BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22191_g1_i3 len=1338 path=[1:0-383 4467:384-394 @385@!:395-877
868:878-970 961:971-1337]

Length=1338
                                                                      Score     E

ref|XP_010025124.1|  PREDICTED: uncharacterized protein LOC104415507    409   5e-137   
ref|XP_010315882.1|  PREDICTED: stress regulated protein isoform X1     405   5e-136   
gb|AAW65807.1|  stress regulated protein isoform 3                      404   2e-135   Solanum virginianum [yellow-fruit nightshade]
ref|XP_006338258.1|  PREDICTED: uncharacterized protein LOC102604994    404   4e-135   
ref|NP_001233778.1|  stress regulated protein                           404   4e-135   
ref|XP_009601047.1|  PREDICTED: uncharacterized protein LOC104096...    400   8e-135   
ref|XP_006433238.1|  hypothetical protein CICLE_v10001775mg             402   2e-134   
ref|XP_006433241.1|  hypothetical protein CICLE_v10001775mg             402   3e-134   
gb|KDP23574.1|  hypothetical protein JCGZ_23407                         401   5e-134   
ref|XP_009601046.1|  PREDICTED: uncharacterized protein LOC104096...    399   2e-133   
ref|XP_011023508.1|  PREDICTED: uncharacterized protein LOC105124970    399   4e-133   
gb|KDO37200.1|  hypothetical protein CISIN_1g019829mg                   398   1e-132   
ref|XP_007030748.1|  A_TM021B04.11 protein                              397   2e-132   
ref|XP_009759314.1|  PREDICTED: uncharacterized protein LOC104211868    396   5e-132   
ref|XP_010524890.1|  PREDICTED: uncharacterized protein LOC104802813    397   8e-132   
ref|XP_002319039.2|  hypothetical protein POPTR_0013s03000g             392   2e-130   Populus trichocarpa [western balsam poplar]
ref|XP_002512307.1|  conserved hypothetical protein                     390   1e-129   Ricinus communis
ref|XP_009335653.1|  PREDICTED: uncharacterized protein LOC103928348    389   2e-129   
ref|XP_007205504.1|  hypothetical protein PRUPE_ppa008298mg             388   7e-129   
ref|XP_004135643.1|  PREDICTED: uncharacterized protein LOC101213973    387   2e-128   
ref|XP_004157269.1|  PREDICTED: uncharacterized protein LOC101223311    387   2e-128   
ref|XP_008246543.1|  PREDICTED: uncharacterized protein LOC103344701    386   5e-128   
ref|XP_008370534.1|  PREDICTED: uncharacterized protein LOC103433999    386   5e-128   
ref|XP_004302472.1|  PREDICTED: uncharacterized protein LOC101309267    385   1e-127   
emb|CDY19716.1|  BnaA09g03690D                                          385   2e-127   
emb|CDX99990.1|  BnaC09g03110D                                          384   4e-127   
emb|CDP15829.1|  unnamed protein product                                384   5e-127   
ref|XP_008450722.1|  PREDICTED: uncharacterized protein LOC103492...    384   6e-127   
ref|XP_009111938.1|  PREDICTED: uncharacterized protein LOC103837...    383   1e-126   
ref|XP_008450721.1|  PREDICTED: uncharacterized protein LOC103492...    384   1e-126   
ref|XP_002872278.1|  hypothetical protein ARALYDRAFT_910860             381   4e-126   
ref|XP_010421644.1|  PREDICTED: uncharacterized protein LOC104707069    381   6e-126   
ref|XP_010494028.1|  PREDICTED: uncharacterized protein LOC104771231    381   6e-126   
ref|XP_011078009.1|  PREDICTED: uncharacterized protein LOC105161...    380   9e-126   
ref|NP_568492.1|  uncharacterized protein                               380   1e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244616.1|  PREDICTED: uncharacterized protein LOC104588...    379   2e-125   
ref|XP_010674978.1|  PREDICTED: uncharacterized protein LOC104891035    379   3e-125   
emb|CAN70022.1|  hypothetical protein VITISV_030170                     377   7e-125   Vitis vinifera
ref|XP_002266105.1|  PREDICTED: uncharacterized protein LOC100267587    377   1e-124   Vitis vinifera
gb|AAM65305.1|  unknown                                                 377   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288255.1|  hypothetical protein CARUB_v10001500mg             372   1e-123   
ref|XP_006394980.1|  hypothetical protein EUTSA_v10004533mg             374   4e-123   
ref|XP_004494650.1|  PREDICTED: uncharacterized protein LOC101514...    374   5e-123   
ref|XP_009393244.1|  PREDICTED: uncharacterized protein LOC103978984    370   1e-121   
gb|EYU28387.1|  hypothetical protein MIMGU_mgv1a024158mg                369   1e-121   
ref|XP_010941743.1|  PREDICTED: uncharacterized protein LOC105059...    369   3e-121   
gb|ABN08173.1|  Peptidase, cysteine peptidase active site               368   9e-121   Medicago truncatula
ref|XP_009111939.1|  PREDICTED: uncharacterized protein LOC103837...    361   2e-118   
ref|XP_007147094.1|  hypothetical protein PHAVU_006G095900g             362   2e-118   
ref|XP_008807275.1|  PREDICTED: uncharacterized protein LOC103719691    360   7e-118   
ref|XP_003626343.1|  hypothetical protein MTR_7g114070                  360   9e-118   
ref|XP_004968785.1|  PREDICTED: uncharacterized protein LOC101776...    357   9e-117   
gb|KHN04030.1|  hypothetical protein glysoja_022716                     357   2e-116   
ref|XP_003567712.1|  PREDICTED: uncharacterized protein LOC100844...    354   1e-115   
ref|XP_002458075.1|  hypothetical protein SORBIDRAFT_03g026530          350   7e-114   Sorghum bicolor [broomcorn]
ref|XP_004494651.1|  PREDICTED: uncharacterized protein LOC101514...    348   2e-113   
gb|ACF82075.1|  unknown                                                 348   3e-113   Zea mays [maize]
tpg|DAA54593.1|  TPA: stress regulated protein                          347   9e-113   
ref|NP_001151260.1|  stress regulated protein                           345   9e-112   Zea mays [maize]
ref|XP_006645915.1|  PREDICTED: uncharacterized protein LOC102713866    343   1e-111   
dbj|BAJ88888.1|  predicted protein                                      344   2e-111   
gb|KCW61717.1|  hypothetical protein EUGRSUZ_H04431                     342   3e-111   
ref|NP_001043093.1|  Os01g0382700                                       343   5e-111   Oryza sativa Japonica Group [Japonica rice]
gb|EMS52575.1|  hypothetical protein TRIUR3_14340                       341   2e-110   
gb|ABR17231.1|  unknown                                                 339   2e-109   Picea sitchensis
gb|AAB61082.1|  contains similarity to Synechococcus PCC7942 chro...    338   9e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010102676.1|  hypothetical protein L484_002090                   332   2e-108   
gb|KHG21903.1|  Eukaryotic translation initiation factor 3 subunit I    333   8e-108   
tpg|DAA54594.1|  TPA: hypothetical protein ZEAMMB73_027015              334   8e-108   
ref|XP_008672985.1|  PREDICTED: stress regulated protein isoform X1     328   2e-105   
gb|EMT23471.1|  hypothetical protein F775_15938                         328   9e-105   
gb|EEC70682.1|  hypothetical protein OsI_02018                          323   1e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_006288256.1|  hypothetical protein CARUB_v10001500mg             320   1e-102   
ref|XP_007205503.1|  hypothetical protein PRUPE_ppa008298mg             320   2e-102   
ref|XP_011078010.1|  PREDICTED: uncharacterized protein LOC105161...    310   5e-99    
ref|XP_006857009.1|  hypothetical protein AMTR_s00197p00027670          310   7e-99    
ref|XP_010941744.1|  PREDICTED: uncharacterized protein LOC105059...    308   1e-97    
ref|XP_010244617.1|  PREDICTED: uncharacterized protein LOC104588...    302   4e-97    
ref|XP_011078011.1|  PREDICTED: uncharacterized protein LOC105161...    279   1e-94    
ref|XP_001779710.1|  predicted protein                                  298   2e-94    
gb|EPS73376.1|  hypothetical protein M569_01378                         310   2e-94    
ref|XP_002966885.1|  hypothetical protein SELMODRAFT_168681             295   8e-93    
ref|XP_002961125.1|  hypothetical protein SELMODRAFT_75099              295   1e-92    
ref|XP_004968786.1|  PREDICTED: uncharacterized protein LOC101776...    290   2e-91    
ref|NP_001031951.1|  uncharacterized protein                            280   1e-90    Arabidopsis thaliana [mouse-ear cress]
gb|KDO48526.1|  hypothetical protein CISIN_1g019841mg                   283   6e-90    
ref|XP_008672986.1|  PREDICTED: stress regulated protein isoform X2     283   1e-88    
ref|XP_006433240.1|  hypothetical protein CICLE_v10001775mg             266   6e-85    
gb|KDO48527.1|  hypothetical protein CISIN_1g019841mg                   264   2e-84    
ref|XP_006433239.1|  hypothetical protein CICLE_v10001775mg             264   2e-84    
gb|KDO48525.1|  hypothetical protein CISIN_1g019841mg                   261   2e-83    
gb|KHN43248.1|  hypothetical protein glysoja_001831                     269   2e-83    
gb|KDO37201.1|  hypothetical protein CISIN_1g019829mg                   249   4e-81    
tpg|DAA54595.1|  TPA: hypothetical protein ZEAMMB73_027015              261   5e-80    
ref|XP_005646206.1|  hypothetical protein COCSUDRAFT_33740              251   3e-76    
ref|XP_010230891.1|  PREDICTED: uncharacterized protein LOC100844...    246   4e-74    
ref|XP_002499536.1|  predicted protein                                  244   5e-74    Micromonas commoda
gb|ACU15850.1|  unknown                                                 230   6e-73    Glycine max [soybeans]
ref|XP_001418869.1|  predicted protein                                  243   8e-73    Ostreococcus lucimarinus CCE9901
gb|KEH24534.1|  stress regulated protein                                229   1e-72    
gb|KEH24535.1|  stress regulated protein                                228   1e-72    
gb|KEH24533.1|  stress regulated protein                                228   1e-72    
ref|XP_005845454.1|  hypothetical protein CHLNCDRAFT_25833              238   1e-71    
ref|XP_003058284.1|  predicted protein                                  239   2e-71    
gb|ABK26568.1|  unknown                                                 227   2e-68    Picea sitchensis
gb|AFK42903.1|  unknown                                                 209   8e-67    
emb|CEF98632.1|  unnamed product                                        225   9e-67    
ref|XP_001700231.1|  predicted protein                                  223   8e-66    Chlamydomonas reinhardtii
ref|XP_007515014.1|  predicted protein                                  221   1e-62    
ref|XP_010244612.1|  PREDICTED: uncharacterized protein LOC104588403    198   9e-57    
gb|KFM27635.1|  hypothetical protein F751_5599                          201   1e-56    
gb|EEC70683.1|  hypothetical protein OsI_02020                          194   4e-56    Oryza sativa Indica Group [Indian rice]
gb|ACN30548.1|  unknown                                                 191   3e-55    Zea mays [maize]
gb|AAW65809.1|  stress regulated protein isoform 1                      167   9e-46    Solanum virginianum [yellow-fruit nightshade]
gb|AAW65808.1|  stress regulated protein isoform 2                      167   7e-45    Solanum virginianum [yellow-fruit nightshade]
ref|XP_002948462.1|  hypothetical protein VOLCADRAFT_103923             171   7e-45    
gb|KDO48519.1|  hypothetical protein CISIN_1g019873mg                   167   3e-44    
ref|XP_006471938.1|  PREDICTED: uncharacterized protein LOC102619...    166   1e-43    
ref|XP_006471937.1|  PREDICTED: uncharacterized protein LOC102619...    165   3e-43    
gb|KDO48518.1|  hypothetical protein CISIN_1g019873mg                   164   9e-43    
gb|KDO48517.1|  hypothetical protein CISIN_1g019873mg                   160   4e-41    
ref|XP_010660032.1|  PREDICTED: uncharacterized protein LOC100257...    157   3e-40    
ref|XP_010660030.1|  PREDICTED: uncharacterized protein LOC100257...    154   8e-39    
ref|XP_002512308.1|  conserved hypothetical protein                     149   2e-37    Ricinus communis
ref|XP_004157268.1|  PREDICTED: uncharacterized LOC101213254            131   2e-36    
ref|NP_001185227.1|  uncharacterized protein                            144   2e-36    
ref|XP_004135797.1|  PREDICTED: uncharacterized protein LOC101213254    131   2e-36    
ref|NP_001117491.1|  uncharacterized protein                            143   4e-36    Arabidopsis thaliana [mouse-ear cress]
ref|NP_175867.2|  uncharacterized protein                               143   5e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008450723.1|  PREDICTED: uncharacterized protein LOC103492218    129   6e-36    
emb|CAN70025.1|  hypothetical protein VITISV_030173                     141   1e-35    Vitis vinifera
gb|AAC64897.1|  Contains similarity to TM021B04.11 gi|2191197 fro...    142   3e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010528840.1|  PREDICTED: uncharacterized protein LOC104805845    140   3e-34    
ref|XP_006302622.1|  hypothetical protein CARUB_v10020727mg             139   5e-34    
ref|XP_010511581.1|  PREDICTED: uncharacterized protein LOC104787...    138   1e-33    
ref|XP_010511580.1|  PREDICTED: uncharacterized protein LOC104787...    137   2e-33    
ref|XP_004244952.1|  PREDICTED: uncharacterized protein LOC101265...    137   3e-33    
ref|XP_009774326.1|  PREDICTED: uncharacterized protein LOC104224392    137   4e-33    
ref|XP_010470367.1|  PREDICTED: uncharacterized protein LOC104750290    136   5e-33    
ref|XP_006392494.1|  hypothetical protein EUTSA_v10023619mg             136   6e-33    
ref|XP_010027216.1|  PREDICTED: uncharacterized protein LOC104417682    131   1e-32    
ref|XP_010324883.1|  PREDICTED: uncharacterized protein LOC101265...    135   1e-32    
ref|XP_009611003.1|  PREDICTED: uncharacterized protein LOC104104575    135   2e-32    
ref|XP_006355264.1|  PREDICTED: uncharacterized protein LOC102583...    135   3e-32    
ref|XP_002891907.1|  hypothetical protein ARALYDRAFT_314862             134   4e-32    
emb|CDY48378.1|  BnaAnng09650D                                          132   1e-31    
ref|XP_009119456.1|  PREDICTED: uncharacterized protein LOC103844...    132   1e-31    
emb|CDY17552.1|  BnaC01g26760D                                          132   2e-31    
emb|CDY57559.1|  BnaCnng32110D                                          132   2e-31    
emb|CDP15827.1|  unnamed protein product                                130   4e-31    
ref|XP_003080222.1|  ATP-dependent Zn proteases-like protein (ISS)      125   9e-31    
ref|WP_039738878.1|  ATP-dependent Zn protease                          127   3e-30    
ref|WP_029632698.1|  hypothetical protein [                             125   1e-29    
ref|WP_016866588.1|  hypothetical protein                               123   7e-29    
ref|WP_010996570.1|  hypothetical protein                               122   9e-29    
ref|WP_017309004.1|  hypothetical protein                               122   1e-28    
ref|WP_016862568.1|  hypothetical protein                               121   2e-28    
ref|WP_015138693.1|  hypothetical protein                               121   2e-28    
ref|WP_026723708.1|  hypothetical protein                               120   5e-28    
ref|WP_009455405.1|  MULTISPECIES: hypothetical protein                 120   5e-28    
ref|WP_039715373.1|  ATP-dependent Zn protease                          119   1e-27    
ref|WP_015152849.1|  hypothetical protein                               119   2e-27    
ref|WP_027846109.1|  hypothetical protein                               119   2e-27    
ref|WP_011317110.1|  hypothetical protein                               118   3e-27    
ref|WP_038099010.1|  ATP-dependent Zn protease                          118   3e-27    
ref|WP_026735371.1|  hypothetical protein                               117   1e-26    
ref|WP_012407348.1|  hypothetical protein                               117   1e-26    
ref|WP_017314331.1|  hypothetical protein                               116   2e-26    
ref|WP_015127389.1|  hypothetical protein                               115   3e-26    
ref|WP_015120691.1|  hypothetical protein                               115   3e-26    
ref|WP_015207050.1|  hypothetical protein                               115   5e-26    
ref|WP_015196605.1|  hypothetical protein                               115   6e-26    
ref|WP_017739677.1|  hypothetical protein                               114   8e-26    
gb|KHN33972.1|  hypothetical protein glysoja_044679                     110   9e-26    
ref|WP_015190980.1|  hypothetical protein                               114   1e-25    
ref|WP_015083577.1|  hypothetical protein                               114   1e-25    
ref|XP_011078013.1|  PREDICTED: uncharacterized protein LOC105161...    115   1e-25    
ref|WP_015115582.1|  hypothetical protein                               114   1e-25    
ref|WP_026099936.1|  hypothetical protein                               113   1e-25    
ref|WP_027404622.1|  hypothetical protein                               114   2e-25    
ref|XP_011078012.1|  PREDICTED: uncharacterized protein LOC105161...    115   2e-25    
ref|WP_015215362.1|  hypothetical protein                               113   2e-25    
gb|AHJ30075.1|  hypothetical protein NSP_37720                          112   3e-25    
ref|WP_027255391.1|  hypothetical protein                               112   3e-25    
ref|WP_017320959.1|  hypothetical protein                               112   4e-25    
ref|WP_006198832.1|  hypothetical protein                               112   4e-25    
ref|WP_035150144.1|  ATP-dependent Zn protease                          112   5e-25    
gb|KEI68740.1|  hypothetical protein A19Y_4027                          112   5e-25    
ref|WP_016951904.1|  hypothetical protein                               112   6e-25    
ref|WP_039200564.1|  ATP-dependent Zn protease                          111   1e-24    
ref|WP_008310822.1|  hypothetical protein                               110   2e-24    
ref|WP_026795707.1|  MULTISPECIES: hypothetical protein                 110   2e-24    
ref|WP_017662825.1|  hypothetical protein                               110   3e-24    
ref|WP_039726475.1|  ATP-dependent Zn protease                          109   4e-24    
ref|WP_006455994.1|  hypothetical protein                               109   4e-24    
ref|WP_027248908.1|  hypothetical protein                               108   8e-24    
ref|WP_011613756.1|  hypothetical protein                               108   9e-24    
ref|WP_022603839.1|  hypothetical protein                               108   1e-23    
ref|XP_006599980.1|  PREDICTED: uncharacterized protein LOC102662133    105   2e-23    
ref|WP_026785972.1|  hypothetical protein                               107   2e-23    
ref|WP_006102119.1|  hypothetical protein                               105   9e-23    
ref|WP_015194303.1|  hypothetical protein                               105   1e-22    
ref|WP_016874006.1|  hypothetical protein                               105   1e-22    
ref|WP_028083464.1|  hypothetical protein                               105   1e-22    
ref|WP_015145177.1|  hypothetical protein                               104   2e-22    
ref|WP_015175065.1|  hypothetical protein                               104   3e-22    
ref|WP_006518853.1|  hypothetical protein                               104   3e-22    
ref|XP_005831184.1|  hypothetical protein GUITHDRAFT_87555              106   4e-22    
ref|WP_023076788.1|  atp-dependent zn protease                          103   6e-22    
ref|WP_009634131.1|  hypothetical protein                               102   1e-21    
ref|XP_005706363.1|  hypothetical protein isoform 2                     105   1e-21    
ref|WP_008179856.1|  hypothetical protein                               102   2e-21    
ref|WP_006626173.1|  MULTISPECIES: hypothetical protein                 102   2e-21    
ref|WP_007354337.1|  MULTISPECIES: hypothetical protein                 101   2e-21    
ref|XP_005792829.1|  hypothetical protein EMIHUDRAFT_57188              100   3e-21    
ref|WP_009557215.1|  ATP-dependent Zn protease                          101   4e-21    
ref|XP_005762339.1|  hypothetical protein EMIHUDRAFT_45563            99.8    4e-21    
ref|WP_019492843.1|  hypothetical protein                               100   5e-21    
ref|WP_015229271.1|  hypothetical protein                               100   7e-21    
ref|WP_006633839.1|  hypothetical protein                               100   7e-21    
ref|WP_015956166.1|  hypothetical protein                               100   8e-21    
ref|WP_015151609.1|  hypothetical protein                               100   9e-21    
ref|WP_015171342.1|  hypothetical protein                             99.8    1e-20    
ref|WP_019509095.1|  hypothetical protein                             99.8    2e-20    
ref|WP_023065940.1|  hypothetical protein                             99.4    2e-20    
ref|WP_006619355.1|  hypothetical protein                             99.0    3e-20    
ref|WP_013322143.1|  hypothetical protein                             98.6    3e-20    
ref|WP_009342478.1|  hypothetical protein                             98.2    4e-20    
ref|WP_038331353.1|  ATP-dependent Zn protease                        98.2    5e-20    
ref|WP_006510695.1|  hypothetical protein                             98.2    5e-20    
ref|WP_017718959.1|  hypothetical protein                             97.8    6e-20    
ref|WP_017288276.1|  hypothetical protein                             97.8    7e-20    
ref|WP_015203927.1|  hypothetical protein                             97.4    9e-20    
ref|WP_006278247.1|  hypothetical protein                             95.5    4e-19    
ref|WP_015784372.1|  hypothetical protein                             95.5    5e-19    
ref|WP_036002232.1|  ATP-dependent Zn protease                        95.5    5e-19    
ref|WP_012596518.1|  hypothetical protein                             95.1    6e-19    
ref|WP_017711813.1|  hypothetical protein                             94.4    1e-18    
ref|WP_024545220.1|  hypothetical protein                             94.0    2e-18    
ref|WP_002759281.1|  hypothetical protein                             93.2    3e-18    
ref|XP_002184685.1|  predicted protein                                91.7    3e-18    Phaeodactylum tricornutum CCAP 1055/1
ref|WP_009784766.1|  hypothetical protein                             92.8    4e-18    
ref|WP_002797278.1|  hypothetical protein                             92.8    4e-18    
ref|WP_002737425.1|  hypothetical protein                             92.4    5e-18    
ref|WP_016514760.1|  hypothetical protein                             92.4    6e-18    
ref|WP_002754791.1|  hypothetical protein                             92.0    8e-18    
gb|KDO61590.1|  hypothetical protein CISIN_1g016454mg                 94.4    9e-18    
ref|XP_006858219.1|  hypothetical protein AMTR_s00062p00186450        93.6    9e-18    
ref|WP_002791119.1|  hypothetical protein                             91.7    9e-18    
ref|XP_006422252.1|  hypothetical protein CICLE_v10005140mg           94.4    1e-17    
ref|WP_002801455.1|  hypothetical protein                             91.7    1e-17    
ref|WP_035992000.1|  ATP-dependent Zn protease                        91.3    1e-17    
ref|WP_037224627.1|  ATP-dependent Zn protease                        90.9    2e-17    
ref|WP_008277121.1|  hypothetical protein                             90.9    2e-17    
ref|WP_015226966.1|  hypothetical protein                             90.9    2e-17    
ref|WP_015133963.1|  M41 family peptidase                             90.9    2e-17    
ref|WP_015180856.1|  hypothetical protein                             90.9    2e-17    
ref|WP_013191856.1|  hypothetical protein                             89.7    3e-17    
ref|WP_002766973.1|  hypothetical protein                             90.1    3e-17    
ref|WP_004157250.1|  hypothetical protein                             90.1    4e-17    
ref|WP_015220310.1|  hypothetical protein                             90.1    4e-17    
ref|WP_011243732.1|  hypothetical protein                             89.7    4e-17    
dbj|GAL92028.1|  hypothetical protein N44_00316                       89.7    4e-17    
ref|XP_007022576.1|  Uncharacterized protein isoform 1                92.4    4e-17    
ref|XP_010557268.1|  PREDICTED: uncharacterized protein LOC104826324  92.0    5e-17    
ref|WP_012268290.1|  hypothetical protein                             89.7    5e-17    
ref|WP_002782267.1|  hypothetical protein                             89.4    6e-17    
ref|WP_008207088.1|  hypothetical protein                             89.0    8e-17    
ref|WP_011377432.1|  hypothetical protein                             88.6    1e-16    
ref|XP_010462482.1|  PREDICTED: uncharacterized protein LOC104743...  87.8    1e-16    
ref|WP_012626760.1|  hypothetical protein                             88.2    1e-16    
ref|XP_010060860.1|  PREDICTED: uncharacterized protein LOC104448685  90.9    1e-16    
ref|WP_017294749.1|  hypothetical protein                             88.2    1e-16    
ref|XP_004951774.1|  PREDICTED: uncharacterized protein LOC101758555  90.9    2e-16    
ref|WP_009545321.1|  MULTISPECIES: hypothetical protein               88.2    2e-16    
gb|KHG21681.1|  ATP-dependent zinc metalloprotease FtsH 3             90.5    2e-16    
ref|WP_012308442.1|  hypothetical protein                             88.2    2e-16    
ref|WP_017305499.1|  hypothetical protein                             87.8    2e-16    
ref|WP_021831046.1|  hypothetical protein                             87.4    2e-16    
ref|XP_008447098.1|  PREDICTED: uncharacterized protein LOC103489...  88.2    2e-16    
ref|WP_030007713.1|  hypothetical protein                             87.8    3e-16    
ref|WP_036483415.1|  ATP-dependent Zn protease                        87.8    3e-16    
ref|WP_007303478.1|  hypothetical protein                             87.4    3e-16    
gb|KGN66127.1|  hypothetical protein Csa_1G572970                     63.2    3e-16    
gb|ACF87710.1|  unknown                                               88.2    3e-16    
ref|WP_021834046.1|  Sll1738 protein                                  87.4    3e-16    
ref|WP_017297519.1|  hypothetical protein                             87.0    4e-16    
ref|WP_006529177.1|  ATP-dependent Zn protease                        86.7    5e-16    
gb|ACG47252.1|  hypothetical protein                                  89.0    7e-16    
ref|NP_001130100.1|  uncharacterized protein LOC100191193             89.0    7e-16    
ref|XP_006346027.1|  PREDICTED: uncharacterized protein LOC102605389  88.2    8e-16    
ref|XP_001762437.1|  predicted protein                                87.0    8e-16    
gb|EPS65428.1|  hypothetical protein M569_09348                       87.8    9e-16    
emb|CDY10505.1|  BnaC03g71090D                                        88.2    1e-15    
ref|XP_011095720.1|  PREDICTED: uncharacterized protein LOC105175093  88.2    1e-15    
ref|XP_009106798.1|  PREDICTED: uncharacterized protein LOC103832...  88.2    1e-15    
ref|XP_010669996.1|  PREDICTED: uncharacterized protein LOC104887105  88.2    1e-15    
ref|XP_004243971.1|  PREDICTED: uncharacterized protein LOC101254711  87.8    1e-15    
ref|XP_008798243.1|  PREDICTED: uncharacterized protein LOC103713192  88.2    1e-15    
ref|XP_005706362.1|  hypothetical protein isoform 1                   87.8    1e-15    
emb|CBJ28498.1|  conserved unknown protein                            89.0    1e-15    
emb|CBI24181.3|  unnamed protein product                              87.8    2e-15    
ref|XP_009768417.1|  PREDICTED: uncharacterized protein LOC104219423  87.8    2e-15    
ref|XP_006393498.1|  hypothetical protein EUTSA_v10011505mg           87.8    2e-15    
ref|XP_002263645.3|  PREDICTED: uncharacterized protein LOC100261626  87.4    2e-15    
ref|XP_002894564.1|  hypothetical protein ARALYDRAFT_474687           87.4    2e-15    
ref|XP_006393500.1|  hypothetical protein EUTSA_v10011505mg           87.8    2e-15    
ref|XP_003570102.1|  PREDICTED: uncharacterized protein LOC100846921  87.4    2e-15    
ref|WP_015222834.1|  hypothetical protein                             85.1    2e-15    
ref|XP_010501263.1|  PREDICTED: uncharacterized protein LOC104778504  87.0    2e-15    
ref|NP_001046019.2|  Os02g0169000                                     87.0    2e-15    
dbj|BAD25720.1|  unknown protein                                      87.0    2e-15    
gb|EYU27567.1|  hypothetical protein MIMGU_mgv1a008097mg              87.0    2e-15    
ref|XP_008447096.1|  PREDICTED: uncharacterized protein LOC103489...  87.4    2e-15    
gb|AAF02831.1|AC009894_2  Hypothetical protein                        87.0    3e-15    
gb|KFK35531.1|  hypothetical protein AALP_AA4G002700                  87.0    3e-15    
ref|XP_009590707.1|  PREDICTED: uncharacterized protein LOC104087850  87.0    3e-15    
gb|AAK32818.1|AF361805_1  At1g56180/F14G9_20                          87.0    3e-15    
gb|AIE74336.1|  hypothetical protein D082_18080                       85.1    3e-15    
ref|NP_564711.1|  uncharacterized protein                             87.0    3e-15    
ref|XP_004139896.1|  PREDICTED: uncharacterized protein LOC101213430  87.0    3e-15    
ref|XP_006305012.1|  hypothetical protein CARUB_v10009377mg           87.0    3e-15    
ref|XP_009417744.1|  PREDICTED: uncharacterized protein LOC103998076  86.7    3e-15    
emb|CDP13573.1|  unnamed protein product                              86.7    4e-15    
dbj|BAJ87062.1|  predicted protein                                    86.3    4e-15    
ref|XP_010260608.1|  PREDICTED: uncharacterized protein LOC104599679  86.7    4e-15    
ref|XP_002453366.1|  hypothetical protein SORBIDRAFT_04g004670        86.7    5e-15    
ref|XP_010941658.1|  PREDICTED: uncharacterized protein LOC105059...  86.3    5e-15    
ref|XP_010941655.1|  PREDICTED: uncharacterized protein LOC105059...  86.3    5e-15    
gb|KDP25068.1|  hypothetical protein JCGZ_22603                       86.3    5e-15    
gb|ACG45567.1|  hypothetical protein                                  85.5    7e-15    
ref|XP_003546818.1|  PREDICTED: uncharacterized protein LOC100800880  85.5    9e-15    
ref|WP_015158285.1|  ATP-dependent Zn protease                        82.8    1e-14    
ref|XP_011013836.1|  PREDICTED: uncharacterized protein LOC105117773  85.1    1e-14    
ref|XP_002316146.2|  hypothetical protein POPTR_0010s17850g           84.7    2e-14    
ref|XP_003596089.1|  hypothetical protein MTR_2g066060                84.0    3e-14    
gb|AFK46324.1|  unknown                                               84.0    3e-14    
gb|EJK47513.1|  hypothetical protein THAOC_33760                      84.7    3e-14    
ref|XP_008226132.1|  PREDICTED: uncharacterized protein LOC103325727  84.0    4e-14    
gb|EWM23569.1|  stress regulated protein                              84.0    4e-14    
gb|EHJ14939.1|  hypothetical protein CWATWH0003_0413                  80.1    4e-14    
ref|XP_004488764.1|  PREDICTED: uncharacterized protein LOC101507...  83.6    4e-14    
ref|XP_007212262.1|  hypothetical protein PRUPE_ppa006642mg           83.6    4e-14    
ref|XP_008779005.1|  PREDICTED: probable aminotransferase TAT2        84.0    5e-14    
ref|XP_002513354.1|  conserved hypothetical protein                   83.6    5e-14    
ref|XP_008372153.1|  PREDICTED: uncharacterized protein LOC103435538  81.6    1e-13    
ref|WP_012160852.1|  hypothetical protein                             80.1    1e-13    
ref|WP_010872056.1|  hypothetical protein                             80.1    1e-13    
ref|WP_010474621.1|  hypothetical protein                             79.7    1e-13    
ref|XP_010462483.1|  PREDICTED: uncharacterized protein LOC104743...  79.0    1e-13    
ref|XP_008372156.1|  PREDICTED: uncharacterized protein LOC103435541  81.6    2e-13    
ref|XP_002503074.1|  predicted protein                                81.3    2e-13    
ref|XP_009106797.1|  PREDICTED: uncharacterized protein LOC103832...  81.3    3e-13    
ref|XP_008356157.1|  PREDICTED: uncharacterized protein LOC103419845  80.1    3e-13    
ref|XP_007148977.1|  hypothetical protein PHAVU_005G030300g           80.9    3e-13    
gb|EYU28388.1|  hypothetical protein MIMGU_mgv11b018351mg             75.9    5e-13    
ref|XP_006471939.1|  PREDICTED: uncharacterized protein LOC102619...  77.8    6e-13    
ref|XP_008364245.1|  PREDICTED: uncharacterized protein LOC103427939  80.1    7e-13    
gb|KDO48520.1|  hypothetical protein CISIN_1g019873mg                 77.0    1e-12    
gb|KDO48523.1|  hypothetical protein CISIN_1g019873mg                 77.4    1e-12    
ref|XP_006646935.1|  PREDICTED: uncharacterized protein LOC102702250  78.6    1e-12    
ref|XP_006393499.1|  hypothetical protein EUTSA_v10011505mg           79.3    1e-12    
ref|XP_004308253.1|  PREDICTED: uncharacterized protein LOC101300106  77.4    5e-12    
ref|WP_019502731.1|  hypothetical protein                             74.7    7e-12    
ref|XP_002289018.1|  predicted protein                                76.6    1e-11    
ref|XP_005825652.1|  hypothetical protein GUITHDRAFT_46078            73.2    1e-11    
ref|XP_010093312.1|  hypothetical protein L484_006771                 73.9    7e-11    
ref|XP_005718663.1|  unnamed protein product                          72.8    7e-11    
ref|XP_007511282.1|  predicted protein                                72.8    8e-11    
ref|XP_005536786.1|  hypothetical protein, conserved                  72.8    1e-10    
ref|WP_009629358.1|  hypothetical protein                             70.9    2e-10    
ref|XP_006382664.1|  hypothetical protein POPTR_0005s04270g           67.4    6e-10    
ref|NP_001054033.1|  Os04g0639300                                     67.0    2e-09    
ref|XP_005708761.1|  sarcosine dimethylglycine methyltransferase      70.1    2e-09    
ref|XP_001694244.1|  hypothetical protein CHLREDRAFT_205570           68.6    2e-09    
gb|EWM26562.1|  hypothetical protein Naga_100084g7                    69.3    3e-09    
ref|XP_003580649.1|  PREDICTED: uncharacterized protein LOC100846062  67.8    4e-09    
ref|XP_007159758.1|  hypothetical protein PHAVU_002G264700g           67.4    5e-09    
emb|CAE03618.3|  OSJNBb0003B01.9                                      67.4    6e-09    
gb|EAZ32146.1|  hypothetical protein OsJ_16343                        67.0    6e-09    
gb|ACG33936.1|  hypothetical protein                                  66.6    9e-09    
ref|XP_004976987.1|  PREDICTED: uncharacterized protein LOC101752516  66.6    9e-09    
ref|XP_006827099.1|  hypothetical protein AMTR_s00010p00242000        67.8    9e-09    
gb|AFK43576.1|  unknown                                               66.6    1e-08    
ref|NP_001140871.1|  hypothetical protein                             66.2    1e-08    
emb|CDP12902.1|  unnamed protein product                              66.6    1e-08    
gb|EMT05966.1|  hypothetical protein F775_05675                       64.3    1e-08    
ref|XP_006653809.1|  PREDICTED: uncharacterized protein LOC102705433  65.9    1e-08    
ref|WP_015163685.1|  hypothetical protein                             65.5    1e-08    
ref|XP_002287278.1|  predicted protein                                63.9    1e-08    
ref|XP_006428030.1|  hypothetical protein CICLE_v10026110mg           65.9    2e-08    
ref|XP_010261112.1|  PREDICTED: uncharacterized protein LOC104600018  65.9    2e-08    
gb|AFK38312.1|  unknown                                               65.5    2e-08    
gb|EMS46681.1|  hypothetical protein TRIUR3_08218                     65.5    2e-08    
ref|XP_002448617.1|  hypothetical protein SORBIDRAFT_06g030240        65.1    3e-08    
ref|XP_008784603.1|  PREDICTED: uncharacterized protein LOC103703...  65.1    3e-08    
gb|EYU31085.1|  hypothetical protein MIMGU_mgv1a010183mg              65.1    3e-08    
dbj|BAJ96471.1|  predicted protein                                    64.7    4e-08    
ref|XP_005782668.1|  hypothetical protein EMIHUDRAFT_456653           64.7    5e-08    
ref|XP_006580305.1|  PREDICTED: uncharacterized protein LOC100807...  64.3    5e-08    
ref|XP_005792905.1|  hypothetical protein EMIHUDRAFT_251116           64.3    5e-08    
ref|XP_009119462.1|  PREDICTED: uncharacterized protein LOC103844...  62.8    5e-08    
gb|KHN38221.1|  hypothetical protein glysoja_003886                   64.3    6e-08    
ref|XP_008784611.1|  PREDICTED: uncharacterized protein LOC103703...  63.5    7e-08    
ref|XP_002870786.1|  predicted protein                                62.4    7e-08    
ref|XP_003525077.1|  PREDICTED: uncharacterized protein LOC100807...  63.9    7e-08    
ref|XP_002975329.1|  hypothetical protein SELMODRAFT_103319           63.2    8e-08    
emb|CEF98633.1|  hypothetical protein OT_ostta07g01285                62.0    8e-08    
ref|WP_011429303.1|  hypothetical protein                             62.8    8e-08    
ref|XP_004504022.1|  PREDICTED: uncharacterized protein LOC101490185  63.5    9e-08    
ref|XP_002964467.1|  hypothetical protein SELMODRAFT_81106            62.8    1e-07    
ref|XP_011090626.1|  PREDICTED: uncharacterized protein LOC105171...  63.5    1e-07    
ref|XP_002184911.1|  predicted protein                                62.0    1e-07    
ref|XP_010937045.1|  PREDICTED: uncharacterized protein LOC105056...  63.2    1e-07    
ref|XP_010937046.1|  PREDICTED: uncharacterized protein LOC105056...  62.8    1e-07    
ref|XP_001422227.1|  predicted protein                                62.0    1e-07    
ref|XP_006346727.1|  PREDICTED: uncharacterized protein LOC102584063  63.2    1e-07    
ref|XP_004236712.1|  PREDICTED: uncharacterized protein LOC101250205  63.2    2e-07    
ref|XP_009785171.1|  PREDICTED: uncharacterized protein LOC104233475  62.4    2e-07    
ref|XP_009605619.1|  PREDICTED: uncharacterized protein LOC104100151  62.4    2e-07    
ref|XP_007205553.1|  hypothetical protein PRUPE_ppa008614mg           62.0    3e-07    
ref|XP_010937047.1|  PREDICTED: uncharacterized protein LOC105056...  61.6    3e-07    
ref|XP_008232727.1|  PREDICTED: uncharacterized protein LOC103331836  62.0    3e-07    
ref|XP_010531414.1|  PREDICTED: uncharacterized protein LOC104807722  62.0    4e-07    
ref|XP_003084143.1|  unnamed protein product                          61.6    5e-07    
ref|XP_010652858.1|  PREDICTED: uncharacterized protein LOC100264...  60.8    5e-07    
ref|XP_006355267.1|  PREDICTED: uncharacterized protein LOC102583...  59.7    5e-07    
ref|WP_015168331.1|  hypothetical protein                             59.7    6e-07    
ref|XP_001768660.1|  predicted protein                                61.2    6e-07    
ref|XP_006355266.1|  PREDICTED: uncharacterized protein LOC102583...  59.7    6e-07    
ref|XP_011090627.1|  PREDICTED: uncharacterized protein LOC105171...  60.8    7e-07    
ref|XP_002276081.1|  PREDICTED: uncharacterized protein LOC100264...  60.8    7e-07    
ref|XP_008457887.1|  PREDICTED: uncharacterized protein LOC103497464  60.5    8e-07    
ref|XP_008342852.1|  PREDICTED: uncharacterized protein LOC103405615  60.5    1e-06    
ref|XP_003531378.1|  PREDICTED: uncharacterized protein LOC100306...  60.1    1e-06    
gb|EMS56117.1|  hypothetical protein TRIUR3_08893                     58.2    1e-06    
ref|XP_005847105.1|  hypothetical protein CHLNCDRAFT_134819           60.5    2e-06    
ref|XP_004304856.1|  PREDICTED: uncharacterized protein LOC101297070  59.3    2e-06    
ref|XP_010027772.1|  PREDICTED: uncharacterized protein LOC104418200  58.9    4e-06    
ref|XP_004148439.1|  PREDICTED: uncharacterized protein LOC101209062  58.5    4e-06    
gb|ABK25412.1|  unknown                                               58.5    4e-06    
ref|XP_009343096.1|  PREDICTED: uncharacterized protein LOC103935053  58.5    5e-06    
ref|XP_011021936.1|  PREDICTED: uncharacterized protein LOC105123...  57.4    5e-06    
gb|EMT19149.1|  hypothetical protein F775_19494                       58.5    6e-06    
gb|EPS69665.1|  hypothetical protein M569_05099                       57.8    7e-06    
ref|XP_011021935.1|  PREDICTED: uncharacterized protein LOC105123...  57.8    7e-06    
gb|KDP35243.1|  hypothetical protein JCGZ_09402                       57.8    8e-06    
ref|XP_002307128.2|  hypothetical protein POPTR_0005s08630g           57.8    8e-06    
ref|XP_010099879.1|  hypothetical protein L484_020061                 56.6    1e-05    
ref|XP_002870784.1|  hypothetical protein ARALYDRAFT_916373           53.5    1e-05    
ref|XP_009416874.1|  PREDICTED: uncharacterized protein LOC103997398  56.6    2e-05    
ref|XP_010681086.1|  PREDICTED: uncharacterized protein LOC104896084  56.2    2e-05    
emb|CDP15828.1|  unnamed protein product                              53.9    3e-05    
tpg|DAA35769.1|  TPA: hypothetical protein ZEAMMB73_590939            55.5    3e-05    
ref|XP_002528682.1|  conserved hypothetical protein                   55.5    5e-05    
ref|XP_007030751.1|  Uncharacterized protein TCM_026497               50.8    1e-04    
ref|XP_011078015.1|  PREDICTED: uncharacterized protein LOC105161...  51.2    2e-04    
ref|XP_010497278.1|  PREDICTED: uncharacterized protein LOC104774...  50.4    2e-04    
ref|XP_007048114.1|  Uncharacterized protein isoform 1                52.8    3e-04    
ref|XP_006296468.1|  hypothetical protein CARUB_v10025652mg           52.4    4e-04    
emb|CDY46224.1|  BnaCnng13750D                                        52.0    5e-04    
gb|EJK71112.1|  hypothetical protein THAOC_07480                      52.0    6e-04    
emb|CDY15852.1|  BnaA04g12590D                                        52.0    6e-04    
ref|XP_006404650.1|  hypothetical protein EUTSA_v10000230mg           51.6    7e-04    
ref|XP_009140317.1|  PREDICTED: uncharacterized protein LOC103864311  51.6    7e-04    
gb|KDO61593.1|  hypothetical protein CISIN_1g016454mg                 51.2    8e-04    
ref|XP_006422253.1|  hypothetical protein CICLE_v10005140mg           51.2    8e-04    



>ref|XP_010025124.1| PREDICTED: uncharacterized protein LOC104415507 [Eucalyptus grandis]
 ref|XP_010025125.1| PREDICTED: uncharacterized protein LOC104415507 [Eucalyptus grandis]
 gb|KCW61718.1| hypothetical protein EUGRSUZ_H04431 [Eucalyptus grandis]
Length=338

 Score =   409 bits (1051),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 233/248 (94%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIET  LLSP+DATLG+IERNLQ+AAL+GG++AWN+L L+PQQ
Sbjct  78    ARQVPQRLYTLDELKLNGIETALLLSPIDATLGAIERNLQLAALAGGLSAWNLLGLSPQQ  137

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLGLLFL TFDSVSFNGG G+L+LDTIGHT S+KYHNRV+QHEAGHFLIAYL+GIL
Sbjct  138   IFYISLGLLFLWTFDSVSFNGGVGSLVLDTIGHTFSQKYHNRVLQHEAGHFLIAYLIGIL  197

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYT++SL+ALKKEGSLNVQAGT+FVDFEFLEEVN G+VSAT LN+FSCIALAGVATEY
Sbjct  198   PRGYTISSLDALKKEGSLNVQAGTSFVDFEFLEEVNAGKVSATTLNKFSCIALAGVATEY  257

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFGCAEGGLADINQLD LL+ LGFTQKKADSQVRWAVLN++L+LRRHE AR KLAE MS
Sbjct  258   LLFGCAEGGLADINQLDSLLKGLGFTQKKADSQVRWAVLNSVLLLRRHEAARGKLAEAMS  317

Query  1110  EGRSVGFC  1133
             EG+SVG+C
Sbjct  318   EGKSVGYC  325


 Score = 76.6 bits (187),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 50/75 (67%), Gaps = 5/75 (7%)
 Frame = +1

