ALPTFVNFNINMMEGILNFLHVLPSRKKPFTILKDVSGIIKPCRLTLLLGPPSSGKTTLL  204

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD  LK SGR+TYNGH M EFVP+RT+AYI+QHDLHIGEMTVRETLA+SAR QG
Sbjct  205   LALAGKLDPTLKTSGRITYNGHGMEEFVPQRTAAYISQHDLHIGEMTVRETLAYSARFQG  264

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEMLAELSRREK  NIKPDPD+D+YMKA + EG EA+VVTDYILK+LGL++CAD L
Sbjct  265   VGSRYEMLAELSRREKAANIKPDPDVDMYMKAAATEGDEANVVTDYILKVLGLDICADTL  324

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKR+TTGEMLVGPA+ALFMDEISTGLDSSTT+QIVN +RQ +HI++G
Sbjct  325   VGDEMIRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTYQIVNMLRQYVHIMKG  384

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA ISLLQPAPETY+LFDDI+LL+DGQ+VYQGPRDNVL+FF+ MGFKCPERKGVADFLQE
Sbjct  385   TAFISLLQPAPETYDLFDDIVLLADGQIVYQGPRDNVLDFFESMGFKCPERKGVADFLQE  444

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW  ++E Y FI V EF+EAFQSF  G+KLGDELA+PFDKSKSHPAAL+ +
Sbjct  445   VTSKKDQKQYWANKDEPYRFIPVSEFAEAFQSFAFGRKLGDELAIPFDKSKSHPAALTKQ  504

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG+  KELLKACA RE LLMKRNSFV+ FK+ QL +MA  AMTVFLRT+M K+++ DG 
Sbjct  505   KYGLGDKELLKACADRELLLMKRNSFVFFFKIFQLTVMALTAMTVFLRTKMHKDTLEDGG  564

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF VIM MFNG +ELA++I KLP FYKQRD+FFFPPWAYA+P+WILKIPVT +E
Sbjct  565   IYTGALFFTVIMVMFNGLTELAMTIQKLPVFYKQRDMFFFPPWAYAIPSWILKIPVTFLE  624

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIW  +TYY IGFDP+ GR  KQ  LL+ V+Q ASALFR   AAGR++IVANTFG  A+
Sbjct  625   VAIWTFLTYYVIGFDPNVGRLMKQYLLLLLVHQSASALFRFIGAAGRNMIVANTFGLFAL  684

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +++  LGG +LSR+DVKKWW+WGYW SPLMYAQNAI VNE+ G SW  + +GT   LGV 
Sbjct  685   LMLFALGGIVLSREDVKKWWLWGYWSSPLMYAQNAIIVNEFTGNSWSRLENGTK--LGVL  742

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             V+ SRG FP+A+WYWIGVG L G+V+L N L+ L+LTYL P  KPQA+L EET  E +A 
Sbjct  743   VMESRGFFPQAYWYWIGVGGLFGFVWLFNILYLLSLTYLKPFEKPQAVLPEET--EDDAQ  800

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K G    +       S + N   R   S   SS       A+ N KRGM+LPFEP  ITF
Sbjct  801   KDGSIRRV-------SARVNESTRRSISSGSSSTRVDAIEANGNRKRGMILPFEPHSITF  853

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+++Y+VDMP EMKAQG T+D+L LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  854   DDVRYSVDMPAEMKAQGATQDKLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  913

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+G+ITISGYPK Q TFARI+GYCEQ DIHSP+VTVYESLVYSAWLRLP E+D  T
Sbjct  914   TGGYIDGNITISGYPKNQATFARISGYCEQNDIHSPNVTVYESLVYSAWLRLPQEVDAET  973

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELT LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  974   RKMFIEEVMELVELTPLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1033

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTV+TGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLG HSS
Sbjct  1034  DARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGHHSS  1093

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I G+ +I+DGYNPATWMLE+T+ AQE  LG+DFA+ Y++SELY RNKALI+E
Sbjct  1094  HLIKYFEGIEGVPKIKDGYNPATWMLEVTTSAQELVLGVDFADHYKSSELYTRNKALIKE  1153

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PG+KDL+FPTKYSQSF TQC+ACLWKQHWSYWRNPPYTAVR LFTTF AL+FGTM
Sbjct  1154  LSIPRPGTKDLFFPTKYSQSFLTQCIACLWKQHWSYWRNPPYTAVRFLFTTFIALIFGTM  1213

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G K  T+QDLFNAMG MYAA+ FLG Q  ++VQPVVAIERTVFYRERAAGMYSALP
Sbjct  1214  FWDLGSKWTTRQDLFNAMGSMYAAINFLGFQYGSTVQPVVAIERTVFYRERAAGMYSALP  1273

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAF Q +IE+P++FVQ+++YG+IVY+M+GF+W A KF WFI+F++F+LLYF LYGMMTVA
Sbjct  1274  YAFSQFLIEIPYVFVQSIVYGLIVYSMMGFDWNAEKFFWFIYFLFFSLLYFVLYGMMTVA  1333

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHN+AAIISS FY  WNLFSGFI+P+ RIPVWWRWYY+  PV++TLYG+I SQFG++
Sbjct  1334  VTPNHNVAAIISSFFYAIWNLFSGFIVPRPRIPVWWRWYYWATPVAYTLYGIIVSQFGEI  1393

Query  4141  KEKLD-TNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K++++  +ETV++F++++F F HD +G VA I++G  V+F FIFA+SI+ FNFQ R
Sbjct  1394  KDQMEGGDETVEEFLRNYFGFRHDMLGMVAAILLGFVVLFTFIFAYSIRTFNFQRR  1449



>gb|AIU41654.1| ABC transporter family protein [Hevea brasiliensis]
Length=1438

 Score =  2053 bits (5320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1009/1438 (70%), Positives = 1215/1438 (84%), Gaps = 21/1438 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             V+R++G++VFSRSSR+  +++   LKWAA+EKLPTY R+R+GIL +  +GG   EIDV+ 
Sbjct  19    VFRNNGLDVFSRSSRDEDDEEA--LKWAALEKLPTYDRLRKGILVSVSKGGA-NEIDVDN  75

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+++LLERLV++A+EDNE FLLKLK+R DRVGI++PTIEVR+EHLN++AEA VGS 
Sbjct  76    LGFQERKTLLERLVKVAEEDNEKFLLKLKNRIDRVGIEIPTIEVRYEHLNIEAEALVGSN  135

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  NFT +I E F+N LH+LPNRK+PL IL DVSG+IKP+RMTLLLGPPSSGKTTLL
Sbjct  136   ALPSFLNFTMSIAEVFLNCLHVLPNRKRPLTILKDVSGVIKPSRMTLLLGPPSSGKTTLL  195

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD +LKVSG VTYN H + EF+P+RT+AYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  196   LALAGKLDPNLKVSGNVTYNAHTLNEFIPQRTAAYISQHDLHIGEMTVRETLAFSARCQG  255

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG ++EMLAELSRREK  NIKPDPD+DV+MKA + EGQE SVVTDY+LKILGL++CAD L
Sbjct  256   VGTQHEMLAELSRREKAANIKPDPDLDVFMKAAATEGQETSVVTDYVLKILGLDICADTL  315

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VG+EMIRGISGGQRKR+TTGEMLVGPA+ALFMDEISTGLDSSTTF I+NS+RQSIHIL G
Sbjct  316   VGNEMIRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTFSIINSLRQSIHILNG  375

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY LFDDIILLSDGQVVYQGPR+ VL FF++MGF+CPERKGVADFLQE
Sbjct  376   TAVISLLQPAPETYNLFDDIILLSDGQVVYQGPREQVLGFFEYMGFRCPERKGVADFLQE  435

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW R+++ Y F+TV EF+EAFQS+ VG+++ ++L+VPFD++K+HPAAL+ K
Sbjct  436   VTSKKDQQQYWARKDQPYRFVTVNEFAEAFQSYEVGRRIAEDLSVPFDRTKNHPAALTTK  495

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
              YGV K ELLKA  SRE+LLMKRNSFVYIFK+ QL++MA + MT+F RTEM ++++ D  
Sbjct  496   HYGVGKMELLKANLSREYLLMKRNSFVYIFKLTQLIVMATIGMTLFFRTEMKRDTLEDAG  555

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             V++GALFF++I  MFNG +EL+++I KLP FYKQR+L FFP W+Y++P+WILKIPVT VE
Sbjct  556   VYLGALFFSLITIMFNGMAELSMTIAKLPVFYKQRNLLFFPAWSYSIPSWILKIPVTFVE  615

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V +WV +TYY IGFDP+ GR FKQ  LL+ VNQMASALFR  A+ GR++IVANTFGS A+
Sbjct  616   VGVWVFITYYVIGFDPNVGRLFKQYMLLLLVNQMASALFRFIASVGRNMIVANTFGSFAL  675

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVP--SGTSETLG  2154
             + +  LGGFIL R ++KKWWIWGYWISPLMY QNAI  NE+LG SW H+P  S ++E+LG
Sbjct  676   LTLFALGGFILKRPEIKKWWIWGYWISPLMYGQNAIVANEFLGHSWNHIPANSNSTESLG  735

Query  2155  VTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERN  2334
             V  +++ G FP A+WYW+G+GA  GY+F+ N L+ +ALT+L+   KPQA++S+E      
Sbjct  736   VQFIKNNGFFPHAYWYWLGLGASAGYIFVFNILYTVALTFLDQFEKPQAIISDE------  789

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
                   P E E  GG+          S    +  S    ++ ++ N K+GMVLPFEP  I
Sbjct  790   ------PEERERSGGAIQ---LSQVESSHRNNTESGTSGIDESNHNKKKGMVLPFEPHSI  840

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFD + Y+VDMP EMK QG+ ED+LVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  841   TFDNVIYSVDMPQEMKNQGVVEDKLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  900

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYIEG I ISGYPK+QETFARI+GYCEQ DIHSPHVTVYESLVYSAWLRLP ++++
Sbjct  901   RKTGGYIEGDIRISGYPKKQETFARISGYCEQNDIHSPHVTVYESLVYSAWLRLPSDVNS  960

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
              TR+MFVEEVM+LVEL  LR+ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS
Sbjct  961   ETRKMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  1020

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLGRH
Sbjct  1021  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGRH  1080

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             S  LI+YFE I G+ +I DGYNPATWMLE++S AQE +LG+DFA +YRNS+LYRRNKA+I
Sbjct  1081  SCHLIKYFEGIEGVSKITDGYNPATWMLEVSSSAQELSLGVDFANIYRNSDLYRRNKAMI  1140

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
             QELSKPAPG+KDLYFPT+YSQ F TQCMACLWKQ WSYWRNPPYT VR  FTTF AL+FG
Sbjct  1141  QELSKPAPGTKDLYFPTQYSQPFLTQCMACLWKQSWSYWRNPPYTGVRFWFTTFIALMFG  1200

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G K   + DL NAMG MY AV+FLGVQN++SVQPVVAIERTVFYRE+AAGMYSA
Sbjct  1201  TIFWDLGSKLEKEGDLSNAMGSMYVAVLFLGVQNSSSVQPVVAIERTVFYREKAAGMYSA  1260

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             +PYA+ Q +IELP++F Q  +Y +I YAMIGFEWTAAKF W++FF+YFTLLYFT YGMM 
Sbjct  1261  MPYAYAQALIELPYIFTQAGVYSLITYAMIGFEWTAAKFFWYLFFLYFTLLYFTYYGMMA  1320

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPNH+IA+IISSAFY  WNLF+GFI+P+ ++PVWWRWYY+ CP+SWTLYGL ASQFG
Sbjct  1321  VAVTPNHHIASIISSAFYAIWNLFAGFIVPRPKMPVWWRWYYWGCPISWTLYGLFASQFG  1380

Query  4135  DVKEKL-DTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+ + L +T +TV+ +V  F+   H+F+G  A +I+GI  +F  IFA SIKAFNFQ R
Sbjct  1381  DITKPLGETGKTVEQYVSDFYGIKHNFLGACAGVIIGIDTLFAVIFAISIKAFNFQRR  1438



>ref|XP_011082577.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Sesamum indicum]
Length=1419

 Score =  2052 bits (5317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1023/1436 (71%), Positives = 1214/1436 (85%), Gaps = 35/1436 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++G+EVFSRSSRE  +++   LKWAA+EKLPT+ R+R+G+L   +   G  E+DV+ 
Sbjct  18    IWRNTGIEVFSRSSREEDDEEA--LKWAALEKLPTFDRLRKGLLFGSK---GANEVDVQS  72

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  +KR+L+ERLV   +EDNE FLLKL++R DRVGID+PTIEVR+EHLNVDAEAY  SR
Sbjct  73    LGFQDKRNLVERLVNTVEEDNEKFLLKLRNRIDRVGIDIPTIEVRYEHLNVDAEAYTASR  132

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALPT  NF  N++E  +N+LH+LP+RKKP  IL DVSGIIKP R+TLLLGPPSSGKTTLL
Sbjct  133   ALPTFVNFNINMMEGILNFLHVLPSRKKPFTILKDVSGIIKPCRLTLLLGPPSSGKTTLL  192

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD  LK SGR+TYNGH M EFVP+RT+AYI+QHDLHIGEMTVRETLA+SAR QG
Sbjct  193   LALAGKLDPTLKTSGRITYNGHGMEEFVPQRTAAYISQHDLHIGEMTVRETLAYSARFQG  252

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEMLAELSRREK  NIKPDPD+D+YMKA + EG EA+VVTDYILK+LGL++CAD L
Sbjct  253   VGSRYEMLAELSRREKAANIKPDPDVDMYMKAAATEGDEANVVTDYILKVLGLDICADTL  312

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEMIRGISGGQRKR+TTGEMLVGPA+ALFMDEISTGLDSSTT+QIVN +RQ +HI++G
Sbjct  313   VGDEMIRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTYQIVNMLRQYVHIMKG  372

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA ISLLQPAPETY+LFDDI+LL+DGQ+VYQGPRDNVL+FF+ MGFKCPERKGVADFLQE
Sbjct  373   TAFISLLQPAPETYDLFDDIVLLADGQIVYQGPRDNVLDFFESMGFKCPERKGVADFLQE  432

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW  ++E Y FI V EF+EAFQSF  G+KLGDELA+PFDKSKSHPAAL+ +
Sbjct  433   VTSKKDQKQYWANKDEPYRFIPVSEFAEAFQSFAFGRKLGDELAIPFDKSKSHPAALTKQ  492

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG+  KELLKACA RE LLMKRNSFV+ FK+ QL +MA  AMTVFLRT+M K+++ DG 
Sbjct  493   KYGLGDKELLKACADRELLLMKRNSFVFFFKIFQLTVMALTAMTVFLRTKMHKDTLEDGG  552

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF VIM MFNG +ELA++I KLP FYKQRD+FFFPPWAYA+P+WILKIPVT +E
Sbjct  553   IYTGALFFTVIMVMFNGLTELAMTIQKLPVFYKQRDMFFFPPWAYAIPSWILKIPVTFLE  612

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIW  +TYY IGFDP+ GR  KQ  LL+ V+Q ASALFR   AAGR++IVANTFG  A+
Sbjct  613   VAIWTFLTYYVIGFDPNVGRLMKQYLLLLLVHQSASALFRFIGAAGRNMIVANTFGLFAL  672

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +++  LGG +LSR+DVKKWW+WGYW SPLMYAQNAI VNE+ G SW  + +GT   LGV 
Sbjct  673   LMLFALGGIVLSREDVKKWWLWGYWSSPLMYAQNAIIVNEFTGNSWSRLENGTK--LGVL  730

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             V+ SRG FP+A+WYWIGVG L G+V+L N L+ L+LTYL P  KPQA+L EET  E +A 
Sbjct  731   VMESRGFFPQAYWYWIGVGGLFGFVWLFNILYLLSLTYLKPFEKPQAVLPEET--EDDAQ  788

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             K G    +       +EK                      A+ N KRGM+LPFEP  ITF
Sbjct  789   KDG---SIRRVSARVNEK----------------------ANGNRKRGMILPFEPHSITF  823

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D+++Y+VDMP EMKAQG T+D+L LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  824   DDVRYSVDMPAEMKAQGATQDKLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  883

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+G+ITISGYPK Q TFARI+GYCEQ DIHSP+VTVYESLVYSAWLRLP E+D  T
Sbjct  884   TGGYIDGNITISGYPKNQATFARISGYCEQNDIHSPNVTVYESLVYSAWLRLPQEVDAET  943

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVELT LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  944   RKMFIEEVMELVELTPLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1003

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTV+TGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLG HSS
Sbjct  1004  DARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGHHSS  1063

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I G+ +I+DGYNPATWMLE+T+ AQE  LG+DFA+ Y++SELY RNKALI+E
Sbjct  1064  HLIKYFEGIEGVPKIKDGYNPATWMLEVTTSAQELVLGVDFADHYKSSELYTRNKALIKE  1123

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PG+KDL+FPTKYSQSF TQC+ACLWKQHWSYWRNPPYTAVR LFTTF AL+FGTM
Sbjct  1124  LSIPRPGTKDLFFPTKYSQSFLTQCIACLWKQHWSYWRNPPYTAVRFLFTTFIALIFGTM  1183

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G K  T+QDLFNAMG MYAA+ FLG Q  ++VQPVVAIERTVFYRERAAGMYSALP
Sbjct  1184  FWDLGSKWTTRQDLFNAMGSMYAAINFLGFQYGSTVQPVVAIERTVFYRERAAGMYSALP  1243

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAF Q +IE+P++FVQ+++YG+IVY+M+GF+W A KF WFI+F++F+LLYF LYGMMTVA
Sbjct  1244  YAFSQFLIEIPYVFVQSIVYGLIVYSMMGFDWNAEKFFWFIYFLFFSLLYFVLYGMMTVA  1303

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPNHN+AAIISS FY  WNLFSGFI+P+ RIPVWWRWYY+  PV++TLYG+I SQFG++
Sbjct  1304  VTPNHNVAAIISSFFYAIWNLFSGFIVPRPRIPVWWRWYYWATPVAYTLYGIIVSQFGEI  1363

Query  4141  KEKLD-TNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             K++++  +ETV++F++++F F HD +G VA I++G  V+F FIFA+SI+ FNFQ R
Sbjct  1364  KDQMEGGDETVEEFLRNYFGFRHDMLGMVAAILLGFVVLFTFIFAYSIRTFNFQRR  1419



>ref|XP_009799503.1| PREDICTED: pleiotropic drug resistance protein 1 [Nicotiana sylvestris]
 sp|Q76CU2.1|PDR1_TOBAC RecName: Full=Pleiotropic drug resistance protein 1; AltName: 
Full=NtPDR1 [Nicotiana tabacum]
 dbj|BAD07483.1| PDR-type ABC transporter 1 [Nicotiana tabacum]
Length=1434

 Score =  2052 bits (5316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1022/1435 (71%), Positives = 1197/1435 (83%), Gaps = 29/1435 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++GVE+FSRSSR+  +++   LKWAA+EKLPT+ R+R+G+L   +  G   E+D+  
Sbjct  29    IWRNNGVEIFSRSSRDEDDEEA--LKWAALEKLPTFDRLRKGLLFGSQ--GAAAEVDIND  84

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+++LLERLV++A EDNE FLLKLK+R DRVGIDLPTIEVR+EHLN+DA+AYVGSR
Sbjct  85    LGFQERKNLLERLVKVADEDNEKFLLKLKNRIDRVGIDLPTIEVRYEHLNIDADAYVGSR  144

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             +LPT  NF  N +E  +N LHIL +RK+ L IL D+SGIIKP RMTLLLGPPSSGKTTLL
Sbjct  145   SLPTFMNFMTNFVETLLNSLHILSSRKRQLTILKDISGIIKPCRMTLLLGPPSSGKTTLL  204

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD  LKV+G+V+YNGHE+ EFVP+RT+AYI+QHDLHIGEMTVRETL FSARCQG
Sbjct  205   LALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEMTVRETLEFSARCQG  264

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG R+EMLAELSRREK  NIKPD DID+YMKA + EGQEA+VVTDY+LKILGL++CAD +
Sbjct  265   VGSRFEMLAELSRREKAANIKPDADIDIYMKAAATEGQEANVVTDYVLKILGLDICADTM  324

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQ+KR+TTGEMLVGP++ALFMDEISTGLDSSTT+ IVNS+RQS+ IL+G
Sbjct  325   VGDDMIRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSSTTYSIVNSLRQSVQILKG  384

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY LFDDIILLSDG +VYQGPRD+VLEFF+ MGFKCP+RKGVADFLQE
Sbjct  385   TAVISLLQPAPETYNLFDDIILLSDGYIVYQGPRDDVLEFFESMGFKCPQRKGVADFLQE  444

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW +R E Y FIT  EF+EA+QSFHVG+KLGDELA PFDK+K HPAAL+N+
Sbjct  445   VTSKKDQQQYWSKRNEPYRFITSKEFAEAYQSFHVGRKLGDELATPFDKTKCHPAALTNE  504

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG+ KKELLK C  RE LLMKRNSFVY+FK  QL +MA + MT+F RTEMP+++  DG 
Sbjct  505   KYGIGKKELLKVCTERELLLMKRNSFVYMFKFSQLTIMALITMTLFFRTEMPRDTTDDGG  564

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF VIM MFNG SELA++I KLP FYKQRDL FFP WAYA+P+WILKIPVTLVE
Sbjct  565   IYAGALFFVVIMIMFNGMSELAMTIFKLPVFYKQRDLLFFPSWAYAIPSWILKIPVTLVE  624

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V +WV +TYY IGFDP+  RF KQ  LLI VNQMAS +FR   A GR++ VA+TFGS A+
Sbjct  625   VGLWVILTYYVIGFDPNITRFLKQFLLLIVVNQMASGMFRFIGAVGRTMGVASTFGSFAL  684

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +L   LGGF+LSRDDVK WWIWGYWISP+MY+ N+I VNE+ GK W H+  G +ETLG T
Sbjct  685   LLQFALGGFVLSRDDVKSWWIWGYWISPMMYSVNSILVNEFDGKKWNHIVPGGNETLGST  744

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             V++SRG FPEA+WYWIGVGALVG+  + NF + LAL YLNP  KPQA+L E+     N  
Sbjct  745   VVKSRGFFPEAYWYWIGVGALVGFTVVFNFCYSLALAYLNPFDKPQAVLPEDGENAENG-  803

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             +    I     G S SE                          N K+GMVLPFEP  ITF
Sbjct  804   EVSSQITSTDGGDSISESQ------------------------NNKKGMVLPFEPHSITF  839

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D++ Y+VDMP EMK QG  EDRLVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  840   DDVVYSVDMPQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  899

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+G I ISGYPK+QETFARI+GYCEQ DIHSP+VTVYESLVYSAWLRLP ++D  T
Sbjct  900   TGGYIDGEIKISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPQDVDEKT  959

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFV+EVM+LVEL  LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  960   RKMFVDEVMELVELGPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1019

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGG+EIYVGPLGRHS 
Sbjct  1020  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSC  1079

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE+  G+ +I++GYNPATWMLE+T+ AQE  LGIDF EVY+NS+LYRRNKALI E
Sbjct  1080  HLIKYFESNPGVAKIKEGYNPATWMLEVTASAQEMMLGIDFTEVYKNSDLYRRNKALISE  1139

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             L  P PGSKDL+F T+YSQSF+TQC+ACLWKQHWSYWRNP YTAVR +FTTF AL+FGTM
Sbjct  1140  LGVPRPGSKDLHFETQYSQSFWTQCVACLWKQHWSYWRNPAYTAVRFIFTTFIALIFGTM  1199

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G K    QDL NAMG MYAAV+FLGVQNA+SVQPVVAIERTVFYRERAAGMYSA+P
Sbjct  1200  FWDLGTKVSKSQDLLNAMGSMYAAVLFLGVQNASSVQPVVAIERTVFYRERAAGMYSAIP  1259

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV IE+P++FVQ++ YG+IVYAMIGFEW   KF W++F M+FTLLYFT YGMM VA
Sbjct  1260  YAFGQVSIEIPYIFVQSVFYGIIVYAMIGFEWDVGKFFWYLFIMFFTLLYFTFYGMMGVA  1319

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPN N+A+I+++ FYG WNLFSGFIIP+ R+PVWWRWYY+  PV+WTLYGL+ASQFGD+
Sbjct  1320  VTPNQNVASIVAAFFYGVWNLFSGFIIPRPRMPVWWRWYYWANPVAWTLYGLVASQFGDI  1379

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             + KL  NETV+ F++ +F F HDF+G VA ++     MF F FAF+IKAFNFQ R
Sbjct  1380  QTKLSDNETVEQFLRRYFGFKHDFLGVVAAVLTAYVFMFAFTFAFAIKAFNFQRR  1434



>dbj|BAB92011.1| pleiotropic drug resistance like protein [Nicotiana tabacum]
Length=1434

 Score =  2052 bits (5316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1022/1435 (71%), Positives = 1197/1435 (83%), Gaps = 29/1435 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++GVE+FSRSSR+  +++   LKWAA+EKLPT+ R+R+G+L   +  G   E+D+  
Sbjct  29    IWRNNGVEIFSRSSRDEDDEEA--LKWAALEKLPTFDRLRKGLLFGSQ--GAAAEVDIND  84

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+++LLERLV++A EDNE FLLKLK+R DRVGIDLPTIEVR+EHLN+DA+AYVGSR
Sbjct  85    LGFQERKNLLERLVKVADEDNEKFLLKLKNRIDRVGIDLPTIEVRYEHLNIDADAYVGSR  144

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             +LPT  NF  N +E  +N LHIL +RK+ L IL D+SGIIKP RMTLLLGPPSSGKTTLL
Sbjct  145   SLPTFMNFMTNFVETLLNSLHILSSRKRQLTILKDISGIIKPCRMTLLLGPPSSGKTTLL  204

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD  LKV+G+V+YNGHE+ EFVP+RT+AYI+QHDLHIGEMTVRETL FSARCQG
Sbjct  205   LALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEMTVRETLEFSARCQG  264

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG R+EMLAELSRREK  NIKPD DID+YMKA + EGQEA+VVTDY+LKILGL++CAD +
Sbjct  265   VGSRFEMLAELSRREKAANIKPDADIDIYMKAAATEGQEANVVTDYVLKILGLDICADTM  324

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQ+KR+TTGEMLVGP++ALFMDEISTGLDSSTT+ IVNS+RQS+ IL+G
Sbjct  325   VGDDMIRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSSTTYSIVNSLRQSVQILKG  384

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY LFDDIILLSDG +VYQGPRD+VLEFF+ MGFKCP+RKGVADFLQE
Sbjct  385   TAVISLLQPAPETYNLFDDIILLSDGYIVYQGPRDDVLEFFESMGFKCPQRKGVADFLQE  444

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW +R E Y FIT  EF+EA+QSFHVG+KLGDELA PFDK+K HPAAL+N+
Sbjct  445   VTSKKDQQQYWSKRNEPYRFITSKEFAEAYQSFHVGRKLGDELATPFDKTKCHPAALTNE  504

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG+ KKELLK C  RE LLMKRNSFVY+FK  QL +MA + MT+F RTEMP+++  DG 
Sbjct  505   KYGIGKKELLKVCTERELLLMKRNSFVYMFKFSQLTIMALITMTLFFRTEMPRDTTDDGG  564

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF VIM MFNG SELA++I KLP FYKQRDL FFP WAYA+P+WILKIPVTLVE
Sbjct  565   IYAGALFFVVIMIMFNGMSELAMTIFKLPVFYKQRDLLFFPSWAYAIPSWILKIPVTLVE  624

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V +WV +TYY IGFDP+  RF KQ  LLI VNQMAS +FR   A GR++ VA+TFGS A+
Sbjct  625   VGLWVILTYYVIGFDPNITRFLKQFLLLIVVNQMASGMFRFIGAVGRTMGVASTFGSFAL  684