Query  181  YGGFRHHPRLGLCNSRIVCLSESGGG-----VRWQLLKRVDEELSKGDERAALSLVKDLQ  345
            YG     PRL +   R + +  S         R Q+L+RVDEEL+KG+ERAAL LVKD Q
Sbjct  7    YGSLSRDPRLKVPILRTIIVRASSSPPQVEFSRRQVLERVDEELAKGNERAALGLVKDSQ  66

Query  346  GKPGGLRCFGAARQV  390
            GKPGGLRCFG+ARQV
Sbjct  67   GKPGGLRCFGSARQV  81



>ref|XP_010315882.1| PREDICTED: stress regulated protein isoform X1 [Solanum lycopersicum]
Length=288

 Score =   405 bits (1040),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 201/247 (81%), Positives = 229/247 (93%), Gaps = 0/247 (0%)
 Frame = +3

Query  393   LQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQI  572
             +Q+PQ+LYSL+EL+LNGIE +SLLSPVDATLG+IERNLQIAA+  G AAW  L+L+PQQI
Sbjct  29    MQVPQRLYSLDELKLNGIEAISLLSPVDATLGAIERNLQIAAILSGSAAWYALDLSPQQI  88

Query  573   lyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILP  752
             L++SLG+LFL T D VSFNGG G L+LDTIGHT S+KYHNRVIQHEAGHFLIAYLLGILP
Sbjct  89    LFVSLGVLFLWTLDLVSFNGGVGTLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYLLGILP  148

Query  753   RGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYL  932
             +GYTLTSL+ALKKEGSLN+QAGTAFVD EF+EEVN+G+V+ATMLNRFSCIALAGVATEYL
Sbjct  149   KGYTLTSLDALKKEGSLNIQAGTAFVDLEFIEEVNRGKVTATMLNRFSCIALAGVATEYL  208

Query  933   LFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSE  1112
             LFG AEGGL+DINQLD LL+SLGFTQKKADSQVRWAVLNTILILRRHE AR+KLAE M++
Sbjct  209   LFGYAEGGLSDINQLDALLKSLGFTQKKADSQVRWAVLNTILILRRHEKARSKLAEAMTQ  268

Query  1113  GRSVGFC  1133
             G+SVG C
Sbjct  269   GKSVGVC  275



>gb|AAW65807.1| stress regulated protein isoform 3 [Solanum virginianum]
 gb|AAW65812.1| stress regulated protein isoform 3 [Solanum virginianum]
Length=326

 Score =   404 bits (1039),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LYSL+ELRLNGIETVSLLSPVDATLG+IERNLQI A+  G AAW  L+L+PQQ
Sbjct  66    ARQVPQRLYSLDELRLNGIETVSLLSPVDATLGAIERNLQIVAILSGSAAWYALDLSPQQ  125

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL++SLG+LFL T D VSFNGG GAL+LDTIGHT S+KYHNRV QHEAGHFLIAYLLGIL
Sbjct  126   ILFVSLGVLFLWTLDLVSFNGGVGALVLDTIGHTFSQKYHNRVTQHEAGHFLIAYLLGIL  185

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTSL+ALKK+GSLN+QAGTAFVDFEF+EEVN G+V+ATMLNRFSCIALAGVATEY
Sbjct  186   PKGYTLTSLDALKKQGSLNIQAGTAFVDFEFIEEVNSGKVTATMLNRFSCIALAGVATEY  245

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG AEGGL+DINQLD LL+SLGFTQKKADSQVRWAVLNTILILRRHE AR KLAE M+
Sbjct  246   LLFGYAEGGLSDINQLDALLKSLGFTQKKADSQVRWAVLNTILILRRHEKARVKLAEAMT  305

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  306   RGKSVGVC  313


 Score = 72.8 bits (177),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 55/81 (68%), Gaps = 9/81 (11%)
 Frame = +1

Query  169  SAACY-GGFRHHPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQ  345
            S A Y GG     +L   NSRI+    SG  V    L++VD+EL KGDERAALSLVKDL+
Sbjct  3    SIAAYCGGLLCCSQLRSSNSRIL----SGLSV----LEQVDKELMKGDERAALSLVKDLR  54

Query  346  GKPGGLRCFGAARQVLCRYPS  408
            GKPGGLRCFGAARQV  R  S
Sbjct  55   GKPGGLRCFGAARQVPQRLYS  75



>ref|XP_006338258.1| PREDICTED: uncharacterized protein LOC102604994 [Solanum tuberosum]
Length=326

 Score =   404 bits (1037),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LYSL+EL+LNGIE +SLLSPVDATLG+IERNLQIAA+  G AAW  L+L+PQQ
Sbjct  66    ARQVPQRLYSLDELKLNGIEAISLLSPVDATLGAIERNLQIAAILSGSAAWYALDLSPQQ  125

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL++SLG+LFL T D VSFNGG G L+LDTIGHT S+KYH+RVIQHEAGHFLIAYLLGIL
Sbjct  126   ILFVSLGVLFLWTLDLVSFNGGVGTLVLDTIGHTFSQKYHSRVIQHEAGHFLIAYLLGIL  185

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTSL+ALKKEGSLN+QAGTAFVDFEF+EEVN+G+V+ATMLNRFSCIALAGVATEY
Sbjct  186   PKGYTLTSLDALKKEGSLNIQAGTAFVDFEFIEEVNRGKVTATMLNRFSCIALAGVATEY  245

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG AEGGL+DINQLD LL+SLGFTQKKADSQVRWAVLNTILILRRHE AR+KLAE M+
Sbjct  246   LLFGYAEGGLSDINQLDALLKSLGFTQKKADSQVRWAVLNTILILRRHEKARSKLAEAMT  305

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  306   RGKSVGVC  313


 Score = 75.9 bits (185),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 55/81 (68%), Gaps = 9/81 (11%)
 Frame = +1

Query  169  SAACY-GGFRHHPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQ  345
            S A Y GG     +L   NSRIV    SG  V    L++VD+EL KGDERAALSLVKDLQ
Sbjct  3    SIASYCGGLLCCSQLRSSNSRIV----SGLSV----LEQVDKELMKGDERAALSLVKDLQ  54

Query  346  GKPGGLRCFGAARQVLCRYPS  408
            GKPGGLRCFGAARQV  R  S
Sbjct  55   GKPGGLRCFGAARQVPQRLYS  75



>ref|NP_001233778.1| stress regulated protein [Solanum lycopersicum]
 gb|AAW65813.1| stress regulated protein [Solanum lycopersicum]
Length=326

 Score =   404 bits (1037),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 228/248 (92%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LYSL+EL+LNGIE +SLLSPVDATLG+IERNLQIAA+  G AAW  L+L+PQQ
Sbjct  66    ARQVPQRLYSLDELKLNGIEAISLLSPVDATLGAIERNLQIAAILSGSAAWYALDLSPQQ  125

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I ++SLG+LFL T D VSFNGG G L+LDTIGHT S+KYHNRVIQHEAGHFLIAYLLGIL
Sbjct  126   IFFVSLGVLFLWTLDLVSFNGGVGTLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYLLGIL  185

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTSL+ALKKEGSLN+QAGTAFVD EF+EEVN+G+V+ATMLNRFSCIALAGVATEY
Sbjct  186   PKGYTLTSLDALKKEGSLNIQAGTAFVDLEFIEEVNRGKVTATMLNRFSCIALAGVATEY  245

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG AEGGL+DINQLD LL+SLGFTQKKADSQVRWAVLNTILILRRHE AR+KLAE M+
Sbjct  246   LLFGYAEGGLSDINQLDALLKSLGFTQKKADSQVRWAVLNTILILRRHEKARSKLAEAMT  305

Query  1110  EGRSVGFC  1133
             +G+SVG C
Sbjct  306   QGKSVGVC  313


 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 55/81 (68%), Gaps = 9/81 (11%)
 Frame = +1

Query  169  SAACY-GGFRHHPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQ  345
            S A Y GG      L   NSRIV    SG  V    L++VD+EL+KGDERAALSLVKDLQ
Sbjct  3    SIAAYCGGLLCCSELRSSNSRIV----SGLSV----LEQVDKELTKGDERAALSLVKDLQ  54

Query  346  GKPGGLRCFGAARQVLCRYPS  408
            GKPGGLRCFGAARQV  R  S
Sbjct  55   GKPGGLRCFGAARQVPQRLYS  75



>ref|XP_009601047.1| PREDICTED: uncharacterized protein LOC104096390 isoform X2 [Nicotiana 
tomentosiformis]
Length=260

 Score =   400 bits (1029),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 200/247 (81%), Positives = 226/247 (91%), Gaps = 0/247 (0%)
 Frame = +3

Query  393   LQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQI  572
             +Q+PQ+LYSL+ELRLNGIETVSLLSPVD  LG+IERNLQ AA+ GG+AAW  L+L+PQQ+
Sbjct  1     MQVPQRLYSLDELRLNGIETVSLLSPVDTNLGAIERNLQFAAVLGGIAAWYALDLDPQQL  60

Query  573   lyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILP  752
             L++SLGLLFL T D VSFNGG GALILDT GH  S+KYHNRV+QHEAGHFLIAYLLGILP
Sbjct  61    LFVSLGLLFLWTLDLVSFNGGVGALILDTTGHIFSQKYHNRVVQHEAGHFLIAYLLGILP  120

Query  753   RGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYL  932
             +GYTLTSL+ALKKEGSLN+QAG AFVDFEF+EEVN+G+V+ATMLNRFSCI+LAGVATEYL
Sbjct  121   KGYTLTSLDALKKEGSLNIQAGAAFVDFEFMEEVNRGKVTATMLNRFSCISLAGVATEYL  180

Query  933   LFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSE  1112
             LFG AEGGL DINQLD LL+SLGFTQKKADSQVRWA+LNTILILRRHE ARAKLAE M+ 
Sbjct  181   LFGYAEGGLTDINQLDALLKSLGFTQKKADSQVRWALLNTILILRRHEKARAKLAEAMTR  240

Query  1113  GRSVGFC  1133
             G+SVG C
Sbjct  241   GKSVGVC  247



>ref|XP_006433238.1| hypothetical protein CICLE_v10001775mg [Citrus clementina]
 gb|ESR46478.1| hypothetical protein CICLE_v10001775mg [Citrus clementina]
Length=322

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+L+EL+LNGIET SLLSPVD TLGSIERNLQ+AA++GGV+AWNV + NPQQ
Sbjct  62    ARQIPQRLYTLDELKLNGIETRSLLSPVDETLGSIERNLQLAAIAGGVSAWNVFSFNPQQ  121

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             ILY+SL LLFL T DSVS+NGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  122   ILYLSLALLFLWTVDSVSYNGGVGSLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYLVGIL  181

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVN G+VSAT LNRFSCIALAGVATEY
Sbjct  182   PKGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNSGKVSATTLNRFSCIALAGVATEY  241

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+ LGFTQKKADSQVRW++LNT+L+LRRH+ ARAKLAE M+
Sbjct  242   LLYGYAEGGLADINKLDALLKGLGFTQKKADSQVRWSLLNTVLLLRRHKGARAKLAEAMT  301

Query  1110  EGRSVGFC  1133
              G+S+G C
Sbjct  302   MGKSLGSC  309


 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  268  QLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            ++LK+VDEELSKGDERAAL+LVKDLQGKPGGLRCFGAARQ+  R
Sbjct  25   RVLKQVDEELSKGDERAALALVKDLQGKPGGLRCFGAARQIPQR  68



>ref|XP_006433241.1| hypothetical protein CICLE_v10001775mg [Citrus clementina]
 ref|XP_006471941.1| PREDICTED: uncharacterized protein LOC102620697 [Citrus sinensis]
 gb|ESR46481.1| hypothetical protein CICLE_v10001775mg [Citrus clementina]
 gb|KDO48524.1| hypothetical protein CISIN_1g019841mg [Citrus sinensis]
Length=335

 Score =   402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+L+EL+LNGIET SLLSPVD TLGSIERNLQ+AA++GGV+AWNV + NPQQ
Sbjct  75    ARQIPQRLYTLDELKLNGIETRSLLSPVDETLGSIERNLQLAAIAGGVSAWNVFSFNPQQ  134

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             ILY+SL LLFL T DSVS+NGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  135   ILYLSLALLFLWTVDSVSYNGGVGSLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYLVGIL  194

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVN G+VSAT LNRFSCIALAGVATEY
Sbjct  195   PKGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNSGKVSATTLNRFSCIALAGVATEY  254

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+ LGFTQKKADSQVRW++LNT+L+LRRH+ ARAKLAE M+
Sbjct  255   LLYGYAEGGLADINKLDALLKGLGFTQKKADSQVRWSLLNTVLLLRRHKGARAKLAEAMT  314

Query  1110  EGRSVGFC  1133
              G+S+G C
Sbjct  315   MGKSLGSC  322


 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  268  QLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            ++LK+VDEELSKGDERAAL+LVKDLQGKPGGLRCFGAARQ+  R
Sbjct  38   RVLKQVDEELSKGDERAALALVKDLQGKPGGLRCFGAARQIPQR  81



>gb|KDP23574.1| hypothetical protein JCGZ_23407 [Jatropha curcas]
Length=333

 Score =   401 bits (1031),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIET SLLSPVD TLGSIERNLQ+AAL GG+AAWN    NPQQ
Sbjct  73    ARQVPQRLYTLDELKLNGIETTSLLSPVDTTLGSIERNLQLAALIGGIAAWNAFGFNPQQ  132

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             ILY SLG LFL T DSVSFNGG G L+LDTIGHT S KYHNRVIQHEAGHFLIAYLLGIL
Sbjct  133   ILYFSLGFLFLWTLDSVSFNGGVGGLVLDTIGHTFSRKYHNRVIQHEAGHFLIAYLLGIL  192

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SLEAL+KEGSLNVQAGTAFVDFEFLEEVN G+VSAT LNRFSCIALAGV TEY
Sbjct  193   PKGYTLSSLEALQKEGSLNVQAGTAFVDFEFLEEVNAGKVSATTLNRFSCIALAGVITEY  252

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL  LGFTQKKADSQ+RW+VLNT+LILRRHE ARAKLAE MS
Sbjct  253   LLYGYAEGGLADINKLDLLLNGLGFTQKKADSQIRWSVLNTVLILRRHERARAKLAEAMS  312

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  313   MGKSVGSC  320


 Score = 82.0 bits (201),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  SAACYGGFRHHPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQG  348
            +  C        R  +C+ RIV  S S G  R Q L +VD+EL+KGDERAALSL+KDL+G
Sbjct  3    TVVCNTTLVSPTRTRICSFRIVNSSPSVGISRQQALDQVDKELAKGDERAALSLIKDLKG  62

Query  349  KPGGLRCFGAARQV  390
            KP GLRCFGAARQV
Sbjct  63   KPSGLRCFGAARQV  76



>ref|XP_009601046.1| PREDICTED: uncharacterized protein LOC104096390 isoform X1 [Nicotiana 
tomentosiformis]
Length=325

 Score =   399 bits (1026),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LYSL+ELRLNGIETVSLLSPVD  LG+IERNLQ AA+ GG+AAW  L+L+PQQ
Sbjct  65    ARQVPQRLYSLDELRLNGIETVSLLSPVDTNLGAIERNLQFAAVLGGIAAWYALDLDPQQ  124

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L++SLGLLFL T D VSFNGG GALILDT GH  S+KYHNRV+QHEAGHFLIAYLLGIL
Sbjct  125   LLFVSLGLLFLWTLDLVSFNGGVGALILDTTGHIFSQKYHNRVVQHEAGHFLIAYLLGIL  184

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTSL+ALKKEGSLN+QAG AFVDFEF+EEVN+G+V+ATMLNRFSCI+LAGVATEY
Sbjct  185   PKGYTLTSLDALKKEGSLNIQAGAAFVDFEFMEEVNRGKVTATMLNRFSCISLAGVATEY  244

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG AEGGL DINQLD LL+SLGFTQKKADSQVRWA+LNTILILRRHE ARAKLAE M+
Sbjct  245   LLFGYAEGGLTDINQLDALLKSLGFTQKKADSQVRWALLNTILILRRHEKARAKLAEAMT  304

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  305   RGKSVGVC  312


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 58/81 (72%), Gaps = 10/81 (12%)
 Frame = +1

Query  169  SAACY-GGFRHHPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQ  345
            SAA Y GG     +LGL NSRIV LS         +L++VD+EL KGD+RAALSLVKDLQ
Sbjct  3    SAAAYCGGLVCCFQLGLSNSRIVGLS---------VLEQVDKELKKGDDRAALSLVKDLQ  53

Query  346  GKPGGLRCFGAARQVLCRYPS  408
            GKPGGLRCFGAARQV  R  S
Sbjct  54   GKPGGLRCFGAARQVPQRLYS  74



>ref|XP_011023508.1| PREDICTED: uncharacterized protein LOC105124970 [Populus euphratica]
Length=330

 Score =   399 bits (1025),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 199/248 (80%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+L+EL+LNGIET SLLSPVDATLG+IERNLQ+A ++GG+A WN   L+PQQ
Sbjct  70    ARQIPQRLYTLDELKLNGIETRSLLSPVDATLGAIERNLQLAGVAGGLATWNAFGLSPQQ  129

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL  SLGLLFL T DSVSFNGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAY++GIL
Sbjct  130   ILLFSLGLLFLWTLDSVSFNGGLGSLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYMVGIL  189

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTLTSLEAL+K+GS NVQAGTAFVDF+FLEEVN G+VSAT LNRFSCIALAGVATEY
Sbjct  190   PRGYTLTSLEALQKDGSFNVQAGTAFVDFDFLEEVNTGKVSATTLNRFSCIALAGVATEY  249

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG AEGGLADIN+LD L++ LGFTQKKADSQVRW+VLNTIL+LRRHE ARAKLAE M+
Sbjct  250   LLFGYAEGGLADINKLDMLIKGLGFTQKKADSQVRWSVLNTILMLRRHEGARAKLAEAMT  309

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  310   MGKSVGSC  317


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 2/63 (3%)
 Frame = +1

Query  202  PRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAA  381
            PRL  C+ +IV    S G  R Q+L++VD+ELSKGDERAALSLVKDLQGKPGGLRCFGAA
Sbjct  13   PRLRFCSKKIV--GSSVGVQRQQVLEQVDKELSKGDERAALSLVKDLQGKPGGLRCFGAA  70

Query  382  RQV  390
            RQ+
Sbjct  71   RQI  73



>gb|KDO37200.1| hypothetical protein CISIN_1g019829mg [Citrus sinensis]
Length=335

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+L+EL+LNGIET SLLSPVD TLGSIERNLQ+AA+ GGV+AWNV   NPQQ
Sbjct  75    ARQIPQRLYTLDELKLNGIETRSLLSPVDETLGSIERNLQLAAIVGGVSAWNVFGFNPQQ  134

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             ILY+SL LLFL T DSVS+NGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  135   ILYLSLALLFLWTVDSVSYNGGVGSLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYLVGIL  194

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTS EALKKEGSLNVQAGTAFVDFEFLEEVN G+VSAT LNRFSCIALAGVATEY
Sbjct  195   PKGYTLTSFEALKKEGSLNVQAGTAFVDFEFLEEVNSGKVSATTLNRFSCIALAGVATEY  254

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+ LGFTQKKADSQVRW++LNT+L+LRRH+ ARAKLA  M+
Sbjct  255   LLYGYAEGGLADINKLDALLKGLGFTQKKADSQVRWSLLNTVLLLRRHKGARAKLAVAMT  314

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  315   MGKSVGSC  322


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +1

Query  202  PRLGLCN-SRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGA  378
            PR+ + + SRIV  SE     R ++LK+VDEELSKGDERAAL+LVKDLQGKPGGLRCFGA
Sbjct  16   PRVKVLSLSRIVSSSEVEVSKR-RVLKQVDEELSKGDERAALALVKDLQGKPGGLRCFGA  74

Query  379  ARQV  390
            ARQ+
Sbjct  75   ARQI  78



>ref|XP_007030748.1| A_TM021B04.11 protein [Theobroma cacao]
 gb|EOY11250.1| A_TM021B04.11 protein [Theobroma cacao]
Length=332

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+ELRLNGIET SLLSPVDATLGSIERNLQ+AA+ GGVAAWN    +PQQ
Sbjct  72    ARQVPQRLYTLDELRLNGIETTSLLSPVDATLGSIERNLQLAAILGGVAAWNAFGFSPQQ  131

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL+ISLG LFL T DSVSFNGG G+ +LDTIGHT S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  132   ILFISLGFLFLWTLDSVSFNGGVGSSVLDTIGHTFSQKYHNRVIQHEAGHFLIAYLVGIL  191

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTLTSLEALKKEGSLN+QAGTAFVDFEFLEE N G+VSAT LNRFSCIALAGVATEY
Sbjct  192   PRGYTLTSLEALKKEGSLNIQAGTAFVDFEFLEEANAGKVSATTLNRFSCIALAGVATEY  251

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+ LGFTQKKADSQVRW+VLNTIL+LRRHE AR +LAE MS
Sbjct  252   LLYGYAEGGLADINKLDALLKGLGFTQKKADSQVRWSVLNTILLLRRHEAARGQLAEAMS  311

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  312   LGKSVGSC  319


 Score = 82.4 bits (202),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +1

Query  169  SAACYGGFRHHPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQG  348
            + A Y      P L L   RIV  SE G   R Q+L++VD+EL+KGDERAAL+LV+DLQG
Sbjct  3    TLAYYCNLSSCPSLRLSTFRIVGSSEIGVS-RRQVLEQVDKELNKGDERAALTLVRDLQG  61

Query  349  KPGGLRCFGAARQV  390
            KPGGLRCFGAARQV
Sbjct  62   KPGGLRCFGAARQV  75



>ref|XP_009759314.1| PREDICTED: uncharacterized protein LOC104211868 [Nicotiana sylvestris]
Length=325

 Score =   396 bits (1017),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LYSL+ELRLNGIETVSLLSPVD TLG+IERNLQ AA+ GG+AAW  L+ +PQQ
Sbjct  65    ARQVPQRLYSLDELRLNGIETVSLLSPVDTTLGAIERNLQFAAVLGGIAAWYALDWSPQQ  124

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L+ SLG+LFL T D VSFNGG GALILDT GHT S+KY NRV+QHEAGHFLIAYLLGIL
Sbjct  125   LLFGSLGVLFLWTLDLVSFNGGVGALILDTTGHTFSQKYRNRVVQHEAGHFLIAYLLGIL  184

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTSL+ALKKEGSLN+QAGTAFVDFEF+EEVN G+++ATMLNRFSCI+LAGVATEY
Sbjct  185   PKGYTLTSLDALKKEGSLNIQAGTAFVDFEFMEEVNSGKLTATMLNRFSCISLAGVATEY  244

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLF  AEGGL DINQLD LL+SLGFTQKKADSQVRWAVLNTILILRRHE ARAKLAE M 
Sbjct  245   LLFSYAEGGLTDINQLDALLKSLGFTQKKADSQVRWAVLNTILILRRHEKARAKLAEAMI  304

Query  1110  EGRSVGFC  1133
             +G+SVG C
Sbjct  305   QGKSVGIC  312


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 58/81 (72%), Gaps = 10/81 (12%)
 Frame = +1

Query  169  SAACY-GGFRHHPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQ  345
            SAA Y GG     +LGL NSRIV LS         +L++VD+EL KGD+RAALSLVKDLQ
Sbjct  3    SAAAYCGGLVCCSQLGLRNSRIVGLS---------VLEQVDKELKKGDDRAALSLVKDLQ  53

Query  346  GKPGGLRCFGAARQVLCRYPS  408
            GKPGGLRCFGAARQV  R  S
Sbjct  54   GKPGGLRCFGAARQVPQRLYS  74



>ref|XP_010524890.1| PREDICTED: uncharacterized protein LOC104802813 [Tarenaya hassleriana]
Length=383

 Score =   397 bits (1021),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGI T+SLLSP DATL S+ERNLQIAA+SGG+AAW   +L+PQQ
Sbjct  123   ARQVPQRLYTLDELKLNGINTMSLLSPTDATLDSVERNLQIAAVSGGLAAWKGFDLSPQQ  182

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL++SLG LFL T D VSFNGG G+L+LDTIGHT S++YHNRVIQHEAGHFL+AYL+GIL
Sbjct  183   ILFLSLGSLFLWTLDLVSFNGGIGSLVLDTIGHTFSQRYHNRVIQHEAGHFLVAYLVGIL  242

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTL+SLEAL++EG+LN+QAGTAFVD+EFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  243   PRGYTLSSLEALQEEGTLNIQAGTAFVDYEFLEEVNAGKVSATMLNRFSCIALAGVATEY  302

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+SLGFTQKKADSQVRW+VLNTILILRRHE AR+KLAE MS
Sbjct  303   LLYGYAEGGLADINKLDVLLKSLGFTQKKADSQVRWSVLNTILILRRHEMARSKLAEAMS  362

Query  1110  EGRSVGFC  1133
             EG+SVG C
Sbjct  363   EGKSVGSC  370


 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  226  RIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
             IV  SE+G   R + L++VD+ELS+GDERAAL LVKDLQGKPGGL CFGAARQV
Sbjct  73   NIVASSETGISSR-KALEQVDKELSRGDERAALGLVKDLQGKPGGLCCFGAARQV  126



>ref|XP_002319039.2| hypothetical protein POPTR_0013s03000g [Populus trichocarpa]
 gb|ABK95557.1| unknown [Populus trichocarpa]
 gb|EEE94962.2| hypothetical protein POPTR_0013s03000g [Populus trichocarpa]
Length=330

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/246 (79%), Positives = 221/246 (90%), Gaps = 0/246 (0%)
 Frame = +3

Query  396   QIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQIl  575
             QIPQ+LY+L+EL+LNGIET SLLSPVDATLG+IER LQ+A ++GG+A WN    +PQQIL
Sbjct  72    QIPQRLYTLDELKLNGIETRSLLSPVDATLGAIERTLQLAGVAGGLATWNAFGFSPQQIL  131

Query  576   yislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPR  755
               SLGLLFL T DSVSFNGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAY++GILPR
Sbjct  132   LFSLGLLFLWTLDSVSFNGGLGSLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYMVGILPR  191

Query  756   GYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLL  935
             GYTLTSLEAL+K+GS NVQAGTAFVDF+FLEEVN G+VSAT LNRFSCIALAGVATEYLL
Sbjct  192   GYTLTSLEALQKDGSFNVQAGTAFVDFDFLEEVNTGKVSATTLNRFSCIALAGVATEYLL  251

Query  936   FGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEG  1115
             FG AEGGLADIN+LD L++ LGFTQKKADSQVRW+VLNTIL+LRRHE AR KLAE M+ G
Sbjct  252   FGYAEGGLADINKLDMLIKGLGFTQKKADSQVRWSVLNTILMLRRHEGAREKLAEAMTMG  311

Query  1116  RSVGFC  1133
             +SVG C
Sbjct  312   KSVGSC  317


 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 2/63 (3%)
 Frame = +1

Query  202  PRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAA  381
            PRL LC+ +IV    S G  R Q+L++VD+ELSKGDERAALSLVKDLQGKPGGLRCFGA 
Sbjct  13   PRLRLCSKKIV--GSSVGVQRQQVLEQVDKELSKGDERAALSLVKDLQGKPGGLRCFGAG  70

Query  382  RQV  390
            RQ+
Sbjct  71   RQI  73



>ref|XP_002512307.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49759.1| conserved hypothetical protein [Ricinus communis]
Length=337

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 199/248 (80%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIE  SLLSPVDATLGSIERNLQ+  L GG+AAWN    +PQQ
Sbjct  77    ARQVPQRLYTLDELKLNGIEAASLLSPVDATLGSIERNLQLCGLLGGIAAWNTFGFSPQQ  136

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I Y SLGLLFLLT DSVSFNGG G+L+LDTIGHT S+KYH+RVIQHEAGHFLIAYL+GIL
Sbjct  137   IFYFSLGLLFLLTLDSVSFNGGVGSLVLDTIGHTFSQKYHSRVIQHEAGHFLIAYLVGIL  196

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SLEAL+KEGSLNVQAGTAFVDFEFLEEVN G++SA  LNRFSCIALAGVATEY
Sbjct  197   PKGYTLSSLEALQKEGSLNVQAGTAFVDFEFLEEVNTGKLSAMSLNRFSCIALAGVATEY  256

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+ LGFTQKKADSQVRW+VLNTILILRRH+ ARAKLAE MS
Sbjct  257   LLYGFAEGGLADINKLDMLLKGLGFTQKKADSQVRWSVLNTILILRRHDGARAKLAEAMS  316

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  317   MGKSVGSC  324


 Score = 70.5 bits (171),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            R Q+L++VD+EL KGDERAAL+LV+DLQGKP GL+C+GAARQV
Sbjct  38   RQQVLEQVDKELKKGDERAALALVRDLQGKPAGLKCYGAARQV  80



>ref|XP_009335653.1| PREDICTED: uncharacterized protein LOC103928348 [Pyrus x bretschneideri]
Length=336

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/248 (77%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LN IE  SLLSPVD TLGSIERNLQIAA+ GGV+AWNV   +PQQ
Sbjct  76    ARQVPQRLYTLDELKLNKIEASSLLSPVDTTLGSIERNLQIAAVVGGVSAWNVFGFSPQQ  135

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I ++SLGLLFL T D++SFNGG G+L++DTIGHT S+KY NRV QHEAGHFLIAYL+GIL
Sbjct  136   IFFLSLGLLFLWTLDAISFNGGLGSLVIDTIGHTFSQKYRNRVTQHEAGHFLIAYLVGIL  195

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SLEALKKEGSLNVQAGTAFVDFEF+EEVN G+VSAT LN+F+C+ALAGVA+EY
Sbjct  196   PKGYTLSSLEALKKEGSLNVQAGTAFVDFEFVEEVNAGKVSATTLNKFACVALAGVASEY  255

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADINQLD L +SLGFTQKK DSQVRW+VLNT+LILRRHE ARAKLAE M+
Sbjct  256   LLYGYAEGGLADINQLDSLFRSLGFTQKKTDSQVRWSVLNTVLILRRHEGARAKLAEAMA  315

Query  1110  EGRSVGFC  1133
             EG+SVG C
Sbjct  316   EGKSVGAC  323


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = +1

Query  181  YGGFRHHPRLGL--CNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKP  354
            Y G    PRL L   + R++C SE     R Q+LK+VDEEL KGDERAALSLVKDLQGKP
Sbjct  9    YAGSSCKPRLSLRFPSFRVICSSELSVS-RRQVLKQVDEELGKGDERAALSLVKDLQGKP  67

Query  355  GGLRCFGAARQV  390
            GGLRCFGAARQV
Sbjct  68   GGLRCFGAARQV  79



>ref|XP_007205504.1| hypothetical protein PRUPE_ppa008298mg [Prunus persica]
 gb|EMJ06703.1| hypothetical protein PRUPE_ppa008298mg [Prunus persica]
Length=337

 Score =   388 bits (997),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LYSL+EL+LNGIE  SLLSPVD TLGSIERNLQ+AA+ GGV+AWNV   + QQ
Sbjct  77    ARQVPQRLYSLDELKLNGIEASSLLSPVDTTLGSIERNLQLAAVLGGVSAWNVFGFSAQQ  136

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLGLLFL T D+VSFNGG  +L++DTIGHT S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  137   IFYISLGLLFLWTLDAVSFNGGVSSLVIDTIGHTFSQKYHNRVIQHEAGHFLIAYLVGIL  196

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SLEALKKEGSLNVQAGTAFVDFEF+EEVN G+VSAT LNRF+C+ALAGVA EY
Sbjct  197   PKGYTLSSLEALKKEGSLNVQAGTAFVDFEFVEEVNAGKVSATTLNRFACVALAGVAAEY  256

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             +L+G AEGGLADINQLD L +SLGFTQKK DSQVRW+VLNT+LILRRHE  RAKLAE MS
Sbjct  257   ILYGYAEGGLADINQLDSLYRSLGFTQKKTDSQVRWSVLNTVLILRRHEVVRAKLAEAMS  316

Query  1110  EGRSVGFC  1133
             EG+SVG C
Sbjct  317   EGKSVGSC  324


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 5/81 (6%)
 Frame = +1

Query  178  CYGGFRHHPRLGLC----NSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQ  345
            CY G  + P+L L     +  I+C SE     R Q+LK+VD+EL KGDERAALSLVKD+Q
Sbjct  7    CYAGSSYRPQLQLSLRFPSFGIICSSEVSVS-RQQVLKQVDKELDKGDERAALSLVKDVQ  65

Query  346  GKPGGLRCFGAARQVLCRYPS  408
            GKPGGLRCFGAARQV  R  S
Sbjct  66   GKPGGLRCFGAARQVPQRLYS  86



>ref|XP_004135643.1| PREDICTED: uncharacterized protein LOC101213973 [Cucumis sativus]
 gb|KGN66128.1| hypothetical protein Csa_1G572980 [Cucumis sativus]
Length=327

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+LEEL+LNGIET SLLSP+D+TLGSIER +Q+AA    V+AWN+    PQQ
Sbjct  67    ARQIPQRLYTLEELKLNGIETSSLLSPLDSTLGSIERYIQLAAGLLAVSAWNLFEFTPQQ  126

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLG LFL T DSV+ NGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYLLG+L
Sbjct  127   IFYISLGFLFLWTLDSVALNGGVGSLVLDTIGHTFSKKYHNRVIQHEAGHFLIAYLLGVL  186

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT +S EA +KEGSLN+QAGTAFVDFEFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  187   PKGYTTSSFEAFQKEGSLNLQAGTAFVDFEFLEEVNAGKVSATMLNRFSCIALAGVATEY  246

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+GCAEGGLADIN+LD LL+ LGFTQKKADSQVRWAVLNTILILRRHE+ARAKLA+ MS
Sbjct  247   LLYGCAEGGLADINKLDVLLKGLGFTQKKADSQVRWAVLNTILILRRHESARAKLADAMS  306

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  307   SGKSVGNC  314


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            R Q+L++VD+EL+KGD+RAAL L+K+ QGK  G+RCFGAARQ+
Sbjct  28   RRQVLEQVDKELAKGDDRAALFLLKESQGKLDGVRCFGAARQI  70



>ref|XP_004157269.1| PREDICTED: uncharacterized protein LOC101223311 [Cucumis sativus]
Length=327

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+LEEL+LNGIET SLLSP+D+TLGSIER +Q+AA    V+AWN+    PQQ
Sbjct  67    ARQIPQRLYTLEELKLNGIETSSLLSPLDSTLGSIERYIQLAAGLLAVSAWNLFEFTPQQ  126

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLG LFL T DSV+ NGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYLLG+L
Sbjct  127   IFYISLGFLFLWTLDSVALNGGVGSLVLDTIGHTFSKKYHNRVIQHEAGHFLIAYLLGVL  186

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT +S EA +KEGSLN+QAGTAFVDFEFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  187   PKGYTTSSFEAFQKEGSLNLQAGTAFVDFEFLEEVNAGKVSATMLNRFSCIALAGVATEY  246

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+GCAEGGLADIN+LD LL+ LGFTQKKADSQVRWAVLNTILILRRHE+ARAKLA+ MS
Sbjct  247   LLYGCAEGGLADINKLDVLLKGLGFTQKKADSQVRWAVLNTILILRRHESARAKLADAMS  306

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  307   SGKSVGNC  314


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 8/73 (11%)
 Frame = +1

Query  181  YGGFRHHP---RLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGK  351
            Y   R+ P    +G+ N    C +E G   R Q+L++VD+EL+KGD+RAAL L+K+ QGK
Sbjct  3    YAVLRYRPCFRAVGIWN----CSTEVGLRRR-QVLEQVDKELAKGDDRAALFLLKESQGK  57

Query  352  PGGLRCFGAARQV  390
              G+RCFGAARQ+
Sbjct  58   LDGVRCFGAARQI  70



>ref|XP_008246543.1| PREDICTED: uncharacterized protein LOC103344701 [Prunus mume]
Length=337

 Score =   386 bits (992),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LYSL+EL+LNGIE  SLLSPVD TLGSIERNLQ+AA+ GGV+AWNV   + QQ
Sbjct  77    ARQVPQRLYSLDELKLNGIEASSLLSPVDTTLGSIERNLQLAAVLGGVSAWNVFGFSAQQ  136

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLGLLFL T D+VSFNGG  +L++DTIGHT S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  137   IFYISLGLLFLWTLDAVSFNGGVSSLVIDTIGHTFSQKYHNRVIQHEAGHFLIAYLVGIL  196

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SLEALKKEGS+NVQAGTAFVDFEF EEVN G+VSAT LNRF+C+ALAGVA EY
Sbjct  197   PKGYTLSSLEALKKEGSINVQAGTAFVDFEFAEEVNAGKVSATTLNRFACVALAGVAAEY  256

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             +L+G AEGGLADINQLD L +SLGFTQKK DSQVRW+VLNT+LILRRHE  RAKLAE MS
Sbjct  257   ILYGYAEGGLADINQLDSLYRSLGFTQKKTDSQVRWSVLNTVLILRRHEVVRAKLAEAMS  316

Query  1110  EGRSVGFC  1133
             EG+SVG C
Sbjct  317   EGKSVGSC  324


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 5/81 (6%)
 Frame = +1

Query  178  CYGGFRHHPRLGLC----NSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQ  345
            CY G  + P+L L     +  I+C SE     R Q+LK+VD+EL KGDERAALSLVKD+Q
Sbjct  7    CYAGTSYRPQLQLSLRFPSFGIICSSEVSVS-RQQVLKQVDKELDKGDERAALSLVKDVQ  65

Query  346  GKPGGLRCFGAARQVLCRYPS  408
            GKPGGLRCFGAARQV  R  S
Sbjct  66   GKPGGLRCFGAARQVPQRLYS  86



>ref|XP_008370534.1| PREDICTED: uncharacterized protein LOC103433999 [Malus domestica]
Length=336

 Score =   386 bits (991),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 192/248 (77%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LN IE  SLLSPVD TLGSIERNLQIAA+ GGV+AWNV   +PQQ
Sbjct  76    ARQVPQRLYTLDELKLNKIEASSLLSPVDTTLGSIERNLQIAAVVGGVSAWNVFGFSPQQ  135

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I Y+SLGLLFL T D++ FNGG G+L++DTIGHT S+KY NRV QHEAGHFLIAYL+GIL
Sbjct  136   IFYLSLGLLFLWTLDAIXFNGGLGSLVIDTIGHTFSQKYRNRVTQHEAGHFLIAYLVGIL  195

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTSLEALKKEGSLNVQAGTAFVDFEF+EEVN G+VSAT LN+F+C+ALAGVA+EY
Sbjct  196   PKGYTLTSLEALKKEGSLNVQAGTAFVDFEFVEEVNAGKVSATTLNKFACVALAGVASEY  255

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADINQLD L +SLGFTQKK DSQVRW+VLNT+LILRRHE AR KLAE M+
Sbjct  256   LLYGYAEGGLADINQLDSLFRSLGFTQKKTDSQVRWSVLNTVLILRRHEGARVKLAEAMA  315

Query  1110  EGRSVGFC  1133
             EG+SVG C
Sbjct  316   EGKSVGAC  323


 Score = 85.1 bits (209),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +1

Query  181  YGGFRHHPRLGL--CNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKP  354
            Y G    PRL L   + R +C SE     R Q+LK+VDEEL KGDERAALSLVKDLQGKP
Sbjct  9    YAGSSCKPRLSLRFPSFRXICSSELSVS-RRQVLKQVDEELGKGDERAALSLVKDLQGKP  67

Query  355  GGLRCFGAARQV  390
            GGLRCFGAARQV
Sbjct  68   GGLRCFGAARQV  79



>ref|XP_004302472.1| PREDICTED: uncharacterized protein LOC101309267 [Fragaria vesca 
subsp. vesca]
Length=331

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/248 (77%), Positives = 217/248 (88%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGI T SLLSPVD TLGSIERNLQIAA+ GGV+AWNV    PQQ
Sbjct  71    ARQVPQRLYTLDELKLNGIVTQSLLSPVDTTLGSIERNLQIAAVVGGVSAWNVFGFTPQQ  130

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             + Y+SL  LFL T D++SFNGG  +L +DTIGHT S+KY NRVIQHEAGHFLIAYLLGIL
Sbjct  131   LFYVSLAALFLWTLDAISFNGGVSSLAIDTIGHTFSQKYRNRVIQHEAGHFLIAYLLGIL  190

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTSL+A KKEGSLNVQAGTAFVD EF+EEVN G+VSAT LNRF+CIALAGV  EY
Sbjct  191   PKGYTLTSLDAFKKEGSLNVQAGTAFVDIEFVEEVNAGKVSATTLNRFACIALAGVVAEY  250

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADINQLD LL+SLGFTQKK DSQVRW+VLNT+LI+RRHE ARAKLAE M+
Sbjct  251   LLYGYAEGGLADINQLDSLLKSLGFTQKKTDSQVRWSVLNTVLIMRRHEAARAKLAEAMA  310

Query  1110  EGRSVGFC  1133
             EG+SVG C
Sbjct  311   EGKSVGSC  318


 Score = 79.0 bits (193),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            R Q+LK+VD++L+KGDERAALSLVKDLQGKPGGLRCFGAARQV
Sbjct  32   RQQVLKQVDKQLAKGDERAALSLVKDLQGKPGGLRCFGAARQV  74



>emb|CDY19716.1| BnaA09g03690D [Brassica napus]
Length=341

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/248 (78%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGI   SLLSP DATLGSIERNLQIA +SGGV AW  L+L+ QQ
Sbjct  81    ARQVPQRLYTLDELKLNGINAASLLSPTDATLGSIERNLQIAGVSGGVVAWRALDLSSQQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             + YISLGLLFL T D VSFNGG G+L+LDTIGHT S++YHNRV+QHEAGHFL+AYL+GIL
Sbjct  141   LFYISLGLLFLWTLDLVSFNGGIGSLVLDTIGHTFSQRYHNRVVQHEAGHFLVAYLVGIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTL+SLEAL+KEGSLN+QAG+AFVDFEFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  201   PRGYTLSSLEALQKEGSLNIQAGSAFVDFEFLEEVNAGKVSATMLNRFSCIALAGVATEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL DI++LD L++SLGFTQKKADSQVRW+VLNTIL+LRRHE AR+KLAE MS
Sbjct  261   LLYGYAEGGLDDISKLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHEVARSKLAEAMS  320

Query  1110  EGRSVGFC  1133
             +G SVG C
Sbjct  321   KGESVGSC  328


 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 6/70 (9%)
 Frame = +1

Query  199  HPRLGLCNSR------IVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGG  360
            HP+  +   R      +V  SE+    R Q L++VD ELS G+ERAALSLVKDLQGK GG
Sbjct  15   HPQKYIVFPRGCYRCIVVGSSETALSRRRQALEQVDSELSSGNERAALSLVKDLQGKAGG  74

Query  361  LRCFGAARQV  390
            LRCFGAARQV
Sbjct  75   LRCFGAARQV  84



>emb|CDX99990.1| BnaC09g03110D [Brassica napus]
Length=341

 Score =   384 bits (986),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/248 (78%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGI   SLLSP DATLGSIERNLQIA +SGG+ AW  L+L+ QQ
Sbjct  81    ARQVPQRLYTLDELKLNGINAASLLSPTDATLGSIERNLQIAGVSGGIVAWRALDLSSQQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             + YISLGLLFL T D VSFNGG G+L+LDTIGHT S++YHNRV+QHEAGHFL+AYL+GIL
Sbjct  141   LFYISLGLLFLWTLDLVSFNGGIGSLVLDTIGHTFSQRYHNRVVQHEAGHFLVAYLVGIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTL+SLEAL+KEGSLN+QAG+AFVDFEFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  201   PRGYTLSSLEALQKEGSLNIQAGSAFVDFEFLEEVNAGKVSATMLNRFSCIALAGVATEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL DI++LD L++SLGFTQKKADSQVRW+VLNTIL+LRRHE AR+KLAE MS
Sbjct  261   LLYGYAEGGLDDISKLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHEVARSKLAEAMS  320

Query  1110  EGRSVGFC  1133
             +G SVG C
Sbjct  321   KGESVGSC  328


 Score = 73.6 bits (179),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  229  IVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            +V  SE+    R Q+L+ VD ELS G+ERAALSLVKDLQG PGGLRCFGAARQV
Sbjct  31   VVGSSETALSRRRQVLELVDSELSSGNERAALSLVKDLQGTPGGLRCFGAARQV  84



>emb|CDP15829.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   384 bits (986),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIET SLLSPVDATLGSIERNLQ+AAL GGVAAWNV +L+PQQ
Sbjct  87    ARQVPQRLYTLDELKLNGIETASLLSPVDATLGSIERNLQVAALLGGVAAWNVFDLSPQQ  146

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L+ SLGLLF  T D VSFNGG  AL+LDTIGHT S+KY NRVIQHEAGHFL AYLLGIL
Sbjct  147   LLFFSLGLLFFWTLDGVSFNGGVSALLLDTIGHTFSQKYRNRVIQHEAGHFLTAYLLGIL  206