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +L   LGGF+LSRDDVK WWIWGYWISP+MY+ N+I VNE+ GK W H+  G +ETLG T
Sbjct  685   LLQFALGGFVLSRDDVKSWWIWGYWISPMMYSVNSILVNEFDGKKWNHIVPGGNETLGST  744

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             V++SRG FPEA+WYWIGVGALVG+  + NF + LAL YLNP  KPQA+L E+     N  
Sbjct  745   VVKSRGFFPEAYWYWIGVGALVGFTVVFNFCYSLALAYLNPFDKPQAVLPEDGENAENG-  803

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             +    I     G S SE                          N K+GMVLPFEP  ITF
Sbjct  804   EVSSQIPSTDGGDSISESQ------------------------NNKKGMVLPFEPHSITF  839

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D++ Y+VDMP EMK QG  EDRLVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  840   DDVVYSVDMPQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  899

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+G I ISGYPK+QETFARI+GYCEQ DIHSP+VTVYESLVYSAWLRLP ++D  T
Sbjct  900   TGGYIDGEIKISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPQDVDEKT  959

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFV+EVM+LVEL  LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  960   RKMFVDEVMELVELGPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1019

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGG+EIYVGPLGRHS 
Sbjct  1020  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSC  1079

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE+  G+ +I++GYNPATWMLE+T+ AQE  LGIDF EVY+NS+LYRRNKALI E
Sbjct  1080  HLIKYFESNPGVAKIKEGYNPATWMLEVTASAQEMMLGIDFTEVYKNSDLYRRNKALISE  1139

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             L  P PGSKDL+F T+YSQSF+TQC+ACLWKQHWSYWRNP YTAVR +FTTF AL+FGTM
Sbjct  1140  LGVPRPGSKDLHFETQYSQSFWTQCVACLWKQHWSYWRNPAYTAVRFIFTTFIALIFGTM  1199

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G K    QDL NAMG MYAAV+FLGVQNA+SVQPVVAIERTVFYRERAAGMYSA+P
Sbjct  1200  FWDLGTKVSKSQDLLNAMGSMYAAVLFLGVQNASSVQPVVAIERTVFYRERAAGMYSAIP  1259

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV IE+P++FVQ++ YG+IVYAMIGFEW   KF W++F M+FTLLYFT YGMM VA
Sbjct  1260  YAFGQVSIEIPYIFVQSVFYGIIVYAMIGFEWDVGKFFWYLFIMFFTLLYFTFYGMMGVA  1319

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPN N+A+I+++ FYG WNLFSGFIIP+ R+PVWWRWYY+  PV+WTLYGL+ASQFGD+
Sbjct  1320  VTPNQNVASIVAAFFYGVWNLFSGFIIPRPRMPVWWRWYYWANPVAWTLYGLVASQFGDI  1379

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             + KL  NETV+ F++ +F F HDF+G VA ++     MF F FAF+IKAFNFQ R
Sbjct  1380  QTKLSDNETVEQFLRRYFGFKHDFLGVVAAVLTAYVFMFAFTFAFAIKAFNFQRR  1434



>ref|XP_002527330.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF35082.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1437

 Score =  2051 bits (5314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1004/1411 (71%), Positives = 1211/1411 (86%), Gaps = 14/1411 (1%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPTY R+R+GIL +  +G    EID++ LG+ EK++L+ERLV++A+EDNE F
Sbjct  41    LKWAALEKLPTYDRLRKGILLSASQGVF-SEIDIDNLGLQEKKTLIERLVKVAEEDNEKF  99

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK+R DRVGI+LPTIEVR+EHLN++AEA  G RALP+  NF+ +I+E  +N+LHILP
Sbjct  100   LLKLKNRIDRVGIELPTIEVRYEHLNIEAEAVSGGRALPSFVNFSISIIEGLLNFLHILP  159

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +R +P  IL DVSGIIKP+RMTLLLGPPSSGKTTLLLALAGKLD +LK SG VTYNG++M
Sbjct  160   SRTRPFTILKDVSGIIKPSRMTLLLGPPSSGKTTLLLALAGKLDPNLKFSGNVTYNGYKM  219

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EF+P+RT+AYI+QHD H+GE+TV+ETLAFSARCQGVG ++E+LAELSRRE   NIKPDP
Sbjct  220   NEFIPQRTAAYISQHDEHMGELTVKETLAFSARCQGVGSQHELLAELSRREIAANIKPDP  279

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDV+MKA + EGQE +VVTDY+LKILGLE+CAD LVG+ MIRGISGGQ+KR+TTGEMLV
Sbjct  280   DIDVFMKAAATEGQETNVVTDYVLKILGLEICADTLVGNAMIRGISGGQKKRVTTGEMLV  339

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTT+QIVN ++Q+ HIL GTAVISLLQPAPETY LFDDIILLS
Sbjct  340   GPARALFMDEISTGLDSSTTYQIVNCLKQTTHILNGTAVISLLQPAPETYNLFDDIILLS  399

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             DGQ+VYQGPR+ VL+FF++MGF+CPERKGVADFLQEVTSRKDQ+QYW RR++ Y FITV 
Sbjct  400   DGQIVYQGPREQVLDFFEYMGFRCPERKGVADFLQEVTSRKDQKQYWARRDQPYRFITVK  459

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EFSEA QS+ VG+++GDEL++PFDKSKSHPAAL+ KKYGV K+ELLKAC SREFLLMKRN
Sbjct  460   EFSEALQSYEVGRRIGDELSIPFDKSKSHPAALATKKYGVGKRELLKACISREFLLMKRN  519

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SF YIFK+ QL++MA +A+T+FLRTEM + ++ DG V++GALF+ V + MFNG +EL+++
Sbjct  520   SFFYIFKLSQLIIMATIAITLFLRTEMDRETLTDGGVYLGALFYTVTIIMFNGMAELSMT  579

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQRDL F+P W+Y+LPTW+LKIPVT VEV +WVC+ YYAIGFDP+ GRFFKQ
Sbjct  580   IAKLPVFYKQRDLLFYPAWSYSLPTWLLKIPVTFVEVGVWVCINYYAIGFDPNIGRFFKQ  639

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               LL+ VNQMAS LFR  AAAGR++IVANTFGS A++ +  LGGF+LSR+++KKWWIW Y
Sbjct  640   YLLLLFVNQMASGLFRFIAAAGRNMIVANTFGSFALLTLFALGGFVLSREEIKKWWIWAY  699

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVTVLRSRGIFPEAHWYWIGVGALVGY  2232
             W+SPLMY QNAI VNE+LG SW H+P  ++E+LGV +L+SRG +P A+WYWIG+GAL+ +
Sbjct  700   WLSPLMYGQNAIVVNEFLGNSWSHIPPNSTESLGVQLLKSRGFYPYAYWYWIGLGALICF  759

Query  2233  VFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgnvvrr  2412
             + + N LF LALT+L+P  K QA++SE++ +   A + G  I+L   G S          
Sbjct  760   LLVFNLLFALALTFLDPFEKRQAVISEDSQSNEPADQTGASIQLRNYGSS----------  809

Query  2413  svssrslssrvgsvnvADPNMKRGMVLPFEPLCITFDEIKYAVDMPTEMKAQGLTEDRLV  2592
                  S +S  G ++  + N K+GMVLPFEP  ITFD++ Y+VDMP EM++QG+ ED+LV
Sbjct  810   ---HISTTSSDGEISEVNHNKKKGMVLPFEPRSITFDDVIYSVDMPQEMRSQGVLEDKLV  866

Query  2593  LLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGSITISGYPKRQETFARI  2772
             LLKG++GAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEG I ISGYPK QETFARI
Sbjct  867   LLKGVSGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGDIRISGYPKNQETFARI  926

Query  2773  AGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATREMFVEEVMDLVELTSLREALVGL  2952
             +GYCEQ DIHSPHVTV ESL+YSAWLRLP E+D+ TR+MFVEEVM+LVEL S++ ALVGL
Sbjct  927   SGYCEQNDIHSPHVTVRESLIYSAWLRLPSEVDSDTRKMFVEEVMELVELDSIKNALVGL  986

Query  2953  PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  3132
             PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC
Sbjct  987   PGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1046

Query  3133  TIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQLIRYFETINGIQRIRDGYNPATW  3312
             TIHQPSIDIF+AFDEL L+KRGGEEIYVGPLGR S  LI+YFE I G+ +I+DGYNPATW
Sbjct  1047  TIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGRQSCHLIKYFEGIEGVSKIKDGYNPATW  1106

Query  3313  MLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQELSKPAPGSKDLYFPTKYSQSFFTQ  3492
             MLE+TS AQE A+GIDF+++Y+NSELYRRNKA+I+ELS PAPG  DLYFPTKYSQSFFTQ
Sbjct  1107  MLEVTSTAQELAMGIDFSDIYKNSELYRRNKAMIKELSVPAPGLNDLYFPTKYSQSFFTQ  1166

Query  3493  CMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMFWGIGPKRRTQQDLFNAMGCMYAA  3672
             C+ACLWKQ  SYWRNPPYTAVR LFT+F AL+FGT+FW +G +R  QQD+FNA G MYAA
Sbjct  1167  CLACLWKQRLSYWRNPPYTAVRFLFTSFIALMFGTIFWDLGSRRSKQQDIFNAAGSMYAA  1226

Query  3673  VVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPHLFVQTLIYGVIV  3852
             V+FLGVQN+ SVQPVVA+ERTVFYRERAAGMYSA+PYA+ QV++E+P+L  Q ++YG I 
Sbjct  1227  VLFLGVQNSASVQPVVAVERTVFYRERAAGMYSAMPYAYAQVLVEIPYLLCQAVVYGTIT  1286

Query  3853  YAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAVTPNHNIAAIISSAFYGFWNLFSG  4032
             YAMIGF+W+ AKF W++FFM+FTLLYFTL+GMM VA TPNH IAAIISSAFYG WNLFSG
Sbjct  1287  YAMIGFDWSIAKFFWYLFFMFFTLLYFTLFGMMCVAATPNHQIAAIISSAFYGIWNLFSG  1346

Query  4033  FIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVKEKLDTNETvkdfvksffdfdhdf  4212
             FIIP+TR+PVWWRWYY+ CPVSWTLYGLIASQFGD++  L+  +T+++F+K ++ F+HDF
Sbjct  1347  FIIPRTRMPVWWRWYYWACPVSWTLYGLIASQFGDMQNALEDKQTIEEFIKDYYGFNHDF  1406

Query  4213  vGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             V  VA +I+G  ++F F F  SIK+FNFQ R
Sbjct  1407  VIVVAGVILGFALLFAFTFGVSIKSFNFQRR  1437



>ref|XP_006601131.1| PREDICTED: putative pleiotropic drug resistance protein 7-like 
[Glycine max]
Length=1446

 Score =  2051 bits (5313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1023/1435 (71%), Positives = 1213/1435 (85%), Gaps = 7/1435 (0%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ ++VFS S RE  E+    LKWAAIE+LPTYLRIRR IL  E+  G  +E+D+++
Sbjct  19    IWRNNSMDVFSTSEREDDEEA---LKWAAIERLPTYLRIRRSILNNED--GKGREVDIKQ  73

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++ ++ERLV+IA+EDNE FLLKL+ R DRVG+D+PTIEVRFEH+NV+A+ YVG R
Sbjct  74    LGLTERKIIVERLVKIAEEDNERFLLKLRERMDRVGLDIPTIEVRFEHINVEAQVYVGGR  133

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP++ NF AN++E F+NYLHI+P+ KKPL IL +VSGIIKP RMTLLLGPP SGKTTLL
Sbjct  134   ALPSMLNFFANVIEGFLNYLHIIPSPKKPLRILQNVSGIIKPRRMTLLLGPPGSGKTTLL  193

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD DL  SGRVTYNGH + EFVP+RTSAYI+Q+D HIGEMTVRETLAFSARCQG
Sbjct  194   LALAGKLDKDLNHSGRVTYNGHGLEEFVPQRTSAYISQYDNHIGEMTVRETLAFSARCQG  253

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG  YEMLAEL RREK   IKPDPDID YMKA ++  Q  SVVTDYILKILGLEVCADI+
Sbjct  254   VGQNYEMLAELLRREKHAKIKPDPDIDAYMKAAALGRQRTSVVTDYILKILGLEVCADIM  313

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD MIRGISGGQ+KR+TTGEMLVGP + LFMDEISTGLDSSTTFQI+NSIRQSIHIL G
Sbjct  314   VGDGMIRGISGGQKKRVTTGEMLVGPIKVLFMDEISTGLDSSTTFQIINSIRQSIHILNG  373

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA++SLLQPAPETYELFDDIILL+DGQ+VYQGPR+NV+EFF+ MGFKCPERKGVADFLQE
Sbjct  374   TALVSLLQPAPETYELFDDIILLTDGQIVYQGPRENVVEFFESMGFKCPERKGVADFLQE  433

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS KDQ QYW R++E Y F+TV EF+EAFQ FH+G+ LG+ELA PFDKSK HP  L+ K
Sbjct  434   VTSIKDQWQYWARKDEPYSFVTVKEFTEAFQLFHIGQNLGEELACPFDKSKCHPNVLTTK  493

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGVNKKELL+ACASREFLLMKRNSFVYIFK+ QL+ +A +  T+FLRT+M +N++ DG 
Sbjct  494   KYGVNKKELLRACASREFLLMKRNSFVYIFKVTQLIYLAVMTTTLFLRTKMHRNTVEDGG  553

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
              +MGALFFAV + MFNG SEL ++I+KLP FYKQRDL F+P WAY+LP WILKIP+ L+E
Sbjct  554   TYMGALFFAVTVAMFNGISELNMAIMKLPVFYKQRDLLFYPAWAYSLPPWILKIPIALIE  613

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VAIW  ++YYAIGFDP+  R  KQ  +++C+NQMAS+LFRL AA GR VIVANT GS A+
Sbjct  614   VAIWEGISYYAIGFDPNFVRLLKQYLIILCINQMASSLFRLMAAFGRDVIVANTVGSFAL  673