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTLTSL+AL KEGSLNVQAGTAFVDFEF EEVN G++SATMLNRFSCIALAGVA+EY
Sbjct  207   PRGYTLTSLDALNKEGSLNVQAGTAFVDFEFNEEVNSGKLSATMLNRFSCIALAGVASEY  266

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG AEGGLADI++LD LL+SLGFTQKKADSQVRWAVLNT+LILRRHE+AR+KLA+ MS
Sbjct  267   LLFGYAEGGLADIDKLDLLLKSLGFTQKKADSQVRWAVLNTVLILRRHEDARSKLAQAMS  326

Query  1110  EGRSVGFC  1133
             EG+SVG C
Sbjct  327   EGKSVGGC  334


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 4/68 (6%)
 Frame = +1

Query  199  HPRLGLCNSRIV-CLSESGGG---VRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLR  366
            + R GL NSR V CLSE  GG   +RWQ+L++VD+ELSKGDERAALSLVK+LQGKPGGLR
Sbjct  23   YSRFGLQNSRTVNCLSEDTGGAVRLRWQVLEQVDKELSKGDERAALSLVKNLQGKPGGLR  82

Query  367  CFGAARQV  390
            CF AARQV
Sbjct  83   CFDAARQV  90



>ref|XP_008450722.1| PREDICTED: uncharacterized protein LOC103492217 isoform X2 [Cucumis 
melo]
Length=355

 Score =   384 bits (986),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 193/249 (78%), Positives = 220/249 (88%), Gaps = 0/249 (0%)
 Frame = +3

Query  387   GALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQ  566
              A QIPQ+LY+LEEL+LNGIET SLLSP+D+TLGSIER +Q+AA    V+AWN+    PQ
Sbjct  94    AARQIPQRLYTLEELKLNGIETSSLLSPLDSTLGSIERYIQLAAGLLAVSAWNLFEFTPQ  153

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
             QI Y+SLG LFL T DSV+ NGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYLLG+
Sbjct  154   QIFYLSLGFLFLWTLDSVALNGGVGSLVLDTIGHTFSKKYHNRVIQHEAGHFLIAYLLGV  213

Query  747   LPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATE  926
             LP+GYT +S EA +KEGSLN+QAGTAFVDFEFLEEVN G+VSATMLNRFSCIALAGVATE
Sbjct  214   LPKGYTTSSFEAFQKEGSLNLQAGTAFVDFEFLEEVNAGKVSATMLNRFSCIALAGVATE  273

Query  927   YLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGM  1106
             YLL+GCAEGGLADIN+LD LL+ LGFTQKKADSQVRWAVLNT+LILRRHE+AR KLA+ M
Sbjct  274   YLLYGCAEGGLADINKLDVLLKGLGFTQKKADSQVRWAVLNTVLILRRHESARTKLADAM  333

Query  1107  SEGRSVGFC  1133
             S G+SVG C
Sbjct  334   SSGKSVGNC  342


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 61/103 (59%), Gaps = 13/103 (13%)
 Frame = +1

Query  94   SLYRTFYKNVVFRLYGF*LFSVWIMSAAC-YGGFRHHP---RLGLCNSRIVCLSESGGGV  261
            SL R FY     +L  F   S  I S  C Y   R+ P     G+ N    C SE G   
Sbjct  5    SLRRRFY----IQLLEFPNHSRIIHSCECEYAVLRYRPCFRAAGIWN----CSSEVGLR-  55

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            R Q+L+++D+EL+KGD+RAAL L+K+ QGK  G+RCFGAARQ+
Sbjct  56   RRQVLEQIDKELAKGDDRAALFLLKESQGKLDGVRCFGAARQI  98



>ref|XP_009111938.1| PREDICTED: uncharacterized protein LOC103837330 isoform X1 [Brassica 
rapa]
Length=341

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/248 (78%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGI   SLLSP DATLGSIERNLQIA +SGGV AW  L+L+ QQ
Sbjct  81    ARQVPQRLYTLDELKLNGINAASLLSPTDATLGSIERNLQIAGVSGGVVAWRALDLSSQQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             + YISLGLLFL T D VSFNGG G+L+LDTIGHT S++YHNRV+QHEAGHFL+AYL+GIL
Sbjct  141   LFYISLGLLFLWTLDLVSFNGGIGSLVLDTIGHTFSQRYHNRVVQHEAGHFLVAYLVGIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTL+SLEAL+KEGSLN+QAG+AFVDFEFLEEVN G+VSATMLNRFSCIALAGVA EY
Sbjct  201   PRGYTLSSLEALQKEGSLNIQAGSAFVDFEFLEEVNAGKVSATMLNRFSCIALAGVANEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL DI++LD L++SLGFTQKKADSQVRW+VLNTIL+LRRHE AR+KLAE MS
Sbjct  261   LLYGYAEGGLDDISKLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHEVARSKLAEAMS  320

Query  1110  EGRSVGFC  1133
             +G SVG C
Sbjct  321   KGESVGSC  328


 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 6/70 (9%)
 Frame = +1

Query  199  HPRLGLCNSR------IVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGG  360
            HP+  +   R      +V  SE+    R Q L++VD ELS G+ERAALSLVKDLQGK GG
Sbjct  15   HPQKYIVFPRGCYRCIVVGSSETALSRRRQALEQVDSELSSGNERAALSLVKDLQGKAGG  74

Query  361  LRCFGAARQV  390
            LRCFGAARQV
Sbjct  75   LRCFGAARQV  84



>ref|XP_008450721.1| PREDICTED: uncharacterized protein LOC103492217 isoform X1 [Cucumis 
melo]
Length=381

 Score =   384 bits (987),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/249 (78%), Positives = 220/249 (88%), Gaps = 0/249 (0%)
 Frame = +3

Query  387   GALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQ  566
              A QIPQ+LY+LEEL+LNGIET SLLSP+D+TLGSIER +Q+AA    V+AWN+    PQ
Sbjct  120   AARQIPQRLYTLEELKLNGIETSSLLSPLDSTLGSIERYIQLAAGLLAVSAWNLFEFTPQ  179

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
             QI Y+SLG LFL T DSV+ NGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYLLG+
Sbjct  180   QIFYLSLGFLFLWTLDSVALNGGVGSLVLDTIGHTFSKKYHNRVIQHEAGHFLIAYLLGV  239

Query  747   LPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATE  926
             LP+GYT +S EA +KEGSLN+QAGTAFVDFEFLEEVN G+VSATMLNRFSCIALAGVATE
Sbjct  240   LPKGYTTSSFEAFQKEGSLNLQAGTAFVDFEFLEEVNAGKVSATMLNRFSCIALAGVATE  299

Query  927   YLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGM  1106
             YLL+GCAEGGLADIN+LD LL+ LGFTQKKADSQVRWAVLNT+LILRRHE+AR KLA+ M
Sbjct  300   YLLYGCAEGGLADINKLDVLLKGLGFTQKKADSQVRWAVLNTVLILRRHESARTKLADAM  359

Query  1107  SEGRSVGFC  1133
             S G+SVG C
Sbjct  360   SSGKSVGNC  368


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 8/73 (11%)
 Frame = +1

Query  181  YGGFRHHP---RLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGK  351
            Y   R+ P     G+ N    C SE G   R Q+L+++D+EL+KGD+RAAL L+K+ QGK
Sbjct  57   YAVLRYRPCFRAAGIWN----CSSEVGLRRR-QVLEQIDKELAKGDDRAALFLLKESQGK  111

Query  352  PGGLRCFGAARQV  390
              G+RCFGAARQ+
Sbjct  112  LDGVRCFGAARQI  124



>ref|XP_002872278.1| hypothetical protein ARALYDRAFT_910860 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48537.1| hypothetical protein ARALYDRAFT_910860 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LYSLEEL+LNGI   SLLSP DATLGSIERNLQIA +SGG+ AW   +L+ QQ
Sbjct  81    ARQVPQRLYSLEELKLNGINAASLLSPTDATLGSIERNLQIAGVSGGIVAWKAFDLSSQQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L++SLG +FL T D VSFNGG  +L+LDTIGHT S++YHNRV+QHEAGHFL+AYL+GIL
Sbjct  141   LLFLSLGFMFLWTLDLVSFNGGIASLVLDTIGHTFSQRYHNRVVQHEAGHFLVAYLVGIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTL+SLEAL+KEGSLN+QAG+AFVD+EFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  201   PRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEVNSGKVSATMLNRFSCIALAGVATEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL DI++LD L++SLGFTQKKADSQVRW+VLNTIL+LRRHE AR+KLA+ MS
Sbjct  261   LLYGYAEGGLDDISKLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHEIARSKLAQAMS  320

Query  1110  EGRSVGFC  1133
             +G SVG C
Sbjct  321   KGESVGSC  328


 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  229  IVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCRYPS  408
            IVC SE+    R Q+L++VD +LS GDERAALSLV+DLQGKP GLRCFGAARQV  R  S
Sbjct  31   IVCSSETALSTRRQVLEQVDSKLSSGDERAALSLVRDLQGKPDGLRCFGAARQVPQRLYS  90



>ref|XP_010421644.1| PREDICTED: uncharacterized protein LOC104707069 [Camelina sativa]
 ref|XP_010455140.1| PREDICTED: uncharacterized protein LOC104736782 [Camelina sativa]
Length=342

 Score =   381 bits (978),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 187/248 (75%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+LEEL+LNGI   SLLSP D TLGSIERNLQIA +SGG+ AW   +L+ QQ
Sbjct  82    ARQVPQRLYTLEELKLNGINAASLLSPTDTTLGSIERNLQIAGVSGGIVAWKAFDLSSQQ  141

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             + Y+SLG +FL T D VSFNGG G+L+LDT+GHT S++YHNRV+QHEAGHFL+AYL+GIL
Sbjct  142   LFYLSLGFMFLWTLDLVSFNGGIGSLVLDTVGHTFSQRYHNRVVQHEAGHFLVAYLIGIL  201

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTL+SLEAL+KEGSLNVQAG+AFVD+EFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  202   PRGYTLSSLEALQKEGSLNVQAGSAFVDYEFLEEVNSGKVSATMLNRFSCIALAGVATEY  261

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL DI++LD L++SLGFTQKKADSQVRW+VLNTIL+LRRHE AR+KLA+ MS
Sbjct  262   LLYGYAEGGLDDISKLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHEIARSKLAQAMS  321

Query  1110  EGRSVGFC  1133
             +G SVG C
Sbjct  322   KGESVGSC  329


 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  229  IVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            I+C SE+G   R Q L+ +D +LS GDERAALSLVKDLQGKP GLRCFGAARQV
Sbjct  32   ILCSSETGLPTRRQALELLDSKLSSGDERAALSLVKDLQGKPDGLRCFGAARQV  85



>ref|XP_010494028.1| PREDICTED: uncharacterized protein LOC104771231 [Camelina sativa]
Length=344

 Score =   381 bits (978),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 187/248 (75%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+LEEL+LNGI   SLLSP D TLGSIERNLQIA +SGG+ AW   +L+ QQ
Sbjct  84    ARQVPQRLYTLEELKLNGINAASLLSPTDTTLGSIERNLQIAGVSGGIVAWKAFDLSSQQ  143

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             + Y+SLG +FL T D VSFNGG G+L+LDT+GHT S++YHNRV+QHEAGHFL+AYL+GIL
Sbjct  144   LFYLSLGFMFLWTLDLVSFNGGIGSLVLDTVGHTFSQRYHNRVVQHEAGHFLVAYLIGIL  203

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTL+SLEAL+KEGSLNVQAG+AFVD+EFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  204   PRGYTLSSLEALQKEGSLNVQAGSAFVDYEFLEEVNSGKVSATMLNRFSCIALAGVATEY  263

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL DI++LD L++SLGFTQKKADSQVRW+VLNTIL+LRRHE AR+KLA+ MS
Sbjct  264   LLYGYAEGGLDDISKLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHEIARSKLAQAMS  323

Query  1110  EGRSVGFC  1133
             +G SVG C
Sbjct  324   KGESVGSC  331


 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  229  IVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            IVC SE+G   R Q L+++D +LS GDERAALSLVKDLQGKP GLRCFGAARQV
Sbjct  34   IVCSSETGLSTRRQALEQLDSKLSSGDERAALSLVKDLQGKPDGLRCFGAARQV  87



>ref|XP_011078009.1| PREDICTED: uncharacterized protein LOC105161869 isoform X1 [Sesamum 
indicum]
Length=335

 Score =   380 bits (976),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+L+ELRLNGIE  SLLSPVD TLGSIER +Q AAL GG+AAWNV +L+PQQ
Sbjct  75    ARQIPQRLYTLDELRLNGIEAASLLSPVDTTLGSIERIIQAAALLGGIAAWNVFDLSPQQ  134

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL+ SLG LFL TFD+VSFNGG   L+LDT+ H+ S+KYH+RV+QHEAGHFLIAYLLGIL
Sbjct  135   ILFTSLGFLFLWTFDAVSFNGGISFLVLDTLAHSFSQKYHDRVVQHEAGHFLIAYLLGIL  194

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTSL+ALKKEGSLNVQAGTAFVDFEFLEEVNKG+VSAT LN+FSCIALAGVATEY
Sbjct  195   PKGYTLTSLDALKKEGSLNVQAGTAFVDFEFLEEVNKGKVSATTLNKFSCIALAGVATEY  254

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG AEGGLADIN LD LL+SLGFTQKKAD+QVRWAVLNT+LILRRHE ARA LA+ MS
Sbjct  255   LLFGTAEGGLADINTLDKLLKSLGFTQKKADAQVRWAVLNTVLILRRHEKARAVLADAMS  314

Query  1110  EGRSVGFC  1133
             EGRSV  C
Sbjct  315   EGRSVSSC  322


 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  250  GGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            G  VRWQ+L++VD+ELS G+ERAAL+LVKDLQ KPGGLRCFG ARQ+
Sbjct  32   GAAVRWQVLEQVDKELSNGNERAALNLVKDLQAKPGGLRCFGTARQI  78



>ref|NP_568492.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABI93880.1| At5g27290 [Arabidopsis thaliana]
 gb|AED93667.1| uncharacterized protein AT5G27290 [Arabidopsis thaliana]
Length=341

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+LEEL+LNGI   SLLSP D TLGSIERNLQIAA+SGG+ AW   +L+ QQ
Sbjct  81    ARQVPQRLYTLEELKLNGINAASLLSPTDTTLGSIERNLQIAAVSGGIVAWKAFDLSSQQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             + +++LG +FL T D VSFNGG G+L+LDT GHT S++YHNRV+QHEAGHFL+AYL+GIL
Sbjct  141   LFFLTLGFMFLWTLDLVSFNGGIGSLVLDTTGHTFSQRYHNRVVQHEAGHFLVAYLVGIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTL+SLEAL+KEGSLN+QAG+AFVD+EFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  201   PRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEVNSGKVSATMLNRFSCIALAGVATEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL DI++LD L++SLGFTQKKADSQVRW+VLNTIL+LRRHE AR+KLA+ MS
Sbjct  261   LLYGYAEGGLDDISKLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHEIARSKLAQAMS  320

Query  1110  EGRSVGFC  1133
             +G SVG C
Sbjct  321   KGESVGSC  328


 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  229  IVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            IVC SE+G  +R Q L++VD +LS GDERAALSLVKDLQGKP GLRCFGAARQV
Sbjct  31   IVCSSETGLSIRRQALEQVDSKLSSGDERAALSLVKDLQGKPDGLRCFGAARQV  84



>ref|XP_010244616.1| PREDICTED: uncharacterized protein LOC104588407 isoform X1 [Nelumbo 
nucifera]
Length=333

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+L+EL+LN I+T+SLLSPVDATLGSIERNLQ+AA+  G++AW    L  QQ
Sbjct  73    ARQIPQRLYTLDELKLNNIDTLSLLSPVDATLGSIERNLQVAAVLAGISAWVAFGLTQQQ  132

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL +SLGLLFL + D V  NGG G+L+LDTIGHT+S+KYHNRVIQHEAGHF+IAYLLGIL
Sbjct  133   ILLLSLGLLFLWSLDLVLVNGGIGSLVLDTIGHTVSQKYHNRVIQHEAGHFIIAYLLGIL  192

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SLEAL+KEGSLNVQAGTAFVDFEF+EEVNKG+VSA MLNRFSCIALAGVATEY
Sbjct  193   PKGYTLSSLEALRKEGSLNVQAGTAFVDFEFVEEVNKGKVSAQMLNRFSCIALAGVATEY  252

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFGCAEGGLADI++LD LL+ LGFTQKKADSQVRWAVLN +L+LRRHE AR+KLAE MS
Sbjct  253   LLFGCAEGGLADIDKLDRLLKGLGFTQKKADSQVRWAVLNIVLLLRRHEGARSKLAEAMS  312

Query  1110  EGRSVGFC  1133
              GRSVGFC
Sbjct  313   MGRSVGFC  320


 Score = 81.6 bits (200),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 3/77 (4%)
 Frame = +1

Query  166  MSAACYGGFRH--HPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKD  339
            M +  Y GFR    PRL L   R +C  E GG  R Q+L++VD+EL+ G++ AALSL +D
Sbjct  1    MGSMVYYGFRLSLRPRLNLRMVRALCSIEPGGS-RLQILEQVDKELASGNDVAALSLARD  59

Query  340  LQGKPGGLRCFGAARQV  390
            LQGKPGGLRCFGAARQ+
Sbjct  60   LQGKPGGLRCFGAARQI  76



>ref|XP_010674978.1| PREDICTED: uncharacterized protein LOC104891035 [Beta vulgaris 
subsp. vulgaris]
Length=331

 Score =   379 bits (972),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIE  SLLSPVD TLGSIERNLQIAA+ GG AAWN L L  QQ
Sbjct  67    ARQVPQRLYTLDELKLNGIEAASLLSPVDTTLGSIERNLQIAAVLGGAAAWNALELTAQQ  126

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +LYISLGLLFL T D VSF GG   L LDTIGHT S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  127   LLYISLGLLFLWTLDLVSFGGGISGLALDTIGHTFSQKYHNRVIQHEAGHFLIAYLIGIL  186

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PR YTL+S EALKKEGSLNVQAGT FVDFEF+EE N G+VSATMLNRFSC+ALAGVATEY
Sbjct  187   PRDYTLSSSEALKKEGSLNVQAGTTFVDFEFVEETNAGKVSATMLNRFSCVALAGVATEY  246

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL DIN+LD LL+SLGFTQKKADSQ+RWAVLNTIL+LRRHE ARAKLA+ MS
Sbjct  247   LLYGYAEGGLDDINKLDGLLKSLGFTQKKADSQLRWAVLNTILLLRRHEEARAKLADAMS  306

Query  1110  EGRSVGFC  1133
              G SVG C
Sbjct  307   MGMSVGSC  314


 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  241  SESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            SE+ GGV+  +L+++D+EL++GDERAALSLVK  Q +PGGLRCFGAARQV
Sbjct  21   SETRGGVKKLILEKLDKELARGDERAALSLVKQAQAQPGGLRCFGAARQV  70



>emb|CAN70022.1| hypothetical protein VITISV_030170 [Vitis vinifera]
Length=320

 Score =   377 bits (969),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIE  SLLSPVDATLGSIERNLQ+AA+ GG++AWNV   +PQQ
Sbjct  60    ARQVPQRLYTLDELKLNGIEASSLLSPVDATLGSIERNLQLAAVLGGLSAWNVFGFSPQQ  119

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L++SLGLLFL T D VSFNGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYLLGIL
Sbjct  120   LLFLSLGLLFLWTLDLVSFNGGVGSLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYLLGIL  179

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTSLEAL+KEGSLN+QAGTAFVDFEFLEEVN G+VSATMLNRFSCIALAGV TEY
Sbjct  180   PKGYTLTSLEALQKEGSLNIQAGTAFVDFEFLEEVNSGKVSATMLNRFSCIALAGVVTEY  239

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+ LGFTQKKADSQVRW+VLNT+LILRR++ AR KLAE MS
Sbjct  240   LLYGYAEGGLADINKLDLLLKGLGFTQKKADSQVRWSVLNTVLILRRNKQARGKLAEAMS  299

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  300   MGKSVGAC  307


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = +1

Query  205  RLGLCNSRIVCLSESGGGV-RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAA  381
            RL +   RIV  S  G  V RWQ+L++VD+EL+KGD+R ALSLVKDLQGKP GLRCFGAA
Sbjct  3    RLRVPTLRIV--SSLGTNVSRWQVLEQVDKELAKGDDRTALSLVKDLQGKPDGLRCFGAA  60

Query  382  RQVLCR  399
            RQV  R
Sbjct  61   RQVPQR  66



>ref|XP_002266105.1| PREDICTED: uncharacterized protein LOC100267587 [Vitis vinifera]
 emb|CBI34318.3| unnamed protein product [Vitis vinifera]
Length=332

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIE  SLLSPVDATLGSIERNLQ+AA+ GG++AWNV   +PQQ
Sbjct  72    ARQVPQRLYTLDELKLNGIEASSLLSPVDATLGSIERNLQLAAVLGGLSAWNVFGFSPQQ  131

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L++SLGLLFL T D VSFNGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYLLGIL
Sbjct  132   LLFLSLGLLFLWTLDLVSFNGGVGSLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYLLGIL  191

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTLTSLEAL+KEGSLN+QAGTAFVDFEFLEEVN G+VSATMLNRFSCIALAGV TEY
Sbjct  192   PKGYTLTSLEALQKEGSLNIQAGTAFVDFEFLEEVNSGKVSATMLNRFSCIALAGVVTEY  251

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+ LGFTQKKADSQVRW+VLNT+LILRR++ AR KLAE MS
Sbjct  252   LLYGYAEGGLADINKLDLLLKGLGFTQKKADSQVRWSVLNTVLILRRNKQARGKLAEAMS  311

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  312   MGKSVGAC  319


 Score = 84.7 bits (208),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = +1

Query  199  HPRLGLCNSRIVCLSESGGGV-RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFG  375
            HPRL +   RIV  S  G  V RWQ+L++VD+EL+KGD+R ALSLVKDLQGKP GLRCFG
Sbjct  13   HPRLRVPTLRIV--SSLGTNVSRWQVLEQVDKELAKGDDRTALSLVKDLQGKPDGLRCFG  70

Query  376  AARQV  390
            AARQV
Sbjct  71   AARQV  75



>gb|AAM65305.1| unknown [Arabidopsis thaliana]
Length=341

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/248 (74%), Positives = 220/248 (89%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+LEEL+LNGI   SLLSP D TLGSIERNLQIAA+SGG+ AW   +L+ QQ
Sbjct  81    ARQVPQRLYTLEELKLNGINAASLLSPTDTTLGSIERNLQIAAVSGGIVAWKAFDLSSQQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             + +++LG +FL T D VSFNGG G+L+LDT GHT S++YHNRV+QHEAGHFL+AYL+ IL
Sbjct  141   LFFLTLGFMFLWTLDLVSFNGGIGSLVLDTTGHTFSQRYHNRVVQHEAGHFLVAYLVEIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTL+SLEAL+KEGSLN+QAG+AFVD+EFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  201   PRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEVNSGKVSATMLNRFSCIALAGVATEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL DI++LD L++SLGFTQKKADSQVRW+VLNTIL+LRRHE AR+KLA+ MS
Sbjct  261   LLYGYAEGGLDDISKLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHEIARSKLAQAMS  320

Query  1110  EGRSVGFC  1133
             +G SVG C
Sbjct  321   KGESVGSC  328


 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  229  IVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            IVC SE+G  +R Q L++VD +LS GDERAALSLVKDLQGKP GLRCFGAARQV
Sbjct  31   IVCSSETGLSIRRQALEQVDSKLSSGDERAALSLVKDLQGKPDGLRCFGAARQV  84



>ref|XP_006288255.1| hypothetical protein CARUB_v10001500mg [Capsella rubella]
 gb|EOA21153.1| hypothetical protein CARUB_v10001500mg [Capsella rubella]
Length=264

 Score =   372 bits (955),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/246 (73%), Positives = 219/246 (89%), Gaps = 0/246 (0%)
 Frame = +3

Query  396   QIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQIl  575
             ++PQ+LY+LEEL+LNGI   SLLSP D TLGSIERNLQIA +SGG+ AW   +L+ QQ+ 
Sbjct  6     EVPQRLYTLEELKLNGINAASLLSPTDTTLGSIERNLQIAGVSGGIVAWQAFDLSSQQLF  65

Query  576   yislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPR  755
             Y++LG +FL T D VS++GG G+L+LDT+GHT S++YHNR++QHEAGHFL+AYL+GILPR
Sbjct  66    YLTLGFMFLWTLDLVSYSGGIGSLVLDTVGHTFSQRYHNRIVQHEAGHFLVAYLVGILPR  125

Query  756   GYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLL  935
             GYTL+SLEAL+KEGSLN+QAG+AFVD+EFLEEVN G+VSATMLNRFSCIALAGVATEYLL
Sbjct  126   GYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEVNSGKVSATMLNRFSCIALAGVATEYLL  185

Query  936   FGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEG  1115
             +G AEGGL DI++LD L++SLGFTQKKADSQVRW+VLNTIL+LRRHE AR KLA+ MS+G
Sbjct  186   YGYAEGGLDDISKLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHEIARNKLAQAMSKG  245

Query  1116  RSVGFC  1133
              SVG C
Sbjct  246   ESVGSC  251



>ref|XP_006394980.1| hypothetical protein EUTSA_v10004533mg [Eutrema salsugineum]
 gb|ESQ32266.1| hypothetical protein EUTSA_v10004533mg [Eutrema salsugineum]
Length=339

 Score =   374 bits (959),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 187/248 (75%), Positives = 220/248 (89%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGI   SLLSP D TLGSIERNLQIA +SGG+ AW   +L+ QQ
Sbjct  79    ARQVPQRLYTLDELKLNGINAASLLSPTDTTLGSIERNLQIAGISGGIVAWLAFDLSSQQ  138

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L+ISLG LFL T D VS NGG G+L+LDTIGHT S++YHNRV+QHEAGHFL+AYL+GIL
Sbjct  139   LLFISLGSLFLWTLDLVSLNGGIGSLVLDTIGHTFSQRYHNRVVQHEAGHFLVAYLVGIL  198

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTL+SLEAL+KEGSLN+QAG+AFVD+EFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  199   PRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEVNAGKVSATMLNRFSCIALAGVATEY  258

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL DI++LD L++SLGFTQKKADSQVRW+VLNTIL+LRRH  AR+KLAE MS
Sbjct  259   LLYGYAEGGLDDISKLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHAIARSKLAEAMS  318

Query  1110  EGRSVGFC  1133
             +G SVG C
Sbjct  319   KGESVGSC  326


 Score = 79.3 bits (194),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 3/66 (5%)
 Frame = +1

Query  202  PRLGLCNSRIVCL---SESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCF  372
            P+  + +S   C+   SE+G   R Q LK++D ELS GDERAALSLVKDLQG+PGGLRCF
Sbjct  17   PKYLVFHSYYGCIVGSSETGLSRRRQALKQLDSELSSGDERAALSLVKDLQGQPGGLRCF  76

Query  373  GAARQV  390
            GAARQV
Sbjct  77   GAARQV  82



>ref|XP_004494650.1| PREDICTED: uncharacterized protein LOC101514881 isoform X1 [Cicer 
arietinum]
Length=341

 Score =   374 bits (959),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 220/248 (89%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIET SLLSPVDATLG IERNL I+A+ GG AAWNV  ++ QQ
Sbjct  81    ARQVPQRLYTLDELKLNGIETSSLLSPVDATLGFIERNLLISAIVGGFAAWNVFGISTQQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLGLLFL TFD VSF GG G+L++DTIGH+LS+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  141   IFYISLGLLFLWTFDLVSFGGGLGSLVVDTIGHSLSQKYHNRVIQHEAGHFLIAYLVGIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT++SL+AL KEGSLN+QAGTAFVDFEF+EEVN G+VSAT LN+FSCIALAGV TEY
Sbjct  201   PKGYTVSSLDALMKEGSLNIQAGTAFVDFEFVEEVNAGKVSATTLNKFSCIALAGVCTEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             L++G +EGGL DI +LD LL  LGFTQKKADSQVRW+VLNTIL+LRRHE ARAKLAE MS
Sbjct  261   LIYGFSEGGLDDIRKLDSLLNGLGFTQKKADSQVRWSVLNTILLLRRHETARAKLAEAMS  320

Query  1110  EGRSVGFC  1133
             +G S+G C
Sbjct  321   KGSSIGSC  328


 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +1

Query  214  LCNSRIVCLSESG-GGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            L  +RI C ++ G    R QLL+ VD+EL+KGD+RAALSLVKDLQGKP GL CFGAARQV
Sbjct  25   LLMARIQCSTKVGVSNYRQQLLESVDKELTKGDDRAALSLVKDLQGKPDGLCCFGAARQV  84



>ref|XP_009393244.1| PREDICTED: uncharacterized protein LOC103978984 [Musa acuminata 
subsp. malaccensis]
Length=338

 Score =   370 bits (950),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LYSL+EL+LNGI+T S LSP+D TLGSIERNLQ+AA+ GGV+AW  L  +P Q
Sbjct  78    ARQVPQRLYSLDELKLNGIDTSSFLSPIDVTLGSIERNLQLAAVLGGVSAWFALGFSPAQ  137

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             ILY SLGLLFL + D + FNGG   L+LDTIGH +S+KYH+RVIQHEAGHFLIAYLLG+L
Sbjct  138   ILYFSLGLLFLWSLDLIYFNGGVRNLVLDTIGHKVSQKYHHRVIQHEAGHFLIAYLLGVL  197

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SLEAL KE SLNVQAGTAFVDFEF+EE+N G+VSA MLNRFSCIALAGVATEY
Sbjct  198   PKGYTLSSLEALIKERSLNVQAGTAFVDFEFIEEINTGKVSAKMLNRFSCIALAGVATEY  257

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG +EGGLADI++LD LL+SLGFTQKKADSQVRWAVLNTIL+LRRHE AR++LAE MS
Sbjct  258   LLFGYSEGGLADIDKLDTLLKSLGFTQKKADSQVRWAVLNTILLLRRHEKARSQLAEAMS  317

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  318   LGKSVGSC  325


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  241  SESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCRYPS  408
            S   G +R QLL+RVDEEL KG+ER ALSL+ +  GKPGGLRCFG ARQV  R  S
Sbjct  32   SIDSGSLRLQLLERVDEELKKGNERGALSLINETHGKPGGLRCFGTARQVPQRLYS  87



>gb|EYU28387.1| hypothetical protein MIMGU_mgv1a024158mg, partial [Erythranthe 
guttata]
Length=307

 Score =   369 bits (946),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+L+EL+LNGIET SLLSPVD+TLGSIER +Q AA++GG+AAWNV +L+PQQ
Sbjct  47    ARQIPQRLYTLDELKLNGIETTSLLSPVDSTLGSIERGIQAAAIAGGIAAWNVFDLSPQQ  106

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I Y+SLGLLFL T D+VSFNGG   LILDT+GH++S+KY+NRV QHEAGHFLIAYLLGIL
Sbjct  107   IFYLSLGLLFLWTLDAVSFNGGISFLILDTLGHSISKKYNNRVAQHEAGHFLIAYLLGIL  166

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GY+LTSL+ALKKEGSLNVQAGTAFVDFEFLEEV+KG+VSAT LNRFSCIALAGVATEY
Sbjct  167   PKGYSLTSLDALKKEGSLNVQAGTAFVDFEFLEEVSKGKVSATTLNRFSCIALAGVATEY  226

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             +L+G AEGGL+DIN LD LL+ LGFTQKKAD QVRWA+LNT+LILRRHE ARA LAE MS
Sbjct  227   ILYGTAEGGLSDINTLDNLLKGLGFTQKKADGQVRWAILNTVLILRRHEKARANLAEAMS  286

Query  1110  EGRSVGFC  1133
             EG SVG C
Sbjct  287   EGLSVGSC  294


 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            RWQ+L++VD+ELS+G++RAAL+LVKD Q K GGLRCFGAARQ+
Sbjct  8    RWQVLEQVDKELSQGNDRAALNLVKDFQAKSGGLRCFGAARQI  50



>ref|XP_010941743.1| PREDICTED: uncharacterized protein LOC105059926 isoform X1 [Elaeis 
guineensis]
Length=341

 Score =   369 bits (947),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LYSL+EL+LNGI+T + LSP+D TLGSIERNLQ+AA+ GG AAW     +  Q
Sbjct  81    ARQVPQRLYSLDELKLNGIDTAAFLSPIDITLGSIERNLQLAAVLGGFAAWRAFGFSQLQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +LY+SLGLLFL T D  SF+GG   L+LDTIGH LSEKYHNRVIQHEAGHFLIAYLLGIL
Sbjct  141   MLYLSLGLLFLWTLDLASFDGGMRNLVLDTIGHNLSEKYHNRVIQHEAGHFLIAYLLGIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SLEAL KEGSLNVQAGT+FVDFEF++EV  G+V+A MLNRFSCIALAGVATEY
Sbjct  201   PKGYTLSSLEALMKEGSLNVQAGTSFVDFEFIDEVVTGKVTAKMLNRFSCIALAGVATEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG +EGGL+DI QLD LL+SLGFTQKKADSQVRWAVLNTILILRRHE AR++LAE MS
Sbjct  261   LLFGYSEGGLSDIGQLDKLLKSLGFTQKKADSQVRWAVLNTILILRRHERARSQLAEAMS  320

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  321   SGKSVGSC  328


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 54/85 (64%), Gaps = 8/85 (9%)
 Frame = +1

Query  178  CYGGFRHHPRLGLCNSRIVCLSESG--------GGVRWQLLKRVDEELSKGDERAALSLV  333
            CY G   H RL +   R V  SES         GG R Q L++VDE L KG+ER ALSLV
Sbjct  6    CYSGVSLHVRLRVLTVRAVNSSESSLDSLTLKSGGSRLQDLQQVDELLRKGNERGALSLV  65

Query  334  KDLQGKPGGLRCFGAARQVLCRYPS  408
            KDLQGKPGGLRCFGAARQV  R  S
Sbjct  66   KDLQGKPGGLRCFGAARQVPQRLYS  90



>gb|ABN08173.1| Peptidase, cysteine peptidase active site [Medicago truncatula]
 gb|AES82561.2| stress regulated protein [Medicago truncatula]
Length=340

 Score =   368 bits (944),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 215/248 (87%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIE +SLLSPVD TLGSIERNL IAA+ GG AAWNV  ++ QQ
Sbjct  80    ARQVPQRLYTLDELKLNGIEAMSLLSPVDTTLGSIERNLLIAAIVGGFAAWNVFGISQQQ  139

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLGLLFL T D VSF GG G+L++DTIGH  S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  140   IFYISLGLLFLWTLDLVSFGGGLGSLVVDTIGHKFSQKYHNRVIQHEAGHFLIAYLVGIL  199

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SL+ + KEGSLN+QAGTAFVDFEFLEEVN G+VSAT LN+FSCIALAGV TEY
Sbjct  200   PKGYTLSSLDGMMKEGSLNIQAGTAFVDFEFLEEVNSGKVSATTLNKFSCIALAGVCTEY  259

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             L++G +EGGL DI +LD LL  LGFTQKKADSQVRW+VLNT+L+LRRHE AR+KLAE MS
Sbjct  260   LIYGFSEGGLDDIRKLDSLLNGLGFTQKKADSQVRWSVLNTVLLLRRHEAARSKLAEAMS  319

Query  1110  EGRSVGFC  1133
              G SVG C
Sbjct  320   MGSSVGSC  327


 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = +1

Query  163  IMSAACYGGFRHHPRLG---LCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLV  333
            +M   C  G      LG   L   RI C S      R QLL+ VD+EL+KGD+RAAL+LV
Sbjct  6    LMHGVCVVGVGLPSSLGQPKLARVRIQC-STKVSSSRQQLLESVDKELTKGDDRAALALV  64

Query  334  KDLQGKPGGLRCFGAARQV  390
            KDLQGKP GL+CFGAARQV
Sbjct  65   KDLQGKPNGLQCFGAARQV  83



>ref|XP_009111939.1| PREDICTED: uncharacterized protein LOC103837330 isoform X2 [Brassica 
rapa]
Length=332

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 215/248 (87%), Gaps = 9/248 (4%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGI   SLLSP DATLGSIERNLQIA +SGGV AW  L+L+ QQ
Sbjct  81    ARQVPQRLYTLDELKLNGINAASLLSPTDATLGSIERNLQIAGVSGGVVAWRALDLSSQQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             + YISLGLLFL T D VSFNGG G+L+LDTIGHT S++YHNRV+QHEAGHFL+AYL+GIL
Sbjct  141   LFYISLGLLFLWTLDLVSFNGGIGSLVLDTIGHTFSQRYHNRVVQHEAGHFLVAYLVGIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTL+SLEAL+KEGSLN+QAG+AFVDFEFLEE         MLNRFSCIALAGVA EY
Sbjct  201   PRGYTLSSLEALQKEGSLNIQAGSAFVDFEFLEE---------MLNRFSCIALAGVANEY  251

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL DI++LD L++SLGFTQKKADSQVRW+VLNTIL+LRRHE AR+KLAE MS
Sbjct  252   LLYGYAEGGLDDISKLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHEVARSKLAEAMS  311

Query  1110  EGRSVGFC  1133
             +G SVG C
Sbjct  312   KGESVGSC  319


 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 6/70 (9%)
 Frame = +1

Query  199  HPRLGLCNSR------IVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGG  360
            HP+  +   R      +V  SE+    R Q L++VD ELS G+ERAALSLVKDLQGK GG
Sbjct  15   HPQKYIVFPRGCYRCIVVGSSETALSRRRQALEQVDSELSSGNERAALSLVKDLQGKAGG  74

Query  361  LRCFGAARQV  390
            LRCFGAARQV
Sbjct  75   LRCFGAARQV  84



>ref|XP_007147094.1| hypothetical protein PHAVU_006G095900g [Phaseolus vulgaris]
 gb|ESW19088.1| hypothetical protein PHAVU_006G095900g [Phaseolus vulgaris]
Length=341

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/248 (75%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+ELRLNGIET+SLLSPVD TLGSIERNLQIAA+ GG+AAWN   ++PQQ
Sbjct  81    ARQVPQRLYTLDELRLNGIETLSLLSPVDTTLGSIERNLQIAAILGGLAAWNAFAISPQQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLGLLFL T D+VSF GG G+L++DTIGHT S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  141   IFYISLGLLFLWTLDAVSFGGGIGSLVVDTIGHTFSQKYHNRVIQHEAGHFLIAYLIGIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GY+++SL+AL+KEGSLN+QAGTAFVDFEF EEVN G+VSAT LNRFSCIALAGV+TEY
Sbjct  201   PKGYSISSLDALQKEGSLNIQAGTAFVDFEFQEEVNTGKVSATTLNRFSCIALAGVSTEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             L++G +EGGL DI +LD LL+ LGFTQKKADSQVRW++LNT+L+LRRHE ARAK+AE ++
Sbjct  261   LIYGFSEGGLDDIRKLDLLLKGLGFTQKKADSQVRWSLLNTVLLLRRHEVARAKVAEALA  320

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  321   MGKSVGSC  328


 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            R ++L++VDEEL+KGD+RAAL+LVKDLQGKPGGLR FGAARQV
Sbjct  42   RKKVLEKVDEELAKGDDRAALTLVKDLQGKPGGLRFFGAARQV  84



>ref|XP_008807275.1| PREDICTED: uncharacterized protein LOC103719691 [Phoenix dactylifera]
Length=341

 Score =   360 bits (924),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 212/248 (85%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+ Y+L+EL+LNGI T + LSP D TLGSIERNLQ+ A+ GG AAW     +  Q
Sbjct  81    ARQVPQRFYNLDELKLNGINTAAFLSPADITLGSIERNLQLVAVLGGFAAWLAFGFSQLQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             ILY+SLGLLFL T D  SF+GG   L+LDTIGH LS+KYHNRVIQHEAGHFLIAYLLGIL
Sbjct  141   ILYLSLGLLFLWTLDLASFDGGVRNLVLDTIGHNLSQKYHNRVIQHEAGHFLIAYLLGIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SLEAL KEGS NVQAGT+FVDFEFL+E+  G++SA MLNRFSCIALAGVATEY
Sbjct  201   PKGYTLSSLEALMKEGSFNVQAGTSFVDFEFLDEIATGKISAKMLNRFSCIALAGVATEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG +EGGLADI++LD LL+SLGFTQKKADSQVRWAVLNTILILRRHE AR++LAE MS
Sbjct  261   LLFGYSEGGLADIDKLDKLLKSLGFTQKKADSQVRWAVLNTILILRRHERARSQLAEAMS  320

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  321   SGKSVGCC  328


 Score = 79.3 bits (194),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 53/83 (64%), Gaps = 8/83 (10%)
 Frame = +1

Query  178  CYGGFRHHPRLGLCNSRIVCLSESG--------GGVRWQLLKRVDEELSKGDERAALSLV  333
            CY G   H RL +   R V  SES         GG R  +L++VDE L KG+ER ALSLV
Sbjct  6    CYSGVPLHVRLRVLTVRAVNSSESSLDSVILKSGGSRLHVLQQVDELLRKGNERGALSLV  65

Query  334  KDLQGKPGGLRCFGAARQVLCRY  402
            KDLQGKP GL+CFGAARQV  R+
Sbjct  66   KDLQGKPRGLQCFGAARQVPQRF  88



>ref|XP_003626343.1| hypothetical protein MTR_7g114070 [Medicago truncatula]
Length=347

 Score =   360 bits (924),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 215/255 (84%), Gaps = 7/255 (3%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIE +SLLSPVD TLGSIERNL IAA+ GG AAWNV  ++ QQ
Sbjct  80    ARQVPQRLYTLDELKLNGIEAMSLLSPVDTTLGSIERNLLIAAIVGGFAAWNVFGISQQQ  139

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLGLLFL T D VSF GG G+L++DTIGH  S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  140   IFYISLGLLFLWTLDLVSFGGGLGSLVVDTIGHKFSQKYHNRVIQHEAGHFLIAYLVGIL  199

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEE-------VNKGQVSATMLNRFSCIAL  908
             P+GYTL+SL+ + KEGSLN+QAGTAFVDFEFLEE       VN G+VSAT LN+FSCIAL
Sbjct  200   PKGYTLSSLDGMMKEGSLNIQAGTAFVDFEFLEEVGCFICSVNSGKVSATTLNKFSCIAL  259

Query  909   AGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARA  1088
             AGV TEYL++G +EGGL DI +LD LL  LGFTQKKADSQVRW+VLNT+L+LRRHE AR+
Sbjct  260   AGVCTEYLIYGFSEGGLDDIRKLDSLLNGLGFTQKKADSQVRWSVLNTVLLLRRHEAARS  319

Query  1089  KLAEGMSEGRSVGFC  1133
             KLAE MS G SVG C
Sbjct  320   KLAEAMSMGSSVGSC  334


 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = +1

Query  163  IMSAACYGGFRHHPRLG---LCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLV  333
            +M   C  G      LG   L   RI C S      R QLL+ VD+EL+KGD+RAAL+LV
Sbjct  6    LMHGVCVVGVGLPSSLGQPKLARVRIQC-STKVSSSRQQLLESVDKELTKGDDRAALALV  64

Query  334  KDLQGKPGGLRCFGAARQV  390
            KDLQGKP GL+CFGAARQV
Sbjct  65   KDLQGKPNGLQCFGAARQV  83



>ref|XP_004968785.1| PREDICTED: uncharacterized protein LOC101776912 isoform X1 [Setaria 
italica]
Length=343

 Score =   357 bits (917),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 215/248 (87%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY L+EL+LNGI+T + LSPVD TLGSIERNLQIAA+ GG++    L ++  Q
Sbjct  83    ARQVPQRLYKLDELKLNGIDTSAFLSPVDLTLGSIERNLQIAAVLGGLSISAALEISQLQ  142

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL++ LGLL L + D V F GG   LILDTIGH LS+KYHNRVIQHEAGHFLIAYLLG+L
Sbjct  143   ILFLVLGLLSLWSVDFVYFGGGVRNLILDTIGHYLSQKYHNRVIQHEAGHFLIAYLLGVL  202

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT+TSL+ L K+GSLNVQAGTAFVD+EFLEE+N G++SATMLN+FSCIALAG+ATEY
Sbjct  203   PKGYTITSLDTLIKQGSLNVQAGTAFVDYEFLEEINTGKLSATMLNKFSCIALAGIATEY  262

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+SLGFTQKKADSQVRWAVLNT+L+LRRHE AR++LAE MS
Sbjct  263   LLYGVAEGGLADINKLDGLLKSLGFTQKKADSQVRWAVLNTVLMLRRHEKARSQLAEAMS  322

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  323   SGKSVGTC  330


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 47/79 (59%), Gaps = 6/79 (8%)
 Frame = +1

Query  178  CYGGFRHHP----RLGLCNSRIVCLSESGGGVRWQ-LLKRVDEELSKGDERAALSLVKDL  342
            C+G F   P    RL L  +R    S S    R + +L++VDE LSKG++ AAL LV   
Sbjct  12   CFG-FTRLPLPAARLRLPPARAADTSASQSPARLRGVLEQVDEALSKGNDEAALFLVHGS  70

Query  343  QGKPGGLRCFGAARQVLCR  399
            QG+ GGLR FGAARQV  R
Sbjct  71   QGEDGGLRGFGAARQVPQR  89



>gb|KHN04030.1| hypothetical protein glysoja_022716 [Glycine soja]
Length=341

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 220/248 (89%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+ELRLNGIET+SLLSPVD TLGSIERNLQIAA+ GG+AAWN   ++PQQ
Sbjct  81    ARQVPQRLYTLDELRLNGIETLSLLSPVDTTLGSIERNLQIAAIVGGLAAWNAFAISPQQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLGLLFL T D+VSF GG G L++DTIGH+ S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  141   IFYISLGLLFLWTLDAVSFGGGIGGLVVDTIGHSFSQKYHNRVIQHEAGHFLIAYLVGIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYT++SL+AL+K GSLN+QAGTAFVDFEF EEVN G+VSAT LN+FSCIALAGV+TEY
Sbjct  201   PRGYTISSLDALQKVGSLNIQAGTAFVDFEFQEEVNSGKVSATTLNKFSCIALAGVSTEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             L++G +EGGL DI +LD LL+ LGFTQKK DSQVRW++LNT+L+LRRHE AR K+AE +S
Sbjct  261   LIYGFSEGGLDDIRKLDLLLKGLGFTQKKTDSQVRWSLLNTVLLLRRHEAARGKVAEALS  320

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  321   MGKSVGSC  328


 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  226  RIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            RI C S + G  R Q+L+++D+EL+KGD+RAAL+LVKDLQGKP GLRCFGAARQV
Sbjct  31   RIRC-SSNVGVSRQQVLEKLDKELAKGDDRAALALVKDLQGKPDGLRCFGAARQV  84



>ref|XP_003567712.1| PREDICTED: uncharacterized protein LOC100844265 isoform X1 [Brachypodium 
distachyon]
Length=340

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 177/248 (71%), Positives = 213/248 (86%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY L+EL+LNGI+T S LSPVD TLGSIERN QIAA+ GG++   V  L+  Q
Sbjct  80    ARQVPQRLYKLDELKLNGIDTSSFLSPVDRTLGSIERNFQIAAVLGGLSVSAVFELSQFQ  139

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L++ +GLLF+ + D + FNGG   L+LDT+GH LS+KYHNRVIQHEAGHFLIAYLLG+L
Sbjct  140   VLFLFVGLLFVWSVDLIYFNGGVRNLVLDTVGHNLSQKYHNRVIQHEAGHFLIAYLLGVL  199

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+ YT+TSL+ L K+GSLNVQAGTAFVDFEF+EE+N G++SA MLN+FSCIALAGVATEY
Sbjct  200   PKEYTITSLDTLMKQGSLNVQAGTAFVDFEFVEEINTGKLSAMMLNKFSCIALAGVATEY  259

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLAD+N+LD L +SLGFTQ KADSQVRWAVLNT+LILRRHE+AR+KLAE MS
Sbjct  260   LLYGYAEGGLADVNKLDGLFKSLGFTQNKADSQVRWAVLNTVLILRRHEDARSKLAEAMS  319

Query  1110  EGRSVGFC  1133
              GRSVG C
Sbjct  320   SGRSVGSC  327


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            R  +L +VD+EL KG++ AALSLV+   G+ GGLRCFGAARQV
Sbjct  41   RSAVLGQVDDELQKGNDEAALSLVRSSLGEGGGLRCFGAARQV  83



>ref|XP_002458075.1| hypothetical protein SORBIDRAFT_03g026530 [Sorghum bicolor]
 gb|EES03195.1| hypothetical protein SORBIDRAFT_03g026530 [Sorghum bicolor]
Length=343

 Score =   350 bits (898),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 178/248 (72%), Positives = 214/248 (86%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGI+T + LSPVD TLGSIERN+QIAA+ GG++    L L+  Q
Sbjct  83    ARQVPQRLYTLDELKLNGIDTSAFLSPVDLTLGSIERNIQIAAILGGLSVSAALELSQLQ  142

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL++ LGLL L + D V F GG   L+LDTIGH LS+KYHNRV+QHEAGHFLIAYLLG+L
Sbjct  143   ILFLILGLLSLWSVDFVYFGGGVRNLVLDTIGHYLSQKYHNRVVQHEAGHFLIAYLLGVL  202

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT+TSL+ L  +GSLNVQAGTAFVD+EFL E+N G++SATM+N+FSCIALAGVATEY
Sbjct  203   PKGYTITSLDTLINQGSLNVQAGTAFVDYEFLGEINTGKLSATMVNKFSCIALAGVATEY  262

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+SLGFTQKKADSQVRWAVLNT+LILRRHE AR++LAE MS
Sbjct  263   LLYGLAEGGLADINKLDGLLKSLGFTQKKADSQVRWAVLNTVLILRRHEKARSQLAEAMS  322

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  323   TGKSVGSC  330


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +1

Query  205  RLGLCNSRIVCLSESGGGVRWQ-LLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAA  381
            RL L  +R    S S    R + +L++VD+ LSKG++ AALSLV+  QG  GGLR FGAA
Sbjct  24   RLRLPPARATDTSASQSPARLRAVLEQVDQALSKGNDEAALSLVRSSQGVDGGLRAFGAA  83

Query  382  RQV  390
            RQV
Sbjct  84   RQV  86



>ref|XP_004494651.1| PREDICTED: uncharacterized protein LOC101514881 isoform X2 [Cicer 
arietinum]
Length=329

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 211/248 (85%), Gaps = 12/248 (5%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIET SLLSPVDATLG IERNL I+A+ GG AAWNV  ++ QQ
Sbjct  81    ARQVPQRLYTLDELKLNGIETSSLLSPVDATLGFIERNLLISAIVGGFAAWNVFGISTQQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLGLLFL TFD VSF GG G+L++DTIGH+LS+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  141   IFYISLGLLFLWTFDLVSFGGGLGSLVVDTIGHSLSQKYHNRVIQHEAGHFLIAYLVGIL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT++SL+AL KEGSLN+QAGTAFVDFEF+EEVN G+VSAT LN+FSCIALAGV TEY
Sbjct  201   PKGYTVSSLDALMKEGSLNIQAGTAFVDFEFVEEVNAGKVSATTLNKFSCIALAGVCTEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             L++G +EGGL DI             +KKADSQVRW+VLNTIL+LRRHE ARAKLAE MS
Sbjct  261   LIYGFSEGGLDDIR------------KKKADSQVRWSVLNTILLLRRHETARAKLAEAMS  308

Query  1110  EGRSVGFC  1133
             +G S+G C
Sbjct  309   KGSSIGSC  316


 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +1

Query  214  LCNSRIVCLSESG-GGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            L  +RI C ++ G    R QLL+ VD+EL+KGD+RAALSLVKDLQGKP GL CFGAARQV
Sbjct  25   LLMARIQCSTKVGVSNYRQQLLESVDKELTKGDDRAALSLVKDLQGKPDGLCCFGAARQV  84



>gb|ACF82075.1| unknown [Zea mays]
Length=326

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 178/248 (72%), Positives = 210/248 (85%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY L+EL+LNGI+T + LSPVD TLGSIERNLQIAA+ GG +    L L+  Q
Sbjct  66    ARQVPQRLYKLDELKLNGIDTSAFLSPVDLTLGSIERNLQIAAVLGGFSVSAALELSQLQ  125

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL++ LGLL L + D V F GG   L+LDTIGH LS+KYHNRVIQHEAGHFLIAYLLG+L
Sbjct  126   ILFLILGLLSLWSVDFVYFGGGVRNLVLDTIGHYLSQKYHNRVIQHEAGHFLIAYLLGVL  185

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT+TSL+ L  +GSLNVQAG AFVD+EFLEE+N G++SATM+N+FSCIALAGVA EY
Sbjct  186   PKGYTITSLDTLMNQGSLNVQAGAAFVDYEFLEEINTGKLSATMVNKFSCIALAGVAAEY  245

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+ LGFTQKKADSQVRWAVLNT+LILRRHE AR++LAE MS
Sbjct  246   LLYGRAEGGLADINKLDGLLKGLGFTQKKADSQVRWAVLNTVLILRRHEKARSQLAEAMS  305

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  306   TGKSVGSC  313


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +1

Query  205  RLGLCNSRIVCLSESGGGVRWQ-LLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAA  381
            RL L  +R    S S    R   +L++VD+ LS+G++ AALSLV+  QG  GGLR FGAA
Sbjct  7    RLRLPPARAADTSSSQSPARLTAVLEQVDQLLSQGNDMAALSLVRSTQGGDGGLRAFGAA  66

Query  382  RQVLCR  399
            RQV  R
Sbjct  67   RQVPQR  72



>tpg|DAA54593.1| TPA: stress regulated protein [Zea mays]
Length=343

 Score =   347 bits (891),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 178/248 (72%), Positives = 210/248 (85%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY L+EL+LNGI+T + LSPVD TLGSIERNLQIAA+ GG +    L L+  Q
Sbjct  83    ARQVPQRLYKLDELKLNGIDTSAFLSPVDLTLGSIERNLQIAAVLGGFSVSAALELSQLQ  142

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL++ LGLL L + D V F GG   L+LDTIGH LS+KYHNRVIQHEAGHFLIAYLLG+L
Sbjct  143   ILFLILGLLSLWSVDFVYFGGGVRNLVLDTIGHYLSQKYHNRVIQHEAGHFLIAYLLGVL  202

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT+TSL+ L  +GSLNVQAG AFVD+EFLEE+N G++SATM+N+FSCIALAGVA EY
Sbjct  203   PKGYTITSLDTLMNQGSLNVQAGAAFVDYEFLEEINTGKLSATMVNKFSCIALAGVAAEY  262

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+ LGFTQKKADSQVRWAVLNT+LILRRHE AR++LAE MS
Sbjct  263   LLYGRAEGGLADINKLDGLLKGLGFTQKKADSQVRWAVLNTVLILRRHEKARSQLAEAMS  322

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  323   TGKSVGSC  330


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 48/79 (61%), Gaps = 6/79 (8%)
 Frame = +1

Query  172  AACYGG--FRHHP---RLGLCNSRIVCLSESGGGVRWQ-LLKRVDEELSKGDERAALSLV  333
            A+C+G    +  P   RL L  +R    S S    R   +L++VD+ LS+G++ AALSLV
Sbjct  8    ASCFGFGLTQMQPAAVRLRLPPARAADTSSSQSPARLTAVLEQVDQLLSQGNDMAALSLV  67

Query  334  KDLQGKPGGLRCFGAARQV  390
            +  QG  GGLR FGAARQV
Sbjct  68   RSTQGGDGGLRAFGAARQV  86



>ref|NP_001151260.1| stress regulated protein [Zea mays]
 gb|ACG42157.1| stress regulated protein [Zea mays]
Length=343

 Score =   345 bits (884),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 177/248 (71%), Positives = 210/248 (85%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY L+EL+LNGI+T + LSPVD TLGSIERNLQIAA+ GG++    L L+  Q
Sbjct  83    ARQVPQRLYKLDELKLNGIDTSAFLSPVDLTLGSIERNLQIAAVLGGLSVSAALELSQLQ  142

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL++ LGLL L + D V F GG   L+LDTIGH LS+KYHNRVIQHEAGHFLIAYLLG+L
Sbjct  143   ILFLILGLLSLWSVDFVYFGGGVRNLVLDTIGHYLSQKYHNRVIQHEAGHFLIAYLLGVL  202

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT+TSL+ L  +GSLNVQAG AFVD+EFLEE+N G++SATM+N+FSCIALAGVA EY
Sbjct  203   PKGYTITSLDTLMNQGSLNVQAGAAFVDYEFLEEINTGKLSATMVNKFSCIALAGVAAEY  262

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G A GGLADIN+LD LL+ LGFTQKKADSQVRWAVLNT+LILRRHE AR++LAE MS
Sbjct  263   LLYGRAGGGLADINKLDGLLKGLGFTQKKADSQVRWAVLNTVLILRRHEKARSQLAEAMS  322

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  323   TGKSVGSC  330


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = +1

Query  205  RLGLCNSRIVCLSESGGGVRWQ-LLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAA  381
            RL L  +R    S S    R   +L++VD+ LS+G++ AALSLV+  QG  GGLR FGAA
Sbjct  24   RLRLPPARAADTSSSQSPARLTAVLEQVDQLLSQGNDMAALSLVRSTQGGDGGLRAFGAA  83

Query  382  RQV  390
            RQV
Sbjct  84   RQV  86



>ref|XP_006645915.1| PREDICTED: uncharacterized protein LOC102713866 [Oryza brachyantha]
Length=328

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 178/248 (72%), Positives = 210/248 (85%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGI+  + LSPVD TLGSIERNLQIAA+ GG++      L+  Q
Sbjct  68    ARQVPQRLYTLDELKLNGIDASAFLSPVDLTLGSIERNLQIAAILGGLSVSVAFELSQLQ  127

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL++ LGLL L + D V F GG   LILDTIGH LS+KYH+RVIQHEAGHFLIAYL+G+L
Sbjct  128   ILFLFLGLLSLWSVDLVYFGGGVRNLILDTIGHNLSQKYHDRVIQHEAGHFLIAYLIGVL  187

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT+TSL+ L K+GSLNVQAGTAFVDFEFL+EVN G++SATMLN+FSCIALAGVATEY
Sbjct  188   PKGYTITSLDTLIKKGSLNVQAGTAFVDFEFLQEVNTGKLSATMLNKFSCIALAGVATEY  247

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G +EGGLADI QLD LL+ LGFTQKKADSQVRWAVLNT+L LRRHE AR++LAE MS
Sbjct  248   LLYGYSEGGLADIGQLDGLLKGLGFTQKKADSQVRWAVLNTVLTLRRHEKARSQLAEAMS  307

Query  1110  EGRSVGFC  1133
              G SVG C
Sbjct  308   SGMSVGSC  315


 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  271  LLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            +L+RVDEEL +G++ AALSLV+  QG  GGLR FGAARQV  R
Sbjct  32   VLERVDEELREGNDEAALSLVRGAQGADGGLRFFGAARQVPQR  74



>dbj|BAJ88888.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/248 (71%), Positives = 207/248 (83%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY L+EL+LNGI+T S LSPVD TLGSIERNLQIAAL GG++      L+  Q
Sbjct  83    ARQVPQRLYKLDELKLNGIDTSSFLSPVDQTLGSIERNLQIAALLGGLSVSVAFELSQLQ  142

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
              L I +GLLF+ + D + +NGG   L+LDTI H+LSEKYHNRVI+HEAGHFLIAYLLG+L
Sbjct  143   ALLIFVGLLFVWSVDLIYYNGGARNLVLDTIAHSLSEKYHNRVIEHEAGHFLIAYLLGVL  202

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+ YT+T L+ L K+GSLNVQAGTAFVDFEF+EE+N G++SA MLN+FSCIALAGVATEY
Sbjct  203   PKEYTITCLDTLTKQGSLNVQAGTAFVDFEFVEEINTGKLSAKMLNKFSCIALAGVATEY  262

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL D+N+LD L +SLGFTQ KADSQVRWAVLN +LILRRHE AR+KLAE MS
Sbjct  263   LLYGYAEGGLDDVNKLDGLFKSLGFTQNKADSQVRWAVLNIVLILRRHEKARSKLAEAMS  322

Query  1110  EGRSVGFC  1133
              GRSVG C
Sbjct  323   SGRSVGSC  330


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  271  LLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            +L++VD+EL KG++ AALSLV+  QG+ GGLRCFGAARQV
Sbjct  47   VLEQVDDELRKGNDEAALSLVRGSQGEGGGLRCFGAARQV  86



>gb|KCW61717.1| hypothetical protein EUGRSUZ_H04431 [Eucalyptus grandis]
Length=309

 Score =   342 bits (877),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 206/248 (83%), Gaps = 29/248 (12%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIET  LLSP+DATLG+IERNLQ+AAL+GG++AWN+L L+PQQ
Sbjct  78    ARQVPQRLYTLDELKLNGIETALLLSPIDATLGAIERNLQLAALAGGLSAWNLLGLSPQQ  137

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLGLLFL TFDS                             HEAGHFLIAYL+GIL
Sbjct  138   IFYISLGLLFLWTFDS-----------------------------HEAGHFLIAYLIGIL  168

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYT++SL+ALKKEGSLNVQAGT+FVDFEFLEEVN G+VSAT LN+FSCIALAGVATEY
Sbjct  169   PRGYTISSLDALKKEGSLNVQAGTSFVDFEFLEEVNAGKVSATTLNKFSCIALAGVATEY  228

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFGCAEGGLADINQLD LL+ LGFTQKKADSQVRWAVLN++L+LRRHE AR KLAE MS
Sbjct  229   LLFGCAEGGLADINQLDSLLKGLGFTQKKADSQVRWAVLNSVLLLRRHEAARGKLAEAMS  288

Query  1110  EGRSVGFC  1133
             EG+SVG+C
Sbjct  289   EGKSVGYC  296


 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 50/75 (67%), Gaps = 5/75 (7%)
 Frame = +1

Query  181  YGGFRHHPRLGLCNSRIVCLSESGGG-----VRWQLLKRVDEELSKGDERAALSLVKDLQ  345
            YG     PRL +   R + +  S         R Q+L+RVDEEL+KG+ERAAL LVKD Q
Sbjct  7    YGSLSRDPRLKVPILRTIIVRASSSPPQVEFSRRQVLERVDEELAKGNERAALGLVKDSQ  66

Query  346  GKPGGLRCFGAARQV  390
            GKPGGLRCFG+ARQV
Sbjct  67   GKPGGLRCFGSARQV  81



>ref|NP_001043093.1| Os01g0382700 [Oryza sativa Japonica Group]
 dbj|BAD68814.1| ATP-dependent Zn proteases-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF05007.1| Os01g0382700 [Oryza sativa Japonica Group]
 gb|EEE54620.1| hypothetical protein OsJ_01867 [Oryza sativa Japonica Group]
Length=346

 Score =   343 bits (879),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 177/248 (71%), Positives = 209/248 (84%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGI+T + LSPVD TLGSIERNLQIAA+ GG++      L+  Q
Sbjct  86    ARQVPQRLYTLDELKLNGIDTSAFLSPVDLTLGSIERNLQIAAVLGGLSVSAAFELSKLQ  145

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L++ LGLL L + D V F GG   LILDTIGH LS+KY NRVIQHEAGHFLIAYLLG+L
Sbjct  146   VLFLFLGLLSLWSVDLVYFGGGVRNLILDTIGHNLSQKYRNRVIQHEAGHFLIAYLLGVL  205

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT+TSL+   K+GSLNVQAGTAFVDFEFL+EVN G++SATMLN+FSCIALAGVATEY
Sbjct  206   PKGYTITSLDTFIKKGSLNVQAGTAFVDFEFLQEVNSGKLSATMLNKFSCIALAGVATEY  265

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADI QLD LL+ LGFTQKKADSQVRWAVLNT+  LRRH+ AR++LAE MS
Sbjct  266   LLYGYAEGGLADIGQLDGLLKGLGFTQKKADSQVRWAVLNTVPALRRHKKARSQLAEAMS  325

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  326   SGKSVGSC  333


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  271  LLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            +L++VDEEL KG++ AALSLV+  QG  GGLR FGAARQV  R
Sbjct  50   VLEQVDEELRKGNDEAALSLVRGSQGADGGLRFFGAARQVPQR  92



>gb|EMS52575.1| hypothetical protein TRIUR3_14340 [Triticum urartu]
Length=341

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 205/248 (83%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY L+EL+LNGI+T S LSPVD TLGSIERNLQIAAL GG++      L+  Q
Sbjct  81    ARQVPQRLYKLDELKLNGIDTSSFLSPVDQTLGSIERNLQIAALLGGLSVSFAFELSQLQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
              L   +GLLF+ + D + +NGG   L+LDTI H+LSEKYHNRVI+HEAGHFLIAYLLG+L
Sbjct  141   ALLTFVGLLFVWSVDLIYYNGGGRNLVLDTIAHSLSEKYHNRVIEHEAGHFLIAYLLGVL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+ YT+T L+ L K+GSLNVQAGTAFVDFEF+EE+N G++SA MLN+FSCIALAGVATEY
Sbjct  201   PKEYTITCLDTLMKQGSLNVQAGTAFVDFEFVEEINTGKLSAKMLNKFSCIALAGVATEY  260

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL D+N+LD L +SLGFTQ KADSQVRWAVLN +LILRRHE AR+KL E MS
Sbjct  261   LLYGYAEGGLDDVNKLDGLFKSLGFTQNKADSQVRWAVLNIVLILRRHEKARSKLKEAMS  320

Query  1110  EGRSVGFC  1133
              GRSVG C
Sbjct  321   SGRSVGSC  328


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 6/70 (9%)
 Frame = +1

Query  199  HP-----RLGLCNSRIVCLSESGGGVRWQ-LLKRVDEELSKGDERAALSLVKDLQGKPGG  360
            HP     RL L  +R    S      R + +L++VD+EL KG++ AALSLV+  QG+ GG
Sbjct  15   HPAATAARLRLPPARAANTSSEPAAARLRAVLEQVDDELRKGNDEAALSLVRGSQGEGGG  74

Query  361  LRCFGAARQV  390
            LRCFGAARQV
Sbjct  75   LRCFGAARQV  84



>gb|ABR17231.1| unknown [Picea sitchensis]
Length=360

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/248 (70%), Positives = 201/248 (81%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ++YSLE+LRLN I+T  LLSPVD TLG + RNLQIAA+ GGVA WN L LN  +
Sbjct  99    ARQVPQKIYSLEDLRLNKIDTTCLLSPVDTTLGGVRRNLQIAAVVGGVATWNTLGLNQSE  158

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L I L  L L T D V   GG  ALI+DTIG  LS+KY +RV QHEAGHFLIAYLLGIL
Sbjct  159   LLAILLAFLTLGTLDQVVNGGGVEALIVDTIGRFLSKKYRDRVAQHEAGHFLIAYLLGIL  218

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SL+ALKKE +LNVQAGTAFVDF+FLEEV  G++S+  L+ +SCIALAGVA EY
Sbjct  219   PKGYTLSSLDALKKERTLNVQAGTAFVDFQFLEEVKSGKLSSGTLSNYSCIALAGVAAEY  278

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG AEGGLADI QLD LL+SLGFTQKKADSQ+RWAVLNTI +LRRHE AR+KLAE M 
Sbjct  279   LLFGLAEGGLADIQQLDNLLKSLGFTQKKADSQIRWAVLNTITLLRRHEQARSKLAEAMD  338

Query  1110  EGRSVGFC  1133
               +SVG C
Sbjct  339   FSKSVGDC  346


 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 4/60 (7%)
 Frame = +1

Query  223  SRIVCLSESGGGV----RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            SRI+ L    GGV    R + L+++D EL +G+ER A S++  LQGKPGGLR FGAARQV
Sbjct  43   SRIIVLCVLNGGVDTSGRKEALRKLDLELERGNEREAFSIITSLQGKPGGLRGFGAARQV  102



>gb|AAB61082.1| contains similarity to Synechococcus PCC7942 chromosomal region 
used as basis of neutral siteII recombinational cloning vector 
(PID:g1174192) [Arabidopsis thaliana]
Length=386

 Score =   338 bits (868),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 215/294 (73%), Gaps = 45/294 (15%)
 Frame = +3

Query  387   GALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQ  566
              A Q+PQ+LY+LEEL+LNGI   SLLSP D TLGSIERNLQIAA+SGG+ AW   +L+ Q
Sbjct  80    AARQVPQRLYTLEELKLNGINAASLLSPTDTTLGSIERNLQIAAVSGGIVAWKAFDLSSQ  139

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVI---------------  701
             Q+ +++LG +FL T D VSFNGG G+L+LDT GHT S++YHNRV+               
Sbjct  140   QLFFLTLGFMFLWTLDLVSFNGGIGSLVLDTTGHTFSQRYHNRVVQKHYIIFHWTYCELR  199

Query  702   -QHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQV---  869
              QHEAGHFL+AYL+GILPRGYTL+SLEAL+KEGSLN+QAG+AFVD+EFLEE NK      
Sbjct  200   SQHEAGHFLVAYLVGILPRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEPNKKLCLLF  259

Query  870   SATMLNRFSCIALAGVATEYLLFGCAEGGLADIN--------------------------  971
                MLNRFSCIALAGVATEYLL+G AEGGL DI+                          
Sbjct  260   QNQMLNRFSCIALAGVATEYLLYGYAEGGLDDISKVSFLLPLKNSSDYVNMLYGFVVLME  319

Query  972   QLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             QLD L++SLGFTQKKADSQVRW+VLNTIL+LRRHE AR+KLA+ MS+G SVG C
Sbjct  320   QLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHEIARSKLAQAMSKGESVGSC  373


 Score = 83.2 bits (204),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  229  IVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            IVC SE+G  +R Q L++VD +LS GDERAALSLVKDLQGKP GLRCFGAARQV
Sbjct  31   IVCSSETGLSIRRQALEQVDSKLSSGDERAALSLVKDLQGKPDGLRCFGAARQV  84



>ref|XP_010102676.1| hypothetical protein L484_002090 [Morus notabilis]
 gb|EXB93884.1| hypothetical protein L484_002090 [Morus notabilis]
Length=306

 Score =   332 bits (850),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 175/248 (71%), Positives = 202/248 (81%), Gaps = 24/248 (10%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGIET SLLSPVDATLG+IERNLQ+AA+ GGV+AWNV   +PQQ
Sbjct  70    ARQVPQRLYTLDELKLNGIETTSLLSPVDATLGAIERNLQLAAVVGGVSAWNVFGFSPQQ  129

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             + Y+S GLLFL T D+VSFNGG  +L+LDT GHT S+K                      
Sbjct  130   VFYLSSGLLFLWTLDAVSFNGGVSSLVLDTTGHTFSQK----------------------  167

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
               GYTL+SLEAL+KEGSLNVQAGT+FVDFEFLEEVN G+VSAT LNRFSCIALAGVATEY
Sbjct  168   --GYTLSSLEALQKEGSLNVQAGTSFVDFEFLEEVNGGKVSATTLNRFSCIALAGVATEY  225

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+SLGFTQKKADSQVRW+VLNTILILRRH+ ARAKLAE M+
Sbjct  226   LLYGYAEGGLADINKLDILLRSLGFTQKKADSQVRWSVLNTILILRRHKVARAKLAEAMT  285

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  286   AGKSVGSC  293


 Score = 90.1 bits (222),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  YGGFRHHPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGG  360
            Y G  H P+L   + R+ C SE     R ++L++VDEEL+KGDE+AALS+VKDLQGKPGG
Sbjct  4    YVGLSHFPQLRFPSFRVKCSSEQVSVSRRKVLEKVDEELTKGDEKAALSIVKDLQGKPGG  63

Query  361  LRCFGAARQV  390
             RCFGAARQV
Sbjct  64   FRCFGAARQV  73



>gb|KHG21903.1| Eukaryotic translation initiation factor 3 subunit I [Gossypium 
arboreum]
Length=303

 Score =   333 bits (853),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 178/248 (72%), Positives = 198/248 (80%), Gaps = 29/248 (12%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+ELRLNGIET SLLSPVD+TLGSIERNLQ+AA+ GGVAAWNV + N QQ
Sbjct  72    ARQVPQRLYTLDELRLNGIETASLLSPVDSTLGSIERNLQLAAILGGVAAWNVFSFNQQQ  131

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL           F S+ F      L L T+              HEAGHFLIAYL+GIL
Sbjct  132   IL-----------FISLGF------LFLWTLDL------------HEAGHFLIAYLVGIL  162

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTLTSLEALKKEGSLN+QAGTAFVDFEFLEEVN G+VSAT LNRFSCIALAGVATEY
Sbjct  163   PRGYTLTSLEALKKEGSLNIQAGTAFVDFEFLEEVNAGKVSATTLNRFSCIALAGVATEY  222

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG AEGGLADIN+LD LL+ LGF+QKKADSQVRWAVLNTIL+LRRHE AR+KLAE MS
Sbjct  223   LLFGYAEGGLADINKLDGLLKGLGFSQKKADSQVRWAVLNTILLLRRHEAARSKLAEAMS  282

Query  1110  EGRSVGFC  1133
              G++VG C
Sbjct  283   LGKTVGSC  290


 Score = 87.0 bits (214),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +1

Query  169  SAACYGGFRHHPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQG  348
            ++ C+      PRL L   RI+  +E G   R Q+L++VD+ELSKGDERAALSLVKDLQG
Sbjct  3    TSVCFLNLSSCPRLRLSTFRILSSAEIGVS-RRQVLEQVDKELSKGDERAALSLVKDLQG  61

Query  349  KPGGLRCFGAARQV  390
            KPGGLRCF AARQV
Sbjct  62   KPGGLRCFAAARQV  75



>tpg|DAA54594.1| TPA: hypothetical protein ZEAMMB73_027015 [Zea mays]
Length=337

 Score =   334 bits (857),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 174/248 (70%), Positives = 205/248 (83%), Gaps = 6/248 (2%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY L+EL+LNGI+T + LSPVD TLGSIERNLQIAA+ GG +    L L+  Q
Sbjct  83    ARQVPQRLYKLDELKLNGIDTSAFLSPVDLTLGSIERNLQIAAVLGGFSVSAALELSQLQ  142

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL++ LGLL L + D V F GG   L+LDTIGH LS+KYHNRVIQHEAGHFLIAYLLG+L
Sbjct  143   ILFLILGLLSLWSVDFVYFGGGVRNLVLDTIGHYLSQKYHNRVIQHEAGHFLIAYLLGVL  202

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT+TSL+ L  +GSLNVQAG AFVD+EFLEE+N G++SATM+N+FSCIALAGVA EY
Sbjct  203   PKGYTITSLDTLMNQGSLNVQAGAAFVDYEFLEEINTGKLSATMVNKFSCIALAGVAAEY  262

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN      + LGFTQKKADSQVRWAVLNT+LILRRHE AR++LAE MS
Sbjct  263   LLYGRAEGGLADIN------KGLGFTQKKADSQVRWAVLNTVLILRRHEKARSQLAEAMS  316

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  317   TGKSVGSC  324


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +1

Query  172  AACYGG--FRHHP---RLGLCNSRIVCLSESGGGVRWQ-LLKRVDEELSKGDERAALSLV  333
            A+C+G    +  P   RL L  +R    S S    R   +L++VD+ LS+G++ AALSLV
Sbjct  8    ASCFGFGLTQMQPAAVRLRLPPARAADTSSSQSPARLTAVLEQVDQLLSQGNDMAALSLV  67

Query  334  KDLQGKPGGLRCFGAARQVLCR  399
            +  QG  GGLR FGAARQV  R
Sbjct  68   RSTQGGDGGLRAFGAARQVPQR  89



>ref|XP_008672985.1| PREDICTED: stress regulated protein isoform X1 [Zea mays]
Length=334

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 202/248 (81%), Gaps = 9/248 (4%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY L+EL+LNGI+T + LSPVD TLGSIERNLQIAA+ GG +    L L+  Q
Sbjct  83    ARQVPQRLYKLDELKLNGIDTSAFLSPVDLTLGSIERNLQIAAVLGGFSVSAALELSQLQ  142

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL++ LGLL L + D V F GG   L+LDTIGH LS+KYHNRVIQHEAGHFLIAYLLG+L
Sbjct  143   ILFLILGLLSLWSVDFVYFGGGVRNLVLDTIGHYLSQKYHNRVIQHEAGHFLIAYLLGVL  202

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYT+TSL+ L  +GSLNVQAG AFVD+EFLEE         M+N+FSCIALAGVA EY
Sbjct  203   PKGYTITSLDTLMNQGSLNVQAGAAFVDYEFLEE---------MVNKFSCIALAGVAAEY  253

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+ LGFTQKKADSQVRWAVLNT+LILRRHE AR++LAE MS
Sbjct  254   LLYGRAEGGLADINKLDGLLKGLGFTQKKADSQVRWAVLNTVLILRRHEKARSQLAEAMS  313

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  314   TGKSVGSC  321


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 48/79 (61%), Gaps = 6/79 (8%)
 Frame = +1

Query  172  AACYGG--FRHHP---RLGLCNSRIVCLSESGGGVRWQ-LLKRVDEELSKGDERAALSLV  333
            A+C+G    +  P   RL L  +R    S S    R   +L++VD+ LS+G++ AALSLV
Sbjct  8    ASCFGFGLTQMQPAAVRLRLPPARAADTSSSQSPARLTAVLEQVDQLLSQGNDMAALSLV  67

Query  334  KDLQGKPGGLRCFGAARQV  390
            +  QG  GGLR FGAARQV
Sbjct  68   RSTQGGDGGLRAFGAARQV  86



>gb|EMT23471.1| hypothetical protein F775_15938 [Aegilops tauschii]
Length=372

 Score =   328 bits (840),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 170/264 (64%), Positives = 203/264 (77%), Gaps = 19/264 (7%)
 Frame = +3

Query  399   IPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQIly  578
             +PQ+LY L+EL+LNGI+T S LSPVD TLGSIERNLQIAAL GG++      L+  Q L 
Sbjct  96    VPQRLYKLDELKLNGIDTSSFLSPVDQTLGSIERNLQIAALLGGLSVSFAFELSQLQALL  155

Query  579   islgllfllTFD-------------------SVSFNGGFGALILDTIGHTLSEKYHNRVI  701
               +GLLF+ + D                    + +NGG   L+LDTI H+LSEKYHNRVI
Sbjct  156   TFVGLLFVWSVDLFLATIFDFPSLKRKTQLSKIYYNGGARNLVLDTIAHSLSEKYHNRVI  215

Query  702   QHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATM  881
             +HEAGHFLIAYLLG+LP+ YT+T L+ L K+GSLNVQAGTAFVDFEF+EE+N G++SA M
Sbjct  216   EHEAGHFLIAYLLGVLPKEYTITCLDTLMKQGSLNVQAGTAFVDFEFVEEINTGKLSAKM  275

Query  882   LNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILI  1061
             LN+FSCIALAGVATEYLL+G +EGGL D+N+LD L +SLGFTQ KADSQVRWAVLN +LI
Sbjct  276   LNKFSCIALAGVATEYLLYGYSEGGLDDVNKLDGLFKSLGFTQNKADSQVRWAVLNIVLI  335

Query  1062  LRRHENARAKLAEGMSEGRSVGFC  1133
             LRRHE AR+KL E MS GRSVG C
Sbjct  336   LRRHEKARSKLKEAMSSGRSVGSC  359



>gb|EEC70682.1| hypothetical protein OsI_02018 [Oryza sativa Indica Group]
Length=332

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 202/248 (81%), Gaps = 9/248 (4%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+L+EL+LNGI+T + LSPVD TLGSIERNLQIAA+ GG++      L+  Q
Sbjct  81    ARQVPQRLYTLDELKLNGIDTSAFLSPVDLTLGSIERNLQIAAVLGGLSVSAAFELSQLQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L++ LGLL L + D V F GG   LILDTIGH LS+KY NRVIQHEAGHFLIAYLLG+L
Sbjct  141   VLFLFLGLLSLWSVDLVYFGGGVRNLILDTIGHNLSQKYRNRVIQHEAGHFLIAYLLGVL  200

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GY++TSL+   K+GSLNVQAGTAFVDFEFL+E         MLN+FSCIALAGVATEY
Sbjct  201   PKGYSITSLDTFIKKGSLNVQAGTAFVDFEFLQE---------MLNKFSCIALAGVATEY  251

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADI QLD LL+ LGFTQKKADSQVRWAVLNT+L LRRH+ AR++LAE MS
Sbjct  252   LLYGYAEGGLADIGQLDGLLKGLGFTQKKADSQVRWAVLNTVLALRRHKKARSQLAEAMS  311

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  312   SGKSVGSC  319


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 45/78 (58%), Gaps = 4/78 (5%)
 Frame = +1

Query  178  CYGGFRHHP---RLGLCNSRIVCLSESGGGVRWQ-LLKRVDEELSKGDERAALSLVKDLQ  345
            CY     HP   RL +        + S    R + +L++VDEEL KG++ AALSLV+  Q
Sbjct  10   CYCFTEPHPAAVRLRVLPPARAANTSSEPAARLRAVLEQVDEELRKGNDEAALSLVRGSQ  69

Query  346  GKPGGLRCFGAARQVLCR  399
            G  GGLR FGAARQV  R
Sbjct  70   GADGGLRFFGAARQVPQR  87



>ref|XP_006288256.1| hypothetical protein CARUB_v10001500mg [Capsella rubella]
 gb|EOA21154.1| hypothetical protein CARUB_v10001500mg [Capsella rubella]
Length=315

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 198/248 (80%), Gaps = 28/248 (11%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY+LEEL+LNG                            G+ AW   +L+ QQ
Sbjct  83    ARQVPQRLYTLEELKLNG----------------------------GIVAWQAFDLSSQQ  114

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             + Y++LG +FL T D VS++GG G+L+LDT+GHT S++YHNR++QHEAGHFL+AYL+GIL
Sbjct  115   LFYLTLGFMFLWTLDLVSYSGGIGSLVLDTVGHTFSQRYHNRIVQHEAGHFLVAYLVGIL  174

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             PRGYTL+SLEAL+KEGSLN+QAG+AFVD+EFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  175   PRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEVNSGKVSATMLNRFSCIALAGVATEY  234

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGL DI++LD L++SLGFTQKKADSQVRW+VLNTIL+LRRHE AR KLA+ MS
Sbjct  235   LLYGYAEGGLDDISKLDGLVKSLGFTQKKADSQVRWSVLNTILLLRRHEIARNKLAQAMS  294

Query  1110  EGRSVGFC  1133
             +G SVG C
Sbjct  295   KGESVGSC  302


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  229  IVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            IVC SE+G   R Q L+ VD +LS GDERAALSLVKDLQGKP GLRCFGAARQV
Sbjct  33   IVCSSETGVSTRRQALELVDSKLSSGDERAALSLVKDLQGKPDGLRCFGAARQV  86



>ref|XP_007205503.1| hypothetical protein PRUPE_ppa008298mg [Prunus persica]
 gb|EMJ06702.1| hypothetical protein PRUPE_ppa008298mg [Prunus persica]
Length=309

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 194/248 (78%), Gaps = 28/248 (11%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LYSL+EL+LNGIE  SLLSPVD TLGSIERNLQ+AA+ GGV+AWNV   + QQ
Sbjct  77    ARQVPQRLYSLDELKLNGIEASSLLSPVDTTLGSIERNLQLAAVLGGVSAWNVFGFSAQQ  136

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             I YISLGLLFL T D+VSFNGG  +L++DTIGHT S+KYHNRVIQ               
Sbjct  137   IFYISLGLLFLWTLDAVSFNGGVSSLVIDTIGHTFSQKYHNRVIQ---------------  181

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
                          KEGSLNVQAGTAFVDFEF+EEVN G+VSAT LNRF+C+ALAGVA EY
Sbjct  182   -------------KEGSLNVQAGTAFVDFEFVEEVNAGKVSATTLNRFACVALAGVAAEY  228

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             +L+G AEGGLADINQLD L +SLGFTQKK DSQVRW+VLNT+LILRRHE  RAKLAE MS
Sbjct  229   ILYGYAEGGLADINQLDSLYRSLGFTQKKTDSQVRWSVLNTVLILRRHEVVRAKLAEAMS  288

Query  1110  EGRSVGFC  1133
             EG+SVG C
Sbjct  289   EGKSVGSC  296


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 5/81 (6%)
 Frame = +1

Query  178  CYGGFRHHPRLGLC----NSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQ  345
            CY G  + P+L L     +  I+C SE     R Q+LK+VD+EL KGDERAALSLVKD+Q
Sbjct  7    CYAGSSYRPQLQLSLRFPSFGIICSSEVSVS-RQQVLKQVDKELDKGDERAALSLVKDVQ  65

Query  346  GKPGGLRCFGAARQVLCRYPS  408
            GKPGGLRCFGAARQV  R  S
Sbjct  66   GKPGGLRCFGAARQVPQRLYS  86



>ref|XP_011078010.1| PREDICTED: uncharacterized protein LOC105161869 isoform X2 [Sesamum 
indicum]
Length=307

 Score =   310 bits (795),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 174/248 (70%), Positives = 195/248 (79%), Gaps = 28/248 (11%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+L+ELRLNGIE  SLLSPVD TLGSIER +Q AAL GG+AAWNV +L+PQQ
Sbjct  75    ARQIPQRLYTLDELRLNGIEAASLLSPVDTTLGSIERIIQAAALLGGIAAWNVFDLSPQQ  134

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL+ SLG LFL TFD+VSFNGG   L+LDT+ H+ S+KYH+RV+Q               
Sbjct  135   ILFTSLGFLFLWTFDAVSFNGGISFLVLDTLAHSFSQKYHDRVVQ---------------  179

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
                          KEGSLNVQAGTAFVDFEFLEEVNKG+VSAT LN+FSCIALAGVATEY
Sbjct  180   -------------KEGSLNVQAGTAFVDFEFLEEVNKGKVSATTLNKFSCIALAGVATEY  226

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG AEGGLADIN LD LL+SLGFTQKKAD+QVRWAVLNT+LILRRHE ARA LA+ MS
Sbjct  227   LLFGTAEGGLADINTLDKLLKSLGFTQKKADAQVRWAVLNTVLILRRHEKARAVLADAMS  286

Query  1110  EGRSVGFC  1133
             EGRSV  C
Sbjct  287   EGRSVSSC  294


 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  250  GGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            G  VRWQ+L++VD+ELS G+ERAAL+LVKDLQ KPGGLRCFG ARQ+  R
Sbjct  32   GAAVRWQVLEQVDKELSNGNERAALNLVKDLQAKPGGLRCFGTARQIPQR  81



>ref|XP_006857009.1| hypothetical protein AMTR_s00197p00027670 [Amborella trichopoda]
 gb|ERN18476.1| hypothetical protein AMTR_s00197p00027670 [Amborella trichopoda]
Length=299

 Score =   310 bits (794),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 197/248 (79%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+ YSL+EL+LN I+T  LLSPVD TL +I+RNLQ+  + G  + W  L  N  Q
Sbjct  39    ARQIPQRSYSLDELKLNRIDTSLLLSPVDTTLRTIKRNLQLVTVLGEFSLWTSLGYNQLQ  98

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L+  LGLL L + D + F+GG   ++LDT G+ LS KY +RV+QHEAGHFL+AYLLG+L
Sbjct  99    LLFFLLGLLSLWSLDLIIFSGGLENMVLDTFGNLLSGKYRSRVVQHEAGHFLVAYLLGVL  158

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+S EAL+KEGSLN+QAGT FVD EFLEEV  G+VSA  LN+FSCIA+AGV  EY
Sbjct  159   PKGYTLSSFEALRKEGSLNIQAGTTFVDIEFLEEVKAGKVSAKTLNQFSCIAMAGVVAEY  218

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             +LFG AEGGL+DI +LD LL+ LGFTQKKADS +RWAVLNT++ILRRH+ AR+KLAE MS
Sbjct  219   ILFGFAEGGLSDIEKLDGLLKGLGFTQKKADSLIRWAVLNTVIILRRHQGARSKLAEAMS  278

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  279   SGKSVGSC  286


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  268  QLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCRYPS  408
            ++L++VD EL++GDE  AL L+++LQ  P GLR FGAARQ+  R  S
Sbjct  2    EVLEQVDMELAEGDEEGALMLIRELQDMPDGLRGFGAARQIPQRSYS  48



>ref|XP_010941744.1| PREDICTED: uncharacterized protein LOC105059926 isoform X2 [Elaeis 
guineensis]
Length=312

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 192/248 (77%), Gaps = 29/248 (12%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LYSL+EL+LNGI+T + LSP+D TLGSIERNLQ+AA+ GG AAW     +  Q
Sbjct  81    ARQVPQRLYSLDELKLNGIDTAAFLSPIDITLGSIERNLQLAAVLGGFAAWRAFGFSQLQ  140

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +LY+SLGLLFL T D                              HEAGHFLIAYLLGIL
Sbjct  141   MLYLSLGLLFLWTLD-----------------------------LHEAGHFLIAYLLGIL  171

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SLEAL KEGSLNVQAGT+FVDFEF++EV  G+V+A MLNRFSCIALAGVATEY
Sbjct  172   PKGYTLSSLEALMKEGSLNVQAGTSFVDFEFIDEVVTGKVTAKMLNRFSCIALAGVATEY  231

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG +EGGL+DI QLD LL+SLGFTQKKADSQVRWAVLNTILILRRHE AR++LAE MS
Sbjct  232   LLFGYSEGGLSDIGQLDKLLKSLGFTQKKADSQVRWAVLNTILILRRHERARSQLAEAMS  291

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  292   SGKSVGSC  299


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 54/85 (64%), Gaps = 8/85 (9%)
 Frame = +1