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             ++VLVLGGF++SR++V KW++WGYW SPLMY QNAI+VNE+LG SWR V   ++ETLGV 
Sbjct  674   LIVLVLGGFVISRENVHKWFVWGYWSSPLMYGQNAIAVNEFLGHSWRKVTPNSNETLGVL  733

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +L++RG FPEA+WYWIGVGAL+GYVFL NFLF LAL YL+P  K QA LS+E L ERNA 
Sbjct  734   ILKTRGFFPEAYWYWIGVGALIGYVFLYNFLFTLALQYLSPFRKDQAGLSQEKLIERNAS  793

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
                E I  +L  G  S +  +V  +       S   S + A+ + ++GMVLPF+PL +TF
Sbjct  794   TAEELI--QLPNGKISSETKIVEEANLPSRSFSGRLSDDKANRSGRKGMVLPFQPLSLTF  851

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DEIKY+VDMP EMK QG+ E+RL LLKG++G FRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  852   DEIKYSVDMPQEMKKQGVFEERLELLKGVSGVFRPGVLTALMGVSGAGKTTLMDVLAGRK  911

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG ITISGYPKRQETFARI+GYCEQ DIHSP+VTVYESL+YSAWLRLP E+D AT
Sbjct  912   TGGYIEGGITISGYPKRQETFARISGYCEQFDIHSPNVTVYESLLYSAWLRLPREVDHAT  971

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MF+EEVM+LVEL S+REALVGLPG NGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  972   RKMFIEEVMELVELNSIREALVGLPGENGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1031

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTV+TGRTVVCTIHQPSIDIFDAFDELLLLK GGE+IY GPLG H S
Sbjct  1032  DARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFDAFDELLLLKLGGEQIYAGPLGHHCS  1091

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE I G+ +I++GYNPATWMLE+TS   EA+L ++F  VYRNSELYRRNK LI+E
Sbjct  1092  DLIQYFEAIQGVPKIKEGYNPATWMLEVTSAGTEASLKVNFTNVYRNSELYRRNKQLIKE  1151

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P  GS+DL+F ++YSQ+  TQC  CLWKQH SYWRN  YTAVRLLFT   ALLFG +
Sbjct  1152  LSIPPEGSRDLHFDSQYSQTLVTQCKVCLWKQHLSYWRNTSYTAVRLLFTMLIALLFGII  1211

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW IG KRR +QDLFNAMG MYAAV F+GVQN  SVQP++A+ERTVFYRERAAGMYSALP
Sbjct  1212  FWDIGLKRRKEQDLFNAMGSMYAAVTFIGVQNGASVQPIIAVERTVFYRERAAGMYSALP  1271

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YA  QV+IELPH+ VQTL+YG+IVYAM+GF+WT +KFLW++FFMYFT LYFT YGMMT+A
Sbjct  1272  YALAQVIIELPHILVQTLMYGIIVYAMMGFDWTTSKFLWYLFFMYFTFLYFTFYGMMTLA  1331

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             +TPN ++AAI+SSAFY  W+LFSGFIIP +RIP+WW+WYY+ICPV+WTL GL+ASQ+GD 
Sbjct  1332  ITPNAHVAAILSSAFYAIWSLFSGFIIPLSRIPIWWKWYYWICPVAWTLNGLVASQYGDN  1391

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             ++KL+  + V++FVKS+F F+H+F+G VA ++ G  V+F  IFAF IK FNFQ R
Sbjct  1392  RDKLENGQRVEEFVKSYFGFEHEFLGVVAIVVAGFSVLFALIFAFGIKVFNFQKR  1446



>ref|XP_009596530.1| PREDICTED: pleiotropic drug resistance protein 1 [Nicotiana tomentosiformis]
Length=1435

 Score =  2050 bits (5310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1016/1435 (71%), Positives = 1194/1435 (83%), Gaps = 28/1435 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++GVE+FSRSSR+  +++   LKWAA+EKLPT+ R+R+G+L   +  G   E+D+  
Sbjct  29    IWRNNGVEIFSRSSRDEDDEEA--LKWAALEKLPTFDRLRKGLLFGSQ--GAAAEVDIND  84

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+++LLERLV++A EDNE FLLKLK+R DRVGIDLPTIEVR+EHLN+DA+AYVGSR
Sbjct  85    LGFQERKNLLERLVKVADEDNEKFLLKLKNRIDRVGIDLPTIEVRYEHLNIDADAYVGSR  144

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
              LPT  NF  N +E  +N LHILP+RK+ L IL D+SGIIKP RMTLLLGPPSSGKTTLL
Sbjct  145   GLPTFMNFMTNFVETLLNSLHILPSRKRQLTILKDISGIIKPCRMTLLLGPPSSGKTTLL  204

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD  LKV+G+V+YNGHE+ EFVP+RT+AYI+QHDLHIGEMTVRETL FSARCQG
Sbjct  205   LALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEMTVRETLEFSARCQG  264

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG R+EMLAELSRREK  NIKPD DID+YMKA + EGQEA+VVTDY+LKILGL++CAD +
Sbjct  265   VGSRFEMLAELSRREKAANIKPDADIDIYMKAAATEGQEANVVTDYVLKILGLDICADTM  324

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQ+KR+TTGEMLVGPA+ALFMDEISTGLDSSTT+ IVNS+RQS+ IL+G
Sbjct  325   VGDDMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSSTTYSIVNSLRQSVQILKG  384

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TAVISLLQPAPETY LFDDIILLSDG +VYQGPRD+VLEFF+ MGFKCP+RKGVADFLQE
Sbjct  385   TAVISLLQPAPETYNLFDDIILLSDGYIVYQGPRDDVLEFFESMGFKCPQRKGVADFLQE  444

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW +R E Y FIT  EF+EA++SFHVG+KLGDELA PFDK+K HPAAL+N 
Sbjct  445   VTSKKDQQQYWSKRNERYRFITSKEFAEAYESFHVGRKLGDELATPFDKTKCHPAALTND  504

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYG+ KKELLK C  RE LLMKRNSFVY+FK  QL +MA + MT+F RTEMP+++  DG 
Sbjct  505   KYGIGKKELLKVCTERELLLMKRNSFVYMFKFSQLTIMALITMTLFFRTEMPRDTTDDGG  564

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF VIM MFNG SELA++I KLP FYKQRDL FFP WAYALP+WILKIPVTLVE
Sbjct  565   IYAGALFFVVIMIMFNGMSELAMTIFKLPVFYKQRDLLFFPSWAYALPSWILKIPVTLVE  624

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V +WV +TYY IGFDP+  RF K   LLI VNQMAS LFR   A GR++ VA+TFGS A+
Sbjct  625   VGLWVILTYYVIGFDPNISRFLKHFLLLIVVNQMASGLFRFIGAMGRTMGVASTFGSFAL  684

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +L   LGGF+LSRDDVK WWIWGYW SP+MY+ N+I VNE+ GK W H+ SG +ETLG T
Sbjct  685   LLQFALGGFVLSRDDVKSWWIWGYWTSPMMYSVNSILVNEFDGKKWNHIVSGGNETLGTT  744

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             V++SRG FPEA+WYWIGVGALVG+  + NF + LAL +LNP  KPQA+L E+     N  
Sbjct  745   VVKSRGFFPEAYWYWIGVGALVGFTIVFNFCYSLALAFLNPFDKPQAVLPEDGENAEN-V  803

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
             +    I     G S +E                       +  N K+GMVLPFEP  ITF
Sbjct  804   EVSSQITSTDGGDSITE-----------------------SQNNNKKGMVLPFEPHSITF  840

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             D++ Y+VDMP EMK QG  EDRLVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  841   DDVVYSVDMPQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  900

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYI+G I ISGYPK+QETFARI+GYCEQ DIHSP+VTVYESLVYSAWLRLP  +D  T
Sbjct  901   TGGYIDGDIKISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPQNVDETT  960

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFV+EVM+LVEL  LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  961   RKMFVDEVMELVELRPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1020

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMR VRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGG+EIYVGPLGRHS 
Sbjct  1021  DARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSC  1080

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
              LI+YFE+  G+ +I++GYNPATWMLE+T+ AQE  LG+DF +VY+NS+LYRRNKALI E
Sbjct  1081  HLIKYFESNPGVAKIKEGYNPATWMLEVTASAQEMMLGVDFTDVYKNSDLYRRNKALISE  1140

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             L  P PGSKDL+F T+YSQSF+TQCMACLWKQHWSYWRNP YTAVR +FTTF AL+FGTM
Sbjct  1141  LGVPRPGSKDLHFETQYSQSFWTQCMACLWKQHWSYWRNPAYTAVRFIFTTFIALIFGTM  1200

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G K    QDL NAMG MYAAV+FLGVQNA+SVQPVVA+ERTVFYRERAAGMYSA+P
Sbjct  1201  FWDLGTKVSKSQDLLNAMGSMYAAVLFLGVQNASSVQPVVAVERTVFYRERAAGMYSAIP  1260

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAFGQV IE+P++FVQ++ YG+IVYAMIGFEW   KF W++F M+FTLLYFT YGMM+VA
Sbjct  1261  YAFGQVSIEIPYIFVQSVFYGIIVYAMIGFEWDVGKFFWYLFIMFFTLLYFTFYGMMSVA  1320

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPN N+A+I+++ FYG WNLFSGFI+P+ R+PVWWRWYY+  PV+WTLYGL+ASQFGD+
Sbjct  1321  VTPNQNVASIVAAFFYGVWNLFSGFIVPRPRMPVWWRWYYWANPVAWTLYGLVASQFGDI  1380

Query  4141  KEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +  L  NETV+ F++ +F F HDF+G VA ++     +F F FAF+IKAFNFQ R
Sbjct  1381  QTTLSDNETVEQFLRRYFGFKHDFLGVVAAVLTAYVFVFAFTFAFAIKAFNFQRR  1435



>ref|XP_008775866.1| PREDICTED: pleiotropic drug resistance protein TUR2-like isoform 
X1 [Phoenix dactylifera]
Length=1472

 Score =  2049 bits (5309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1000/1435 (70%), Positives = 1207/1435 (84%), Gaps = 27/1435 (2%)
 Frame = +1

Query  73    LKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLGVAEKRSLLERLVRIAQEDNESF  252
             LKWAA+EKLPTY R+R+GIL      G   EIDVE LG  E+++L+ERLVR+A+EDNE F
Sbjct  41    LKWAALEKLPTYNRMRKGILTGAT--GERMEIDVENLGFQERKNLMERLVRVAEEDNEKF  98

Query  253   LLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRALPTIFNFTANILEAFMNYLHILP  432
             LLKLK R DRVGI+ PTIEVRFE+L V AEA VG+  +PT+ NF AN +E  +N L+ILP
Sbjct  99    LLKLKSRLDRVGIENPTIEVRFENLEVHAEALVGNSGVPTVINFFANNIEGLLNSLYILP  158

Query  433   NRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlllalagkldsdlKVSGRVTYNGHEM  612
             +RK+P+ IL+D+SG+IKP+RMTLLLGPPSSGKTT+L ALAGKLD+ LKVSGRVTYNGH M
Sbjct  159   SRKRPMTILNDISGVIKPSRMTLLLGPPSSGKTTMLRALAGKLDTSLKVSGRVTYNGHGM  218

Query  613   TEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVGHRYEMLAELSRREKELNIKPDP  792
              EFVP+RTSAYI+QHDLH+GEMTVRETLAFSARCQGVG RYEML ELSRREK  NIKPDP
Sbjct  219   DEFVPQRTSAYISQHDLHLGEMTVRETLAFSARCQGVGTRYEMLTELSRREKAANIKPDP  278

Query  793   DIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVGDEMIRGISGGQRKRLTTGEMLV  972
             DIDVYMKAIS+EGQE SVVTDYILKILGL++CAD +VGD M+RGISGGQ+KR+TTGEMLV
Sbjct  279   DIDVYMKAISVEGQE-SVVTDYILKILGLDICADTMVGDAMLRGISGGQKKRVTTGEMLV  337

Query  973   GPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTAVISLLQPAPETYELFDDIILLS  1152
             GPARALFMDEISTGLDSSTTFQIVNS+RQS+HIL GTA+I+LLQPAPETY+LFDDIILLS
Sbjct  338   GPARALFMDEISTGLDSSTTFQIVNSLRQSVHILGGTALIALLQPAPETYDLFDDIILLS  397

Query  1153  DGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVTSRKDQEQYWMRREEAYEFITVG  1332
             +GQ+VYQGPR++VLEFF+ MGF+CPERKGVADFLQEVTSRKDQ+QYW RR+E Y FI V 
Sbjct  398   EGQIVYQGPREHVLEFFESMGFRCPERKGVADFLQEVTSRKDQQQYWARRDEPYRFIPVK  457

Query  1333  EFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKYGVNKKELLKACASREFLLMKRN  1512
             EF++AF SFHVG++L  EL+ PFDKS++HPAAL+  +YG++K+ELLKAC +REFLLMKRN
Sbjct  458   EFADAFLSFHVGRRLEIELSTPFDKSRNHPAALTTSRYGISKRELLKACMAREFLLMKRN  517

Query  1513  SFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTVFMGALFFAVIMTMFNGFSELALS  1692
             SFVYIFK+ QL L+A +AMTVFLRT+M  +   DG V+MGALF  +I  +FNGF+ELA+S
Sbjct  518   SFVYIFKLFQLCLIATIAMTVFLRTKMGHSDTEDGLVYMGALFIGIITHLFNGFAELAMS  577

Query  1693  ILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQ  1872
             I KLP FYKQRDL F+P WAYALP WILKIP++ +E  ++V MTYY IGFDP+  R F+Q
Sbjct  578   IAKLPVFYKQRDLLFYPGWAYALPAWILKIPISFLECGLYVAMTYYVIGFDPNVQRMFRQ  637

Query  1873  LFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAMILVLVLGGFILSRDDVKKWWIWGY  2052
               +   V+QMAS LFRL AA GR ++VANTFGS A ++++VLGGF++SR D++KWWIWGY
Sbjct  638   FLIFALVSQMASGLFRLLAACGREMVVANTFGSFAQLVLIVLGGFVISRKDIRKWWIWGY  697

Query  2053  WISPLMYAQNAISVNEYLGKSWRHVPSGT--SETLGVTVLRSRGIFPEAHWYWIGVGALV  2226
             W SPLMYAQNAI+VNE+LGK WR+V + T  +ETLGV VL SRG+FP+A WYWIGVGAL+
Sbjct  698   WSSPLMYAQNAIAVNEFLGKKWRYVVNATASTETLGVQVLESRGLFPQAKWYWIGVGALL  757

Query  2227  GYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNACKRGEPIELELKGGSTSEKgn--  2400
             GY+ + NF F +AL+YL+P+GK Q ++SEE L E+ A + GE +EL  +  ++S      
Sbjct  758   GYIVVFNFFFTVALSYLDPIGKGQTVISEEALKEKQANRTGESVELPTRERNSSHPSEGQ  817

Query  2401  -------------------vvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITFD  2523
                                 +  +  S S ++ +     A+ N ++GMVLPF PL +TFD
Sbjct  818   FNKKVRNLIYRNTDAYLQIHMTAARGSGSRTTGMEISTEANQNRRKGMVLPFVPLSLTFD  877

Query  2524  EIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRKT  2703
             ++KY+VDMP EMKAQG+TEDRL LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRKT
Sbjct  878   DVKYSVDMPQEMKAQGVTEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  937

Query  2704  GGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTATR  2883
             GGYIEGSI ISGYPK+QETFARI+GYCEQ DIHSPHVT+YESLVYSAWLRLPPE+D++ R
Sbjct  938   GGYIEGSIKISGYPKKQETFARISGYCEQNDIHSPHVTIYESLVYSAWLRLPPEVDSSRR  997

Query  2884  EMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  3063
             +MF+EEVM+LVELT LR+A+VGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  998   KMFIEEVMELVELTPLRKAMVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1057

Query  3064  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSSQ  3243
             ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGGEEIYVGPLG +S +
Sbjct  1058  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGHNSCE  1117

Query  3244  LIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQEL  3423
             LI+YFE I+G+ +I+DGYNPATWMLE+TS AQE  LG++F EVY+NS+L+RRNKALIQEL
Sbjct  1118  LIKYFEGISGVAKIKDGYNPATWMLEVTSMAQEEILGVNFVEVYKNSDLFRRNKALIQEL  1177

Query  3424  SKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTMF  3603
             S P PGSKDLYFP +Y+Q    QC+AC WKQ+ SYWRNP Y A+RL FTT  AL+FGT+F
Sbjct  1178  STPPPGSKDLYFPAQYAQPSLIQCIACFWKQYKSYWRNPSYNAIRLFFTTVIALMFGTIF  1237

Query  3604  WGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALPY  3783
             W +G K  TQQDLFNA G MY AV+F+G+QN+ +VQP+V +ERTVFYRE+AAGMYSALPY
Sbjct  1238  WRLGSKTTTQQDLFNATGSMYCAVMFIGIQNSQTVQPIVDVERTVFYREKAAGMYSALPY  1297

Query  3784  AFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVAV  3963
             AF QV IE+P+ F+QT++YG++VY+MI F+WTAAKF+W+IFFM+FT LYFT YGMM VA+
Sbjct  1298  AFAQVAIEIPYTFLQTVVYGLLVYSMINFDWTAAKFMWYIFFMFFTFLYFTYYGMMAVAL  1357

Query  3964  TPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDVK  4143
             TPN NIAAI+S+AFY  WNLF+GF+IP+ RIPVWWRWYY+ CP+SWTLYGL+ASQFGD+ 
Sbjct  1358  TPNSNIAAIVSTAFYAIWNLFAGFVIPRPRIPVWWRWYYWACPISWTLYGLLASQFGDMG  1417

Query  4144  E-KLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             +  +DT ETVK FV+ +F ++HDF+G VA  ++   V+F  +F+F +K  NFQ R
Sbjct  1418  DTTMDTGETVKHFVRRYFGYEHDFLGAVAAAVIAFPVLFATVFSFGVKVLNFQRR  1472



>emb|CBI36223.3| unnamed protein product [Vitis vinifera]
Length=1707

 Score =  2049 bits (5309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1013/1397 (73%), Positives = 1195/1397 (86%), Gaps = 16/1397 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG EVFSRSSR+  +++   LKWAA+EKLPTY R+R+G+L   E  G   E+D+  
Sbjct  173   IWRNSGAEVFSRSSRDEDDEEA--LKWAALEKLPTYNRLRKGLLIGSE--GEASEVDIHN  228

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+++L+ERLV+IA+EDNE FLLKLK+R DRVGIDLP IEVRFEHL +DAEA+VGSR
Sbjct  229   LGPQERKNLVERLVKIAEEDNEKFLLKLKNRMDRVGIDLPEIEVRFEHLTIDAEAHVGSR  288

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  N   N +E  +N L ILP+RKK   ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  289   ALPSFINSVFNQIEDILNTLRILPSRKKKFTILHDVSGIIKPGRMTLLLGPPSSGKTTLL  348

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LAL+GKLDS LKV+GRVTYNGH M EFVP+RT+AYI+Q D HIGEMTVRETLAFSARCQG
Sbjct  349   LALSGKLDSSLKVTGRVTYNGHGMNEFVPQRTAAYISQLDTHIGEMTVRETLAFSARCQG  408

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+ML ELSRREK  NIKPDPDIDV+MKA + EGQ+ +V+TDY LKILGLE+CAD +
Sbjct  409   VGDRYDMLVELSRREKAANIKPDPDIDVFMKAAAAEGQKENVITDYTLKILGLEICADTM  468

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTT+QIVNS+RQ++HIL G
Sbjct  469   VGDEMVRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLRQTVHILNG  528

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSD +++YQGPR++VL FF+ MGF+CPERKGVADFLQE
Sbjct  529   TALISLLQPAPETYDLFDDIILLSDSRIIYQGPREDVLNFFESMGFRCPERKGVADFLQE  588

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTSRKDQEQYW  ++E Y F+T  EF+EAFQSFH G+KLGDELA PFDK+KSHPAAL  +
Sbjct  589   VTSRKDQEQYWAHKDEPYSFVTAKEFAEAFQSFHFGRKLGDELATPFDKTKSHPAALKTE  648

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKELL AC SRE+LLMKRNSFVYIFK+ QL ++A +AMT+FLRTEM KN+  DG 
Sbjct  649   KYGVRKKELLDACISREYLLMKRNSFVYIFKLTQLTIVAMIAMTIFLRTEMHKNTTEDGN  708

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF V+M MFNG SELA++ILKLP FYKQR L F+P WAYALP+W LKIP+T VE
Sbjct  709   IYTGALFFTVMMVMFNGMSELAMTILKLPVFYKQRGLLFYPAWAYALPSWFLKIPITFVE  768

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V +WV +TYY IGFDP+ GR F+Q  LL+ +NQ AS+LFR  AAA RS+IVANTFGS A+
Sbjct  769   VGVWVFITYYVIGFDPNVGRLFRQYLLLLLLNQTASSLFRFIAAACRSMIVANTFGSFAL  828

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSW-RHVPSGTSETLGV  2157
             +L   LGG +LSR++VKKWWIWGYW SP+MYAQNAI VNE+LGKSW ++  + ++E+LGV
Sbjct  829   VLPFALGGIVLSRENVKKWWIWGYWSSPMMYAQNAILVNEFLGKSWSKNASTNSTESLGV  888

Query  2158  TVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNA  2337
              VL++RG F EAHWYWIG GAL+G++F+ NF + +ALTYLNP  KPQA+++ E+    NA
Sbjct  889   AVLKARGFFTEAHWYWIGAGALLGFIFVFNFCYTVALTYLNPFEKPQAVITVES---DNA  945

Query  2338  CKRGEPIEL--ELKGG----STSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPF  2499
                G+ IEL    KG     +++E G  + RS+SS S S R  ++  A  N K+GMVLPF
Sbjct  946   KTEGK-IELSSHRKGSIDQTASTESGEEIGRSISSVSSSVRAEAIAEARRNNKKGMVLPF  1004

Query  2500  EPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLM  2679
             +PL ITFD+I+Y+VDMP EMK+QG+ EDRL LLKG++GAFRPGVLTALMG+SGAGKTTLM
Sbjct  1005  QPLSITFDDIRYSVDMPEEMKSQGVPEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  1064

Query  2680  DVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLP  2859
             DVLAGRKTGGYIEGSI+ISGYPK+QETFARI+GYCEQ DIHSPHVTV+ESL+YSAWLRLP
Sbjct  1065  DVLAGRKTGGYIEGSISISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLP  1124

Query  2860  PEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  3039
             P +D  TR+MF+EEVM+LVELT LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM
Sbjct  1125  PNVDAETRKMFIEEVMELVELTPLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  1184

Query  3040  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVG  3219
             DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGG+EIY+G
Sbjct  1185  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGQEIYMG  1244

Query  3220  PLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRR  3399
             PLGRHSS LI+YFE I G+ +I+DGYNPATWMLE+T+ AQE  LG+DF E+Y  S+LYRR
Sbjct  1245  PLGRHSSHLIKYFEGIEGVSKIKDGYNPATWMLEVTASAQELILGVDFTEIYEKSDLYRR  1304

Query  3400  NKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFN  3579
             NK LI+ELS+P PGSKDLYFPT+YSQSFFTQCMACLWKQ  SYWRNPPYTAVR  FTTF 
Sbjct  1305  NKDLIKELSQPTPGSKDLYFPTQYSQSFFTQCMACLWKQRLSYWRNPPYTAVRFFFTTFV  1364

Query  3580  ALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAA  3759
             AL+FGTMFW +G KR  QQD+ NAMG MYAAV+FLG QN  SVQPVVA+ERTVFYRERAA
Sbjct  1365  ALMFGTMFWDLGTKRTRQQDISNAMGSMYAAVLFLGFQNGQSVQPVVAVERTVFYRERAA  1424

Query  3760  GMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftl  3939
             GMYSA+PYAF Q ++E+P++F Q ++YGVIVYAMIGFEWTAAKF W++FFM+F+LLYFT 
Sbjct  1425  GMYSAMPYAFAQALVEIPYVFSQAVVYGVIVYAMIGFEWTAAKFFWYLFFMFFSLLYFTF  1484

Query  3940  yGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLI  4119
             YGMM VA TPN +IAAI++S+FY  WNLFSGFI+P+ RIPVWWRWYY+ CPV+W+LYGL+
Sbjct  1485  YGMMAVAATPNQHIAAIVASSFYTLWNLFSGFIVPRNRIPVWWRWYYWACPVAWSLYGLV  1544

Query  4120  ASQFGDVKEK-LDTNET  4167
              SQFGD+++  LD+N T
Sbjct  1545  TSQFGDIEDTLLDSNVT  1561



>gb|KDP36998.1| hypothetical protein JCGZ_06054 [Jatropha curcas]
Length=1442

 Score =  2049 bits (5308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1003/1439 (70%), Positives = 1214/1439 (84%), Gaps = 24/1439 (2%)
 Frame = +1

Query  7     RSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKLG  186
             R++GV+VFSRSSRE  +++   LKWAA+EKLPTY R+R+GIL +  +G    EID++ LG
Sbjct  22    RNNGVDVFSRSSREEDDEEA--LKWAALEKLPTYDRLRKGILVSVSKGE-MHEIDIDDLG  78

Query  187   VAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRAL  366
               E+++L++RLVR+A+EDNE FLLKLK+R DRVGI++PTIEVRFEHLN++AE +VGSRAL
Sbjct  79    FQERKTLVDRLVRVAEEDNEKFLLKLKNRIDRVGIEIPTIEVRFEHLNIEAEVHVGSRAL  138

Query  367   PTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttllla  546
             PT  NF+ANI+E F+N LHILP+RKK L IL DVSG+IKP+RMTLLLGPPSSGKTTLLLA
Sbjct  139   PTFVNFSANIVEGFLNSLHILPSRKKQLTILKDVSGVIKPSRMTLLLGPPSSGKTTLLLA  198

Query  547   lagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGVG  726
             LAGKLD +LK SG VTYNGH M EF+P+RT+AYI+QHDLHIGEMTVRETLAFSARCQGVG
Sbjct  199   LAGKLDPNLKFSGSVTYNGHGMNEFIPQRTAAYISQHDLHIGEMTVRETLAFSARCQGVG  258

Query  727   HRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILVG  906
              +++MLAELSRREK  NIKPDPDIDV+MKA + EGQ+ +VVTDYILKILGLE+CAD LVG
Sbjct  259   TQHDMLAELSRREKIANIKPDPDIDVFMKAAATEGQDTNVVTDYILKILGLEICADTLVG  318

Query  907   DEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGTA  1086
             DEM+RGISGGQRKR+TTGEMLVGPA+ALFMDEISTGLDSSTT+QIVNS++QSIHIL GTA
Sbjct  319   DEMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTYQIVNSLKQSIHILNGTA  378

Query  1087  VISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEVT  1266
             V+SLLQPAPETY+LFDDIILLSDGQ+VYQGPRD+VL FF++MGF CPERKGVADFLQEVT
Sbjct  379   VVSLLQPAPETYDLFDDIILLSDGQIVYQGPRDDVLGFFEYMGFGCPERKGVADFLQEVT  438

Query  1267  SRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKKY  1446
             SRKDQ+QYW  +++ Y F+TV EF+ AFQS+ +G+K+  +L++PFDK++SHPAAL+ +KY
Sbjct  439   SRKDQQQYWTCKDQPYSFVTVPEFTRAFQSYEIGQKIEHDLSIPFDKTRSHPAALATRKY  498