Query  178  CYGGFRHHPRLGLCNSRIVCLSESG--------GGVRWQLLKRVDEELSKGDERAALSLV  333
            CY G   H RL +   R V  SES         GG R Q L++VDE L KG+ER ALSLV
Sbjct  6    CYSGVSLHVRLRVLTVRAVNSSESSLDSLTLKSGGSRLQDLQQVDELLRKGNERGALSLV  65

Query  334  KDLQGKPGGLRCFGAARQVLCRYPS  408
            KDLQGKPGGLRCFGAARQV  R  S
Sbjct  66   KDLQGKPGGLRCFGAARQVPQRLYS  90



>ref|XP_010244617.1| PREDICTED: uncharacterized protein LOC104588407 isoform X2 [Nelumbo 
nucifera]
Length=301

 Score =   302 bits (774),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 193/248 (78%), Gaps = 32/248 (13%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+L+EL+LN I+T+SLLSPVDATLGSIERNLQ+AA+  G++AW    L  QQ
Sbjct  73    ARQIPQRLYTLDELKLNNIDTLSLLSPVDATLGSIERNLQVAAVLAGISAWVAFGLTQQQ  132

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             IL +SLGLLFL + D V  NGG G+L+LDTIGHT+S+KYHNRVIQHEAGHF+IAYLLGIL
Sbjct  133   ILLLSLGLLFLWSLDLVLVNGGIGSLVLDTIGHTVSQKYHNRVIQHEAGHFIIAYLLGIL  192

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+SLEAL+KEGSLNVQAGTAFVDFEF+EEVNKG+VSA                  
Sbjct  193   PKGYTLSSLEALRKEGSLNVQAGTAFVDFEFVEEVNKGKVSA------------------  234

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
                           QLD LL+ LGFTQKKADSQVRWAVLN +L+LRRHE AR+KLAE MS
Sbjct  235   --------------QLDRLLKGLGFTQKKADSQVRWAVLNIVLLLRRHEGARSKLAEAMS  280

Query  1110  EGRSVGFC  1133
              GRSVGFC
Sbjct  281   MGRSVGFC  288


 Score = 82.0 bits (201),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 3/77 (4%)
 Frame = +1

Query  166  MSAACYGGFRH--HPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKD  339
            M +  Y GFR    PRL L   R +C  E GG  R Q+L++VD+EL+ G++ AALSL +D
Sbjct  1    MGSMVYYGFRLSLRPRLNLRMVRALCSIEPGGS-RLQILEQVDKELASGNDVAALSLARD  59

Query  340  LQGKPGGLRCFGAARQV  390
            LQGKPGGLRCFGAARQ+
Sbjct  60   LQGKPGGLRCFGAARQI  76



>ref|XP_011078011.1| PREDICTED: uncharacterized protein LOC105161869 isoform X3 [Sesamum 
indicum]
Length=294

 Score =   279 bits (713),  Expect(3) = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A QIPQ+LY+L+ELRLNGIE  SLLSPVD TLGSIER +Q AAL GG+AAWNV +L+PQQ
Sbjct  75   ARQIPQRLYTLDELRLNGIEAASLLSPVDTTLGSIERIIQAAALLGGIAAWNVFDLSPQQ  134

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            IL+ SLG LFL TFD+VSFNGG   L+LDT+ H+ S+KYH+RV+QHEAGHFLIAYLLGIL
Sbjct  135  ILFTSLGFLFLWTFDAVSFNGGISFLVLDTLAHSFSQKYHDRVVQHEAGHFLIAYLLGIL  194

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
            P+GYTLTSL+ALKKEGSLNVQAGTAFVDFEFLEEVNKG+VSAT LN+FSCIALAGVATEY
Sbjct  195  PKGYTLTSLDALKKEGSLNVQAGTAFVDFEFLEEVNKGKVSATTLNKFSCIALAGVATEY  254

Query  930  LLFGCAEGG  956
            LLFG AE G
Sbjct  255  LLFGTAEVG  263


 Score = 79.7 bits (195),  Expect(3) = 1e-94, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  250  GGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            G  VRWQ+L++VD+ELS G+ERAAL+LVKDLQ KPGGLRCFG ARQ+  R
Sbjct  32   GAAVRWQVLEQVDKELSNGNERAALNLVKDLQAKPGGLRCFGTARQIPQR  81


 Score = 38.9 bits (89),  Expect(3) = 1e-94, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +2

Query  974   VGLSTAKPGVYTEKGRFSGEMGCTEHYTHSAPP  1072
             VG  T + G+YTE+GR S EMGC++H   SA P
Sbjct  262   VGQITQELGLYTEEGRRSSEMGCSQHCPDSASP  294



>ref|XP_001779710.1| predicted protein [Physcomitrella patens]
 gb|EDQ55506.1| predicted protein [Physcomitrella patens]
Length=287

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/248 (60%), Positives = 189/248 (76%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A  +P +LYSLEELRLN I+   LLSP D TLG+++RNLQ AA++G    W  L L+  Q
Sbjct  26    ATSVPYRLYSLEELRLNKIDATQLLSPTDQTLGNVKRNLQYAAIAGAAVTWWQLGLDQYQ  85

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L  ++  LFL T D ++  GG  AL+LD+IG  LS KY +RV QHE+GHFLI+YL+GIL
Sbjct  86    LLAAAVLFLFLGTVDQIANGGGVEALLLDSIGRILSPKYQDRVAQHESGHFLISYLVGIL  145

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+ YTL+S +A +K G+LNVQAGT FVD++F EEV  G++S+T LN+FSC+ALAGVATEY
Sbjct  146   PKSYTLSSFDAFRKYGALNVQAGTTFVDYDFQEEVTTGKLSSTTLNKFSCVALAGVATEY  205

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             L +  AEGGLADI QLD +L+ L FTQKKADSQVRWAVLNT+ ILRRH + +AKLA  M 
Sbjct  206   LRYEIAEGGLADILQLDAVLKGLTFTQKKADSQVRWAVLNTVSILRRHFDLQAKLAAAML  265

Query  1110  EGRSVGFC  1133
              G+SVG C
Sbjct  266   AGKSVGEC  273



>gb|EPS73376.1| hypothetical protein M569_01378 [Genlisea aurea]
Length=1169

 Score =   310 bits (794),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 201/249 (81%), Gaps = 9/249 (4%)
 Frame = +3

Query  387   GALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQ  566
              A QIPQ++Y+ +ELRLNGI+T SLLSPVD T+ +  R +Q AAL GG+  WNV  L+P 
Sbjct  73    AARQIPQRIYTPDELRLNGIKTSSLLSPVDTTIVTTARTIQAAALLGGITTWNVFRLSPS  132

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
             QIL+  LGLLFL +FD++ FNGG   L++DT+ H+ S+KYHNRV+QHEAGHFLIAYLLGI
Sbjct  133   QILFTILGLLFLWSFDAIYFNGGLSFLVIDTLAHSFSQKYHNRVVQHEAGHFLIAYLLGI  192

Query  747   LPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATE  926
             LP+GYTLTSLEA K EGSLNVQAGT FVDFEFL+E          LN+FSCIALAGVATE
Sbjct  193   LPKGYTLTSLEAWKNEGSLNVQAGTKFVDFEFLQET---------LNKFSCIALAGVATE  243

Query  927   YLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGM  1106
             Y+L+G AEGG++DI  LD LL+ LGFTQKKAD QVRWAVLNT+LI+RRH+ ARA LA  M
Sbjct  244   YVLYGAAEGGISDIATLDRLLKGLGFTQKKADGQVRWAVLNTVLIVRRHDRARAALAAAM  303

Query  1107  SEGRSVGFC  1133
             +EGRSVG+C
Sbjct  304   AEGRSVGYC  312


 Score = 65.1 bits (157),  Expect(2) = 2e-94, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 7/66 (11%)
 Frame = +1

Query  193  RHHPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCF  372
            R  PR      + +C SE     R QLL+ VD+ELS G+E+AAL+L+KDLQ   G +RCF
Sbjct  19   RSSPR------KTLCASEFRAAERLQLLEHVDKELSDGNEKAALNLIKDLQAN-GSIRCF  71

Query  373  GAARQV  390
            GAARQ+
Sbjct  72   GAARQI  77



>ref|XP_002966885.1| hypothetical protein SELMODRAFT_168681 [Selaginella moellendorffii]
 gb|EFJ31484.1| hypothetical protein SELMODRAFT_168681 [Selaginella moellendorffii]
Length=323

 Score =   295 bits (756),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 195/249 (78%), Gaps = 0/249 (0%)
 Frame = +3

Query  387   GALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQ  566
              A Q+PQ++Y+LEELRLNGI+T   LSPVD TLG++ RNLQ+AAL+GG+AAW + +L+  
Sbjct  61    AARQVPQRIYTLEELRLNGIDTARFLSPVDFTLGTVRRNLQLAALAGGIAAWQLFHLDQF  120

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
             Q+L   +  LF+ T D + +NGG  AL+LDT+G  +S KY NRV QHEAGHFL+AYL+GI
Sbjct  121   QLLIGVVVALFVGTLDQIVYNGGVEALLLDTLGRVVSGKYKNRVAQHEAGHFLVAYLMGI  180

Query  747   LPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATE  926
             LP  YTL+SL+A +K GSLNVQAGT+FVDFEF EEV+    ++  LN+++C+ALAGVATE
Sbjct  181   LPADYTLSSLDAFRKNGSLNVQAGTSFVDFEFQEEVSFKFPASKTLNKYACVALAGVATE  240

Query  927   YLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGM  1106
             +L FG AEGGL+DI QLD LL+ L FTQ KADSQVRWAVLNT+ ILRRH    +KLAE M
Sbjct  241   FLKFGLAEGGLSDIQQLDELLKRLNFTQLKADSQVRWAVLNTVSILRRHLALHSKLAEAM  300

Query  1107  SEGRSVGFC  1133
               G+SVG C
Sbjct  301   DAGKSVGQC  309



>ref|XP_002961125.1| hypothetical protein SELMODRAFT_75099 [Selaginella moellendorffii]
 gb|EFJ38664.1| hypothetical protein SELMODRAFT_75099 [Selaginella moellendorffii]
Length=323

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 195/249 (78%), Gaps = 0/249 (0%)
 Frame = +3

Query  387   GALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQ  566
              A Q+PQ++Y+LEELRLNGI+T   LSPVD TLG++ RNLQ+AAL+GG+AAW + +L+  
Sbjct  61    AARQVPQRIYTLEELRLNGIDTARFLSPVDFTLGTVRRNLQLAALAGGIAAWQLFHLDQF  120

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
             Q+L   +  LF+ T D + +NGG  AL+LDT+G  +S KY NRV QHEAGHFL+AYL+GI
Sbjct  121   QLLIGVVVALFVGTLDQIVYNGGVEALLLDTLGRVVSGKYKNRVAQHEAGHFLVAYLMGI  180

Query  747   LPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATE  926
             LP  YTL+SL+A +K GSLNVQAGT+FVDFEF EEV+    ++  LN+++C+ALAGVATE
Sbjct  181   LPADYTLSSLDAFRKNGSLNVQAGTSFVDFEFQEEVSFKFPASKTLNKYACVALAGVATE  240

Query  927   YLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGM  1106
             +L FG AEGGL+DI QLD LL+ L FTQ KADSQVRWAVLNT+ ILRRH    +KLAE M
Sbjct  241   FLKFGLAEGGLSDIQQLDELLKRLNFTQLKADSQVRWAVLNTVSILRRHLALHSKLAEAM  300

Query  1107  SEGRSVGFC  1133
               G+SVG C
Sbjct  301   DTGKSVGQC  309



>ref|XP_004968786.1| PREDICTED: uncharacterized protein LOC101776912 isoform X2 [Setaria 
italica]
Length=270

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  618   VSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEG  797
             V F GG   LILDTIGH LS+KYHNRVIQHEAGHFLIAYLLG+LP+GYT+TSL+ L K+G
Sbjct  86    VYFGGGVRNLILDTIGHYLSQKYHNRVIQHEAGHFLIAYLLGVLPKGYTITSLDTLIKQG  145

Query  798   SLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQL  977
             SLNVQAGTAFVD+EFLEE+N G++SATMLN+FSCIALAG+ATEYLL+G AEGGLADIN+L
Sbjct  146   SLNVQAGTAFVDYEFLEEINTGKLSATMLNKFSCIALAGIATEYLLYGVAEGGLADINKL  205

Query  978   DFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             D LL+SLGFTQKKADSQVRWAVLNT+L+LRRHE AR++LAE MS G+SVG C
Sbjct  206   DGLLKSLGFTQKKADSQVRWAVLNTVLMLRRHEKARSQLAEAMSSGKSVGTC  257


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 46/76 (61%), Gaps = 6/76 (8%)
 Frame = +1

Query  178  CYGGFRHHP----RLGLCNSRIVCLSESGGGVRWQ-LLKRVDEELSKGDERAALSLVKDL  342
            C+G F   P    RL L  +R    S S    R + +L++VDE LSKG++ AAL LV   
Sbjct  12   CFG-FTRLPLPAARLRLPPARAADTSASQSPARLRGVLEQVDEALSKGNDEAALFLVHGS  70

Query  343  QGKPGGLRCFGAARQV  390
            QG+ GGLR FGAARQV
Sbjct  71   QGEDGGLRGFGAARQV  86



>ref|NP_001031951.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED93668.1| uncharacterized protein AT5G27290 [Arabidopsis thaliana]
Length=262

 Score =   280 bits (715),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A Q+PQ+LY+LEEL+LNGI   SLLSP D TLGSIERNLQIAA+SGG+ AW   +L+ QQ
Sbjct  81   ARQVPQRLYTLEELKLNGINAASLLSPTDTTLGSIERNLQIAAVSGGIVAWKAFDLSSQQ  140

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            + +++LG +FL T D VSFNGG G+L+LDT GHT S++YHNRV+QHEAGHFL+AYL+GIL
Sbjct  141  LFFLTLGFMFLWTLDLVSFNGGIGSLVLDTTGHTFSQRYHNRVVQHEAGHFLVAYLVGIL  200

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
            PRGYTL+SLEAL+KEGSLN+QAG+AFVD+EFLEEVN G+VSATMLNRFSCIALAGVATEY
Sbjct  201  PRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEVNSGKVSATMLNRFSCIALAGVATEY  260

Query  930  LL  935
            LL
Sbjct  261  LL  262


 Score = 83.6 bits (205),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  229  IVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            IVC SE+G  +R Q L++VD +LS GDERAALSLVKDLQGKP GLRCFGAARQV
Sbjct  31   IVCSSETGLSIRRQALEQVDSKLSSGDERAALSLVKDLQGKPDGLRCFGAARQV  84



>gb|KDO48526.1| hypothetical protein CISIN_1g019841mg [Citrus sinensis]
Length=286

 Score =   283 bits (723),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 180/248 (73%), Gaps = 49/248 (20%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+L+EL+LNGIET SLLSPVD TLGSIERNLQ+AA++GGV+AWNV + NPQQ
Sbjct  75    ARQIPQRLYTLDELKLNGIETRSLLSPVDETLGSIERNLQLAAIAGGVSAWNVFSFNPQQ  134

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             ILY+SL LLFL T DSVS+NGG G+L+LDTIGHT S+KYHNRVIQ               
Sbjct  135   ILYLSLALLFLWTVDSVSYNGGVGSLVLDTIGHTFSQKYHNRVIQ---------------  179

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
                                               VN G+VSAT LNRFSCIALAGVATEY
Sbjct  180   ----------------------------------VNSGKVSATTLNRFSCIALAGVATEY  205

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLADIN+LD LL+ LGFTQKKADSQVRW++LNT+L+LRRH+ ARAKLAE M+
Sbjct  206   LLYGYAEGGLADINKLDALLKGLGFTQKKADSQVRWSLLNTVLLLRRHKGARAKLAEAMT  265

Query  1110  EGRSVGFC  1133
              G+S+G C
Sbjct  266   MGKSLGSC  273


 Score = 77.4 bits (189),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +1

Query  268  QLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            ++LK+VDEELSKGDERAAL+LVKDLQGKPGGLRCFGAARQ+
Sbjct  38   RVLKQVDEELSKGDERAALALVKDLQGKPGGLRCFGAARQI  78



>ref|XP_008672986.1| PREDICTED: stress regulated protein isoform X2 [Zea mays]
 gb|ACN31045.1| unknown [Zea mays]
 tpg|DAA54596.1| TPA: hypothetical protein ZEAMMB73_027015 [Zea mays]
Length=270

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +3

Query  618   VSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEG  797
             V F GG   L+LDTIGH LS+KYHNRVIQHEAGHFLIAYLLG+LP+GYT+TSL+ L  +G
Sbjct  86    VYFGGGVRNLVLDTIGHYLSQKYHNRVIQHEAGHFLIAYLLGVLPKGYTITSLDTLMNQG  145

Query  798   SLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQL  977
             SLNVQAG AFVD+EFLEE+N G++SATM+N+FSCIALAGVA EYLL+G AEGGLADIN+L
Sbjct  146   SLNVQAGAAFVDYEFLEEINTGKLSATMVNKFSCIALAGVAAEYLLYGRAEGGLADINKL  205

Query  978   DFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             D LL+ LGFTQKKADSQVRWAVLNT+LILRRHE AR++LAE MS G+SVG C
Sbjct  206   DGLLKGLGFTQKKADSQVRWAVLNTVLILRRHEKARSQLAEAMSTGKSVGSC  257


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = +1

Query  205  RLGLCNSRIVCLSESGGGVRWQ-LLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAA  381
            RL L  +R    S S    R   +L++VD+ LS+G++ AALSLV+  QG  GGLR FGAA
Sbjct  24   RLRLPPARAADTSSSQSPARLTAVLEQVDQLLSQGNDMAALSLVRSTQGGDGGLRAFGAA  83

Query  382  RQV  390
            RQV
Sbjct  84   RQV  86



>ref|XP_006433240.1| hypothetical protein CICLE_v10001775mg [Citrus clementina]
 gb|ESR46480.1| hypothetical protein CICLE_v10001775mg [Citrus clementina]
 gb|KDO48528.1| hypothetical protein CISIN_1g019841mg [Citrus sinensis]
Length=248

 Score =   266 bits (679),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A QIPQ+LY+L+EL+LNGIET SLLSPVD TLGSIERNLQ+AA++GGV+AWNV + NPQQ
Sbjct  75   ARQIPQRLYTLDELKLNGIETRSLLSPVDETLGSIERNLQLAAIAGGVSAWNVFSFNPQQ  134

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            ILY+SL LLFL T DSVS+NGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  135  ILYLSLALLFLWTVDSVSYNGGVGSLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYLVGIL  194

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATML  884
            P+GYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVN G+VSAT+L
Sbjct  195  PKGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNSGKVSATIL  239


 Score = 77.8 bits (190),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  268  QLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            ++LK+VDEELSKGDERAAL+LVKDLQGKPGGLRCFGAARQ+  R
Sbjct  38   RVLKQVDEELSKGDERAALALVKDLQGKPGGLRCFGAARQIPQR  81



>gb|KDO48527.1| hypothetical protein CISIN_1g019841mg [Citrus sinensis]
Length=255

 Score =   264 bits (675),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A QIPQ+LY+L+EL+LNGIET SLLSPVD TLGSIERNLQ+AA++GGV+AWNV + NPQQ
Sbjct  75   ARQIPQRLYTLDELKLNGIETRSLLSPVDETLGSIERNLQLAAIAGGVSAWNVFSFNPQQ  134

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            ILY+SL LLFL T DSVS+NGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  135  ILYLSLALLFLWTVDSVSYNGGVGSLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYLVGIL  194

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATM  881
            P+GYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVN G+VSAT+
Sbjct  195  PKGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNSGKVSATV  238


 Score = 78.2 bits (191),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  268  QLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            ++LK+VDEELSKGDERAAL+LVKDLQGKPGGLRCFGAARQ+  R
Sbjct  38   RVLKQVDEELSKGDERAALALVKDLQGKPGGLRCFGAARQIPQR  81



>ref|XP_006433239.1| hypothetical protein CICLE_v10001775mg [Citrus clementina]
 gb|ESR46479.1| hypothetical protein CICLE_v10001775mg [Citrus clementina]
Length=240

 Score =   264 bits (674),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A QIPQ+LY+L+EL+LNGIET SLLSPVD TLGSIERNLQ+AA++GGV+AWNV + NPQQ
Sbjct  75   ARQIPQRLYTLDELKLNGIETRSLLSPVDETLGSIERNLQLAAIAGGVSAWNVFSFNPQQ  134

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            ILY+SL LLFL T DSVS+NGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  135  ILYLSLALLFLWTVDSVSYNGGVGSLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYLVGIL  194

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATM  881
            P+GYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVN G+VSAT+
Sbjct  195  PKGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNSGKVSATV  238


 Score = 78.2 bits (191),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  268  QLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            ++LK+VDEELSKGDERAAL+LVKDLQGKPGGLRCFGAARQ+  R
Sbjct  38   RVLKQVDEELSKGDERAALALVKDLQGKPGGLRCFGAARQIPQR  81



>gb|KDO48525.1| hypothetical protein CISIN_1g019841mg [Citrus sinensis]
Length=289

 Score =   261 bits (666),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/251 (59%), Positives = 174/251 (69%), Gaps = 52/251 (21%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A QIPQ+LY+L+EL+LNGIET SLLSPVD TLGSIERNLQ+AA++GGV+AWNV + NPQQ
Sbjct  75    ARQIPQRLYTLDELKLNGIETRSLLSPVDETLGSIERNLQLAAIAGGVSAWNVFSFNPQQ  134

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             ILY+SL LLFL T DSVS+NGG G+L+LDTIGHT S+KYHNRVIQ               
Sbjct  135   ILYLSLALLFLWTVDSVSYNGGVGSLVLDTIGHTFSQKYHNRVIQ---------------  179

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
                                               VN G+VSAT LNRFSCIALAGVATEY
Sbjct  180   ----------------------------------VNSGKVSATTLNRFSCIALAGVATEY  205

Query  930   LLFGCAEGGLADINQL---DFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAE  1100
             LL+G AEGGLADIN++   D    +    QKKADSQVRW++LNT+L+LRRH+ ARAKLAE
Sbjct  206   LLYGYAEGGLADINKVPPHDSAQLTASEIQKKADSQVRWSLLNTVLLLRRHKGARAKLAE  265

Query  1101  GMSEGRSVGFC  1133
              M+ G+S+G C
Sbjct  266   AMTMGKSLGSC  276


 Score = 77.8 bits (190),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  268  QLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            ++LK+VDEELSKGDERAAL+LVKDLQGKPGGLRCFGAARQ+  R
Sbjct  38   RVLKQVDEELSKGDERAALALVKDLQGKPGGLRCFGAARQIPQR  81



>gb|KHN43248.1| hypothetical protein glysoja_001831 [Glycine soja]
Length=262

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 188/246 (76%), Gaps = 33/246 (13%)
 Frame = +3

Query  396   QIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQIl  575
             Q+PQ+LY+L+EL+L                        IAA+ GG+AAWN   ++PQQI 
Sbjct  37    QVPQRLYTLDELKL------------------------IAAIVGGLAAWNAFAISPQQIF  72

Query  576   yislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPR  755
             YISLGLLFL T D+VSF GG G+L++DTI H+ S+KYHNRVIQHEAGHFLIAYL+GILPR
Sbjct  73    YISLGLLFLWTLDAVSFGGGIGSLVVDTIVHSFSQKYHNRVIQHEAGHFLIAYLVGILPR  132

Query  756   GYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLL  935
             GYT +SL+AL+KEGSLN+QAGTAF DFEF EE          LN+FSCIALAG++TEYL+
Sbjct  133   GYTNSSLDALQKEGSLNIQAGTAFADFEFQEET---------LNKFSCIALAGMSTEYLI  183

Query  936   FGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEG  1115
             +G +EGGL DI +LD LL+ LGFTQKK+D+QVRW++LNT+L+L+ HE ARAK+AE +S G
Sbjct  184   YGFSEGGLDDIRKLDLLLKGLGFTQKKSDTQVRWSLLNTVLLLQMHEAARAKVAEALSMG  243

Query  1116  RSVGFC  1133
             +SVG C
Sbjct  244   KSVGSC  249



>gb|KDO37201.1| hypothetical protein CISIN_1g019829mg [Citrus sinensis]
Length=244

 Score =   249 bits (636),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A QIPQ+LY+L+EL+LNGIET SLLSPVD TLGSIERNLQ+AA+ GGV+AWNV   NPQQ
Sbjct  75   ARQIPQRLYTLDELKLNGIETRSLLSPVDETLGSIERNLQLAAIVGGVSAWNVFGFNPQQ  134

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            ILY+SL LLFL T DSVS+NGG G+L+LDTIGHT S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  135  ILYLSLALLFLWTVDSVSYNGGVGSLVLDTIGHTFSQKYHNRVIQHEAGHFLIAYLVGIL  194

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV  854
            P+GYTLTS EALKKEGSLNVQAGTAFVDFEFLEEV
Sbjct  195  PKGYTLTSFEALKKEGSLNVQAGTAFVDFEFLEEV  229


 Score = 81.6 bits (200),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 2/67 (3%)
 Frame = +1

Query  202  PRLGLCN-SRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGA  378
            PR+ + + SRIV  SE     R ++LK+VDEELSKGDERAAL+LVKDLQGKPGGLRCFGA
Sbjct  16   PRVKVLSLSRIVSSSEVEVSKR-RVLKQVDEELSKGDERAALALVKDLQGKPGGLRCFGA  74

Query  379  ARQVLCR  399
            ARQ+  R
Sbjct  75   ARQIPQR  81



>tpg|DAA54595.1| TPA: hypothetical protein ZEAMMB73_027015 [Zea mays]
Length=278

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A Q+PQ+LY L+EL+LNGI+T + LSPVD TLGSIERNLQIAA+ GG +    L L+  Q
Sbjct  83   ARQVPQRLYKLDELKLNGIDTSAFLSPVDLTLGSIERNLQIAAVLGGFSVSAALELSQLQ  142

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            IL++ LGLL L + D V F GG   L+LDTIGH LS+KYHNRVIQHEAGHFLIAYLLG+L
Sbjct  143  ILFLILGLLSLWSVDFVYFGGGVRNLVLDTIGHYLSQKYHNRVIQHEAGHFLIAYLLGVL  202

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
            P+GYT+TSL+ L  +GSLNVQAG AFVD+EFLEE+N G++SATM+N+FSCIALAGVA EY
Sbjct  203  PKGYTITSLDTLMNQGSLNVQAGAAFVDYEFLEEINTGKLSATMVNKFSCIALAGVAAEY  262

Query  930  LLFGCAEGGLADINQL  977
            LL+G AEGGLADIN++
Sbjct  263  LLYGRAEGGLADINKV  278


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +1

Query  205  RLGLCNSRIVCLSESGGGVRWQ-LLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAA  381
            RL L  +R    S S    R   +L++VD+ LS+G++ AALSLV+  QG  GGLR FGAA
Sbjct  24   RLRLPPARAADTSSSQSPARLTAVLEQVDQLLSQGNDMAALSLVRSTQGGDGGLRAFGAA  83

Query  382  RQVLCR  399
            RQV  R
Sbjct  84   RQVPQR  89



>ref|XP_005646206.1| hypothetical protein COCSUDRAFT_33740 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21662.1| hypothetical protein COCSUDRAFT_33740 [Coccomyxa subellipsoidea 
C-169]
Length=279

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 174/246 (71%), Gaps = 0/246 (0%)
 Frame = +3

Query  396   QIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQIl  575
             QIP+++YSLEELRLN IE    LSP D TLG++   LQ   L G  AA+  L+    Q+L
Sbjct  15    QIPKRIYSLEELRLNKIEAEKFLSPKDDTLGTVRTILQGGGLLGIAAAYFGLHWELSQLL  74

Query  576   yislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPR  755
                 GL FLLT D V+  GG  AL++DT   T++  Y  RV  HE+GHFLIAYL+G+LPR
Sbjct  75    GTLAGLGFLLTVDQVANGGGLEALLIDTAARTINPSYGERVATHESGHFLIAYLVGLLPR  134

Query  756   GYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLL  935
              YTL+SL+A K+ G+LNVQAGT F D  +  EV  G +S+T L+R+ C+ALAG+ATEY+ 
Sbjct  135   TYTLSSLDAYKRYGALNVQAGTLFCDSAYQREVASGTLSSTSLDRYCCVALAGIATEYIK  194

Query  936   FGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEG  1115
             +G AEGGL D+ QLD LL++L FTQKKAD Q+RWAVLN   +LRR+   +++LA+ M+ G
Sbjct  195   YGQAEGGLNDVQQLDGLLKALQFTQKKADGQIRWAVLNVTALLRRYSRVQSQLAQAMAAG  254

Query  1116  RSVGFC  1133
             +SVG C
Sbjct  255   KSVGDC  260



>ref|XP_010230891.1| PREDICTED: uncharacterized protein LOC100844265 isoform X2 [Brachypodium 
distachyon]
Length=291

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 167/248 (67%), Gaps = 49/248 (20%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ+LY L+EL+LNGI+T S LSPVD TLGSIERN QIAA+ GG++   V  L+  Q
Sbjct  80    ARQVPQRLYKLDELKLNGIDTSSFLSPVDRTLGSIERNFQIAAVLGGLSVSAVFELSQFQ  139

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L++ +GLLF+ + D + FNGG   L+LDT+GH LS+KYHNRVIQ               
Sbjct  140   VLFLFVGLLFVWSVDLIYFNGGVRNLVLDTVGHNLSQKYHNRVIQ---------------  184

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
                                               +N G++SA MLN+FSCIALAGVATEY
Sbjct  185   ----------------------------------INTGKLSAMMLNKFSCIALAGVATEY  210

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LL+G AEGGLAD+N+LD L +SLGFTQ KADSQVRWAVLNT+LILRRHE+AR+KLAE MS
Sbjct  211   LLYGYAEGGLADVNKLDGLFKSLGFTQNKADSQVRWAVLNTVLILRRHEDARSKLAEAMS  270

Query  1110  EGRSVGFC  1133
              GRSVG C
Sbjct  271   SGRSVGSC  278


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            R  +L +VD+EL KG++ AALSLV+   G+ GGLRCFGAARQV
Sbjct  41   RSAVLGQVDDELQKGNDEAALSLVRSSLGEGGGLRCFGAARQV  83



>ref|XP_002499536.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO60794.1| predicted protein, partial [Micromonas sp. RCC299]
Length=263

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 170/247 (69%), Gaps = 4/247 (2%)
 Frame = +3

Query  399   IPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQ--QI  572
             +P++ Y+L EL+LNGIE   LLSP ++T+  +   L   AL   V AW VL+ +P   Q+
Sbjct  10    VPRRDYALSELKLNGIEAEKLLSPTESTISGLRDVLGRVALVS-VGAW-VLSSHPSGAQV  67

Query  573   lyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILP  752
               +       +  D V+F GG  AL LDT+    S+ Y  R+  HEA HFL+AYL+GILP
Sbjct  68    TGVLATAAAAIAIDQVTFAGGMEALALDTLAQATSKTYVARLRLHEAAHFLVAYLMGILP  127

Query  753   RGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYL  932
             +GYTL+SL+A K+ G+LNVQAG AF D  F  EV KG++++  L RFSC+ALAG+  EY+
Sbjct  128   KGYTLSSLDAYKEYGALNVQAGCAFCDGAFQAEVAKGKITSGSLGRFSCVALAGIGMEYV  187

Query  933   LFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSE  1112
              +G AEGG+AD+ QLD +L++L F+QKK+DS+VRWAVLNTI ILRRHE    KL+E M+ 
Sbjct  188   AYGFAEGGVADVRQLDGMLRALAFSQKKSDSEVRWAVLNTISILRRHEGTVRKLSERMAA  247

Query  1113  GRSVGFC  1133
             G SVG C
Sbjct  248   GASVGEC  254



>gb|ACU15850.1| unknown [Glycine max]
Length=232

 Score =   230 bits (586),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A Q+PQ+LY+L+ELRLNGIET+SLLSPVD TLGSIERNLQIAA+ GG+AAWN   ++PQQ
Sbjct  81   ARQVPQRLYTLDELRLNGIETLSLLSPVDTTLGSIERNLQIAAIVGGLAAWNAFAISPQQ  140

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            I YISLGLLFL T D+VSF GG G L++DTIGH+ S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  141  IFYISLGLLFLWTLDAVSFGGGIGGLVVDTIGHSFSQKYHNRVIQHEAGHFLIAYLVGIL  200

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEF  842
            PRGYT++SL+AL+K GSLN+QAGTAFVDFEF
Sbjct  201  PRGYTISSLDALQKVGSLNIQAGTAFVDFEF  231


 Score = 73.6 bits (179),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  226  RIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            RI C S + G  R Q+L+++D+EL+KGD+RAAL+LVKDLQGKP GLRCFGAARQV
Sbjct  31   RIRC-SSNVGVSRQQVLEKLDKELAKGDDRAALALVKDLQGKPDGLRCFGAARQV  84



>ref|XP_001418869.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97162.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=292

 Score =   243 bits (619),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 167/248 (67%), Gaps = 0/248 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A  +P++ Y+L ELRLN IE   LL+P ++T+  I  N         VA    L+    Q
Sbjct  31    AHNVPKRDYALAELRLNNIEAEKLLAPTESTIKGIRDNFTRLLGVAYVAGLYFLHPTFAQ  90

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
                ++    F  T+D ++F GG  AL LDT+  + S++Y  R+ +HEA HFL AYL+GIL
Sbjct  91    GAGVAAFAAFCATYDQIAFGGGVSALALDTVAQSTSKEYVTRLRRHEAAHFLTAYLIGIL  150

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
             P+GYTL+S++A K  G+ N+QAG AF D EF  EV KG++++T L RF+C+A+AG+  EY
Sbjct  151   PKGYTLSSMDAFKTYGAFNIQAGCAFCDGEFQREVQKGKITSTSLGRFACVAMAGICMEY  210

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             +LFG AEGGL+D+ QLD LL++L FTQKK+DS+VRWAVLNT  +LRRH     KLA+ M+
Sbjct  211   ILFGFAEGGLSDVQQLDGLLRALAFTQKKSDSEVRWAVLNTTSLLRRHLGLTEKLADYMA  270

Query  1110  EGRSVGFC  1133
              G SVG C
Sbjct  271   RGASVGEC  278



>gb|KEH24534.1| stress regulated protein [Medicago truncatula]
Length=321

 Score =   229 bits (583),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A Q+PQ+LY+L+EL+LNGIE +SLLSPVD TLGSIERNL IAA+ GG AAWNV  ++ QQ
Sbjct  80   ARQVPQRLYTLDELKLNGIEAMSLLSPVDTTLGSIERNLLIAAIVGGFAAWNVFGISQQQ  139

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            I YISLGLLFL T D VSF GG G+L++DTIGH  S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  140  IFYISLGLLFLWTLDLVSFGGGLGSLVVDTIGHKFSQKYHNRVIQHEAGHFLIAYLVGIL  199

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRF  893
            P+GYTL+SL+ + KEGSLN+QAGTAFVDFEFLEEV     S  +++ F
Sbjct  200  PKGYTLSSLDGMMKEGSLNIQAGTAFVDFEFLEEVGCFICSVYLMHYF  247


 Score = 73.9 bits (180),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = +1

Query  163  IMSAACYGGFRHHPRLG---LCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLV  333
            +M   C  G      LG   L   RI C S      R QLL+ VD+EL+KGD+RAAL+LV
Sbjct  6    LMHGVCVVGVGLPSSLGQPKLARVRIQC-STKVSSSRQQLLESVDKELTKGDDRAALALV  64

Query  334  KDLQGKPGGLRCFGAARQV  390
            KDLQGKP GL+CFGAARQV
Sbjct  65   KDLQGKPNGLQCFGAARQV  83



>gb|KEH24535.1| stress regulated protein [Medicago truncatula]
Length=252

 Score =   228 bits (582),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A Q+PQ+LY+L+EL+LNGIE +SLLSPVD TLGSIERNL IAA+ GG AAWNV  ++ QQ
Sbjct  80   ARQVPQRLYTLDELKLNGIEAMSLLSPVDTTLGSIERNLLIAAIVGGFAAWNVFGISQQQ  139

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            I YISLGLLFL T D VSF GG G+L++DTIGH  S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  140  IFYISLGLLFLWTLDLVSFGGGLGSLVVDTIGHKFSQKYHNRVIQHEAGHFLIAYLVGIL  199

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRF  893
            P+GYTL+SL+ + KEGSLN+QAGTAFVDFEFLEEV     S  +++ F
Sbjct  200  PKGYTLSSLDGMMKEGSLNIQAGTAFVDFEFLEEVGCFICSVYLMHYF  247


 Score = 74.3 bits (181),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = +1

Query  163  IMSAACYGGFRHHPRLG---LCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLV  333
            +M   C  G      LG   L   RI C S      R QLL+ VD+EL+KGD+RAAL+LV
Sbjct  6    LMHGVCVVGVGLPSSLGQPKLARVRIQC-STKVSSSRQQLLESVDKELTKGDDRAALALV  64

Query  334  KDLQGKPGGLRCFGAARQV  390
            KDLQGKP GL+CFGAARQV
Sbjct  65   KDLQGKPNGLQCFGAARQV  83



>gb|KEH24533.1| stress regulated protein [Medicago truncatula]
Length=261

 Score =   228 bits (581),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A Q+PQ+LY+L+EL+LNGIE +SLLSPVD TLGSIERNL IAA+ GG AAWNV  ++ QQ
Sbjct  80   ARQVPQRLYTLDELKLNGIEAMSLLSPVDTTLGSIERNLLIAAIVGGFAAWNVFGISQQQ  139

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            I YISLGLLFL T D VSF GG G+L++DTIGH  S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  140  IFYISLGLLFLWTLDLVSFGGGLGSLVVDTIGHKFSQKYHNRVIQHEAGHFLIAYLVGIL  199

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRF  893
            P+GYTL+SL+ + KEGSLN+QAGTAFVDFEFLEEV     S  +++ F
Sbjct  200  PKGYTLSSLDGMMKEGSLNIQAGTAFVDFEFLEEVGCFICSVYLMHYF  247


 Score = 74.3 bits (181),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = +1

Query  163  IMSAACYGGFRHHPRLG---LCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLV  333
            +M   C  G      LG   L   RI C S      R QLL+ VD+EL+KGD+RAAL+LV
Sbjct  6    LMHGVCVVGVGLPSSLGQPKLARVRIQC-STKVSSSRQQLLESVDKELTKGDDRAALALV  64

Query  334  KDLQGKPGGLRCFGAARQV  390
            KDLQGKP GL+CFGAARQV
Sbjct  65   KDLQGKPNGLQCFGAARQV  83



>ref|XP_005845454.1| hypothetical protein CHLNCDRAFT_25833, partial [Chlorella variabilis]
 gb|EFN53352.1| hypothetical protein CHLNCDRAFT_25833, partial [Chlorella variabilis]
Length=260

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 166/246 (67%), Gaps = 0/246 (0%)
 Frame = +3

Query  396   QIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQIl  575
             Q P++ Y+L ELRLN I+    L+P D+TL  +   +Q   L+G  AA+    L+  QI+
Sbjct  1     QTPKRTYTLAELRLNKIQPEEFLAPTDSTLSGVRNVVQGGFLAGLTAAYFTQLLDLTQIV  60

Query  576   yislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPR  755
              + +   FLLT D V+  GGF AL++D+ G  ++  Y  RV  HEAGHFL+AYLLG+LPR
Sbjct  61    QVVVATGFLLTVDQVANGGGFEALLVDSAGRVVNGTYGRRVALHEAGHFLVAYLLGLLPR  120

Query  756   GYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLL  935
             GYTL+SL+   K+  LNVQAG  F D  F  EV  G++S++ L+ ++C+ALAGVATE+L 
Sbjct  121   GYTLSSLDLFLKKRQLNVQAGCQFCDSAFQAEVATGRLSSSSLDTYACVALAGVATEWLR  180

Query  936   FGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEG  1115
             FG AEGGL D+ QLD LLQ+L FTQ KADSQVRWAVLN + +LRRHE     LA  M  G
Sbjct  181   FGRAEGGLEDVRQLDRLLQALRFTQAKADSQVRWAVLNVVTLLRRHERVHDALAAAMQRG  240

Query  1116  RSVGFC  1133
              SVG C
Sbjct  241   GSVGEC  246



>ref|XP_003058284.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58235.1| predicted protein [Micromonas pusilla CCMP1545]
Length=312

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 170/247 (69%), Gaps = 4/247 (2%)
 Frame = +3

Query  399   IPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQ--QI  572
             +P++ Y+L EL+LNGIE   LLSP ++T+ ++ R+    AL+  V  W +   +P    +
Sbjct  56    VPRRDYALSELKLNGIEAERLLSPTESTISNL-RDAVSKALALVVGGW-IFAAHPSGSTL  113

Query  573   lyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILP  752
                +      L  D + F GG  AL+LDT+  T S +Y  R+  HEA HFL+AYL+GILP
Sbjct  114   AAAASVAAGALVVDQIGFGGGVEALVLDTLAQTTSTEYKARLRIHEAAHFLVAYLMGILP  173

Query  753   RGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYL  932
             +GYTL+SL+A +K G+LNVQAG AF D  F  EV +G++ +  L RFSC+ALAG++ EY+
Sbjct  174   KGYTLSSLDAYEKYGALNVQAGCAFCDGAFQREVARGKIGSGSLGRFSCVALAGISMEYI  233

Query  933   LFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSE  1112
              FG +EGG++D+ QLD +L++L FTQKK+DS+VRWAVLNTI +LRRHE    KL+E M+ 
Sbjct  234   AFGFSEGGVSDVRQLDGMLRALAFTQKKSDSEVRWAVLNTITLLRRHEACVRKLSEKMAA  293

Query  1113  GRSVGFC  1133
             G SVG C
Sbjct  294   GASVGEC  300



>gb|ABK26568.1| unknown [Picea sitchensis]
Length=311

 Score =   227 bits (579),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/248 (53%), Positives = 153/248 (62%), Gaps = 49/248 (20%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A Q+PQ++YSLE+LRLN I+T  LLSPVD TLG + RNLQIAA+ GGVA WN L LN  +
Sbjct  99    ARQVPQKIYSLEDLRLNKIDTTCLLSPVDTTLGGVRRNLQIAAVVGGVATWNTLGLNQSE  158

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
             +L I L  L L T D V   GG  ALI+DTIG  LS+KY +RV Q               
Sbjct  159   LLAILLAFLTLGTLDQVVNGGGVEALIVDTIGRFLSKKYRDRVAQ---------------  203

Query  750   PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEY  929
                                               V  G++S+  L+ +SCIALAGVA EY
Sbjct  204   ----------------------------------VKSGKLSSGTLSNYSCIALAGVAAEY  229

Query  930   LLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMS  1109
             LLFG AEGGLADI QLD LL+SLGFTQKKADSQ+RWAVLNTI +LRRHE AR+KLAE M 
Sbjct  230   LLFGLAEGGLADIQQLDNLLKSLGFTQKKADSQIRWAVLNTITLLRRHEQARSKLAEAMD  289

Query  1110  EGRSVGFC  1133
               +SVG C
Sbjct  290   FSKSVGDC  297


 Score = 61.2 bits (147),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 4/60 (7%)
 Frame = +1

Query  223  SRIVCLSESGGGV----RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            SRI+ L    GGV    R + L+++D EL +G+ER A S++  LQGKPGGLR FGAARQV
Sbjct  43   SRIIVLCVLNGGVDTSGRKEALRKLDLELERGNEREAFSIITSLQGKPGGLRGFGAARQV  102



>gb|AFK42903.1| unknown [Medicago truncatula]
Length=261

 Score =   209 bits (532),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A Q+PQ+LY+L+EL+LNGIE + LLSPVD TLGSIERNL IAA+ GG AAWNV  ++ QQ
Sbjct  80   ARQVPQRLYTLDELKLNGIEAMPLLSPVDTTLGSIERNLLIAAIVGGFAAWNVFGISQQQ  139

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            I YISLGLLFL T D VSF GG G+L++DTIGH  S+KYHNRVIQHEAGHFLIAYL+GIL
Sbjct  140  IFYISLGLLFLWTLDLVSFGGGLGSLVVDTIGHKFSQKYHNRVIQHEAGHFLIAYLVGIL  199

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRF  893
            P+GYTL+SL+ + K G     + TAFVDFEFLEEV     S  +++ F
Sbjct  200  PKGYTLSSLDGMMKGGFSQYSSSTAFVDFEFLEEVGCFICSVYLMHYF  247


 Score = 74.3 bits (181),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = +1

Query  163  IMSAACYGGFRHHPRLG---LCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLV  333
            +M   C  G      LG   L   RI C S      R QLL+ VD+EL+KGD+RAAL+LV
Sbjct  6    LMHGVCVVGVGLPSSLGQPKLARVRIQC-STKVSSSRQQLLESVDKELTKGDDRAALALV  64