Query  1447  GVNKKELLKACASREFLLMKRNSFVYIFKM----IQLVLMAFVAMTVFLRTEMPKNSIAD  1614
             GV K ELLKAC SRE+LLMKRNSFVYIFK+     QL +MA + MT+FLRT M ++ + D
Sbjct  499   GVGKIELLKACFSREYLLMKRNSFVYIFKIGQFCYQLTVMAIITMTLFLRTNMHRDDVTD  558

Query  1615  GTVFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTL  1794
             G +++GALFF V+M +FNG SE++++I+KLP FYKQRD  F+P WAY+LP WILKIP+T 
Sbjct  559   GGIYLGALFFTVVMVLFNGMSEISMTIVKLPVFYKQRDFLFYPSWAYSLPIWILKIPITF  618

Query  1795  VEVAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSC  1974
             +E+A+WV +TYYAIGFDP+ GR FKQ  LL+   QM+SALFR  A+ GR++IVANTFGS 
Sbjct  619   LEIAVWVFITYYAIGFDPNVGRLFKQYLLLLLFTQMSSALFRFIASVGRNMIVANTFGSF  678

Query  1975  AMILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLG  2154
             A++ ++ LGG ILSR+DVKKWWIWGYW+SP+MY QNA+ VNE+LGKSW H+P+ + E LG
Sbjct  679   ALLTLVALGGVILSREDVKKWWIWGYWMSPVMYGQNAVVVNEFLGKSWSHIPAKSEEPLG  738

Query  2155  VTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERN  2334
             + V++SRG FPEAHWYW+G+GA  G++ + N    LAL +LNP  KPQA +SEE+ A R+
Sbjct  739   IQVMKSRGFFPEAHWYWLGLGASAGFILVFNICSTLALHFLNPFEKPQAFISEES-APRD  797

Query  2335  ACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCI  2514
               +      ++L    +S++      +  +             + N K+GMVL  EP C+
Sbjct  798   KTEGA----IQLSQAESSDRTKTEIEASGNDE----------VNHNKKKGMVLQIEPHCL  843

Query  2515  TFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAG  2694
             TFD + Y+VDMP EMK+QG+ ED+LVLLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAG
Sbjct  844   TFDNVVYSVDMPQEMKSQGVLEDKLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  903

Query  2695  RKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDT  2874
             RKTGGYIEGSITISGYPK+QETFARI+GYCEQ DIH+PHVTVYESL++SAWLRL PEID+
Sbjct  904   RKTGGYIEGSITISGYPKKQETFARISGYCEQNDIHAPHVTVYESLLFSAWLRLAPEIDS  963

Query  2875  ATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  3054
             +TR+MFV+E+M+LVEL  LR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS
Sbjct  964   STRDMFVDEIMELVELNPLRHALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  1023

Query  3055  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRH  3234
             GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL LLKRGGEEIYVGPLGRH
Sbjct  1024  GLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLLKRGGEEIYVGPLGRH  1083

Query  3235  SSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALI  3414
             S  LI+YFE + G+ +I+DGYNPATWMLE+TS AQE ALG+DF+ +Y+NSELYRRN A+I
Sbjct  1084  SYHLIKYFEEVEGVSKIKDGYNPATWMLEVTSSAQELALGVDFSAIYKNSELYRRNIAVI  1143

Query  3415  QELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFG  3594
              ELS PAPGSKDLYF T+YSQSF TQC+ACLWKQ  SYWRNPPYTA+R LFT F AL+FG
Sbjct  1144  NELSTPAPGSKDLYFSTQYSQSFLTQCIACLWKQRLSYWRNPPYTAIRFLFTIFIALMFG  1203

Query  3595  TMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSA  3774
             T+FW +G K   QQDL N+ G +YAAV+FLGVQN +SVQPVVA+ERTVFYRERAAGMYSA
Sbjct  1204  TIFWNLGSKTGKQQDLSNSTGSLYAAVLFLGVQNGSSVQPVVAVERTVFYRERAAGMYSA  1263

Query  3775  LPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMT  3954
             LPYA+ QV++ELP++F Q  +YG+I YAMIGFEWTAAKF W+IFFMYFTLLYFT YGMM 
Sbjct  1264  LPYAYAQVIVELPYIFCQAFVYGLITYAMIGFEWTAAKFFWYIFFMYFTLLYFTYYGMMA  1323

Query  3955  VAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFG  4134
             VAVTPN++IA+I+SSAFY  WN+FSGF+IP+ R+PVWWRWYY+ CPV+WTLYGL+ASQ+G
Sbjct  1324  VAVTPNYHIASIVSSAFYAIWNIFSGFVIPRPRMPVWWRWYYWGCPVAWTLYGLLASQYG  1383

Query  4135  DVKEKLDTNETvkdfvksffd--fdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
             D+K+ L+  +               HDF+G VA +I GI V+F FIFA SI++FNFQ R
Sbjct  1384  DIKDPLEDGDQQPVQDFLREYYGIKHDFLGKVAVVIPGIAVLFAFIFAVSIRSFNFQRR  1442



>ref|XP_010654719.1| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis 
vinifera]
Length=1459

 Score =  2048 bits (5307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1026/1443 (71%), Positives = 1215/1443 (84%), Gaps = 16/1443 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR+SG EVFSRSSR+  +++   LKWAA+EKLPTY R+R+G+L   E  G   E+D+  
Sbjct  25    IWRNSGAEVFSRSSRDEDDEEA--LKWAALEKLPTYNRLRKGLLIGSE--GEASEVDIHN  80

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG  E+++L+ERLV+IA+EDNE FLLKLK+R DRVGIDLP IEVRFEHL +DAEA+VGSR
Sbjct  81    LGPQERKNLVERLVKIAEEDNEKFLLKLKNRMDRVGIDLPEIEVRFEHLTIDAEAHVGSR  140

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  N   N +E  +N L ILP+RKK   ILHDVSGIIKP RMTLLLGPPSSGKTTLL
Sbjct  141   ALPSFINSVFNQIEDILNTLRILPSRKKKFTILHDVSGIIKPGRMTLLLGPPSSGKTTLL  200

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LAL+GKLDS LKV+GRVTYNGH M EFVP+RT+AYI+Q D HIGEMTVRETLAFSARCQG
Sbjct  201   LALSGKLDSSLKVTGRVTYNGHGMNEFVPQRTAAYISQLDTHIGEMTVRETLAFSARCQG  260

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RY+ML ELSRREK  NIKPDPDIDV+MKA + EGQ+ +V+TDY LKILGLE+CAD +
Sbjct  261   VGDRYDMLVELSRREKAANIKPDPDIDVFMKAAAAEGQKENVITDYTLKILGLEICADTM  320

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGDEM+RGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTT+QIVNS+RQ++HIL G
Sbjct  321   VGDEMVRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLRQTVHILNG  380

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSD +++YQGPR++VL FF+ MGF+CPERKGVADFLQE
Sbjct  381   TALISLLQPAPETYDLFDDIILLSDSRIIYQGPREDVLNFFESMGFRCPERKGVADFLQE  440

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             V++ +   QYW  ++           +EAFQSFH G+KLGDELA PFDK+KSHPAAL  +
Sbjct  441   VSANRRSXQYWAHKDXXXXXXXXXXXAEAFQSFHFGRKLGDELATPFDKTKSHPAALKTE  500

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV KKELL AC SRE+LLMKRNSFVYIFK+ QL ++A +AMT+FLRTEMPKN+  DG 
Sbjct  501   KYGVGKKELLDACISREYLLMKRNSFVYIFKLTQLTIVAMIAMTIFLRTEMPKNTTEDGI  560

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++ GALFF V+  MFNG SELA++ILKLP FYKQR L F+P WAYALP+W LKIP+T VE
Sbjct  561   IYTGALFFTVMKVMFNGMSELAMTILKLPVFYKQRGLLFYPAWAYALPSWFLKIPITFVE  620

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             V +WV +TYY IGFDP+ GR F+Q  LL+ +NQ AS+LFR  AAA RS+IVANTFGS A+
Sbjct  621   VGLWVFITYYVIGFDPNVGRLFRQYLLLLLLNQTASSLFRFIAAACRSMIVANTFGSFAL  680

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSW-RHVPSGTSETLGV  2157
             +L   LGGF+LSR+ VKKWWIWGYW SP+MYAQNAI VNE+LGKSW ++  + ++E+LGV
Sbjct  681   VLPFALGGFVLSRESVKKWWIWGYWSSPMMYAQNAIVVNEFLGKSWSKNASTNSTESLGV  740

Query  2158  TVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNA  2337
              VL++RG F EAHWYWIG GAL+G++F+ NF + +ALTYLNP  KP+A+++ E+    NA
Sbjct  741   AVLKARGFFTEAHWYWIGAGALLGFIFVFNFCYTVALTYLNPFEKPRAVITVES---DNA  797

Query  2338  CKRGEPIEL--ELKGG----STSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPF  2499
                G+ IEL    KG     +++E G  + RS+SS S S R  ++  A  N K+GMVLPF
Sbjct  798   KTEGK-IELSSHRKGSIDQTASTESGEEIGRSISSVSSSVRAEAIAEARRNNKKGMVLPF  856

Query  2500  EPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLM  2679
             +PL ITFD+I+Y+VDMP EMK+QG+ EDRL LLKG++GAFRPGVLTALMG+SGAGK+TLM
Sbjct  857   QPLSITFDDIRYSVDMPEEMKSQGVPEDRLELLKGVSGAFRPGVLTALMGVSGAGKSTLM  916

Query  2680  DVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLP  2859
             DVLAGRKTGGYIEGSI+ISGYPK+QETFARI+GYCEQ DIHSPHVTV+ESL+YSAWLRLP
Sbjct  917   DVLAGRKTGGYIEGSISISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLP  976

Query  2860  PEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  3039
             P +D  TR+MF+EEVMDLVELT LR ALVGLPGVNGLS EQRKRLTIAVELVANPSIIFM
Sbjct  977   PNVDAETRKMFIEEVMDLVELTPLRGALVGLPGVNGLSIEQRKRLTIAVELVANPSIIFM  1036

Query  3040  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVG  3219
             DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGG+EIY+G
Sbjct  1037  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGQEIYMG  1096

Query  3220  PLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRR  3399
             PLGRHSS LI+YFE I G+ +I+DGYNPATWMLE+T+ AQE  LG+DF E+Y  S++YRR
Sbjct  1097  PLGRHSSHLIKYFEGIEGVSKIKDGYNPATWMLEVTASAQELILGVDFTEIYEKSDIYRR  1156

Query  3400  NKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFN  3579
             NK LI+ELS+P PGSKDLYFPT+YSQSFFTQCMACLWKQ  SYWRNPPYTAVR  FTTF 
Sbjct  1157  NKDLIKELSQPTPGSKDLYFPTQYSQSFFTQCMACLWKQRLSYWRNPPYTAVRFFFTTFV  1216

Query  3580  ALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAA  3759
             AL+FGTMFW +G KR  QQD+ NAMG MYAAV+FLG QN  SVQPVVA+ERTVFYRERAA
Sbjct  1217  ALMFGTMFWDLGTKRTRQQDISNAMGSMYAAVLFLGFQNGQSVQPVVAVERTVFYRERAA  1276

Query  3760  GMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftl  3939
             GMYSA+PYAF Q ++E+P++F Q + YGVIVYAMIGFEWTAAKF W++FFM+FTLLYFT 
Sbjct  1277  GMYSAMPYAFAQALVEIPYVFSQAVAYGVIVYAMIGFEWTAAKFFWYLFFMFFTLLYFTF  1336

Query  3940  yGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLI  4119
             YGMM VA TPN +IAAI++ AFY  WNLFSGFI+P+ RIPVWWRWYY+ CPV+W+LYGL+
Sbjct  1337  YGMMAVAATPNQHIAAIVALAFYTLWNLFSGFIVPRNRIPVWWRWYYWACPVAWSLYGLV  1396

Query  4120  ASQFGDVKEK-LDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNF  4296
              SQFGD+++  LD+N TVK ++  +  F HDF+G VA +IVG  V+F FIFAF+IKAFNF
Sbjct  1397  TSQFGDIEDTLLDSNVTVKQYLDDYLGFKHDFLGVVAVVIVGFTVLFLFIFAFAIKAFNF  1456

Query  4297  QTR  4305
             Q R
Sbjct  1457  QRR  1459



>ref|XP_006596115.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Glycine max]
Length=1454

 Score =  2048 bits (5306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1027/1443 (71%), Positives = 1222/1443 (85%), Gaps = 15/1443 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ ++VFS S RE  ED    LKWAAIE+LPTYLRI+R IL  E+  G  +E+D+++
Sbjct  19    IWRNNNMDVFSTSEREDDEDA---LKWAAIERLPTYLRIQRSILNNED--GKGREVDIKQ  73

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++ LLERLV+IA+EDNE FLLKL+ R DRVG+D+PTIEVRFEH+NV+A+ YVG R
Sbjct  74    LGLTERKILLERLVKIAEEDNERFLLKLRERMDRVGLDIPTIEVRFEHINVEAQVYVGGR  133

Query  361   ALPTIFNFTANILE-------AFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPS  519
             ALP++ NF AN+LE        F+NYLHI+P+ KKPL IL ++SGIIKP RMTLLLGPP 
Sbjct  134   ALPSMLNFFANVLEDLFFLPKGFLNYLHIIPSPKKPLRILQNISGIIKPRRMTLLLGPPG  193

Query  520   sgkttlllalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLA  699
             SGKTTLLLALAGKL  DLK SGRVTYNGHE+ EFVP+RTSAYI+Q+D HIGEMTVRETLA
Sbjct  194   SGKTTLLLALAGKLGKDLKHSGRVTYNGHELEEFVPQRTSAYISQYDNHIGEMTVRETLA  253

Query  700   FSARCQGVGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGL  879
             FSARCQGVG  YE+LAEL RREK+  IKPDPDID YMKA ++  Q  SVVTDYILKILGL
Sbjct  254   FSARCQGVGQNYEILAELLRREKQAKIKPDPDIDSYMKAAALGRQRTSVVTDYILKILGL  313