Query  334  KDLQGKPGGLRCFGAARQV  390
            KDLQGKP GL+CFGAARQV
Sbjct  65   KDLQGKPNGLQCFGAARQV  83



>emb|CEF98632.1| unnamed product, partial [Ostreococcus tauri]
Length=238

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 156/226 (69%), Gaps = 6/226 (3%)
 Frame = +3

Query  465   SPVDATLGSIERN---LQIAALSGGVAAWNVLNLNPQQIlyislgllfllTFDSVSFNGG  635
             +P ++T+  I  N   L +AA  GGV A   L+    Q   ++    F   +D V+F GG
Sbjct  2     APTESTIKGIRDNFTRLLVAAYVGGVVA---LHPTFAQGAGVAAFATFCSVYDQVAFAGG  58

Query  636   FGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQA  815
               AL LDT+  + S++Y  R+ +HEA HFL AYL+GILP+GYTL+SL+A +  G+ N+QA
Sbjct  59    VSALALDTVAQSTSKEYVTRLRRHEAAHFLTAYLIGILPKGYTLSSLDAFRTYGAFNIQA  118

Query  816   GTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQS  995
             G AF D EF EEV KG++S+T L +F+C+A+AG+  EY+LFG AEGGL+D+ QLD LL++
Sbjct  119   GCAFCDGEFQEEVRKGKISSTSLGKFACVAMAGICMEYILFGFAEGGLSDVQQLDGLLRA  178

Query  996   LGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             L F+QKK+DS+VRWAVLNT  +LRRH     KLAE M+ G SVG C
Sbjct  179   LAFSQKKSDSEVRWAVLNTTALLRRHVGLTEKLAEIMARGASVGEC  224



>ref|XP_001700231.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO98346.1| predicted protein [Chlamydomonas reinhardtii]
Length=269

 Score =   223 bits (569),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 168/249 (67%), Gaps = 1/249 (0%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
             A  +P++ Y+LEELRLN IE   LLSP D  L ++    ++AA +G VAA   L  +  Q
Sbjct  7     ARAVPKRNYTLEELRLNRIEPEKLLSPKDTQLNAVRDAARLAAGAGLVAAAVGLQWDAGQ  66

Query  570   IlyislgllfllTFDSVSFNGGFGALILDTIGHTL-SEKYHNRVIQHEAGHFLIAYLLGI  746
             +L  + G +  LT D V   GG  AL++DT+G  L  + Y  RV  HEAGH L+AYL+G+
Sbjct  67    VLAAAFGGVAALTVDQVVNGGGGEALLVDTLGRLLRPQTYGARVAAHEAGHLLVAYLVGL  126

Query  747   LPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATE  926
             LPR YTL+SL+A  +  +LN+QAGT F D  F  EV  G++ A+ L+R++C+ALAGV TE
Sbjct  127   LPRAYTLSSLDAFLRYRALNIQAGTRFCDSAFAAEVAGGRLKASSLDRYTCVALAGVVTE  186

Query  927   YLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGM  1106
             YL +G AEGGL D+ QLD + ++LGFTQKKAD++VRWAVLNT  +LRRH    A+LA  M
Sbjct  187   YLQYGVAEGGLGDVRQLDDMFRALGFTQKKADAEVRWAVLNTAELLRRHSRLHAELAAAM  246

Query  1107  SEGRSVGFC  1133
               G SVG C
Sbjct  247   GRGASVGQC  255



>ref|XP_007515014.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15254.1| predicted protein [Bathycoccus prasinos]
Length=460

 Score =   221 bits (563),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/249 (46%), Positives = 164/249 (66%), Gaps = 5/249 (2%)
 Frame = +3

Query  396   QIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAA-----LSGGVAAWNVLNLN  560
             Q+P++ Y+L EL+LN I+   LL+P + T+  I++ L +A      +   V +   +   
Sbjct  194   QVPKRSYALAELKLNDIDPSKLLAPTENTITEIKKKLGVAVGALVIVGAIVTSGEDVGAA  253

Query  561   PQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLL  740
             P Q +   + L FLL +D+V+ N G   L+LD + +  SE+Y  R+ +HEAGHFL+AYL 
Sbjct  254   PFQAIKTFVFLSFLLAYDAVALNAGAQNLVLDFVANLTSEEYKTRLRRHEAGHFLVAYLT  313

Query  741   GILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVA  920
             G+LP+GYTL+SL+A K+ G LNVQAGT F D +F  EV +G++++T + RF+C+ALAGV 
Sbjct  314   GVLPKGYTLSSLDAFKRFGRLNVQAGTLFCDGQFQNEVKRGKITSTSVGRFACVALAGVC  373

Query  921   TEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAE  1100
              EY  +G +EGG ADI QLD L  +L F+QKK+D +VRWA LNT+ I+RRHE    +LA 
Sbjct  374   AEYAKYGNSEGGAADIQQLDQLFNALQFSQKKSDDEVRWATLNTMAIVRRHEGLVDELAR  433

Query  1101  GMSEGRSVG  1127
              M  G S  
Sbjct  434   MMGTGESTA  442



>ref|XP_010244612.1| PREDICTED: uncharacterized protein LOC104588403 [Nelumbo nucifera]
Length=329

 Score =   198 bits (504),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 157/247 (64%), Gaps = 35/247 (14%)
 Frame = +3

Query  393   LQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQI  572
             LQ+P+ + +L+EL+L G + + LL  VD  L  ++R+L+IA                   
Sbjct  105   LQVPRSVNTLDELKLIGPDILPLLPLVDPLLELVDRSLKIA-------------------  145

Query  573   lyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILP  752
                        T +S+SFN    + ILDT   +L E+ H   +QHEAGHFLIAYLLGILP
Sbjct  146   -----------TLESISFNE-LESSILDT--DSLCEEKHLMCMQHEAGHFLIAYLLGILP  191

Query  753   RGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYL  932
             RGY + S+EA  K+    +     FV FEFL+EVN+G  S+  LNRFSCI LAG+ +EYL
Sbjct  192   RGYAVPSIEAFWKDKF--IVGKVEFVGFEFLKEVNRGNFSSKNLNRFSCITLAGLVSEYL  249

Query  933   LFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSE  1112
             +FG +EG  +DI +L+ + + LGFT+ +ADSQV+WA+LNT+++L RH  AR+KLAE M  
Sbjct  250   VFGFSEGSYSDIEKLNRIFKCLGFTENEADSQVKWALLNTVILLHRHREARSKLAEAMGL  309

Query  1113  GRSVGFC  1133
             G+SVGFC
Sbjct  310   GKSVGFC  316


 Score = 51.2 bits (121),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +1

Query  193  RHHPRLGLCNSRIVCLS-ESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRC  369
            RH P   +  + IV    +    +R   L+RVD ELS+G+ + ALS+VK LQ KPGGL  
Sbjct  40   RHRPEFQMTRNMIVSTGRKEQLSLRRHGLQRVDRELSRGNFKTALSIVKQLQEKPGGLCG  99

Query  370  FGAAR  384
            FGAA+
Sbjct  100  FGAAK  104



>gb|KFM27635.1| hypothetical protein F751_5599 [Auxenochlorella protothecoides]
Length=331

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/243 (47%), Positives = 156/243 (64%), Gaps = 0/243 (0%)
 Frame = +3

Query  396   QIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQIl  575
             Q+P++ Y+LEE+RLN I+  +LLSPVDAT+  +   LQ  A SG +A      ++     
Sbjct  77    QVPKRPYTLEEVRLNRIDPAALLSPVDATMNGVRTGLQAVAASGLLALLYGGAVDVSGAA  136

Query  576   yislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPR  755
              + L    L   D V   GG  AL+LD     +S  Y +RV  HEAGHFL+AYLLG+LPR
Sbjct  137   VLVLLGATLAVADQVGTGGGVEALLLDLAARKVSGSYASRVATHEAGHFLVAYLLGLLPR  196

Query  756   GYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLL  935
              YTL+S +A + +G L VQAGT F D +F  EV  G++S+  L+ F+C+ LAGV  E ++
Sbjct  197   SYTLSSWDAFQAQGRLGVQAGTEFCDGDFQREVASGKLSSNSLDAFTCLGLAGVCAETVV  256

Query  936   FGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEG  1115
             +G +EGGLADI QLD LL+ + F Q KAD QVRW+ +N +++LRRH  A A L + M  G
Sbjct  257   YGRSEGGLADIAQLDSLLRRINFNQAKADDQVRWSAINDVVLLRRHAAAHAALTKAMQAG  316

Query  1116  RSV  1124
             +SV
Sbjct  317   KSV  319



>gb|EEC70683.1| hypothetical protein OsI_02020 [Oryza sativa Indica Group]
Length=243

 Score =   194 bits (493),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  390  ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQ  569
            A Q+PQ+LY+L+EL+LNGI+T + LSPVD TLGSIERNLQIAA+ GG++      L+  Q
Sbjct  86   ARQVPQRLYTLDELKLNGIDTSAFLSPVDLTLGSIERNLQIAAVLGGLSVSAAFELSKLQ  145

Query  570  IlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGIL  749
            +L++ LGLL L + D V F GG   LILDTIGH LS+KY NRVIQHEAGHFLIAYLLG+L
Sbjct  146  VLFLFLGLLSLWSVDLVYFGGGVRNLILDTIGHNLSQKYRNRVIQHEAGHFLIAYLLGVL  205

Query  750  PRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV  854
            P+GYT+TSL+   K+GSLNVQAGTAFVDFEFL+E+
Sbjct  206  PKGYTITSLDTFIKKGSLNVQAGTAFVDFEFLQEL  240


 Score = 53.1 bits (126),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  271  LLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            +L++VDEEL KG++ AALSLV+  QG  GGLR FGAARQV  R
Sbjct  50   VLEQVDEELRKGNDEAALSLVRGSQGADGGLRFFGAARQVPQR  92



>gb|ACN30548.1| unknown [Zea mays]
 tpg|DAA54597.1| TPA: hypothetical protein ZEAMMB73_027015 [Zea mays]
Length=129

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  792   EGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADIN  971
             +GSLNVQAG AFVD+EFLEE+N G++SATM+N+FSCIALAGVA EYLL+G AEGGLADIN
Sbjct  3     QGSLNVQAGAAFVDYEFLEEINTGKLSATMVNKFSCIALAGVAAEYLLYGRAEGGLADIN  62

Query  972   QLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             +LD LL+ LGFTQKKADSQVRWAVLNT+LILRRHE AR++LAE MS G+SVG C
Sbjct  63    KLDGLLKGLGFTQKKADSQVRWAVLNTVLILRRHEKARSQLAEAMSTGKSVGSC  116



>gb|AAW65809.1| stress regulated protein isoform 1 [Solanum virginianum]
 gb|AAW65810.1| stress regulated protein isoform 1 [Solanum virginianum]
Length=175

 Score =   167 bits (424),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  834   FEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQK  1013
             F    +VN G+V+ATMLNRFSCIALAGVATEYLLFG AEGGL+DINQLD LL+SLGFTQK
Sbjct  63    FGAARQVNSGKVTATMLNRFSCIALAGVATEYLLFGYAEGGLSDINQLDALLKSLGFTQK  122

Query  1014  KADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             KADSQVRWAVLNTILILRRHE AR KLAE M+ G+SVG C
Sbjct  123   KADSQVRWAVLNTILILRRHEKARVKLAEAMTRGKSVGVC  162


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 52/73 (71%), Gaps = 8/73 (11%)
 Frame = +1

Query  172  AACYGGFRHHPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQGK  351
            AA  GG     +L   NSRI+    SG  V    L++VD+EL KGDERAALSLVKDL+GK
Sbjct  5    AAYCGGLLCCSQLRSSNSRIL----SGLSV----LEQVDKELMKGDERAALSLVKDLRGK  56

Query  352  PGGLRCFGAARQV  390
            PGGLRCFGAARQV
Sbjct  57   PGGLRCFGAARQV  69



>gb|AAW65808.1| stress regulated protein isoform 2 [Solanum virginianum]
 gb|AAW65811.1| stress regulated protein isoform 2 [Solanum virginianum]
Length=248

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  843   LEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKAD  1022
             L+ VN G+V+ATMLNRFSCIALAGVATEYLLFG AEGGL+DINQLD LL+SLGFTQKKAD
Sbjct  139   LDLVNSGKVTATMLNRFSCIALAGVATEYLLFGYAEGGLSDINQLDALLKSLGFTQKKAD  198

Query  1023  SQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             SQVRWAVLNTILILRRHE AR KLAE M+ G+SVG C
Sbjct  199   SQVRWAVLNTILILRRHEKARVKLAEAMTRGKSVGVC  235


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 55/81 (68%), Gaps = 9/81 (11%)
 Frame = +1

Query  169  SAACY-GGFRHHPRLGLCNSRIVCLSESGGGVRWQLLKRVDEELSKGDERAALSLVKDLQ  345
            S A Y GG     +L   NSRI+    SG  V    L++VD+EL KGDERAALSLVKDL+
Sbjct  3    SIAAYCGGLLCCSQLRSSNSRIL----SGLSV----LEQVDKELMKGDERAALSLVKDLR  54

Query  346  GKPGGLRCFGAARQVLCRYPS  408
            GKPGGLRCFGAARQV  R  S
Sbjct  55   GKPGGLRCFGAARQVPQRLYS  75



>ref|XP_002948462.1| hypothetical protein VOLCADRAFT_103923 [Volvox carteri f. nagariensis]
 gb|EFJ50337.1| hypothetical protein VOLCADRAFT_103923 [Volvox carteri f. nagariensis]
Length=346

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 137/201 (68%), Gaps = 0/201 (0%)
 Frame = +3

Query  396  QIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQIl  575
            Q+P++LYS+EELRLN +ET  LLSP D +L ++    Q+AA  G  AA    + +   +L
Sbjct  145  QVPKRLYSIEELRLNRVETEKLLSPKDTSLNAVRTQAQVAAALGLAAAAWANHWDGGGVL  204

Query  576  yislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPR  755
                G++F+L  D V+  GG  AL++D++G  L   Y  RV  HEAGH L+AYL+G++PR
Sbjct  205  AALFGVVFVLMADQVANGGGGEALLVDSLGRLLRPSYAARVAYHEAGHLLVAYLVGLMPR  264

Query  756  GYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLL  935
             YTL+S++A  +  +LN+QAGT F D EF  EV  G++ ++ L+R++C+ALAGV TEYL 
Sbjct  265  AYTLSSMDAFLRYRALNIQAGTRFCDGEFAAEVATGRLKSSSLDRYTCVALAGVVTEYLR  324

Query  936  FGCAEGGLADINQLDFLLQSL  998
            FG AEGGL D+ QLD + ++L
Sbjct  325  FGVAEGGLGDVQQLDAMFRAL  345



>gb|KDO48519.1| hypothetical protein CISIN_1g019873mg [Citrus sinensis]
Length=311

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 101/267 (38%), Positives = 150/267 (56%), Gaps = 54/267 (20%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIER-NLQIAALSGGVAAWNVLNLNPQ  566
             A Q+P++L SL+E  L+  E ++L +  D+ + SIER NL           ++ L+  P 
Sbjct  67    AKQVPKRLSSLDESELDSKELLTLRALFDSVMESIERCNL-----------FDSLDEAPS  115

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
                          T +S+  +G +          +L E+ H   +QHEAGHFL  YLLG+
Sbjct  116   D------------TVESIVEDGSYV---------SLKEEDHFMCVQHEAGHFLTGYLLGV  154

Query  747   LPRGYTLTSLEALKKEGSLNVQAG-TAFVDFEFLEEV-----------------NKGQVS  872
             LP+GY + S+EALK++   +   G   FV F+FL+EV                 N+G++S
Sbjct  155   LPKGYEIPSVEALKQD---DFTVGRVQFVGFDFLKEVADARKQKKDTGQVGSWGNRGEIS  211

Query  873   ATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNT  1052
                LN FSC+ L G+  E+L+FG +EG  +DIN+LD + Q LG+ + +ADSQV+WA LNT
Sbjct  212   VKTLNNFSCVILGGLVAEHLVFGHSEGHYSDINKLDKVFQWLGYNKSEADSQVKWAALNT  271

Query  1053  ILILRRHENARAKLAEGMSEGRSVGFC  1133
             +LI   H   R++LAE M+ GRS+G C
Sbjct  272   VLISHHHIQVRSRLAEAMALGRSIGSC  298


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKP-GGLRCFGAARQVLCRYPS  408
            R Q LKRVD ELS+G+ + ALSLVK LQ KP GGLR FGAA+QV  R  S
Sbjct  27   RRQALKRVDRELSRGNFKVALSLVKQLQRKPAGGLRGFGAAKQVPKRLSS  76



>ref|XP_006471938.1| PREDICTED: uncharacterized protein LOC102619675 isoform X2 [Citrus 
sinensis]
Length=311

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 150/267 (56%), Gaps = 54/267 (20%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIER-NLQIAALSGGVAAWNVLNLNPQ  566
             A Q+P++L SL+E  L+  E ++L +  D+ + SIER NL           ++ L+  P 
Sbjct  67    AKQVPKRLSSLDESELDSKELLTLRALFDSVMESIERCNL-----------FDSLDEAPS  115

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
                          T +S+  +G +          +L E+ H   +QHEAGHFL  YLLG+
Sbjct  116   D------------TVESIVEDGSYV---------SLKEEDHFMCVQHEAGHFLTGYLLGV  154

Query  747   LPRGYTLTSLEALKKEGSLNVQAG-TAFVDFEFLEEV-----------------NKGQVS  872
             LP+GY + S+EAL+++   +   G   FV F+FL EV                 N+G++S
Sbjct  155   LPKGYEIPSVEALRQD---DFAVGRVQFVGFDFLNEVADARKQKKDTGQVGSWGNRGEIS  211

Query  873   ATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNT  1052
             +  LN FSC+ L G+  E+L+FG +EG  +DIN+LD + Q LG+ + +ADSQV+WA LNT
Sbjct  212   SKTLNNFSCVILGGLVAEHLVFGHSEGHYSDINKLDKVFQWLGYNKSEADSQVKWAALNT  271

Query  1053  ILILRRHENARAKLAEGMSEGRSVGFC  1133
             +LI   H   R++LAE M+ GRS+G C
Sbjct  272   VLISHHHIQVRSRLAEAMALGRSIGSC  298


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKP-GGLRCFGAARQVLCRYPS  408
            R Q LKRVD ELS+G+ + ALSLVK LQ KP GGLR FGAA+QV  R  S
Sbjct  27   RRQALKRVDRELSRGNFKVALSLVKQLQRKPAGGLRGFGAAKQVPKRLSS  76



>ref|XP_006471937.1| PREDICTED: uncharacterized protein LOC102619675 isoform X1 [Citrus 
sinensis]
Length=314

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/270 (37%), Positives = 150/270 (56%), Gaps = 57/270 (21%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIER-NLQIAALSGGVAAWNVLNLNPQ  566
             A Q+P++L SL+E  L+  E ++L +  D+ + SIER NL           ++ L+  P 
Sbjct  67    AKQVPKRLSSLDESELDSKELLTLRALFDSVMESIERCNL-----------FDSLDEAPS  115

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
                          T +S+  +G +          +L E+ H   +QHEAGHFL  YLLG+
Sbjct  116   D------------TVESIVEDGSYV---------SLKEEDHFMCVQHEAGHFLTGYLLGV  154

Query  747   LPRGYTLTSLEALKKEGSLNVQAG-TAFVDFEFLEEV--------------------NKG  863
             LP+GY + S+EAL+++   +   G   FV F+FL EV                    N+G
Sbjct  155   LPKGYEIPSVEALRQD---DFAVGRVQFVGFDFLNEVADARKQKKDTGQVGSWAMQGNRG  211

Query  864   QVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAV  1043
             ++S+  LN FSC+ L G+  E+L+FG +EG  +DIN+LD + Q LG+ + +ADSQV+WA 
Sbjct  212   EISSKTLNNFSCVILGGLVAEHLVFGHSEGHYSDINKLDKVFQWLGYNKSEADSQVKWAA  271

Query  1044  LNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             LNT+LI   H   R++LAE M+ GRS+G C
Sbjct  272   LNTVLISHHHIQVRSRLAEAMALGRSIGSC  301


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKP-GGLRCFGAARQVLCRYPS  408
            R Q LKRVD ELS+G+ + ALSLVK LQ KP GGLR FGAA+QV  R  S
Sbjct  27   RRQALKRVDRELSRGNFKVALSLVKQLQRKPAGGLRGFGAAKQVPKRLSS  76



>gb|KDO48518.1| hypothetical protein CISIN_1g019873mg [Citrus sinensis]
Length=334

 Score =   164 bits (416),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 100/265 (38%), Positives = 149/265 (56%), Gaps = 54/265 (20%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIER-NLQIAALSGGVAAWNVLNLNPQ  566
             A Q+P++L SL+E  L+  E ++L +  D+ + SIER NL           ++ L+  P 
Sbjct  67    AKQVPKRLSSLDESELDSKELLTLRALFDSVMESIERCNL-----------FDSLDEAPS  115

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
                          T +S+  +G +          +L E+ H   +QHEAGHFL  YLLG+
Sbjct  116   D------------TVESIVEDGSYV---------SLKEEDHFMCVQHEAGHFLTGYLLGV  154

Query  747   LPRGYTLTSLEALKKEGSLNVQAG-TAFVDFEFLEEV-----------------NKGQVS  872
             LP+GY + S+EALK++   +   G   FV F+FL+EV                 N+G++S
Sbjct  155   LPKGYEIPSVEALKQD---DFTVGRVQFVGFDFLKEVADARKQKKDTGQVGSWGNRGEIS  211

Query  873   ATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNT  1052
                LN FSC+ L G+  E+L+FG +EG  +DIN+LD + Q LG+ + +ADSQV+WA LNT
Sbjct  212   VKTLNNFSCVILGGLVAEHLVFGHSEGHYSDINKLDKVFQWLGYNKSEADSQVKWAALNT  271

Query  1053  ILILRRHENARAKLAEGMSEGRSVG  1127
             +LI   H   R++LAE M+ GRS+G
Sbjct  272   VLISHHHIQVRSRLAEAMALGRSIG  296


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKP-GGLRCFGAARQVLCRYPS  408
            R Q LKRVD ELS+G+ + ALSLVK LQ KP GGLR FGAA+QV  R  S
Sbjct  27   RRQALKRVDRELSRGNFKVALSLVKQLQRKPAGGLRGFGAAKQVPKRLSS  76



>gb|KDO48517.1| hypothetical protein CISIN_1g019873mg [Citrus sinensis]
Length=332

 Score =   160 bits (404),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 100/265 (38%), Positives = 149/265 (56%), Gaps = 56/265 (21%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIER-NLQIAALSGGVAAWNVLNLNPQ  566
             A Q+P++L SL+E  L+  E ++L +  D+ + SIER NL           ++ L+  P 
Sbjct  67    AKQVPKRLSSLDESELDSKELLTLRALFDSVMESIERCNL-----------FDSLDEAPS  115

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
                          T +S+  +G +          +L E+ H   +QHEAGHFL  YLLG+
Sbjct  116   D------------TVESIVEDGSYV---------SLKEEDHFMCVQHEAGHFLTGYLLGV  154

Query  747   LPRGYTLTSLEALKKEGSLNVQAG-TAFVDFEFLEEV-----------------NKGQVS  872
             LP+GY + S+EALK++   +   G   FV F+FL+EV                 N+G++S
Sbjct  155   LPKGYEIPSVEALKQD---DFTVGRVQFVGFDFLKEVADARKQKKDTGQVGSWGNRGEIS  211

Query  873   ATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNT  1052
                LN FSC+ L G+  E+L+FG +EG  +DIN+LD + Q LG+ + +ADSQV+WA LNT
Sbjct  212   T--LNNFSCVILGGLVAEHLVFGHSEGHYSDINKLDKVFQWLGYNKSEADSQVKWAALNT  269

Query  1053  ILILRRHENARAKLAEGMSEGRSVG  1127
             +LI   H   R++LAE M+ GRS+G
Sbjct  270   VLISHHHIQVRSRLAEAMALGRSIG  294


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKP-GGLRCFGAARQVLCRYPS  408
            R Q LKRVD ELS+G+ + ALSLVK LQ KP GGLR FGAA+QV  R  S
Sbjct  27   RRQALKRVDRELSRGNFKVALSLVKQLQRKPAGGLRGFGAAKQVPKRLSS  76



>ref|XP_010660032.1| PREDICTED: uncharacterized protein LOC100257204 isoform X2 [Vitis 
vinifera]
Length=331

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 107/151 (71%), Gaps = 10/151 (7%)
 Frame = +3

Query  702   QHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAG-TAFVDFEFLEEVNKGQV---  869
             QHEAGHFL+ YLLG+LPRGY + S EAL+++      AG   FV FEFL +V   ++   
Sbjct  172   QHEAGHFLVGYLLGVLPRGYEIPSKEALRQD---RFAAGRVEFVGFEFLRQVRTTEIVEK  228

Query  870   ---SATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWA  1040
                    LNRFSC+ +AG+  EYL+FGC+EG  +D+ QLD +L+ LGF++ +A SQ++WA
Sbjct  229   KFSKGKTLNRFSCVIVAGLIAEYLVFGCSEGLHSDVEQLDEVLKWLGFSEGEAYSQMKWA  288

Query  1041  VLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             VLNT+LIL RH  AR +LA+ M+ G+SVG+C
Sbjct  289   VLNTVLILSRHHEARLRLAKAMALGKSVGYC  319


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            R + LK VD ELSKG+ + A+SLVK L GKPGGLR FGAA+QV  R
Sbjct  67   RRRSLKMVDRELSKGNYKTAVSLVKQLNGKPGGLRGFGAAKQVSHR  112



>ref|XP_010660030.1| PREDICTED: uncharacterized protein LOC100257204 isoform X1 [Vitis 
vinifera]
 ref|XP_010660031.1| PREDICTED: uncharacterized protein LOC100257204 isoform X1 [Vitis 
vinifera]
 emb|CBI34319.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 109/160 (68%), Gaps = 19/160 (12%)
 Frame = +3

Query  702   QHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAG-TAFVDFEFLEEVNKGQV---  869
             QHEAGHFL+ YLLG+LPRGY + S EAL+++      AG   FV FEFL +V   ++   
Sbjct  172   QHEAGHFLVGYLLGVLPRGYEIPSKEALRQD---RFAAGRVEFVGFEFLRQVRTTEIVEK  228

Query  870   ------------SATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQK  1013
                         S+  LNRFSC+ +AG+  EYL+FGC+EG  +D+ QLD +L+ LGF++ 
Sbjct  229   KFSKGKSKKGKISSKTLNRFSCVIVAGLIAEYLVFGCSEGLHSDVEQLDEVLKWLGFSEG  288

Query  1014  KADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             +A SQ++WAVLNT+LIL RH  AR +LA+ M+ G+SVG+C
Sbjct  289   EAYSQMKWAVLNTVLILSRHHEARLRLAKAMALGKSVGYC  328


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            R + LK VD ELSKG+ + A+SLVK L GKPGGLR FGAA+QV  R
Sbjct  67   RRRSLKMVDRELSKGNYKTAVSLVKQLNGKPGGLRGFGAAKQVSHR  112



>ref|XP_002512308.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49760.1| conserved hypothetical protein [Ricinus communis]
Length=287

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 103/157 (66%), Gaps = 4/157 (3%)
 Frame = +3

Query  669   TLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLE  848
             +  E+YHN  +QHEAGHFL+ YLLG LP+ Y   S+E L+ +G+        F+ FEFL 
Sbjct  120   STCEEYHNLCLQHEAGHFLVGYLLGSLPKRYRTPSIEELR-DGNF-AGGNVKFLGFEFLR  177

Query  849   EVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADI--NQLDFLLQSLGFTQKKAD  1022
             E N+G++S+  LN FSCI L G+  E+L FG +EG  +D+   QLD  L+ L  ++ +A+
Sbjct  178   EGNRGKISSKTLNNFSCITLGGLVVEHLAFGHSEGHYSDVVKEQLDSTLKWLELSEDEAN  237

Query  1023  SQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              QVRWA +NTI IL RH  AR KL E M+ G+SVG C
Sbjct  238   FQVRWAAVNTIAILNRHYKARLKLVEAMARGQSVGCC  274


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQV  390
            R + L+RVD ELSKG+ + ALSLV  LQGKP GLR FGAA+QV
Sbjct  31   RRKSLQRVDRELSKGNFKDALSLVNQLQGKPFGLRGFGAAKQV  73



>ref|XP_004157268.1| PREDICTED: uncharacterized LOC101213254 [Cucumis sativus]
Length=319

 Score =   131 bits (330),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/268 (32%), Positives = 136/268 (51%), Gaps = 50/268 (19%)
 Frame = +3

Query  387   GALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQ  566
              A QI ++   L+E  +N ++ +SL   VD+ L S+++ LQI+ L       ++L++   
Sbjct  70    AAKQIIKKRLELDESEVNRMDILSLQPLVDSILDSVQQCLQISLLE------DILSVE--  121

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
                            +S    G   +           E+ H    QHEAGHFL+ YL+G+
Sbjct  122   -------------KLESSMAEGRHSS--------RCEEQEHFICAQHEAGHFLVGYLMGV  160

Query  747   LPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------------------NKGQV  869
             LP+ Y + S++AL++  +   +   +FV FEFL E+                   NKG +
Sbjct  161   LPKAYQVPSIQALRQ--NRFAEGKVSFVGFEFLGEIDSAKILGENADIRSFNNRANKGTI  218

Query  870   SATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLN  1049
             S+  LN+FSC+ L G+  E L+ G ++G LADI +L  +L  LG  + +AD  +RWA  N
Sbjct  219   SSKTLNQFSCVTLGGLVAELLVAGNSDGHLADILKLWSVLTWLGLPKSEADLHLRWAATN  278

Query  1050  TILILRRHENARAKLAEGMSEGRSVGFC  1133
             T  I+ RH   R++LAE M+  + +G C
Sbjct  279   TAFIMSRHCETRSRLAEAMALAKPIGLC  306


 Score = 50.4 bits (119),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVL  393
            R + LK VD  LSK   ++A+SLVK LQGKP GLR FGAA+Q++
Sbjct  32   RRRALKLVDRALSKRQYKSAVSLVKQLQGKPYGLRGFGAAKQII  75



>ref|NP_001185227.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE33134.1| uncharacterized protein AT1G54680 [Arabidopsis thaliana]
Length=217

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 105/155 (68%), Gaps = 10/155 (6%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEE--------  851
             V+QHE+GHFL+ YLLG+LPR Y + +LEA+++  S NV     FV FEFL++        
Sbjct  51    VVQHESGHFLVGYLLGVLPRHYEIPTLEAVRQNVS-NVTGRVEFVGFEFLKQLMKDDVDG  109

Query  852   -VNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQ  1028
              +N+G +S+  LN FSC+ L G+ TE++LFG +EG  +DI +L+ +L+ LGFT+ + ++ 
Sbjct  110   QMNQGNISSKTLNNFSCVILGGMVTEHILFGYSEGLYSDIVKLNDVLRWLGFTESEKEAH  169

Query  1029  VRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             ++WAV NT+ +L  H+ AR  LAE M++ + +  C
Sbjct  170   IKWAVSNTVSLLHSHKEARVSLAETMAKAKPISTC  204



>ref|XP_004135797.1| PREDICTED: uncharacterized protein LOC101213254 [Cucumis sativus]
Length=319

 Score =   131 bits (329),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/268 (32%), Positives = 135/268 (50%), Gaps = 50/268 (19%)
 Frame = +3

Query  387   GALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQ  566
              A QI ++   L+E  +N ++ +SL   VD+ L S+++ LQI+ L        +L++   
Sbjct  70    AAKQIIKKRLELDESEVNRMDILSLQPLVDSILDSVQQCLQISLLE------EILSVE--  121

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
                            +S    G   +           E+ H    QHEAGHFL+ YL+G+
Sbjct  122   -------------KLESSMAEGRHSS--------RCEEQEHFICAQHEAGHFLVGYLMGV  160

Query  747   LPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------------------NKGQV  869
             LP+ Y + S++AL++  +   +   +FV FEFL E+                   NKG +
Sbjct  161   LPKAYQVPSIQALRQ--NRFAEGKVSFVGFEFLGEIDSAKILGENADIRSFNNRANKGTI  218

Query  870   SATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLN  1049
             S+  LN+FSC+ L G+  E L+ G ++G LADI +L  +L  LG  + +AD  +RWA  N
Sbjct  219   SSKTLNQFSCVTLGGLVAELLVAGNSDGHLADILKLWSVLTWLGLPKSEADLHLRWAATN  278

Query  1050  TILILRRHENARAKLAEGMSEGRSVGFC  1133
             T  I+ RH   R++LAE M+  + +G C
Sbjct  279   TTFIMSRHCETRSRLAEAMALAKPIGLC  306


 Score = 50.4 bits (119),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVL  393
            R + LK VD  LSK   ++A+SLVK LQGKP GLR FGAA+Q++
Sbjct  32   RRRALKLVDRALSKRQYKSAVSLVKQLQGKPYGLRGFGAAKQII  75



>ref|NP_001117491.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE33133.1| uncharacterized protein AT1G54680 [Arabidopsis thaliana]
Length=219

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 105/161 (65%), Gaps = 16/161 (10%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------  854
             V+QHE+GHFL+ YLLG+LPR Y + +LEA+++  S NV     FV FEFL++V       
Sbjct  47    VVQHESGHFLVGYLLGVLPRHYEIPTLEAVRQNVS-NVTGRVEFVGFEFLKQVGAANQLM  105

Query  855   --------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQ  1010
                     N+G +S+  LN FSC+ L G+ TE++LFG +EG  +DI +L+ +L+ LGFT+
Sbjct  106   KDDVDGQMNQGNISSKTLNNFSCVILGGMVTEHILFGYSEGLYSDIVKLNDVLRWLGFTE  165

Query  1011  KKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              + ++ ++WAV NT+ +L  H+ AR  LAE M++ + +  C
Sbjct  166   SEKEAHIKWAVSNTVSLLHSHKEARVSLAETMAKAKPISTC  206



>ref|NP_175867.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAD94389.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33132.1| uncharacterized protein AT1G54680 [Arabidopsis thaliana]
Length=223

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 105/161 (65%), Gaps = 16/161 (10%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------  854
             V+QHE+GHFL+ YLLG+LPR Y + +LEA+++  S NV     FV FEFL++V       
Sbjct  51    VVQHESGHFLVGYLLGVLPRHYEIPTLEAVRQNVS-NVTGRVEFVGFEFLKQVGAANQLM  109

Query  855   --------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQ  1010
                     N+G +S+  LN FSC+ L G+ TE++LFG +EG  +DI +L+ +L+ LGFT+
Sbjct  110   KDDVDGQMNQGNISSKTLNNFSCVILGGMVTEHILFGYSEGLYSDIVKLNDVLRWLGFTE  169

Query  1011  KKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              + ++ ++WAV NT+ +L  H+ AR  LAE M++ + +  C
Sbjct  170   SEKEAHIKWAVSNTVSLLHSHKEARVSLAETMAKAKPISTC  210



>ref|XP_008450723.1| PREDICTED: uncharacterized protein LOC103492218 [Cucumis melo]
Length=319

 Score =   129 bits (323),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 132/268 (49%), Gaps = 50/268 (19%)
 Frame = +3

Query  387   GALQIPQQLYSLEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQ  566
              A QI ++   L+E  +NG++ +SL   VD+ L S+++ LQI+ L   ++A       P+
Sbjct  70    AAKQIIKRRLELDESEVNGMDMLSLQPLVDSILDSVQQCLQISFLEEILSAEK-----PE  124

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
                                      ++          E+ H    QHEAGHFL+ YL+G+
Sbjct  125   ------------------------SSMAEGRHSSRCEEQEHFICAQHEAGHFLVGYLMGV  160

Query  747   LPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------------------NKGQV  869
             LP+ Y + S++AL +  +   +   +FV FEFL E+                   NKG +
Sbjct  161   LPKEYQVPSVQALSQ--NRFAEGKVSFVGFEFLGEIDSVKILGQNADIKKFNKRANKGTI  218

Query  870   SATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLN  1049
             S+  LN+FSC+ L G+  E L+ G ++G LADI +L  +L   G  + +AD  +RWA  N
Sbjct  219   SSKTLNQFSCVTLGGLVAELLVAGNSDGHLADILKLWSVLTWFGLPKSEADLHLRWAATN  278

Query  1050  TILILRRHENARAKLAEGMSEGRSVGFC  1133
             T  I+ RH   R +LAE M+  + +G C
Sbjct  279   TAFIMSRHCETRLRLAEAMTLAKPIGLC  306


 Score = 51.2 bits (121),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  262  RWQLLKRVDEELSKGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            R + LK VD  LSK   ++A+SLVK LQGKP GLR FGAA+Q++ R
Sbjct  32   RRRALKLVDRALSKRQYKSAVSLVKQLQGKPYGLRGFGAAKQIIKR  77



>emb|CAN70025.1| hypothetical protein VITISV_030173 [Vitis vinifera]
Length=209

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 101/156 (65%), Gaps = 13/156 (8%)
 Frame = +3

Query  687   HNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAG-TAFVDFEFLEEVNKG  863
             H    QHEAGHFL+ YLLG+LPRGY + S EAL+++      AG   FV FEFL +V   
Sbjct  48    HFLYTQHEAGHFLVGYLLGVLPRGYEIPSKEALRQD---RFAAGRVEFVGFEFLRQVRTT  104

Query  864   QV------SATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADS  1025
             ++          LNRFSC+ +AG+  EYL+FGC+EG  +D+ Q    L     ++ +A S
Sbjct  105   EIVEKKFSKGKTLNRFSCVIVAGLIAEYLVFGCSEGLHSDVEQC---LSGWASSEGEAYS  161

Query  1026  QVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             Q++WAVLNT+LIL RH  AR +LA+ M+ G+SVG+C
Sbjct  162   QMKWAVLNTVLILSRHHEARLRLAKAMALGKSVGYC  197



>gb|AAC64897.1| Contains similarity to TM021B04.11 gi|2191197 from A. thaliana 
BAC gb|AF007271 [Arabidopsis thaliana]
Length=289

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 105/161 (65%), Gaps = 16/161 (10%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------  854
             V+QHE+GHFL+ YLLG+LPR Y + +LEA+++  S NV     FV FEFL++V       
Sbjct  117   VVQHESGHFLVGYLLGVLPRHYEIPTLEAVRQNVS-NVTGRVEFVGFEFLKQVGAANQLM  175

Query  855   --------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQ  1010
                     N+G +S+  LN FSC+ L G+ TE++LFG +EG  +DI +L+ +L+ LGFT+
Sbjct  176   KDDVDGQMNQGNISSKTLNNFSCVILGGMVTEHILFGYSEGLYSDIVKLNDVLRWLGFTE  235

Query  1011  KKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              + ++ ++WAV NT+ +L  H+ AR  LAE M++ + +  C
Sbjct  236   SEKEAHIKWAVSNTVSLLHSHKEARVSLAETMAKAKPISTC  276



>ref|XP_010528840.1| PREDICTED: uncharacterized protein LOC104805845 [Tarenaya hassleriana]
Length=305

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 103/165 (62%), Gaps = 20/165 (12%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------  854
             V+QHE+GHFL+ YLLG+LPR Y +   EAL+   S  V     FV FEFL+EV       
Sbjct  129   VVQHESGHFLVGYLLGVLPRRYEIPKSEALRCNDS-TVTGRVEFVGFEFLKEVGIAKQLM  187

Query  855   ------------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSL  998
                          +G++S+ +LN FSC+ L G+ TE++L G +EG  +D+++L  +L+ L
Sbjct  188   KDDVLCKTYQMETRGKISSKILNSFSCVILGGLVTEHMLLGYSEGLHSDVDKLLSVLRWL  247

Query  999   GFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             GFT+ +A S +RWA  NT  +L  H++AR KLAE M+  +SVG+C
Sbjct  248   GFTETEAKSHIRWAASNTAYLLLSHKDAREKLAEAMAMSKSVGYC  292



>ref|XP_006302622.1| hypothetical protein CARUB_v10020727mg [Capsella rubella]
 gb|EOA35520.1| hypothetical protein CARUB_v10020727mg [Capsella rubella]
Length=295

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 102/167 (61%), Gaps = 22/167 (13%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------  854
             V+QHE+GHFL+ YLLG+LPR Y + +LE +K E  L+V     FV FEFL+EV       
Sbjct  117   VVQHESGHFLVGYLLGVLPRHYEIPTLEDIK-ENVLSVTGRVEFVGFEFLKEVGAANRVM  175

Query  855   --------------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQ  992
                           ++G +S+  LN FSC+ L G+  E+LLFG +EG  +D+ +L+ +LQ
Sbjct  176   KDDMDGRMNLSVSGSQGNISSKTLNNFSCVILGGMVAEHLLFGYSEGYYSDVVKLNDVLQ  235

Query  993   SLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              LGFT+ + ++ ++WA  NT+ +L  H  AR  LAE M++ + +G C
Sbjct  236   WLGFTETEKETHIKWAASNTVSLLHSHSEARVSLAEAMAKAKPIGDC  282



>ref|XP_010511581.1| PREDICTED: uncharacterized protein LOC104787674 isoform X2 [Camelina 
sativa]
Length=292

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 103/165 (62%), Gaps = 20/165 (12%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------  854
             V+QHE+GHFL+ YLLG+LPR Y + +LEA+++  S +V     FV FEFL++V       
Sbjct  119   VVQHESGHFLVGYLLGVLPRHYQVPTLEAVRQNMS-SVTGRVEFVGFEFLKQVGAANQLM  177

Query  855   ------------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSL  998
                          +G +S+  LN FSC+ L G+  E+LLFG +EG  +D+ +L+ +L+ L
Sbjct  178   KDDMDGRMNLSDTQGNISSKTLNNFSCVILGGMVAEHLLFGYSEGFYSDVVKLNDVLRWL  237

Query  999   GFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             GFT+ + +S ++WAV NT+ IL  +  AR  LAE M++ R +G C
Sbjct  238   GFTETEKESHIKWAVSNTVYILHSYREARVALAEAMAKARPIGSC  282



>ref|XP_010511580.1| PREDICTED: uncharacterized protein LOC104787674 isoform X1 [Camelina 
sativa]
Length=294

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 103/167 (62%), Gaps = 22/167 (13%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------  854
             V+QHE+GHFL+ YLLG+LPR Y + +LEA+++  S +V     FV FEFL++V       
Sbjct  119   VVQHESGHFLVGYLLGVLPRHYQVPTLEAVRQNMS-SVTGRVEFVGFEFLKQVGAANQLM  177

Query  855   --------------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQ  992
                            +G +S+  LN FSC+ L G+  E+LLFG +EG  +D+ +L+ +L+
Sbjct  178   KDDMDGRMNLSVSDTQGNISSKTLNNFSCVILGGMVAEHLLFGYSEGFYSDVVKLNDVLR  237

Query  993   SLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              LGFT+ + +S ++WAV NT+ IL  +  AR  LAE M++ R +G C
Sbjct  238   WLGFTETEKESHIKWAVSNTVYILHSYREARVALAEAMAKARPIGSC  284



>ref|XP_004244952.1| PREDICTED: uncharacterized protein LOC101265151 isoform X2 [Solanum 
lycopersicum]
Length=305

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 102/168 (61%), Gaps = 21/168 (13%)
 Frame = +3

Query  687   HNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV----  854
             H   +QHE GHFL+ YL+G+LPR Y + SL+ + ++     Q    F+ FEFL+EV    
Sbjct  132   HQMCLQHEVGHFLVGYLVGVLPRSYEVPSLQDITQDKF--AQGNVQFLGFEFLKEVDINT  189

Query  855   ---------------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLL  989
                            N+ ++S+  LNRF C+ L G+A E+LLFG +E   +D+ +LD +L
Sbjct  190   ISSKRFTHGKLKSKENRAKISSQTLNRFLCVILGGLAAEHLLFGYSELLHSDVQKLDRVL  249

Query  990   QSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             + L + + +ADS VRWA+L T+ +L  H  AR++LAE M+  RS+G+C
Sbjct  250   RWLCYNENEADSLVRWAILTTLSLLSHHHEARSRLAEAMTSRRSIGYC  297



>ref|XP_009774326.1| PREDICTED: uncharacterized protein LOC104224392 [Nicotiana sylvestris]
Length=292

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 103/157 (66%), Gaps = 10/157 (6%)
 Frame = +3

Query  687   HNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV----  854
             H   +QHEAGHFL+ YL+G+LPR Y + S+E + ++     Q    F+ FEFL++V    
Sbjct  130   HQMCLQHEAGHFLVGYLVGVLPRSYQVPSVEDIIQDKF--AQGNVHFLGFEFLKQVDIDT  187

Query  855   ---NK-GQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKAD  1022
                NK  Q+S+  LN+F C+ L G+  E+L+FG +E   +D+ QLD +L+ L F + +AD
Sbjct  188   ISSNKFTQISSRTLNKFLCVILGGLVAEHLVFGYSELLHSDVQQLDRVLRWLCFNENEAD  247