Query  880   EVCADILVGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQ  1059
             EVCADI+VGD MIRGISGGQ+KR+TTGEMLVGP + LFMDEISTGLDSSTTFQI+NSIRQ
Sbjct  314   EVCADIMVGDGMIRGISGGQKKRVTTGEMLVGPIKVLFMDEISTGLDSSTTFQIINSIRQ  373

Query  1060  SIHILQGTAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKG  1239
             SIHIL GTA++SLLQPAPETYELFDDIILL+DGQ+VYQGPR+NVLEFF+ MGFKCPERKG
Sbjct  374   SIHILNGTALVSLLQPAPETYELFDDIILLTDGQIVYQGPRENVLEFFESMGFKCPERKG  433

Query  1240  VADFLQEVTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSH  1419
             VADFLQEVTS+KDQ QYW+R++E Y F+TV +F+EAFQ FH+G+ LG+ELA PFD+SKSH
Sbjct  434   VADFLQEVTSKKDQWQYWVRKDEPYSFVTVKDFAEAFQLFHIGQNLGEELASPFDRSKSH  493

Query  1420  PAALSNKKYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPK  1599
             P  L+ KKYGVNKKELL+ACASREFLLMKRNSFVYIFK+ QL+ +A +  T+FLRT+M +
Sbjct  494   PNVLTTKKYGVNKKELLRACASREFLLMKRNSFVYIFKVTQLIYLAIITTTLFLRTKMHR  553

Query  1600  NSIADGTVFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILK  1779
             +++ DG  +MGALFFAV + MFNG SEL ++I+KLP FYKQRDL F+P WAY+LP WILK
Sbjct  554   DTVEDGGAYMGALFFAVTVAMFNGISELNMAIMKLPVFYKQRDLLFYPAWAYSLPPWILK  613

Query  1780  IPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVAN  1959
             IP+TL+EVAIW  ++YYAIGFDP   R  KQ  +++C+NQMAS+LFRL AA GR VIVAN
Sbjct  614   IPITLIEVAIWEGISYYAIGFDPSLVRLLKQYLIILCINQMASSLFRLMAAFGRDVIVAN  673

Query  1960  TFGSCAMILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGT  2139
             T GS A+++VLVLGGF++SR++V KW++WGYW SPLMY QNAI+VNE+LG SWR V   +
Sbjct  674   TAGSFALLIVLVLGGFVISRENVHKWFLWGYWSSPLMYGQNAIAVNEFLGHSWRKVTPNS  733

Query  2140  SETLGVTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAM-LSEE  2316
             +ETLGV +L++RG FPEA+WYWIGVGAL+GYVFL NFLF LAL YL+P  K QA  LS+E
Sbjct  734   NETLGVLILKTRGFFPEAYWYWIGVGALIGYVFLYNFLFTLALQYLSPFRKDQASGLSQE  793

Query  2317  TLAERNACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLP  2496
              L ERNA    E I+L  KG S+SE  N+V  +       S   S + A  + +RGMVLP
Sbjct  794   KLLERNASTAEELIQLP-KGNSSSE-TNIVEEANIPSRSFSGRISDDKASGSGRRGMVLP  851

Query  2497  FEPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTL  2676
             F+PL +TFDE+KY+VDMP EMK QG+ E+RL LLKG++G FRPGVLTALMG+SGAGKTTL
Sbjct  852   FQPLSLTFDEMKYSVDMPQEMKKQGVFEERLELLKGVSGVFRPGVLTALMGVSGAGKTTL  911

Query  2677  MDVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRL  2856
             MDVLAGRKTGGYIEGSITISGYPKRQETFARI+GYCEQ DIHSP+VTVYESL+YSAWLRL
Sbjct  912   MDVLAGRKTGGYIEGSITISGYPKRQETFARISGYCEQFDIHSPNVTVYESLLYSAWLRL  971

Query  2857  PPEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  3036
             P E+D ATR+MF+EEVM+LVEL S+REALVGLPG NGLSTEQRKRLTIAVELVANPSIIF
Sbjct  972   PREVDRATRKMFIEEVMELVELNSIREALVGLPGENGLSTEQRKRLTIAVELVANPSIIF  1031

Query  3037  MDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYV  3216
             MDEPTSGLDARAAAIVMRTVRNTV+TGRTVVCTIHQPSIDIFDAFDELLLLK GGE+IY 
Sbjct  1032  MDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFDAFDELLLLKLGGEQIYA  1091

Query  3217  GPLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYR  3396
             GPLGRH S LI+YFE I G+ +I++GYNPATWMLE+TS   EA++ ++F  VYRNSELY 
Sbjct  1092  GPLGRHCSHLIQYFEAIQGVPKIKEGYNPATWMLEVTSAGTEASIKVNFTNVYRNSELYG  1151

Query  3397  RNKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTF  3576
             RNK LIQELS P  GS+DL+F ++YSQ+  TQC ACLWKQH SYWRN  YTAVRLLFT  
Sbjct  1152  RNKQLIQELSIPPQGSRDLHFDSQYSQTLVTQCKACLWKQHLSYWRNTSYTAVRLLFTML  1211

Query  3577  NALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERA  3756
              ALLFG +FW IG KR  +QDLFNAMG MYAAV F+GVQN  SVQP++A+ERTVFYRERA
Sbjct  1212  IALLFGIIFWDIGLKRSKEQDLFNAMGSMYAAVTFIGVQNGASVQPIIAVERTVFYRERA  1271

Query  3757  AGMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyft  3936
             AGMYSALPYA  QV+IELPH+ VQ L+YG+IVYAM+GF+WT +KFLW++FFMYFT LY+T
Sbjct  1272  AGMYSALPYALAQVIIELPHILVQALMYGIIVYAMMGFDWTTSKFLWYLFFMYFTFLYYT  1331

Query  3937  lyGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGL  4116
              YGMMT+A+TPN ++AAI+SSAFY  W+LFSGF+IP +RIP+WW+WYY+ICPV+WTL GL
Sbjct  1332  FYGMMTMAITPNAHVAAILSSAFYAIWSLFSGFVIPLSRIPIWWKWYYWICPVAWTLNGL  1391

Query  4117  IASQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNF  4296
             +ASQ+GD ++KL+  + V++FVKS+F F+HDF+G VA+++ G  ++F FIFAF IK  NF
Sbjct  1392  VASQYGDNRDKLENGQRVEEFVKSYFGFEHDFLGVVASVVAGFSLLFAFIFAFGIKVLNF  1451

Query  4297  QTR  4305
             Q R
Sbjct  1452  QKR  1454



>gb|AGT28054.1| pleiotropic drug resistance transporter 2 [Panax ginseng]
Length=1445

 Score =  2048 bits (5305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1008/1437 (70%), Positives = 1216/1437 (85%), Gaps = 25/1437 (2%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             VWRS+G+EVFS+S+R+  +++   LKWA++EKLPT+ R+R+G+L   + G G  E+D++ 
Sbjct  32    VWRSNGMEVFSKSARDEDDEEA--LKWASLEKLPTFDRLRKGLLLGSQ-GAGASEVDIDD  88

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++ LLERLV +A+EDNE FLLKL+ R DRVGIDLP IEVRF+HL ++AEA+VGSR
Sbjct  89    LGIQERKKLLERLVNVAEEDNERFLLKLRDRVDRVGIDLPLIEVRFDHLTIEAEAHVGSR  148

Query  361   ALPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttll  540
             ALP+  NF  +I+E  ++ L +LPNRK+ L IL DVSGI++P RMTLLLGPPSSGKTTLL
Sbjct  149   ALPSFLNFNISIVEGLLDTLRLLPNRKQRLTILEDVSGILRPCRMTLLLGPPSSGKTTLL  208

Query  541   lalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQG  720
             LALAGKLD  LK SGRVTYNGHEMTEFVP+RT+AYI+QHDLHIGEMTVRETLAFSARCQG
Sbjct  209   LALAGKLDPTLKFSGRVTYNGHEMTEFVPQRTAAYISQHDLHIGEMTVRETLAFSARCQG  268

Query  721   VGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADIL  900
             VG RYEMLAELSRREK+ NIKPDPD+D+YMKA + EGQEA+VVTDY+LKILGL+VCAD +
Sbjct  269   VGSRYEMLAELSRREKDANIKPDPDVDIYMKAAATEGQEANVVTDYVLKILGLDVCADTM  328

Query  901   VGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQG  1080
             VGD+MIRGISGGQRKR+TTGEMLVGP++ALFMDEISTGLDSSTT+QIV ++R S+HILQG
Sbjct  329   VGDQMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVKALRHSVHILQG  388

Query  1081  TAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQE  1260
             TA+ISLLQPAPETY+LFDDIILLSDGQ+VYQGPR+NVL+FF+ MGFKCPERKGVADFLQE
Sbjct  389   TALISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLQFFESMGFKCPERKGVADFLQE  448

Query  1261  VTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNK  1440
             VTS+KDQ+QYW+R++E Y FIT  EFSEAFQSFHVG +LG +LA P+DK +SHPAAL+  
Sbjct  449   VTSKKDQKQYWLRKDEPYRFITATEFSEAFQSFHVGLRLGGDLATPYDKGRSHPAALTTD  508

Query  1441  KYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGT  1620
             KYGV+K ELLKA  +RE LLMKRNSFVYIFK+ QL +M+ V M +FLRTE+  N+  DG 
Sbjct  509   KYGVSKTELLKAVTAREILLMKRNSFVYIFKLFQLTVMSIVTMALFLRTELNHNTTTDGG  568

Query  1621  VFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILKIPVTLVE  1800
             ++MGALFFAV+M MFNG +ELA++I KLP FYKQRDL F+P W+YALP+WI+KIP+T +E
Sbjct  569   IYMGALFFAVVMLMFNGLAELAMTIAKLPIFYKQRDLLFYPTWSYALPSWIIKIPITFLE  628

Query  1801  VAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVANTFGSCAM  1980
             VA+WV +TYY IGFDP+ GRF KQ  +L+ +NQMASALFRL AA GR++I+A TFG  A+
Sbjct  629   VAVWVVLTYYVIGFDPNVGRFVKQYIVLLLINQMASALFRLMAALGRNMILAFTFGGFAL  688

Query  1981  ILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGTSETLGVT  2160
             +++  LGGF+L+RDDV KWW+WGY+ SP+MY  NAI+VNE+LG  W  + +  +ET+GV 
Sbjct  689   LVLFALGGFVLARDDVAKWWLWGYYSSPMMYGMNAIAVNEFLGHQWSKLTANGNETIGVA  748

Query  2161  VLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAMLSEETLAERNAC  2340
             +LRSRG FP A+WYWIGVGALVG+V +LNF   +AL YL+PLGKPQA++ E+        
Sbjct  749   ILRSRGFFPYAYWYWIGVGALVGFVLILNFAVTVALNYLDPLGKPQAVIPEK-------G  801

Query  2341  KRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLPFEPLCITF  2520
                EPIEL  +G S+  K      +V              A+PN KRGM+LPFEP  ITF
Sbjct  802   DTAEPIELSSRGSSSKGKAGSQEINVE-------------ANPNKKRGMILPFEPHSITF  848

Query  2521  DEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTLMDVLAGRK  2700
             DE+KY+VDMP EMK Q + ED+L+LLKG++GAFRPGVLTALMG+SGAGKTTLMDVLAGRK
Sbjct  849   DEVKYSVDMPQEMKDQSVVEDKLLLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  908

Query  2701  TGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRLPPEIDTAT  2880
             TGGYIEG+ITISG+PK+QETFARI+GYCEQ DIHSPHVTVYESL+YSAWLRLP E+D+ T
Sbjct  909   TGGYIEGNITISGFPKKQETFARISGYCEQNDIHSPHVTVYESLIYSAWLRLPSEVDSVT  968

Query  2881  REMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  3060
             R+MFV+EV++LVEL +L++ LVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  969   RKMFVDEVLELVELNTLKDGLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1028

Query  3061  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRHSS  3240
             DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIF+AFDEL L+KRGG+E+YVGP+GRHSS
Sbjct  1029  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQELYVGPVGRHSS  1088

Query  3241  QLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYRRNKALIQE  3420
             QLI YFE I+GI +I+DGYNPATWMLE+T+ AQE  LG+DF EVYRNS+LYRRNKALI+E
Sbjct  1089  QLINYFEDIDGISKIKDGYNPATWMLEVTTSAQEMVLGVDFTEVYRNSDLYRRNKALIRE  1148

Query  3421  LSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFNALLFGTM  3600
             LS P PG+KD+YF ++YSQSF TQC+ACLWKQ  SYWRN  YTAVR LF T  AL+ G+M
Sbjct  1149  LSTPRPGTKDIYFSSQYSQSFLTQCLACLWKQRCSYWRNTSYTAVRFLFATAIALMLGSM  1208

Query  3601  FWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERAAGMYSALP  3780
             FW +G K RTQQDLFNA G MYAA +FLGVQNA+SVQPVV +ERTVFYRERAAGMYSALP
Sbjct  1209  FWDLGSKMRTQQDLFNATGSMYAACLFLGVQNASSVQPVVDVERTVFYRERAAGMYSALP  1268

Query  3781  YAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyftlyGMMTVA  3960
             YAF QV++E+P++F Q  +YGVIVYAMIGF+WT  KF+W+IFF +FTLLYFTL+GMMTVA
Sbjct  1269  YAFAQVLVEVPYIFTQAAVYGVIVYAMIGFDWTVVKFIWYIFFTFFTLLYFTLFGMMTVA  1328

Query  3961  VTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGLIASQFGDV  4140
             VTPN +IAAII++AF+  WN+FSGFIIP+ ++PVWWRWY ++CPV+WTLYG+IASQFGD+
Sbjct  1329  VTPNADIAAIIAAAFFALWNVFSGFIIPRPKMPVWWRWYSWVCPVAWTLYGMIASQFGDI  1388

Query  4141  KEK--LDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNFQTR  4305
              +K  +D    VK FV+ +F F+H  V    T + G  V+F F FAFSIK+FNFQ R
Sbjct  1389  DDKTLVDAKVNVKKFVEDYFGFEHGNVWVAGTAVAGFTVVFAFTFAFSIKSFNFQRR  1445



>ref|XP_006596116.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X3 [Glycine max]
Length=1449

 Score =  2048 bits (5305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1025/1443 (71%), Positives = 1220/1443 (85%), Gaps = 20/1443 (1%)
 Frame = +1

Query  1     VWRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEK  180
             +WR++ ++VFS S RE  ED    LKWAAIE+LPTYLRI+R IL  E+  G  +E+D+++
Sbjct  19    IWRNNNMDVFSTSEREDDEDA---LKWAAIERLPTYLRIQRSILNNED--GKGREVDIKQ  73

Query  181   LGVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSR  360
             LG+ E++ LLERLV+IA+EDNE FLLKL+ R DRVG+D+PTIEVRFEH+NV+A+ YVG R
Sbjct  74    LGLTERKILLERLVKIAEEDNERFLLKLRERMDRVGLDIPTIEVRFEHINVEAQVYVGGR  133

Query  361   ALPTIFNFTANILE-------AFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPS  519
             ALP++ NF AN+LE        F+NYLHI+P+ KKPL IL ++SGIIKP RMTLLLGPP 
Sbjct  134   ALPSMLNFFANVLEDLFFLPKGFLNYLHIIPSPKKPLRILQNISGIIKPRRMTLLLGPPG  193

Query  520   sgkttlllalagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLA  699
             SGKTTLLLALAGKL  DLK SGRVTYNGHE+ EFVP+RTSAYI+Q+D HIGEMTVRETLA
Sbjct  194   SGKTTLLLALAGKLGKDLKHSGRVTYNGHELEEFVPQRTSAYISQYDNHIGEMTVRETLA  253

Query  700   FSARCQGVGHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGL  879
             FSARCQGVG  YE+LAEL RREK+  IKPDPDID YMKA ++  Q  SVVTDYILKILGL
Sbjct  254   FSARCQGVGQNYEILAELLRREKQAKIKPDPDIDSYMKAAALGRQRTSVVTDYILKILGL  313

Query  880   EVCADILVGDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQ  1059
             EVCADI+VGD MIRGISGGQ+KR+TTGEMLVGP + LFMDEISTGLDSSTTFQI+NSIRQ
Sbjct  314   EVCADIMVGDGMIRGISGGQKKRVTTGEMLVGPIKVLFMDEISTGLDSSTTFQIINSIRQ  373

Query  1060  SIHILQGTAVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKG  1239
             SIHIL GTA++SLLQPAPETYELFDDIILL+DGQ+VYQGPR+NVLEFF+ MGFKCPERKG
Sbjct  374   SIHILNGTALVSLLQPAPETYELFDDIILLTDGQIVYQGPRENVLEFFESMGFKCPERKG  433

Query  1240  VADFLQEVTSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSH  1419
             VADFLQEVTS+KDQ QYW+R++E Y F+TV +F+EAFQ FH+G+ LG+ELA PFD+SKSH
Sbjct  434   VADFLQEVTSKKDQWQYWVRKDEPYSFVTVKDFAEAFQLFHIGQNLGEELASPFDRSKSH  493

Query  1420  PAALSNKKYGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPK  1599
             P  L+ KKYGVNKKELL+ACASREFLLMKRNSFVYIFK+ QL+ +A +  T+FLRT+M +
Sbjct  494   PNVLTTKKYGVNKKELLRACASREFLLMKRNSFVYIFKVTQLIYLAIITTTLFLRTKMHR  553

Query  1600  NSIADGTVFMGALFFAVIMTMFNGFSELALSILKLPAFYKQRDLFFFPPWAYALPTWILK  1779
             +++ DG  +MGALFFAV + MFNG SEL ++I+KLP FYKQRDL F+P WAY+LP WILK
Sbjct  554   DTVEDGGAYMGALFFAVTVAMFNGISELNMAIMKLPVFYKQRDLLFYPAWAYSLPPWILK  613

Query  1780  IPVTLVEVAIWVCMTYYAIGFDPDAGRFFKQLFLLICVNQMASALFRLTAAAGRSVIVAN  1959
             IP+TL+EVAIW  ++YYAIGFDP   R  KQ  +++C+NQMAS+LFRL AA GR VIVAN
Sbjct  614   IPITLIEVAIWEGISYYAIGFDPSLVRLLKQYLIILCINQMASSLFRLMAAFGRDVIVAN  673

Query  1960  TFGSCAMILVLVLGGFILSRDDVKKWWIWGYWISPLMYAQNAISVNEYLGKSWRHVPSGT  2139
             T GS A+++VLVLGGF++SR++V KW++WGYW SPLMY QNAI+VNE+LG SWR V   +
Sbjct  674   TAGSFALLIVLVLGGFVISRENVHKWFLWGYWSSPLMYGQNAIAVNEFLGHSWRKVTPNS  733

Query  2140  SETLGVTVLRSRGIFPEAHWYWIGVGALVGYVFLLNFLFCLALTYLNPLGKPQAM-LSEE  2316
             +ETLGV +L++RG FPEA+WYWIGVGAL+GYVFL NFLF LAL YL+P  K QA  LS+E
Sbjct  734   NETLGVLILKTRGFFPEAYWYWIGVGALIGYVFLYNFLFTLALQYLSPFRKDQASGLSQE  793

Query  2317  TLAERNACKRGEPIELELKGGSTSEKgnvvrrsvssrslssrvgsvnvADPNMKRGMVLP  2496
              L ERNA    E I+L  KG S+SE+      +       S   S + A  + +RGMVLP
Sbjct  794   KLLERNASTAEELIQLP-KGNSSSEE------ANIPSRSFSGRISDDKASGSGRRGMVLP  846

Query  2497  FEPLCITFDEIKYAVDMPTEMKAQGLTEDRLVLLKGINGAFRPGVLTALMGISGAGKTTL  2676
             F+PL +TFDE+KY+VDMP EMK QG+ E+RL LLKG++G FRPGVLTALMG+SGAGKTTL
Sbjct  847   FQPLSLTFDEMKYSVDMPQEMKKQGVFEERLELLKGVSGVFRPGVLTALMGVSGAGKTTL  906

Query  2677  MDVLAGRKTGGYIEGSITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAWLRL  2856
             MDVLAGRKTGGYIEGSITISGYPKRQETFARI+GYCEQ DIHSP+VTVYESL+YSAWLRL
Sbjct  907   MDVLAGRKTGGYIEGSITISGYPKRQETFARISGYCEQFDIHSPNVTVYESLLYSAWLRL  966

Query  2857  PPEIDTATREMFVEEVMDLVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  3036
             P E+D ATR+MF+EEVM+LVEL S+REALVGLPG NGLSTEQRKRLTIAVELVANPSIIF
Sbjct  967   PREVDRATRKMFIEEVMELVELNSIREALVGLPGENGLSTEQRKRLTIAVELVANPSIIF  1026

Query  3037  MDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYV  3216
             MDEPTSGLDARAAAIVMRTVRNTV+TGRTVVCTIHQPSIDIFDAFDELLLLK GGE+IY 
Sbjct  1027  MDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFDAFDELLLLKLGGEQIYA  1086

Query  3217  GPLGRHSSQLIRYFETINGIQRIRDGYNPATWMLEITSEAQEAALGIDFAEVYRNSELYR  3396
             GPLGRH S LI+YFE I G+ +I++GYNPATWMLE+TS   EA++ ++F  VYRNSELY 
Sbjct  1087  GPLGRHCSHLIQYFEAIQGVPKIKEGYNPATWMLEVTSAGTEASIKVNFTNVYRNSELYG  1146

Query  3397  RNKALIQELSKPAPGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTF  3576
             RNK LIQELS P  GS+DL+F ++YSQ+  TQC ACLWKQH SYWRN  YTAVRLLFT  
Sbjct  1147  RNKQLIQELSIPPQGSRDLHFDSQYSQTLVTQCKACLWKQHLSYWRNTSYTAVRLLFTML  1206

Query  3577  NALLFGTMFWGIGPKRRTQQDLFNAMGCMYAAVVFLGVQNATSVQPVVAIERTVFYRERA  3756
              ALLFG +FW IG KR  +QDLFNAMG MYAAV F+GVQN  SVQP++A+ERTVFYRERA
Sbjct  1207  IALLFGIIFWDIGLKRSKEQDLFNAMGSMYAAVTFIGVQNGASVQPIIAVERTVFYRERA  1266

Query  3757  AGMYSALPYAFGQVVIELPHLFVQTLIYGVIVYAMIGFEWTAAKFLWfiffmyftllyft  3936
             AGMYSALPYA  QV+IELPH+ VQ L+YG+IVYAM+GF+WT +KFLW++FFMYFT LY+T
Sbjct  1267  AGMYSALPYALAQVIIELPHILVQALMYGIIVYAMMGFDWTTSKFLWYLFFMYFTFLYYT  1326

Query  3937  lyGMMTVAVTPNHNIAAIISSAFYGFWNLFSGFIIPKTRIPVWWRWYYYICPVSWTLYGL  4116
              YGMMT+A+TPN ++AAI+SSAFY  W+LFSGF+IP +RIP+WW+WYY+ICPV+WTL GL
Sbjct  1327  FYGMMTMAITPNAHVAAILSSAFYAIWSLFSGFVIPLSRIPIWWKWYYWICPVAWTLNGL  1386

Query  4117  IASQFGDVKEKLDTNETvkdfvksffdfdhdfvGYVATIIVGICVMFGFIFAFSIKAFNF  4296
             +ASQ+GD ++KL+  + V++FVKS+F F+HDF+G VA+++ G  ++F FIFAF IK  NF
Sbjct  1387  VASQYGDNRDKLENGQRVEEFVKSYFGFEHDFLGVVASVVAGFSLLFAFIFAFGIKVLNF  1446

Query  4297  QTR  4305
             Q R
Sbjct  1447  QKR  1449



>ref|XP_007217658.1| hypothetical protein PRUPE_ppa000226mg [Prunus persica]
 gb|EMJ18857.1| hypothetical protein PRUPE_ppa000226mg [Prunus persica]
Length=1436

 Score =  2048 bits (5305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1035/1437 (72%), Positives = 1215/1437 (85%), Gaps = 24/1437 (2%)
 Frame = +1

Query  4     WRSSGVEVFsrssreaaeddeeaLKWAAIEKLPTYLRIRRGILAAEEEGGGPKEIDVEKL  183
             WR++GVEVFSRSSRE  ++    LKWAA+EKLPTY R+R+GIL +    G   E+D+  L
Sbjct  21    WRNNGVEVFSRSSREEDDEAA--LKWAALEKLPTYNRLRKGILTSP--AGEASEVDIPNL  76

Query  184   GVAEKRSLLERLVRIAQEDNESFLLKLKHRTDRVGIDLPTIEVRFEHLNVDAEAYVGSRA  363
             G  E++ L+ER ++ A+EDNE FLLKLK+R DRVGIDLPTIEVR+EHLNV+AEAYVGSRA
Sbjct  77    GFQERKELIERFLKGAEEDNERFLLKLKNRIDRVGIDLPTIEVRYEHLNVEAEAYVGSRA  136

Query  364   LPTIFNFTANILEAFMNYLHILPNRKKPLPILHDVSGIIKPARMTLLLGPPSsgkttlll  543
             LPT+FNF  NI E  +N L I  +RK  L ILH VSGIIKP+RMTLLLGPPSSGKTTLLL
Sbjct  137   LPTLFNFIINIFEGILNSLRIFSSRKTHLSILHSVSGIIKPSRMTLLLGPPSSGKTTLLL  196

Query  544   alagkldsdlKVSGRVTYNGHEMTEFVPRRTSAYINQHDLHIGEMTVRETLAFSARCQGV  723
             ALAGKLD DLK+SGRVTYNGHEM +FVP++T+AYI+QHDLH+GEMTVRETLAFSARCQGV
Sbjct  197   ALAGKLDPDLKLSGRVTYNGHEMNDFVPQKTAAYISQHDLHVGEMTVRETLAFSARCQGV  256

Query  724   GHRYEMLAELSRREKELNIKPDPDIDVYMKAISIEGQEASVVTDYILKILGLEVCADILV  903
             G RY+ML+EL RRE+  NIKPDPDIDV+MKAI+ EGQE +VVTDYILKILGLEVCAD +V
Sbjct  257   GTRYDMLSELCRREQAANIKPDPDIDVFMKAIATEGQEVNVVTDYILKILGLEVCADTIV  316

Query  904   GDEMIRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSIRQSIHILQGT  1083
             GDEM+RGISGGQRKR+TTGEMLVGPA ALFMDEISTGLDSSTTFQIVNSI+Q I IL GT
Sbjct  317   GDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDSSTTFQIVNSIKQYIRILNGT  376

Query  1084  AVISLLQPAPETYELFDDIILLSDGQVVYQGPRDNVLEFFQHMGFKCPERKGVADFLQEV  1263
             AVISLLQPAPETYELFDDIILLSDGQ+VYQG R++VLEFF+ MGFKCPERKG+ADFLQEV
Sbjct  377   AVISLLQPAPETYELFDDIILLSDGQIVYQGSREHVLEFFESMGFKCPERKGIADFLQEV  436

Query  1264  TSRKDQEQYWMRREEAYEFITVGEFSEAFQSFHVGKKLGDELAVPFDKSKSHPAALSNKK  1443
             TSRKDQEQYW  +++ Y F+TV EF+EAFQSFHVG+K+GDEL++PFDKSK+HPAAL+ K+
Sbjct  437   TSRKDQEQYWACKDKPYRFVTVKEFNEAFQSFHVGQKIGDELSIPFDKSKNHPAALTTKE  496

Query  1444  YGVNKKELLKACASREFLLMKRNSFVYIFKMIQLVLMAFVAMTVFLRTEMPKNSIADGTV  1623
             YG+ K ELLKAC SRE+LL KRN+FVYIFK+IQL +MA ++MT+FLRT+M  +S+ DG V
Sbjct  497   YGLKKGELLKACFSREYLLAKRNAFVYIFKLI