Query  1023  SQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             S VRWAV+ T+ +L +H  AR++LAE M+  RS+G+C
Sbjct  248   SVVRWAVITTLSLLSQHHEARSRLAEAMNSRRSIGYC  284



>ref|XP_010470367.1| PREDICTED: uncharacterized protein LOC104750290 [Camelina sativa]
Length=295

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 102/165 (62%), Gaps = 20/165 (12%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------  854
             V+QHE+GHFL+ YLLG+LPR Y + +LEA+++  S +V     FV FEFL++V       
Sbjct  119   VVQHESGHFLVGYLLGVLPRHYEVPTLEAVRQNVS-SVTGRVEFVGFEFLKQVGAANQLM  177

Query  855   ------------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSL  998
                          +G +S+  LN FSC+ L G+  E+LLFG +EG  +D+ +L+ +L  L
Sbjct  178   KNDMGGRMNLSDTQGNISSKTLNNFSCVILGGMVAEHLLFGYSEGFYSDVVKLNDVLGWL  237

Query  999   GFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             GFT+ + +S ++WAV NT+ IL  +  AR  LAE MS+ + +G C
Sbjct  238   GFTETEKESHIKWAVSNTVSILHSYREARVPLAEAMSKAKPIGSC  282



>ref|XP_006392494.1| hypothetical protein EUTSA_v10023619mg [Eutrema salsugineum]
 gb|ESQ29780.1| hypothetical protein EUTSA_v10023619mg [Eutrema salsugineum]
Length=293

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 102/165 (62%), Gaps = 20/165 (12%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------  854
             V+QHE+GHFL+ YLLG+LPR Y + + EA+K+  S NV     FV FEFL+EV       
Sbjct  117   VVQHESGHFLVGYLLGVLPRRYEIPNFEAIKQNVS-NVTGRVEFVGFEFLKEVGAANQFM  175

Query  855   ------------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSL  998
                         N+G +S+  LN FSC+ L G+ TE++LFG +EG  +D+ +L+ +L+  
Sbjct  176   KGDVGRRINLSSNRGNISSKTLNNFSCVILGGMVTEHILFGYSEGYYSDVVKLNSVLRWR  235

Query  999   GFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             GFT+ + ++ +R A LNTI +L  +  AR  LAE MS+ + +G C
Sbjct  236   GFTEIEKEAHIRCAALNTISLLHSYSEARVSLAEAMSKAKPIGAC  280



>ref|XP_010027216.1| PREDICTED: uncharacterized protein LOC104417682 [Eucalyptus grandis]
 gb|KCW61719.1| hypothetical protein EUGRSUZ_H04432 [Eucalyptus grandis]
Length=315

 Score =   131 bits (329),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 135/271 (50%), Gaps = 58/271 (21%)
 Frame = +3

Query  390   ALQIPQQLYSLEELRLNGIETVSLLSP-VDATLGSIERNLQIAALSGGVAAWNVLNLNPQ  566
             A Q+P++++  ++L+LNG++ +S LSP VD+ L SI+  L  A                 
Sbjct  69    AKQVPKRVWLPDDLKLNGMD-LSYLSPLVDSILDSIQSCLDFA-----------------  110

Query  567   QIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGI  746
                          T DSV+ +G    ++ +     L E+      QHEAGHFL+AYLLG+
Sbjct  111   ------------RTEDSVAGSGRQRVVLEEGNNQPLGEEDIFMCTQHEAGHFLVAYLLGV  158

Query  747   LPRGYTLTSLEALKKEGSLNVQ--AGTA-FVDFEFLEEV-------------------NK  860
             LP+ Y +     LK+  S   Q   GT  FV FEFL EV                   NK
Sbjct  159   LPKEYKV-----LKRGNSSQDQFAGGTVKFVGFEFLREVPDLDTLNESIGSTESSYRVNK  213

Query  861   GQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWA  1040
               +S+   N FSC+ L G+  E L FG +EG  +D+++L+ +++ LG T+      V+WA
Sbjct  214   RCISSKTFNNFSCVILGGLVAELLSFGYSEGLHSDVDKLERVMRWLGLTESAVKPHVKWA  273

Query  1041  VLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              LNT  IL  H   R +LA+ M  G+S+G C
Sbjct  274   SLNTAFILHHHHKTRLQLAKAMGSGKSIGSC  304


 Score = 37.7 bits (86),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  301  KGDERAALSLVKDLQGKPGGLRCFGAARQVLCR  399
            K + R AL++ + LQGKPGGL  FG+A+QV  R
Sbjct  43   KRNYRNALTIARQLQGKPGGLAGFGSAKQVPKR  75



>ref|XP_010324883.1| PREDICTED: uncharacterized protein LOC101265151 isoform X1 [Solanum 
lycopersicum]
Length=310

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 102/173 (59%), Gaps = 26/173 (15%)
 Frame = +3

Query  687   HNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV----  854
             H   +QHE GHFL+ YL+G+LPR Y + SL+ + ++     Q    F+ FEFL+EV    
Sbjct  132   HQMCLQHEVGHFLVGYLVGVLPRSYEVPSLQDITQDKF--AQGNVQFLGFEFLKEVQIVQ  189

Query  855   --------------------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQ  974
                                 N+ ++S+  LNRF C+ L G+A E+LLFG +E   +D+ +
Sbjct  190   VDINTISSKRFTHGKLKSKENRAKISSQTLNRFLCVILGGLAAEHLLFGYSELLHSDVQK  249

Query  975   LDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             LD +L+ L + + +ADS VRWA+L T+ +L  H  AR++LAE M+  RS+G+C
Sbjct  250   LDRVLRWLCYNENEADSLVRWAILTTLSLLSHHHEARSRLAEAMTSRRSIGYC  302



>ref|XP_009611003.1| PREDICTED: uncharacterized protein LOC104104575 [Nicotiana tomentosiformis]
Length=308

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 102/168 (61%), Gaps = 21/168 (13%)
 Frame = +3

Query  687   HNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVN---  857
             H   +QHEAGHFL+ Y +G+LPR Y + S+E + ++     Q    F+ FEFL++V+   
Sbjct  135   HQMCLQHEAGHFLVGYFVGVLPRSYQVPSVEDIIQDKF--AQGNVQFLGFEFLKQVDIDT  192

Query  858   ----------------KGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLL  989
                             + ++S+  LN+F C+ L G+A EYL+FG +E   +D+ QLD +L
Sbjct  193   ISSNKFTQGKLKSKEIRAKISSRTLNKFLCVILGGLAAEYLVFGYSELLHSDVQQLDRVL  252

Query  990   QSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             + L F + +ADS VRWAV+ T+ +L  H  AR++LAE M+  RS+G+C
Sbjct  253   RWLCFNENEADSVVRWAVITTLSLLSHHHEARSRLAEAMNSRRSIGYC  300



>ref|XP_006355264.1| PREDICTED: uncharacterized protein LOC102583329 isoform X1 [Solanum 
tuberosum]
 ref|XP_006355265.1| PREDICTED: uncharacterized protein LOC102583329 isoform X2 [Solanum 
tuberosum]
Length=308

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 101/168 (60%), Gaps = 21/168 (13%)
 Frame = +3

Query  687   HNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV----  854
             H   +QHE GHFL+ YL+G+LPR Y + SL+ + ++     Q    F+ FEFL+EV    
Sbjct  135   HQMCLQHEVGHFLVGYLVGVLPRSYEVPSLQDITQDKF--AQGNVQFLGFEFLKEVDINT  192

Query  855   ---------------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLL  989
                            N+ ++S+  LNRF C+ L G+A E+L+FG +E   +D+ +LD +L
Sbjct  193   ISSKRCTQGKLKSKENRAKISSQTLNRFLCVILGGLAAEHLVFGYSELLHSDVQKLDRVL  252

Query  990   QSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             + L + + +ADS VRWA+L T+ +L  H  AR++LAE M   RS+G+C
Sbjct  253   RWLCYNENEADSLVRWAILTTLSLLSHHHEARSRLAEAMISRRSIGYC  300



>ref|XP_002891907.1| hypothetical protein ARALYDRAFT_314862 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68166.1| hypothetical protein ARALYDRAFT_314862 [Arabidopsis lyrata subsp. 
lyrata]
Length=294

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 102/165 (62%), Gaps = 20/165 (12%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------  854
             V+QHE+GHFL+ YLLG+LPR Y + +LEA+++  S +V     FV FEFL++V       
Sbjct  118   VVQHESGHFLVGYLLGVLPRYYEIPTLEAVRQNVS-SVTGRVEFVGFEFLKQVGAANQLM  176

Query  855   ------------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSL  998
                          +G +S+  LN FSC+ L G+  E+LLFG +EG  +D+ +L  +L+ L
Sbjct  177   KDDRDSRMNLSDTQGNISSKTLNNFSCVILGGMVAEHLLFGYSEGFYSDVVKLIDVLRWL  236

Query  999   GFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             GFT+ + ++ +RWAV NT+ +L  H  AR  LAE +++ + +G C
Sbjct  237   GFTETEKEAHIRWAVSNTVSLLHSHSEARVSLAEAIAKAKPIGAC  281



>emb|CDY48378.1| BnaAnng09650D [Brassica napus]
Length=286

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 100/161 (62%), Gaps = 19/161 (12%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------  854
             V+QHE+GHFL+ YLLG+LPR Y + +LEA++     NV     FV FEFL++V       
Sbjct  117   VVQHESGHFLVGYLLGVLPRRYEIPNLEAMRD----NVTGRVEFVGFEFLKQVGAANQFM  172

Query  855   --------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQ  1010
                     ++G +S+  LN FSC+ L G+ TE++LFG +EG  +D+ +L+ +LQ  GFT+
Sbjct  173   KDDVDLSVSQGYISSKTLNNFSCVILGGMVTEHMLFGYSEGFYSDVVKLNNVLQWRGFTE  232

Query  1011  KKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              +  + +RWA  NT+ +L  +  AR  LA+ M++ + +G C
Sbjct  233   MEKAAHIRWAASNTVSLLHSYNEARVSLAKAMAKAKPIGAC  273



>ref|XP_009119456.1| PREDICTED: uncharacterized protein LOC103844420 isoform X1 [Brassica 
rapa]
Length=286

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 100/161 (62%), Gaps = 19/161 (12%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV-------  854
             V+QHE+GHFL+ YLLG+LPR Y + +LEA++     NV     FV FEFL++V       
Sbjct  117   VVQHESGHFLVGYLLGVLPRRYEIPNLEAMRD----NVTGRVEFVGFEFLKQVGAANQFM  172

Query  855   --------NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQ  1010
                     ++G +S+  LN FSC+ L G+ TE++LFG +EG  +D+ +L+ +LQ  GFT+
Sbjct  173   KDDVDLSVSQGYISSKTLNNFSCVILGGMVTEHMLFGYSEGFYSDVVKLNNVLQWRGFTE  232

Query  1011  KKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              +  + +RWA  NT+ +L  +  AR  LA+ M++ + +G C
Sbjct  233   MEKAAHIRWAASNTVSLLHSYNEARVSLAKAMAKAKPIGAC  273



>emb|CDY17552.1| BnaC01g26760D [Brassica napus]
Length=286

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 99/161 (61%), Gaps = 19/161 (12%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVN------  857
             V+QHE+GHFL+ YLLG+LPR Y + +LEA++     NV     FV FEFL++V       
Sbjct  117   VVQHESGHFLVGYLLGVLPRRYEIPNLEAMRD----NVTGRVEFVGFEFLKQVGAANQFM  172

Query  858   ---------KGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQ  1010
                      +G +S+  LN FSC+ L G+ TE++LFG +EG  +D+ +L+ +LQ  GFT+
Sbjct  173   KDDVDLSVCQGYISSKTLNNFSCVILGGMVTEHMLFGYSEGFYSDVVKLNNVLQWRGFTE  232

Query  1011  KKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              +  + +RWA  NT+ +L  +  AR  LA+ M++ + +G C
Sbjct  233   MEKAAHIRWAASNTVSLLHSYNEARVSLAKAMAKAKPIGAC  273



>emb|CDY57559.1| BnaCnng32110D [Brassica napus]
Length=286

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 99/161 (61%), Gaps = 19/161 (12%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVN------  857
             V+QHE+GHFL+ YLLG+LPR Y + +LEA++     NV     FV FEFL++V       
Sbjct  117   VVQHESGHFLVGYLLGVLPRRYEIPNLEAMRD----NVTGRVEFVGFEFLKQVGAANQFM  172

Query  858   ---------KGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQ  1010
                      +G +S+  LN FSC+ L G+ TE++LFG +EG  +D+ +L+ +LQ  GFT+
Sbjct  173   KDDVDLSVCQGYISSKTLNNFSCVILGGMVTEHMLFGYSEGFYSDVVKLNNVLQWRGFTE  232

Query  1011  KKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              +  + +RWA  NT+ +L  +  AR  LA+ M++ + +G C
Sbjct  233   MEKAAHIRWAASNTVSLLHSYNEARVSLAKAMAKAKPIGAC  273



>emb|CDP15827.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 109/194 (56%), Gaps = 51/194 (26%)
 Frame = +3

Query  696   VIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTA-FVDFEFLEEVNK----  860
              +QHEAGHF++ YLLGILP+ Y + S+E L+K+   N+  G   F+ FEFL+EV+     
Sbjct  37    CLQHEAGHFVVGYLLGILPKKYRVPSMEELEKD---NLAGGKVEFLGFEFLQEVSNTTLP  93

Query  861   ---------------GQVSATM----------------------------LNRFSCIALA  911
                            G VS+ +                            LNRF C+ L 
Sbjct  94    ETYFTNRKHNSKEYDGIVSSKVSYASSGSPRLLLDLVSIWTVTDILLYQTLNRFLCVILG  153

Query  912   GVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAK  1091
             G+A E L+FG +E   +D++QLD +++ LG++   A+SQ++WA +NT+LILRRH  A ++
Sbjct  154   GLAAELLMFGYSELLHSDVDQLDRVMKCLGYSTDMANSQIKWAAINTLLILRRHHKATSR  213

Query  1092  LAEGMSEGRSVGFC  1133
             +AE M+ GRS+GFC
Sbjct  214   VAEAMALGRSIGFC  227



>ref|XP_003080222.1| ATP-dependent Zn proteases-like protein (ISS) [Ostreococcus tauri]
Length=137

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  846   EEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADS  1025
             EEV KG++S+T L +F+C+A+AG+  EY+LFG AEGGL+D+ QLD LL++L F+QKK+DS
Sbjct  28    EEVRKGKISSTSLGKFACVAMAGICMEYILFGFAEGGLSDVQQLDGLLRALAFSQKKSDS  87

Query  1026  QVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             +VRWAVLNT  +LRRH     KLAE M+ G SVG C
Sbjct  88    EVRWAVLNTTALLRRHVGLTEKLAEIMARGASVGEC  123



>ref|WP_039738878.1| ATP-dependent Zn protease [Hassallia byssoidea]
 gb|KIF36664.1| ATP-dependent Zn protease [Hassallia byssoidea VB512170]
Length=231

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 116/196 (59%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             ++NL+P      +  +L + T DS S  G  G+L+LD I    S ++ +R++ HEAGHFL
Sbjct  25    LVNLSPAVPAIATFAVLGIATLDSFSLQGKGGSLLLDWIA-GFSPEHRDRIVHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
              AYLLGI   GYTLT+ EALK+      Q G AF D E   ++ +G+++A ML+R+  + 
Sbjct  84    TAYLLGIPISGYTLTAWEALKQ--GQPGQGGVAFDDAELASQLEQGKITAQMLDRYCTVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L+F  AEGG  D ++L  +L SLGF+    D + R+ +L    +L+ + ++ 
Sbjct  142   MAGIAAEALVFDNAEGGSDDKSKLAGVLTSLGFSASAYDQKQRFCLLQAKNLLQENWSSY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L + M +  SV  C
Sbjct  202   QALVDAMRKRASVKEC  217



>ref|WP_029632698.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=230

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 116/198 (59%), Gaps = 7/198 (4%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             ++NL+P      +  +L + T DS S  G   +L+LD I    S ++ +R++ HEAGHFL
Sbjct  25    LVNLSPAVPAIATFAILGIATLDSFSLQGKGSSLLLDWIA-GFSPEHRDRIVHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALK--KEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSC  899
              AYLLGI   GYTLT+ EALK  + G    Q G AF D E   ++ +G+++A ML+R+  
Sbjct  84    TAYLLGIPVSGYTLTAWEALKLGQPG----QGGVAFDDAELALQLEQGKITAQMLDRYCT  139

Query  900   IALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHEN  1079
             + +AG+A E L+F   EGG  D N+L  +L+SLGF+    D + R+ +L    +L+ + +
Sbjct  140   VWMAGIAAEALVFDNTEGGSDDKNKLAGVLKSLGFSASTYDQKQRFCLLQAKNLLQENWS  199

Query  1080  ARAKLAEGMSEGRSVGFC  1133
             +   L E M +  SV  C
Sbjct  200   SYKALVEAMRQRASVKDC  217



>ref|WP_016866588.1| hypothetical protein [Fischerella muscicola]
Length=225

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 113/197 (57%), Gaps = 3/197 (2%)
 Frame = +3

Query  543   NVLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHF  722
             ++ NL+P      +  +L + TFDS    G  G + LD I    S K+  R+I HEAGHF
Sbjct  24    SMFNLSPTLPALATFTILGIATFDSFGLQGKGGTIFLDWIAG-FSPKHRERIIHHEAGHF  82

Query  723   LIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCI  902
             L+AYLLGI   GYTL++ EA K++     Q G +F D E   ++ +G +SA ML+R+  +
Sbjct  83    LVAYLLGIPVIGYTLSAWEAWKQKQP--GQGGVSFDDAELASQLEQGTLSAQMLDRYCTV  140

Query  903   ALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENA  1082
              +AG+  E L++  AEGG  D ++L  +L+SLGF+    + + R+ VL    +L+ + +A
Sbjct  141   WMAGITAETLVYENAEGGADDKSKLAGVLRSLGFSVSACEQKQRFCVLQAKTLLQENWSA  200

Query  1083  RAKLAEGMSEGRSVGFC  1133
                L + M +  +V  C
Sbjct  201   YQALVDAMRQKATVAEC  217



>ref|WP_010996570.1| hypothetical protein [Nostoc sp. PCC 7120]
 ref|NP_486454.1| hypothetical protein alr2414 [Nostoc sp. PCC 7120]
 dbj|BAB74113.1| alr2414 [Nostoc sp. PCC 7120]
Length=228

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 114/196 (58%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             ++NL+P      +  +L + TFDS S  G  G ++LD I    S ++ +R+I HEAGHFL
Sbjct  25    LINLSPAIPAIATFTILGIATFDSFSLQGKGGTILLDWIA-GFSPQHRDRIIHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +AYLLG+   GYTL++ EA ++   L  Q G  F D E + +V +G++S  +L R+  I 
Sbjct  84    VAYLLGVPVTGYTLSAWEAWRQ--GLPGQGGVTFDDVELMSQVQQGKISNQVLERYCTIC  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L+F  AEGG+ D ++L  + + LGF++     + R+ VL    +L+ +  + 
Sbjct  142   MAGIAAETLVFERAEGGIDDKSKLATIFKVLGFSESVCQQKQRFHVLQAKTLLQNNWASY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L + + +  ++  C
Sbjct  202   EALVQAIRQKSAIADC  217



>ref|WP_017309004.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=231

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 113/197 (57%), Gaps = 3/197 (2%)
 Frame = +3

Query  543   NVLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHF  722
             ++ NL+P      +  +L + TFDS S  G  G + LD +    S ++  R+I HEAGHF
Sbjct  24    SMFNLSPTIPALATFTILGIATFDSFSLQGKGGTIFLDWVA-AFSPEHRERIIHHEAGHF  82

Query  723   LIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCI  902
             L+AYLLGI   GYTL++ EA K++     Q G +F D E   ++ +G +SA M++R+  +
Sbjct  83    LVAYLLGIPVIGYTLSAWEAWKQKQP--GQGGVSFDDAELASQLERGSLSAQMVDRYCTV  140

Query  903   ALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENA  1082
              +AG+  E L++  AEGG  D ++L  +L+SLGF+      + R+ VL    +L+ + +A
Sbjct  141   WMAGITAETLVYENAEGGADDKSKLAGVLKSLGFSASACQQKQRFCVLQAKTLLQENWSA  200

Query  1083  RAKLAEGMSEGRSVGFC  1133
                L + M +  +V  C
Sbjct  201   YQALVDAMRQKATVSEC  217



>ref|WP_016862568.1| hypothetical protein [Fischerella muscicola]
Length=225

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 113/197 (57%), Gaps = 3/197 (2%)
 Frame = +3

Query  543   NVLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHF  722
             ++ NL+P      +  +L + TFDS S  G  G + LD +    S ++  R+I HEAGHF
Sbjct  24    SMFNLSPTIPALATFTILGIATFDSFSLQGKGGTIFLDWVA-AFSPEHRERIIHHEAGHF  82

Query  723   LIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCI  902
             L+AYLLGI   GYTL++ EA K++     Q G +F D E   ++ +G +SA M++R+  +
Sbjct  83    LVAYLLGIPIIGYTLSAWEAWKQKQP--GQGGVSFDDAELASQLERGSLSAQMVDRYCTV  140

Query  903   ALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENA  1082
              +AG+  E L++  AEGG  D ++L  +L+SLGF+    + + R+  L    +L+ + +A
Sbjct  141   WMAGITAETLVYENAEGGADDKSKLAGVLKSLGFSASACEQKQRFCALQAKTLLQENWSA  200

Query  1083  RAKLAEGMSEGRSVGFC  1133
                L + M +  +V  C
Sbjct  201   YQALVDAMRQKATVAEC  217



>ref|WP_015138693.1| hypothetical protein [Nostoc sp. PCC 7524]
 ref|YP_007075848.1| hypothetical protein Nos7524_2409 [Nostoc sp. PCC 7524]
 gb|AFY48251.1| hypothetical protein Nos7524_2409 [Nostoc sp. PCC 7524]
Length=230

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 115/196 (59%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             ++NL+P      +  +L + TFDS S  G  G ++LD I    S ++ +R+I HEAGHFL
Sbjct  25    LINLSPTVPAVATFTILGIATFDSFSLQGKGGTIVLDWIA-GFSPQHRDRIIHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +A+LLGI   GYTL++ EA K+      Q G +F D E   ++ +G++S  ML R+  + 
Sbjct  84    VAHLLGIPVTGYTLSAWEAWKQ--GQPGQGGVSFDDEELASQLQQGKLSTQMLERYCTVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L+F  AEGG  D ++L  +L+++GF++     + R+ VL    +L+ + ++ 
Sbjct  142   MAGIAAENLVFTQAEGGFDDQSKLAAVLKTVGFSESAYQQKQRFHVLQAKTLLQENWSSY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L   M +  ++G C
Sbjct  202   QALVVAMRQRATIGNC  217



>ref|WP_026723708.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=225

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 112/197 (57%), Gaps = 3/197 (2%)
 Frame = +3

Query  543   NVLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHF  722
             ++ NL+P      +  +L + TFDS    G  G + LD +    S ++  R+I HEAGHF
Sbjct  24    SMFNLSPTIPALATFTILGIATFDSFGLQGKGGTIFLDWVAG-FSPEHRERIIHHEAGHF  82

Query  723   LIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCI  902
             L+AYLLGI   GYTL++ EA K++     Q G +F D E   ++ +G +SA M++R+  +
Sbjct  83    LVAYLLGIPVIGYTLSAWEAWKQKQP--GQGGVSFDDTELAAQLERGSLSAQMVDRYCTV  140

Query  903   ALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENA  1082
              +AG+  E L++  AEGG  D ++L  +LQSLGF+    + + R+  L    +L+ + +A
Sbjct  141   WMAGITAETLVYENAEGGADDKSKLAGVLQSLGFSASTCEQKQRFCALQAKTLLQENWSA  200

Query  1083  RAKLAEGMSEGRSVGFC  1133
                L + M +  +V  C
Sbjct  201   YQALVDAMRQKATVSEC  217



>ref|WP_009455405.1| MULTISPECIES: hypothetical protein [Fischerella]
 gb|EHC18058.1| hypothetical protein FJSC11DRAFT_1120 [Fischerella sp. JSC-11]
Length=225

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 112/197 (57%), Gaps = 3/197 (2%)
 Frame = +3

Query  543   NVLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHF  722
             ++ NL+P      +  +L + TFDS    G  G + LD +    S K+  R+I HEAGHF
Sbjct  24    SMFNLSPTVPALATFTILGIATFDSFGLQGKGGTIFLDWVAG-FSPKHRERIIHHEAGHF  82

Query  723   LIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCI  902
             L+AYLLGI   GYTL++ EA K++     Q G +F D E   ++  G+++A ML+R+  +
Sbjct  83    LVAYLLGIPVIGYTLSAWEAWKQKQP--GQGGVSFDDAELASQLEWGKLTAQMLDRYCTV  140

Query  903   ALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENA  1082
              +AG+  E L++  AEGG  D ++L  +L+SLGF+    + + R+  L    +L+ + +A
Sbjct  141   WMAGITAETLVYENAEGGADDKSKLAGVLKSLGFSASACEQKQRFCALQAKTLLQENWSA  200

Query  1083  RAKLAEGMSEGRSVGFC  1133
                L + M +  +V  C
Sbjct  201   YQALVDAMRQKATVAEC  217



>ref|WP_039715373.1| ATP-dependent Zn protease [Scytonema millei]
 gb|KIF17817.1| ATP-dependent Zn protease [Scytonema millei VB511283]
Length=231

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 104/177 (59%), Gaps = 5/177 (3%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T DS SF G  G LILD +  + S ++ +R+++HEAGHFL+A+LL I   GYTL++ EAL
Sbjct  45    TLDSFSFQGKGGNLILDWLA-SFSPQHRDRIVRHEAGHFLVAHLLNIPITGYTLSAWEAL  103

Query  786   K-KEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLA  962
             K K+  L    G +F D E   ++++G ++A ML+R+  + +AG+A E L++   EGG  
Sbjct  104   KQKQPGL---GGVSFEDRELAAQLDRGTLTAQMLDRYCTVWMAGLAAEDLVYSNTEGGAD  160

Query  963   DINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             D  +   +L  LG+T +  + + RWAVL    +L  + +A   L   M +   V  C
Sbjct  161   DRQKFGMILTPLGYTARAVEQKQRWAVLQAKTLLEANWSAYEALVGMMQQRAGVDEC  217



>ref|WP_015152849.1| hypothetical protein [Chroococcidiopsis thermalis]
 ref|YP_007090167.1| hypothetical protein Chro_0752 [Chroococcidiopsis thermalis PCC 
7203]
 gb|AFY86298.1| hypothetical protein Chro_0752 [Chroococcidiopsis thermalis PCC 
7203]
Length=236

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 105/177 (59%), Gaps = 5/177 (3%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T DS SF G  G L+LD +  + S ++ +R+++HEAGHFL+A+LL I   GYTL++ EAL
Sbjct  45    TLDSFSFQGKGGNLVLDWLA-SFSPQHRDRIVRHEAGHFLVAHLLNIPITGYTLSAWEAL  103

Query  786   K-KEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLA  962
             K K+  L    G +F D E   ++++G ++A ML+R+  + +AG+A E L++   EGG  
Sbjct  104   KQKQPGL---GGVSFEDRELAAQLDRGMLTAQMLDRYCTVWMAGLAAEDLVYSNTEGGAD  160

Query  963   DINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             D  +L  +L  LG+T    + + RWAVL    +L+ + +A   L   M +   V  C
Sbjct  161   DRQKLGMVLTPLGYTANAVEQKQRWAVLQARTLLQTNWSAYEALVGMMQQRAGVDEC  217



>ref|WP_027846109.1| hypothetical protein [Mastigocoleus testarum]
Length=222

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 105/176 (60%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             + D+ ++ G  G L+LD+I    S KY  R++ HEAGHFL+A LLG+   GYTL++ EAL
Sbjct  45    SIDNFAWEGKGGNLVLDSIAR-FSPKYRERIVHHEAGHFLVASLLGVAVTGYTLSAWEAL  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             + +  L  Q G +F D E  ++V  G +SA ML+R+  + +AG+A E L++   EGG  D
Sbjct  104   Q-QNQLG-QGGVSFDDEELAQQVEAGHISAQMLDRYCTVLMAGIAAEKLVYDEVEGGADD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              ++L+ +L SLGF+      ++R+  L    +++ + +    L + M + +SV  C
Sbjct  162   KSKLNAILNSLGFSPNNNKQKLRFYTLQAKTLIQDNLSNYQNLVDAMHQRKSVSEC  217



>ref|WP_011317110.1| hypothetical protein [Anabaena variabilis]
 ref|YP_320743.1| hypothetical protein Ava_0222 [Anabaena variabilis ATCC 29413]
 gb|ABA19848.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=231

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 112/196 (57%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             ++NL+P      +  +L + TFDS S  G  G ++LD I    S ++ +R+I HEAGHFL
Sbjct  25    LINLSPAVPAIATFTILGIATFDSFSLQGKGGTILLDWIA-GFSPQHRDRIIHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +AYLLG+   GYTL++ EA + +G    Q G  F D E + +V +G++S   L R+  I 
Sbjct  84    VAYLLGVPVTGYTLSAWEAWR-QGQPG-QGGVTFDDVELVSQVEQGKISNQALERYCTIC  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L+F  AEGG  D ++L  + + LGF++     + R+ VL    +L+ +  + 
Sbjct  142   MAGIAAETLVFERAEGGTDDKSKLATIFKVLGFSESVCQQKQRFHVLQAKTLLQNNWASY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L + + +  ++  C
Sbjct  202   QALVQAIRQKSTIADC  217



>ref|WP_038099010.1| ATP-dependent Zn protease [Tolypothrix bouteillei]
 gb|KIE08236.1| ATP-dependent Zn protease [Tolypothrix bouteillei VB521301]
Length=235

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 104/176 (59%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T DS S  G  G L+LD +  + S ++  R++ HEAGHFL+AYLLGI   GYTL++ EA+
Sbjct  45    TLDSFSLQGQGGNLLLDWMA-SFSPEHRERILHHEAGHFLVAYLLGIPVVGYTLSAWEAI  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K++     Q G +F D E   ++ +G+++A ML+R+    +AG+A E L++   EGG  D
Sbjct  104   KQKQP--GQGGVSFDDGELASQLEQGKITAQMLDRYCTTWMAGIAAETLVYNNTEGGADD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              ++L  +L+SLGF+    + + R+ +L    +L  H  A   L + M +  SV  C
Sbjct  162   KSKLAGVLKSLGFSGSNTNLKQRFCLLQAKTLLEEHWAAYQALVDVMRQRASVAEC  217



>ref|WP_026735371.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=225

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 110/196 (56%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             + NL+P      +  +L + T D+ S  G  G ++LD I    S ++  R+I HEAGHFL
Sbjct  25    LFNLSPTVPALATFTILGIATLDAFSLQGKGGNILLDWIAG-FSPEHRERIIHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +AYLLGI   GYTL++ EA +++     Q G +F D E   ++ KG +SA ML+R+  + 
Sbjct  84    VAYLLGIPVVGYTLSAWEAWRQKQP--GQGGVSFDDEELASQLEKGTLSAQMLDRYCTVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+  E L++  AEGG  D  +L  +L+SLGF+    D + R+  L    +L+ + +  
Sbjct  142   MAGITAETLVYENAEGGADDQTKLAGVLKSLGFSAFACDQKQRFCALQAKTLLQENWSVY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L + M +  +V  C
Sbjct  202   QALVDAMRQRATVAEC  217



>ref|WP_012407348.1| hypothetical protein [Nostoc punctiforme]
 ref|YP_001864266.1| hypothetical protein Npun_F0560 [Nostoc punctiforme PCC 73102]
 gb|ACC79323.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
Length=225

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 110/195 (56%), Gaps = 3/195 (2%)
 Frame = +3

Query  549   LNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLI  728
             LNL+P      +  +L + T DS S  G  G + LD I    S ++ +R++ HEAGHFL+
Sbjct  26    LNLSPAVPALATFAILGIATLDSFSLQGKGGTIFLDWIA-GFSSEHRDRIVHHEAGHFLV  84

Query  729   AYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIAL  908
             AYLLGI   GYTL++ EA K+      Q G +F D E   ++  G++SA ML+R+  + +
Sbjct  85    AYLLGIPVTGYTLSAWEAWKQ--GQPGQGGVSFDDGELASQLEVGKISAQMLDRYCTVWM  142

Query  909   AGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARA  1088
             AG+A E L+F  AEGG  D ++L  +L  LGF++     ++R+  L    +L+ + ++  
Sbjct  143   AGIAAETLVFDNAEGGSDDKSKLIGVLTVLGFSESVYQQKLRFHALQAKTLLQENWSSYE  202

Query  1089  KLAEGMSEGRSVGFC  1133
              L   M +  SV  C
Sbjct  203   ALVNAMRQRASVEDC  217



>ref|WP_017314331.1| hypothetical protein [Mastigocladopsis repens]
Length=229

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 101/176 (57%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             TFD  S  G  G L+LD I    S ++  R+I HEAGHFL+AYLLGI    YTL++ EAL
Sbjct  45    TFDVFSLQGKGGNLLLDWIA-GFSPEHRERIIHHEAGHFLVAYLLGIPVINYTLSAWEAL  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K+      Q G +F D +   ++ +G++SA ML+R+  + +AG+A E L++  +EGG  D
Sbjct  104   KQRQP--GQGGVSFDDGKLASQLEQGRISAQMLDRYCTVWMAGIAAETLVYKNSEGGADD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               +L  +L +LGF+    + + R+  L    +L+ + +A   L   M +  +V  C
Sbjct  162   KTKLSIVLTNLGFSASTCEQKQRFCTLQAKTLLQENWSAYQALVNSMRQRATVAEC  217



>ref|WP_015127389.1| hypothetical protein [Calothrix sp. PCC 7507]
 ref|YP_007064401.1| hypothetical protein Cal7507_1091 [Calothrix sp. PCC 7507]
 gb|AFY31567.1| hypothetical protein Cal7507_1091 [Calothrix sp. PCC 7507]
Length=226

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 106/196 (54%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             + NL+P      +  +L + TFDS    G  G + LD I    S+++ +R+I HEAGHFL
Sbjct  25    LFNLSPTIPALATFTILGIATFDSFRLQGKGGTIFLDWIA-GFSQEHRDRIIHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             IAYL  I   GYTL++ EA K+      Q G  F D +   ++  G++SA ML+R+  I 
Sbjct  84    IAYLFEIPISGYTLSAWEAWKQ--GQPGQGGVTFNDDQLASQLQVGKISAQMLDRYCTIW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L+F   EGG  D N+L  +L +LGF       + R+  L    +L+ +  + 
Sbjct  142   MAGIAAETLVFNNTEGGADDQNKLAGVLTNLGFAASVRQQKQRFYALQAKTLLQENWPSY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L + M +G SV  C
Sbjct  202   EALVKAMRQGASVADC  217



>ref|WP_015120691.1| hypothetical protein [Rivularia sp. PCC 7116]
 ref|YP_007057679.1| hypothetical protein Riv7116_4718 [Rivularia sp. PCC 7116]
 gb|AFY57132.1| hypothetical protein Riv7116_4718 [Rivularia sp. PCC 7116]
Length=230

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 111/197 (56%), Gaps = 5/197 (3%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             ++NL+P      +  +L + TFDS S  G  G L LD I    S +Y  R++ HEAGHFL
Sbjct  25    LINLSPAVPAVATFAILGIATFDSWSLEGRGGTLFLDLISG-FSSEYRERILHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALK-KEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCI  902
             +A++LG+   GYTL++ EA K K+  L   AG  F D E L +  KG ++  +L R+  I
Sbjct  84    VAHVLGVPVTGYTLSAWEAFKQKQKGL---AGVTFGDVELLSQFEKGAITTRILERYYTI  140

Query  903   ALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENA  1082
              +AG+A E L++  A GG  D N+L  +L+SLG +    + + R+++L    +L  + +A
Sbjct  141   WMAGIAAEKLVYDDASGGADDQNKLKGVLKSLGCSDSFCNQKQRFSILQAKTLLENNWSA  200

Query  1083  RAKLAEGMSEGRSVGFC  1133
                L + M +  +V  C
Sbjct  201   YQTLVDTMRKRATVKEC  217



>ref|WP_015207050.1| hypothetical protein [Cylindrospermum stagnale]
 ref|YP_007146474.1| hypothetical protein Cylst_1510 [Cylindrospermum stagnale PCC 
7417]
 gb|AFZ23794.1| hypothetical protein Cylst_1510 [Cylindrospermum stagnale PCC 
7417]
Length=242

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 100/176 (57%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T DS S  G  G + LD I  + S++Y +R++ HEAGHFLIA+LLGI   GYTL++ EA 
Sbjct  45    TLDSFSLQGQGGTIFLDWI-SSFSKEYRDRILHHEAGHFLIAHLLGIPATGYTLSAWEAW  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K+      Q G  F D +   ++  G++   ML+R+  + +AG+A E ++F  AEGG  D
Sbjct  104   KQ--GQPGQGGVTFEDEQLASQLAAGKIGVQMLDRYCTVWMAGIAAETVVFNSAEGGTDD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             + +L  +L +LGFT+     + R+  L    +L  + ++   L + M +  SV  C
Sbjct  162   LGKLKGVLTTLGFTESICQQKQRFYALQAKNLLEENWSSYQALVKAMEQRASVEDC  217



>ref|WP_015196605.1| hypothetical protein [Calothrix parietina]
 ref|YP_007135923.1| hypothetical protein Cal6303_0886 [Calothrix sp. PCC 6303]
 gb|AFY99950.1| hypothetical protein Cal6303_0886 [Calothrix sp. PCC 6303]
Length=230

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 99/176 (56%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T DS +F G    + LD I    S  +  R+I HEAGHFL+A+ L I   GYTLT+ EA+
Sbjct  45    TLDSFTFQGQGSNVFLDWIA-GFSPAHRERIIHHEAGHFLVAHQLEIPISGYTLTAWEAI  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K++     Q G +F D E   ++ KGQ++A ML+R+  + +AG+A E +++  +EGG  D
Sbjct  104   KQKQP--GQGGVSFDDAELTSQLQKGQITAQMLDRYCTVWMAGIAAETIVYNNSEGGADD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              N+L  +L+ LGF++   D + R+  L    +L  +  A   L E M +   V  C
Sbjct  162   RNKLAGVLKGLGFSEATFDHKQRFCALQAKTLLEENWQAYQALVEAMRQRVPVQEC  217



>ref|WP_017739677.1| hypothetical protein [Scytonema hofmanni]
Length=230

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 105/176 (60%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T DS S  G  G L+LD +  + S ++  R++ HEAGHFL+AYLLGI   GYTL++ EA+
Sbjct  45    TLDSFSLQGKGGNLLLDWMA-SFSPEHRERILHHEAGHFLVAYLLGIPVVGYTLSAWEAV  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K++     Q G +F D +   ++ +G+++A ML+R+    +AG+A E L++   EGG  D
Sbjct  104   KQKQP--GQGGVSFDDEKLASQLEQGKITAQMLDRYCTTWMAGIAAETLVYNDTEGGADD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              ++L  +L+S+G +  +   + R+ +L    +L+ H +A   L + M +  SV  C
Sbjct  162   KSKLAGVLKSVGLSPNQYHLKQRFCLLQAKTLLQEHWSAYQALVDVMRQRASVAEC  217



>gb|KHN33972.1| hypothetical protein glysoja_044679, partial [Glycine soja]
Length=101

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  882   LNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILI  1061
             LN+FSCIALAGV+TEYL++G +EGGL DI +LD LL+ LGFTQKKADS VRW +LNT+L+
Sbjct  1     LNKFSCIALAGVSTEYLIYGFSEGGLDDIRKLDLLLKGLGFTQKKADSHVRWPLLNTVLV  60

Query  1062  LRRHENARAKLAEGMSEGRSVGFC  1133
             L RHE AR K+AE +S G+S+G C
Sbjct  61    LWRHEAARGKVAEALSMGKSIGSC  84



>ref|WP_015190980.1| hypothetical protein [Gloeocapsa sp. PCC 7428]
 ref|YP_007130273.1| hypothetical protein Glo7428_4680 [Gloeocapsa sp. PCC 7428]
 gb|AFZ33113.1| hypothetical protein Glo7428_4680 [Gloeocapsa sp. PCC 7428]
Length=232

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 109/196 (56%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             + NL+P      +  LL L T DS S  G  G L+LD    + S ++ +R+++HEAGHFL
Sbjct  25    MFNLSPTLPAIATFSLLGLATLDSFSLQGKGGTLVLDWFA-SFSPQHRDRIVRHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +A+LLGI   GY L++ EALK++     Q G +F D E   ++ +G +S  +L+R+  I 
Sbjct  84    VAHLLGIPVTGYALSAWEALKQKQP--GQGGVSFDDTEVASQLAQGTISTQLLDRYCTIW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AGVA E L++  AEGG  D   L  +L SLGF+    + + R+  L    +L+++  A 
Sbjct  142   MAGVAAETLVYDRAEGGADDRQHLHTVLSSLGFSAASVELKQRFCSLQARNLLQQNWAAY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L   M +   V  C
Sbjct  202   EALINAMRQRADVAEC  217



>ref|WP_015083577.1| hypothetical protein [Anabaena sp. 90]
 ref|YP_007001081.1| hypothetical protein ANA_C20593 [Anabaena sp. 90]
 gb|AFW97024.1| hypothetical protein ANA_C20593 [Anabaena sp. 90]
Length=237

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 100/176 (57%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+ SF G  G ++LD +    S +Y  R++ HEAGHFL+AYLLGI    YTL++ EA 
Sbjct  45    TLDNFSFQGKGGTIVLDLMAR-FSPEYKERILHHEAGHFLVAYLLGIPVTSYTLSAWEAW  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             KK      Q G    D E   ++  GQ++A ML+R+  I +AG+A E L+F  AEGG  D
Sbjct  104   KK--GQPGQGGITLEDSELTAQIETGQITAQMLDRYCTIWMAGIAAETLVFKSAEGGNDD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               +L+  LQ +GF++     + R+ +L +  +++ + ++   L   M +  S+  C
Sbjct  162   KIKLNEFLQVIGFSETGYQQKQRFHLLQSKNLIQENWDSYQALVTAMRKRASIVEC  217



>ref|XP_011078013.1| PREDICTED: uncharacterized protein LOC105161871 isoform X2 [Sesamum 
indicum]
Length=324

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 97/163 (60%), Gaps = 16/163 (10%)
 Frame = +3

Query  681   KYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKE--GSLNVQAGTAFVDFEFLEEV  854
             K H     HEAGHFL+ Y+LG+LP+ Y + S+E L ++     NV+    FV FEFL +V
Sbjct  148   KDHLMCTHHEAGHFLVGYMLGVLPKRYKIPSVEDLLQDEFAGGNVE----FVGFEFLRDV  203

Query  855   NKGQVS----------ATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGF  1004
                 +S             L +FSC+ L G+A E+L+FGC+E   +D+ +LD + + L F
Sbjct  204   YGATMSKGKFTKKKLCKKTLKKFSCVILGGLAAEHLIFGCSELLHSDVEKLDRVHKWLNF  263

Query  1005  TQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             T+ K +S++R A    + IL  H  AR++LAE M+ GRSVGFC
Sbjct  264   TESKVESEIRGAAEAAVTILYSHSEARSRLAETMALGRSVGFC  306



>ref|WP_015115582.1| hypothetical protein [Nostoc sp. PCC 7107]
 ref|YP_007052543.1| hypothetical protein Nos7107_4875 [Nostoc sp. PCC 7107]
 gb|AFY45393.1| hypothetical protein Nos7107_4875 [Nostoc sp. PCC 7107]
Length=228

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 110/195 (56%), Gaps = 3/195 (2%)
 Frame = +3

Query  549   LNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLI  728
             +NL+P      +  +L + T DS S  G  G +++D I    S ++ +R+I+HEAGHFL 
Sbjct  26    INLSPTIPALATFTILGIATLDSFSLQGKGGTILVDWIAG-FSSEHRDRIIRHEAGHFLA  84

Query  729   AYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIAL  908
             A LLGI   GYTL++ EA +K      Q G AF D E   ++ KG +SA ML+R+  + +
Sbjct  85    ASLLGIPVTGYTLSAWEAWRK--GQPGQGGVAFNDVELAAQLEKGTISAQMLDRYCTMWM  142

Query  909   AGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARA  1088
             AG+A E L+F  AEGG  D  +L  +L+ +GF++     + R+ VL    +L  + ++  
Sbjct  143   AGLAAEALVFDRAEGGGDDKAKLAGVLKIVGFSESAFQQKQRFHVLQAKTLLEENWSSYE  202

Query  1089  KLAEGMSEGRSVGFC  1133
              L + M +  SV  C
Sbjct  203   ALVQAMQQRASVEEC  217



>ref|WP_026099936.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=226

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 108/196 (55%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             +LNL+P      +  +L + TFDS    G  G + LD I    S ++ +R++ HEAGHFL
Sbjct  25    LLNLSPTIPALATFTILGIATFDSFKLQGKGGTIFLDWIA-GFSGEHRDRIVHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
              AYLL I   GYTL++ EA K+      Q G AF D +   ++  G++SA +L+R+  + 
Sbjct  84    TAYLLDIPISGYTLSAWEAWKQ--GQPGQGGVAFNDDQLASQLEAGKISAQILDRYCTVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L+F   EGG  D N+L  +L +LGF+      + R+  L    +L+ + ++ 
Sbjct  142   MAGIAAETLVFNNTEGGADDQNKLVGVLANLGFSPSACQQKQRFHALQAKTLLQENWSSY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L + M E  SV  C
Sbjct  202   QALVKAMRERASVVDC  217



>ref|WP_027404622.1| hypothetical protein [Aphanizomenon flos-aquae]
Length=237

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 100/176 (57%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+ SF G  G ++LD +    S +Y  R++ HEAGHFL+A+LL I   GYTL++ EA 
Sbjct  45    TLDNFSFQGKGGTIVLDLVAR-FSPEYKERILHHEAGHFLVAHLLEIPVTGYTLSAWEAW  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             KK      Q G    D E   ++  G++SA ML+R+  I +AG+A E L+F  +EGG  D
Sbjct  104   KK--GQPGQGGITLEDSELTAQIENGKISAQMLDRYCTIWMAGIAAETLVFNSSEGGNDD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              ++L  +LQ +GF++     + R+ +L +  +++ +  +   L   M E  SV  C
Sbjct  162   KSKLTEILQVIGFSEAGYQQKQRFHLLQSKTLIQENWESYQALVVAMRERVSVVEC  217



>ref|XP_011078012.1| PREDICTED: uncharacterized protein LOC105161871 isoform X1 [Sesamum 
indicum]
Length=352

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 97/163 (60%), Gaps = 16/163 (10%)
 Frame = +3

Query  681   KYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKE--GSLNVQAGTAFVDFEFLEEV  854
             K H     HEAGHFL+ Y+LG+LP+ Y + S+E L ++     NV+    FV FEFL +V
Sbjct  176   KDHLMCTHHEAGHFLVGYMLGVLPKRYKIPSVEDLLQDEFAGGNVE----FVGFEFLRDV  231

Query  855   NKGQVSA----------TMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGF  1004
                 +S             L +FSC+ L G+A E+L+FGC+E   +D+ +LD + + L F
Sbjct  232   YGATMSKGKFTKKKLCKKTLKKFSCVILGGLAAEHLIFGCSELLHSDVEKLDRVHKWLNF  291

Query  1005  TQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             T+ K +S++R A    + IL  H  AR++LAE M+ GRSVGFC
Sbjct  292   TESKVESEIRGAAEAAVTILYSHSEARSRLAETMALGRSVGFC  334



>ref|WP_015215362.1| hypothetical protein [Anabaena cylindrica]
 ref|YP_007157646.1| hypothetical protein Anacy_3332 [Anabaena cylindrica PCC 7122]
 gb|AFZ58736.1| hypothetical protein Anacy_3332 [Anabaena cylindrica PCC 7122]
Length=226

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 102/178 (57%), Gaps = 7/178 (4%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+ SF G  G ++LD +    S +Y  R++ HEAGHF++AYLLGI   GYTL++ EA 
Sbjct  45    TLDNFSFQGKGGTVVLDWLAR-FSLEYRERILHHEAGHFIVAYLLGIPVTGYTLSAWEAW  103

Query  786   K--KEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGL  959
             K  + G    Q G    D E  +++ KG+++ +M+ R+  I +AG+A E L+F  AEGG 
Sbjct  104   KIGQPG----QGGVILEDSEIAKQLEKGKITVSMVERYCNIWMAGIAAEMLVFKSAEGGG  159

Query  960   ADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              D  +L+  L +LGF +   D + R+ +L    +++ +      L E M +G +V  C
Sbjct  160   DDKAKLNQFLAALGFEENVFDQKQRFYLLQAKNLIQENWENYQNLVEAMRKGVNVEEC  217



>gb|AHJ30075.1| hypothetical protein NSP_37720 [Nodularia spumigena CCY9414]
Length=211

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 111/196 (57%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             +++L+P      ++ +L + TFD+ S  G  G +ILD I    S ++ +R+I HEAGHFL
Sbjct  10    LIHLSPAVPAIATVTILGIATFDNFSLQGQGGTIILDWIA-GFSPQHRDRIIHHEAGHFL  68

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
              AYLL I   GYTL++ EA K+      Q G +F D E   ++ +G +S  +++R+  I 
Sbjct  69    TAYLLDIPVTGYTLSAWEAWKQ--GQPGQGGVSFDDGELATQLEQGTISTQIIDRYCTIW  126

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+  E L+F  AEGG  D N+L  +L  LGF++  A  + ++  L    +L+ + ++ 
Sbjct  127   MAGIVAETLVFNHAEGGADDKNKLAGVLAGLGFSESAALQKQKFHFLQAKTLLQENWSSY  186

Query  1086  AKLAEGMSEGRSVGFC  1133
               L + M +  SV  C
Sbjct  187   EALVKSMQQRVSVSDC  202



>ref|WP_027255391.1| hypothetical protein [Planktothrix agardhii]
Length=226

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 104/196 (53%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             VLN++P     I+  LL + T D   F G   +L++D +  T S     R++ HEAGHFL
Sbjct  25    VLNISPFIPAGITFFLLGVATLDVFQFQGQGASLLIDGLAGT-SASTQERILHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +AYL+ I  +GY L   EA K+      Q G  F D    E++ +GQ+SA +L+R+  + 
Sbjct  84    VAYLMEIPIQGYALNGWEAFKQ--GFKAQGGVQFADQLLWEQLQQGQISAQVLDRYCAVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L+F  AEGG  D N++  +   L     +A  + RWA+L    ++  H+ A 
Sbjct  142   MAGIAAETLIFKKAEGGREDRNKIIAIWTQLQRPLSEAKIKERWAILQAKTLIETHKVAY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L E M    SV  C
Sbjct  202   LGLVEAMRNRASVADC  217



>ref|WP_017320959.1| hypothetical protein [cyanobacterium PCC 7702]
Length=228

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 109/196 (56%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             VLNL+P         +L L T D+ S+ G    L LD I    S ++  RV+ HEAGHFL
Sbjct  25    VLNLSPAVTAITIFAVLGLATVDTTSWQGKGTTLFLDWIAG-FSPEHRERVLHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +AYL  I   GY+L++ EA K++ S   Q G +F D +   ++ +G +SA ML+R+  + 
Sbjct  84    VAYLFDIPIIGYSLSAWEAWKQKQS--GQGGVSFNDQKLALQLEQGTISAQMLDRYCTVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L++   EGG  D ++L  +L S+GF+    + + R+  L    +L+++ +A 
Sbjct  142   MAGIAAEALVYKNVEGGSDDKSKLATVLTSMGFSPSACEQKQRFFALQAKTLLQKNWSAY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L   M +  SV  C
Sbjct  202   QALVSAMRQRASVAEC  217



>ref|WP_006198832.1| hypothetical protein [Nodularia spumigena]
 gb|EAW43040.1| hypothetical protein N9414_11439 [Nodularia spumigena CCY9414]
Length=226

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 111/196 (57%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             +++L+P      ++ +L + TFD+ S  G  G +ILD I    S ++ +R+I HEAGHFL
Sbjct  25    LIHLSPAVPAIATVTILGIATFDNFSLQGQGGTIILDWIA-GFSPQHRDRIIHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
              AYLL I   GYTL++ EA K+      Q G +F D E   ++ +G +S  +++R+  I 
Sbjct  84    TAYLLDIPVTGYTLSAWEAWKQ--GQPGQGGVSFDDGELATQLEQGTISTQIIDRYCTIW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+  E L+F  AEGG  D N+L  +L  LGF++  A  + ++  L    +L+ + ++ 
Sbjct  142   MAGIVAETLVFNHAEGGADDKNKLAGVLAGLGFSESAALQKQKFHFLQAKTLLQENWSSY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L + M +  SV  C
Sbjct  202   EALVKSMQQRVSVSDC  217



>ref|WP_035150144.1| ATP-dependent Zn protease [Calothrix sp. 336/3]
 gb|KFB82135.1| hypothetical protein IJ00_03815 [Calothrix sp. 336/3]
Length=224

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 109/196 (56%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             +LNL+P      +  LL + TFDS S  G  G + LD +    S ++  R+++HEAGHFL
Sbjct  25    LLNLSPTIPAIATFTLLGVATFDSFSLQGKGGTIFLDWLAG-FSVEHRERILRHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +A+LLGI   GYTL++ EA ++      Q G  F D E + ++  G+++A ML+R+  + 
Sbjct  84    VAHLLGIPVAGYTLSAWEAWRQ--GQTGQGGVNFADEELISQLQTGKITAQMLDRYCTVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L++  +EGG  D ++L  +L S+GF    +  + R+ +L    +L  +    
Sbjct  142   MAGIAAETLVYQNSEGGADDRSKLGEILASVGFAPNASAQKQRFCLLQAKTLLEENWTTY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L   M +  +V  C
Sbjct  202   EALVNAMGQRATVAEC  217



>gb|KEI68740.1| hypothetical protein A19Y_4027 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=227

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 104/196 (53%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             VLN++P     I+  LL + T D   F G   +L++D +  T S     R++ HEAGHFL
Sbjct  26    VLNISPLIPAGITFFLLGVATLDVFQFQGQGASLLIDGLAGT-SASTQERILHHEAGHFL  84

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +AYL+ I  +GY L   EA K+      Q G  F D    E++ +GQ+SA +L+R+  + 
Sbjct  85    VAYLMEIPIQGYALNGWEAFKQ--GFKAQGGVQFADQLLWEQLQQGQISAQVLDRYCAVW  142

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L+F  AEGG  D N++  +   L     +A  + RWA+L    ++  H+ A 
Sbjct  143   MAGIAAETLIFKKAEGGREDRNKIIAIWTQLQRPLSEAKIKERWAILQAKTLIETHKVAY  202

Query  1086  AKLAEGMSEGRSVGFC  1133
               L E M    SV  C
Sbjct  203   LGLVEAMRNRASVEDC  218



>ref|WP_016951904.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=223

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 99/176 (56%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+ SF G  G ++LD +    S +Y  R++ HEAGHFL+A LL I   GYTL++ EA 
Sbjct  45    TLDNFSFQGKGGTIVLDWLAR-FSPEYKERILHHEAGHFLVANLLEIPVTGYTLSAWEAW  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K+      Q G    D E   ++ KGQ++A ML+R+  I +AG+A E L+F  AEGG  D
Sbjct  104   KQ--GQPGQGGITLEDGELTAQIEKGQITAQMLDRYCTIWMAGIAAETLVFNSAEGGNDD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               +L  +LQ LGF++     + R+ +L +  +++ + ++   L   M    +V  C
Sbjct  162   KTKLIEVLQVLGFSEAGYQQKQRFHLLQSKNLIQENWDSYQALVAAMKRRATVSEC  217



>ref|WP_039200564.1| ATP-dependent Zn protease [Aphanizomenon flos-aquae]
 gb|KHG42407.1| ATP-dependent Zn protease [Aphanizomenon flos-aquae 2012/KM/D3]
Length=237

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 99/176 (56%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+ SF G  G ++LD +    S +Y  R++ HEAGHFL+A+LL I   GYTL++ EA 
Sbjct  45    TLDNFSFQGKGGTIVLDFVAR-FSPEYKERILHHEAGHFLVAHLLEIPVTGYTLSAWEAW  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             KK      Q G    D E   ++  G++SA ML+R+  I +AG+A E L F  +EGG  D
Sbjct  104   KK--GQPGQGGITLEDSELTAQIENGKISAQMLDRYCTIWMAGIAAETLFFNSSEGGNDD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              ++L  +L+ +GF++     + R+ +L +  +++ +  +   L   M E  SV  C
Sbjct  162   KSKLTEVLRVIGFSEAGYQQKQRFHLLQSKTLIQENWESYQALVAAMRERVSVVEC  217



>ref|WP_008310822.1| hypothetical protein [Leptolyngbya sp. PCC 6406]
Length=240

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 94/176 (53%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D +   G  G LI+ ++    S +   R+  HEA HFL+A+LL I  + Y+L + EA 
Sbjct  54    TLDQIMGQGTLGNLIIGSLSR-FSPQQRQRIAHHEAAHFLVAHLLDIPIQDYSLNAWEAW  112

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             +K   L  Q G  F   +    + +G++SA M+NR++ + +AG+A E  ++G A GG  D
Sbjct  113   RK--GLPGQGGVRFDTTDLEAPLAQGKISAQMVNRYATVWMAGIAAEQWIYGEALGGQDD  170

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               +   L Q LG + ++  +Q RWA L    +L  H++A   L   M+ G SV  C
Sbjct  171   QQKFAILWQQLGRSSQERQTQQRWAALQARTMLEHHQDAYRALVAAMTAGESVADC  226



>ref|WP_026795707.1| MULTISPECIES: hypothetical protein [Planktothrix]
Length=226

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 104/196 (53%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             VLN++P     I+  LL + T D   F G   +L++D +  T S     R++ HEAGHFL
Sbjct  25    VLNISPFIPAGITFFLLGVATLDVFQFQGQGASLLIDGLAGT-SASTRERILHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +A+L+ I  +GY L   EA K+      Q G  F D    E++ +GQ+SA +L+R+  + 
Sbjct  84    VAHLMEIPIQGYALNGWEAFKQ--GFKAQGGVQFADQLLWEQLQQGQISAQVLDRYCAVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L+F  AEGG  D N++  +   L     +A  + RWA+L    ++  H+ A 
Sbjct  142   MAGIAAETLIFKKAEGGREDRNKIIAIWTQLQRPLSEAKIKERWAILQAKTLIETHKVAY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L E M    SV  C
Sbjct  202   LGLVEAMRNRASVADC  217



>ref|WP_017662825.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=227

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 109/196 (56%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             ++NL+P        G+L L T D++ FNG    ++LD +G+T S++  +R+++HEAGHFL
Sbjct  25    MVNLSPVVPAATVFGILGLATVDTLGFNGQGTMVLLDWLGNTSSDR-RDRIVRHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +AYLL I    YTL + +A+K+        G  F D   LE++ +G +SA  L+R++ + 
Sbjct  84    VAYLLDIPIADYTLNAWDAVKR--GYRGYGGVQFDDRHLLEQLQQGTLSARTLDRYAKVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L      GG  D  QL  + + L         + RWA+     ++  H++A 
Sbjct  142   MAGIAAEQLHNDTEIGGDGDRLQLRQIFKQLRPAITDIVQRERWAIFQAKTLISTHQDAY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L E M+EGRSV  C
Sbjct  202   NALVEAMTEGRSVDEC  217



>ref|WP_039726475.1| ATP-dependent Zn protease [Lyngbya confervoides]
 gb|KIF14684.1| ATP-dependent Zn protease [Aphanocapsa montana BDHKU210001]
 gb|KIF39608.1| ATP-dependent Zn protease [Lyngbya confervoides BDU141951]
Length=234

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 89/175 (51%), Gaps = 3/175 (2%)
 Frame = +3

Query  609   FDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALK  788
              D  SFNG  G L+++ +   LS     R+I HEAGHFLIAYLL I    YTL++ +A K
Sbjct  46    LDQASFNGTIGNLLINGLNR-LSGDERERIIHHEAGHFLIAYLLNIPVTDYTLSAWDAWK  104

Query  789   KEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADI  968
             K   L    G  F   +    +  GQ+ A  LNR+  + +AG+A E L++G A+GG  D 
Sbjct  105   K--GLPGLGGVQFDTSDLEATLKTGQLPAQTLNRYCTVWMAGIAAEQLVYGQAQGGQDDR  162

Query  969   NQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              +   L Q L     +   + RWA L    +L +H++A   L   MS    V  C
Sbjct  163   QKFSILWQQLQRPIPEGQMRQRWAALQAKTLLEKHQDAYTALVAAMSADTPVNDC  217



>ref|WP_006455994.1| hypothetical protein [Synechococcus sp. PCC 7335]
 gb|EDX86231.1| hypothetical protein S7335_3934 [Synechococcus sp. PCC 7335]
Length=243

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 105/198 (53%), Gaps = 7/198 (4%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             + N++P  +      +  ++  D     G  G +++D I    SE Y  R++ HEAGHFL
Sbjct  25    LFNISPGAVAIALSSIAGVIAIDRFGAQGRGGNILIDLISRQSSE-YRQRILHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKK--EGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSC  899
             +A+LL I  + YTL++ EA K    G   V   TA ++     ++  G +SA  +NR+  
Sbjct  84    VAHLLDIPVQSYTLSAWEATKAGVPGLGGVVLDTAAIE----NDLATGTISAQQVNRYCI  139

Query  900   IALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHEN  1079
             + +AG+A E  ++G AEGG  D  +L  L +    T   A++Q+RWA+L    +L + + 
Sbjct  140   LWMAGIAAETQIYGSAEGGEDDQTKLRLLWKQTQRTASAAETQIRWALLQAQTLLEKQKQ  199

Query  1080  ARAKLAEGMSEGRSVGFC  1133
             A   L E MS+G SV  C
Sbjct  200   AYDALVEAMSKGSSVESC  217



>ref|WP_027248908.1| hypothetical protein [Planktothrix agardhii]
Length=226

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 104/196 (53%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             VLN++P     I+  LL + T D   F G   +L++D +  T S     R++ HEAGHFL
Sbjct  25    VLNISPFIPAGITFFLLGVATLDVFQFQGQGASLLIDGLAGT-SASTRERILHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +A+L+ I  +GY L   EA K+      Q G  F D    E++ +GQ+SA +L+R+  + 
Sbjct  84    VAHLMEIPIQGYALNGWEAFKQ--GFKAQGGVQFADQLLWEQLQQGQISAQVLDRYCAVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L+F  AEGG  D +++  +   L     +A  + RWA+L    ++  H+ A 
Sbjct  142   MAGIAAETLIFKKAEGGREDRDKIIAIWTQLQRPLSEAKIKERWAILQAKTLIETHKVAY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L E M    SV  C
Sbjct  202   LGLVEAMRNRASVADC  217



>ref|WP_011613756.1| hypothetical protein [Trichodesmium erythraeum]
 ref|YP_723906.1| hypothetical protein Tery_4446 [Trichodesmium erythraeum IMS101]
 gb|ABG53433.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101]
Length=229

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 113/198 (57%), Gaps = 8/198 (4%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             + N++P  I   +  +L L T D++ + G    +++D +  T SEK  +R+I HEAGHFL
Sbjct  25    IFNISPFYIAIATFSVLVLATIDTLGWQGQGSMILVDLVAGTSSEK-RDRIICHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +AYLL I   GY L + EA ++  S   Q G  F D +   ++  G +S+ +++R+  + 
Sbjct  84    VAYLLEIPISGYALNAWEAFRQGQS--SQGGVRFDDQKLAAQLYSGVISSQLVDRYCTVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVR--WAVLNTILILRRHEN  1079
             +AG+A E L++G AEGG  D  ++  +L+ L   ++  +S+++  WA L    +L  H++
Sbjct  142   MAGIAAENLVYGNAEGGAEDRTKITAILRQL---KRPGESKLKQSWASLQARNLLENHQS  198

Query  1080  ARAKLAEGMSEGRSVGFC  1133
             A   L + M+E  SV  C
Sbjct  199   AYKALVKAMTERSSVSDC  216



>ref|WP_022603839.1| hypothetical protein [Rubidibacter lacunae]
 gb|ERN43087.1| hypothetical protein KR51_00001490 [Rubidibacter lacunae KORDI 
51-2]
Length=227

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 100/179 (56%), Gaps = 10/179 (6%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D  ++ G    L++D      S++  +RV+ HEAGHFL AY LGI   GY LT+ EA 
Sbjct  45    TTDRFAWEGQGALLLVDAFA---SDEQRDRVLHHEAGHFLAAYFLGIPIAGYALTAWEAF  101

Query  786   KKE---GSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGG  956
             +++   G+  V+  T+ +D+    EV  G+V A  ++RFS + +AG+A E   +G A GG
Sbjct  102   RQQQPAGAGGVRFDTSALDYA---EVASGKV-ALAVDRFSTVWMAGIAAEERTYGSATGG  157

Query  957   LADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               D  QL  +L+SLGF+ +  + + RWA L    +L RH +A   L E M    SV  C
Sbjct  158   GDDRGQLKTMLRSLGFSLQARNQKERWAKLQAQALLERHADAYIALVEAMGARTSVEEC  216



>ref|XP_006599980.1| PREDICTED: uncharacterized protein LOC102662133 [Glycine max]
Length=152

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 74/125 (59%), Gaps = 34/125 (27%)
 Frame = +3

Query  849   EVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQ------------------  974
              VN  +VSAT LN+FSCIALAGV TEYL++G +EGGL DI +                  
Sbjct  11    RVNSRKVSATTLNKFSCIALAGVYTEYLIYGFSEGGLDDIRKVYATFYLLSYWQHLESSH  70

Query  975   --------------LDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSE  1112
                           L  LL+ LGF QKKADSQVRW++LNT  +LRR++ AR K+ E +S 
Sbjct  71    GIAITNCNFLNCKHLGLLLKDLGFAQKKADSQVRWSLLNT--VLRRYQAARGKVVEALST  128

Query  1113  GRSVG  1127
             G+SVG
Sbjct  129   GKSVG  133



>ref|WP_026785972.1| hypothetical protein [Planktothrix rubescens]
Length=226

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 104/196 (53%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             VLN++P     I+  LL + T D   F G   +L++D +  T S     R++ HEAGHFL
Sbjct  25    VLNISPLIPAGITFFLLGVATLDVFQFQGQGASLLIDGLAGT-SASTRERILHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +A+L+ I  +GY L   EA K+      Q G  F D    E++ +GQ+S+ +L+R+  + 
Sbjct  84    VAHLMEIPIQGYALNGWEAFKQ--GFKAQGGVQFADQLLWEQLQQGQISSLILDRYCAVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L+F  AEGG  D +++  +   L     +A  + RWA+L    ++  H+ A 
Sbjct  142   MAGIAAETLIFKKAEGGREDRDKIIAIWTQLQRPLSEAKIKERWAILQAKTLIETHKVAY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L E M    SV  C
Sbjct  202   LGLVEAMRNRASVADC  217



>ref|WP_006102119.1| hypothetical protein [Coleofasciculus chthonoplastes]
 gb|EDX74276.1| hypothetical protein MC7420_3800 [Coleofasciculus chthonoplastes 
PCC 7420]
Length=228

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 102/180 (57%), Gaps = 11/180 (6%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T DS+SF G    ++LD +    S+ Y +R++ HEAGHFL+AYLLGI   GYTLT+ EAL
Sbjct  46    TVDSLSFQGKGTTVLLDWLAQRRSD-YRDRILHHEAGHFLVAYLLGIPIAGYTLTAWEAL  104

Query  786   KKEGSLNVQAGTAFVDFEFLE----EVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEG  953
             K+      Q G   V F+  +     +  G++  T L+RF  + +AG+A E L++G AEG
Sbjct  105   KQG-----QPGLGGVQFDTQQLSPNPLAIGEMRLT-LDRFCTVWMAGIAAETLVYGEAEG  158

Query  954   GLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             G+ D  +L   L+       +  ++ RWA+L    +L+ +  A   L + M+E  SVG C
Sbjct  159   GIDDCQKLKEALRLFERPVGEFTTKQRWAMLQAQTMLQDNWEAYEALIKAMAERTSVGDC  218



>ref|WP_015194303.1| hypothetical protein [Stanieria cyanosphaera]
 ref|YP_007133604.1| hypothetical protein Sta7437_3127 [Stanieria cyanosphaera PCC 
7437]
 gb|AFZ36638.1| hypothetical protein Sta7437_3127 [Stanieria cyanosphaera PCC 
7437]
Length=223

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 101/196 (52%), Gaps = 5/196 (3%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             +LN++P      +LG++ L T D++S+N     L+LD      + +   RVI HEAGHFL
Sbjct  25    ILNISPTIPAMATLGIMGLATVDTLSWNNRGVTLLLDVFS---TPQQRQRVIHHEAGHFL  81

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
              AY LGI   GY+LT+ EALK+      + G AF   E   +    +     L+RF  + 
Sbjct  82    TAYFLGIPVTGYSLTAWEALKQ--GQPGRGGVAFNTQELTTKPINFEEMRLTLDRFCTVW  139

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L++G AEGG  D  QL   L   G  +     + RWA +    I+ RH+NA 
Sbjct  140   MAGIAAEKLVYGNAEGGQEDCEQLRLALSLAGLPEIGYAQKQRWAQIQATSIIERHQNAY  199

Query  1086  AKLAEGMSEGRSVGFC  1133
               L   M +  SV  C
Sbjct  200   QALVTAMEQRASVVEC  215



>ref|WP_016874006.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=232

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 97/176 (55%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D++ + G  G + LD I    S  +  R+I HEAGHFL+AYLL I   GYTL++ EA 
Sbjct  45    TVDTLGWQGKGGTIFLDWIA-GFSPAHRERIIHHEAGHFLVAYLLDIPVIGYTLSAWEAW  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K++     Q G +F D E   ++ +G +S  ML+R+  + +AG+A E L++  AEGG  D
Sbjct  104   KQKQP--GQGGVSFDDQELASQLERGTISTQMLDRYCTVWMAGIAAETLVYKNAEGGADD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              ++L  +L S+G +    + + R+  L    +L+ +  A   L   M +  SV  C
Sbjct  162   KSKLAGVLGSMGCSASVCEQKQRFFALQAKTLLQENWLAYQALVNAMRQRASVAEC  217



>ref|WP_028083464.1| hypothetical protein [Dolichospermum circinale]
Length=226

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 97/176 (55%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+ SF G  G + LD +    S +Y  R++ HEAGHFL+A+LL I   GYTL++ EA 
Sbjct  45    TLDNFSFQGKGGTIFLDFLAR-FSPEYKERILHHEAGHFLVAHLLEIPITGYTLSAWEAW  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K +G    Q G +  D E   ++ KG++S  +L R+  I +AG+A E L+F   +GG  D
Sbjct  104   K-QGQPG-QGGVSIDDRELTTQIEKGEISTQILERYCTILMAGIAAETLIFDAPQGGNDD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               +L   LQ LGF++     + R+ +L +  +++ +  +   L   M +G  V  C
Sbjct  162   KIKLMQFLQVLGFSEDIYQQKQRFHLLQSKNLIQENWESYQALVSAMKKGVDVQEC  217



>ref|WP_015145177.1| hypothetical protein [Pleurocapsa minor]
 ref|YP_007082435.1| hypothetical protein Ple7327_3688 [Pleurocapsa sp. PCC 7327]
 gb|AFY78878.1| hypothetical protein Ple7327_3688 [Pleurocapsa sp. PCC 7327]
Length=224

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 105/196 (54%), Gaps = 6/196 (3%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             +LN++P      +LG++ L T D++++NG    L LD      S +   RV+ HEAGHFL
Sbjct  25    ILNISPVIPAATTLGIMGLATLDNLTWNGKATTLFLDLFS---SPQQRQRVVHHEAGHFL  81

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +AY LGI   GYTL++ EA K EG   +  G    D   LE+    + +  +L RF  + 
Sbjct  82    VAYFLGIPVVGYTLSAWEAFK-EGQPGL--GGVVFDTNLLEKSADLREAPIILERFCTVW  138

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E +++G  EGG +D   L  +L+ +G  +     + RWA L    +L +H+ + 
Sbjct  139   MAGIAAETIVYGNVEGGESDRENLREVLRFVGLPESVYPQKERWAYLQAKSLLEKHQKSY  198

Query  1086  AKLAEGMSEGRSVGFC  1133
               L + M +  SV  C
Sbjct  199   EALVQAMEKRASVEEC  214



>ref|WP_015175065.1| hypothetical protein [Oscillatoria nigro-viridis]
 ref|YP_007114157.1| hypothetical protein Osc7112_1194 [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ05741.1| hypothetical protein Osc7112_1194 [Oscillatoria nigro-viridis 
PCC 7112]
Length=235

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 91/176 (52%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T DS  + G  G ++LD +G T  EK  +R++ HEAGHFL+AYLLGI    Y L + EA 
Sbjct  45    TLDSFQWQGQGGTILLDWLGGTSKEK-RDRILHHEAGHFLVAYLLGIPVTSYALNAWEAF  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K+      Q G  F D +   ++  G +SA +L+++  + +AG+  E  ++G AEGG  D
Sbjct  104   KQ--GQTAQGGVRFEDEQLASQLQNGTLSAQLLDQYCTVWMAGIVAEKFVYGSAEGGAED  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               ++  +L  L     +   +  W +L    +L  H++A   L   M    +V  C
Sbjct  162   RTKISAILTQLRRPSSEIQLKQNWGLLRAKNLLESHKSAYEALVAAMENRATVAEC  217



>ref|WP_006518853.1| hypothetical protein [Leptolyngbya sp. PCC 7375]
 gb|EKU97680.1| hypothetical protein Lepto7375DRAFT_6912 [Leptolyngbya sp. PCC 
7375]
Length=230

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 111/198 (56%), Gaps = 7/198 (4%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             +L ++P+ +  ++  LL L+T D + + G  G L++D +    S +Y +R+++HEAGHFL
Sbjct  25    LLAISPEGLATVTATLLGLITIDQLGWQGRGGRLLVDWLSQR-SPEYCDRIVRHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKK--EGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSC  899
              AYLLGI    YTLT+ E L+   +GS  V   T  +D      V  G++S   ++R+  
Sbjct  84    TAYLLGIPIAAYTLTAWETLRSGVDGSGGVIFKTDGID----RAVENGKISQQEIDRYCT  139

Query  900   IALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHEN  1079
             + +AG+A E +++G A+GG  D  +L+ L + +     +   + RW++L    ++ +  +
Sbjct  140   VWMAGIAAEEIVYGIAQGGRDDRLKLNLLWRQINRPLAEVPLKQRWSMLQAKTLIEKESD  199

Query  1080  ARAKLAEGMSEGRSVGFC  1133
             A   L + M+E R V  C
Sbjct  200   AYGALIDAMAERRPVNEC  217



>ref|XP_005831184.1| hypothetical protein GUITHDRAFT_87555, partial [Guillardia theta 
CCMP2712]
 gb|EKX44204.1| hypothetical protein GUITHDRAFT_87555, partial [Guillardia theta 
CCMP2712]
Length=361

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 91/153 (59%), Gaps = 4/153 (3%)
 Frame = +3

Query  681   KYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNK  860
             KY  +VI+HEAGHFL+AYLLG   +G+ L++ +A +    +  QAGT F D +   ++N 
Sbjct  69    KYKEKVIKHEAGHFLLAYLLGCPIQGFFLSAWDATR--AGIRGQAGTVFFDNDLSTQLNA  126

Query  861   GQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSL--GFTQKKADSQVR  1034
              +V+ T ++R++ + + G+A E + +  AEGG +D + L   L  L   +  ++  +Q R
Sbjct  127   NRVTRTAIDRYTIVLMGGIAAEAMNYEQAEGGASDESALVSFLVGLLPPWQPQQVLNQAR  186

Query  1035  WAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             WAV   IL+LR H  A   L + M+ G S+G C
Sbjct  187   WAVTEAILLLREHRAAYDSLCDAMARGESLGTC  219



>ref|WP_023076788.1| atp-dependent zn protease [Leptolyngbya sp. Heron Island J]
 gb|ESA32195.1| atp-dependent zn protease [Leptolyngbya sp. Heron Island J]
Length=230

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 106/196 (54%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             +L ++P+ +  ++  LL +   D + + G  G L++D I    S +Y +R+++HEAGHFL
Sbjct  25    LLAISPEGLATVTAALLGIAAVDQLGWQGRGGRLLIDWISQR-SPEYCDRIVRHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
              AYLLGI    YTLT+ EAL     ++   G  F   +    V  G++S   ++R+  + 
Sbjct  84    TAYLLGIPIADYTLTAWEALHS--GVDGNGGVIFKTDDIDRAVAAGKISQQEIDRYCTVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E + +G AEGG  D  +L+ L + +     +   + RW++L    ++ +  +A 
Sbjct  142   MAGIAAEEITYGSAEGGHDDRLKLNLLWRQINRPLAEVPLKQRWSMLQAKTLIEKEADAY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L + M+E R V  C
Sbjct  202   GVLIDAMAERRPVSEC  217



>ref|WP_009634131.1| hypothetical protein [Synechocystis sp. PCC 7509]
Length=229

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 103/197 (52%), Gaps = 5/197 (3%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             + NL+P      +  LL L T DS    G  GA++ D    T S +  +R++ HEAGHFL
Sbjct  25    LFNLSPTIPAIATFTLLGLATVDSFGLQGKGGAVVSDLFAWT-SRQNRDRILHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALK-KEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCI  902
             +A+ L I   GYTL++ EALK K+  L    G  F D E    + +G + A +L+R+  I
Sbjct  84    VAHFLDIPVTGYTLSAWEALKQKQPGL---GGVTFADDELASNLQQGTLKAQLLDRYCTI  140

Query  903   ALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENA  1082
              +AG+  E L++  A GG  D+N+L  +L  +GF+      + R + ++   IL  +  A
Sbjct  141   WMAGITAENLVYNDAHGGADDLNKLKKVLTPIGFSAAAQAQKQRSSAISAKTILTENWKA  200

Query  1083  RAKLAEGMSEGRSVGFC  1133
                L + M +  SV  C
Sbjct  201   YEALVQAMQQRVSVDEC  217



>ref|XP_005706363.1| hypothetical protein isoform 2 [Galdieria sulphuraria]
 gb|EME29843.1| hypothetical protein isoform 2 [Galdieria sulphuraria]
Length=400

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 102/178 (57%), Gaps = 12/178 (7%)
 Frame = +3

Query  612   DSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKK  791
             D ++  G     I + +   L   Y  +V++HEAGHFL++YLLG   RG  L++ E+L  
Sbjct  221   DQIALQGA----IFEELYKNLFPIYKKKVLKHEAGHFLVSYLLGCPVRGIVLSAWESL--  274

Query  792   EGSLNV--QAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
               SL +  QAGT F D +   E++ G ++   ++R+S + +AG+A E L +G AEGG +D
Sbjct  275   --SLGIPGQAGTLFFDRKLESELSTGFLTDATIDRYSIVLMAGIAAEALEYGQAEGGQSD  332

Query  966   INQLDFLLQSLG--FTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
                L  +L  L   +++++  +Q RWAVL  ILI+++ + A   L   +S  + +G C
Sbjct  333   EAALLRVLTCLNPPWSKERVFNQARWAVLQAILIIKKQKKAYDALVHALSSKKPLGDC  390



>ref|WP_008179856.1| hypothetical protein [Moorea producens]
 gb|EGJ34600.1| hypothetical protein LYNGBM3L_13750 [Moorea producens 3L]
Length=222

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 109/198 (55%), Gaps = 7/198 (4%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             +LN++P      + G+L L+T D  SF G    L+LD +  T + ++  R+I+HEAGHFL
Sbjct  25    LLNISPAIPAVTTFGVLSLVTLDGFSFQGKGLTLLLDVLAST-NPEHRGRIIRHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFL--EEVNKGQVSATMLNRFSC  899
             +AYLLGI   GYTL++ EAL KEG L    G +F D E L  +  N  ++  T L+RF  
Sbjct  84    VAYLLGIPITGYTLSAWEAL-KEGQLG-NGGVSF-DTEALSAKAYNLREMRLT-LDRFCT  139

Query  900   IALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHEN  1079
             + +AG+A E +++   EGG  D  +L   L+ LGF+  +   + RWA      ++  H  
Sbjct  140   VWMAGIAAETIVYENVEGGAEDCEKLRDALEGLGFSGSEYSVKARWAERQATSMITEHWE  199

Query  1080  ARAKLAEGMSEGRSVGFC  1133
             +   L   M +  SV  C
Sbjct  200   SYEALVAAMEKRASVAEC  217



>ref|WP_006626173.1| MULTISPECIES: hypothetical protein [Arthrospira]
 gb|EDZ94713.1| conserved hypothetical protein [Arthrospira maxima CS-328]
 emb|CCE16033.1| conserved exported hypothetical protein [Arthrospira sp. PCC 
8005]
 gb|EKD05802.1| hypothetical protein SPLC1_S590200 [Arthrospira platensis C1]
 emb|CDM94596.1| conserved exported protein of unknown function [Arthrospira sp. 
PCC 8005]
Length=227

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 102/176 (58%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+ S  G    +++D    + S    +R++ HEAGHFL+AYLLG+   GY LT+ EA 
Sbjct  45    TLDTFSLQGQGSTILVDWFAGS-SGSRRDRIVHHEAGHFLMAYLLGVPVEGYALTAWEAF  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             ++      Q G  F D E +E+++ G +S+  ++++  + +AG+A E L++  A GGL+D
Sbjct  104   RQ--GQKAQGGVRFNDVELMEQLDHGVISSEAIDKYCKVWMAGIAAEILVYDQALGGLSD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
                +  L   LG + + A+ + RWA+L    +L+++ +A   LA  M+EG SV  C
Sbjct  162   RQNIRRLWTQLGRSPQDAEIKERWAILQAKTLLKQNWSALEALAAAMAEGASVAEC  217



>ref|WP_007354337.1| MULTISPECIES: hypothetical protein [Kamptonema]
 emb|CBN55114.1| conserved exported hypothetical protein [ [[Oscillatoria] sp. 
PCC 6506]
Length=225

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 92/176 (52%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
              FD+  + G   A++ D +  + S+   +R+++HEAGHFL+AYLL I   GY L + EA 
Sbjct  45    AFDTFQWQGQGSAILSDVLAGS-SDDRRDRILRHEAGHFLVAYLLEIPVSGYALNAWEAF  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K+      Q G  F D E   ++ KG  S  +L+R+  + +AG+A E L++G AEGG  D
Sbjct  104   KQ--GQTAQGGVRFEDQELASQMQKGAFSVQLLDRYCTVWMAGIAAENLVYGNAEGGAED  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              N++  +L  L     +   +   A+L    ++  H+ A   L E M +   V  C
Sbjct  162   RNKIRLILSQLRRPASEFKQKENRALLQARNLIENHKLAYEALVEAMKKREPVAEC  217



>ref|XP_005792829.1| hypothetical protein EMIHUDRAFT_57188, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD40400.1| hypothetical protein EMIHUDRAFT_57188, partial [Emiliania huxleyi 
CCMP1516]
Length=163

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 81/157 (52%), Gaps = 5/157 (3%)
 Frame = +3

Query  675   SEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV  854
             S  Y  ++++HEAGHFL AYLLG       L  L A   +      AGT F D    + +
Sbjct  1     SPGYRRKIVEHEAGHFLTAYLLGCPVEACLLDPLRA-ATDPRFQGAAGTVFFDPLLADAM  59

Query  855   NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSL----GFTQKKAD  1022
               G V  + ++R+S + +AG+A E  L G AEGG AD   L  LL SL     +   K  
Sbjct  60    RAGSVPRSSVDRYSVVVMAGIAAEAELHGQAEGGRADEQALVRLLTSLDGGRSWDYAKIT  119

Query  1023  SQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             +Q RWA  +  L++R H  A   L E ++ GRSVG C
Sbjct  120   NQARWAASSAALLVRAHRPAFDALVEALAAGRSVGTC  156



>ref|WP_009557215.1| ATP-dependent Zn protease [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ68450.1| ATP-dependent Zn protease [Oscillatoriales cyanobacterium JSC-12]
Length=229

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 90/174 (52%), Gaps = 3/174 (2%)
 Frame = +3

Query  612   DSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKK  791
             D+ ++ G    L+LD +    S  + +RV++HEAGHFL+A+ L I   GYTL + E+ ++
Sbjct  47    DTFNWQGKGSTLLLDRLA-GFSADHRDRVVRHEAGHFLVAHQLNIPVTGYTLNAWESFRR  105

Query  792   EGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADIN  971
               +   Q G  F   E   E+ +G +SA +L+R+  I +AG A E+L +G  +GG  D  
Sbjct  106   GQA--GQGGVQFNTQELDAELQQGTLSAHLLDRYCTIWMAGAAAEHLTYGNVQGGTDDFQ  163

Query  972   QLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             +L  +L  L F+      + RWA L    +L+ H      L   M    SV  C
Sbjct  164   KLRLILSRLQFSPAAIQQKERWAALQAKTLLQEHWETYESLIAAMQRRASVEEC  217



>ref|XP_005762339.1| hypothetical protein EMIHUDRAFT_45563, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD09910.1| hypothetical protein EMIHUDRAFT_45563, partial [Emiliania huxleyi 
CCMP1516]
Length=163

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 80/157 (51%), Gaps = 5/157 (3%)
 Frame = +3

Query  675   SEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEV  854
             S  Y  ++++HEAGHFL AYLLG       L  L A   +      AGT F D    + +
Sbjct  1     SPGYRRKIVEHEAGHFLTAYLLGCPVEACLLDPLRA-ATDPRFQGAAGTVFFDPLLADAM  59

Query  855   NKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSL----GFTQKKAD  1022
               G V  + ++R+S + +AG+A E  L G AEGG AD   L  LL SL     +   K  
Sbjct  60    RAGSVPRSSVDRYSVVVMAGIAAEAELHGQAEGGRADEQALVRLLTSLDGGRSWDYAKIT  119

Query  1023  SQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             +Q RWA  +  L +R H  A   L E ++ GRSVG C
Sbjct  120   NQARWAASSAALCIRAHRPAFDALVEALAAGRSVGTC  156



>ref|WP_019492843.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=225

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 107/196 (55%), Gaps = 3/196 (2%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             +++L+P      ++ +L + T DS +  G  G + LD I  + S  +  R+  HEAGHFL
Sbjct  25    LVHLSPAVPAVATVTILGIATLDSFALQGKGGNVFLDWIA-SFSPAHRERIAHHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +A  LGI    YTL +  ALK +G   +  G +F D     E+ + Q+SA  L+R+  + 
Sbjct  84    VATKLGIPVVSYTLNAWSALK-QGQAGL-GGVSFDDANLESELGQRQISAQTLDRYCTVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E L++  AEGG  D  +L  LL+SLGF++   + + R+ +L    +L+ + +A 
Sbjct  142   MAGIAAETLVYNNAEGGADDKTKLVALLKSLGFSESTFNQKQRFCMLQAKSLLQENWSAY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L   M +  SV  C
Sbjct  202   KALVNAMKQRASVEEC  217



>ref|WP_015229271.1| hypothetical protein [Dactylococcopsis salina]
 ref|YP_007171630.1| hypothetical protein Dacsa_1597 [Dactylococcopsis salina PCC 
8305]
 gb|AFZ50273.1| hypothetical protein Dacsa_1597 [Dactylococcopsis salina PCC 
8305]
Length=247

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 93/179 (52%), Gaps = 11/179 (6%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             TFD++++N     L LD      + +   RV+ HEAGHFL AY LGI   GY+LT+ EA 
Sbjct  65    TFDTLTWNNRGVTLFLDLFS---TAEQRERVLHHEAGHFLAAYFLGIPITGYSLTAWEAF  121

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSAT---MLNRFSCIALAGVATEYLLFGCAEGG  956
             +++     Q G   V F+       GQ       ML+RF  +  AG+A E L +G AEGG
Sbjct  122   RQK-----QPGKGGVQFDTTALEKGGQKPNQINLMLDRFCTVWCAGMAAEILSYGNAEGG  176

Query  957   LADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               D +QL  +L+ LG+   +   +  W+ L    ++ R++ A   L + M +G SV  C
Sbjct  177   EDDRSQLQAILKELGYPPSQRKQKQEWSTLQAKSLIERNQEAYQTLIKVMRQGASVESC  235



>ref|WP_006633839.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK86847.1| hypothetical protein MicvaDRAFT_3632 [Microcoleus vaginatus FGP-2]
Length=225

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 93/176 (53%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T DS  + G  G ++LD +G + S++  +R++ HEAGHFL+A+LLGI    Y L + EA 
Sbjct  45    TLDSFQWQGQGGTILLDWLGGS-SKQKRDRILHHEAGHFLVAHLLGIPVTSYALNAWEAF  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K+      Q G  F D +   ++  G +SA +L+++  + +AG+  E  ++G A+GG  D
Sbjct  104   KQ--GQTAQGGVRFEDEQLASQLQSGTLSAQLLDQYCTVWMAGIVAEKFVYGSAQGGAED  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               ++  +L  L     +   +  W +L    ++  H++A   L   M E  +V  C
Sbjct  162   RTKISAILTQLRRPSSEIQLKQNWGLLRAKNLIENHKSAYEALVAAMEERATVAEC  217



>ref|WP_015956166.1| hypothetical protein [Cyanothece sp. PCC 7424]
 ref|YP_002379449.1| hypothetical protein PCC7424_4211 [Cyanothece sp. PCC 7424]
 gb|ACK72581.1| conserved hypothetical protein [Cyanothece sp. PCC 7424]
Length=223

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 115/238 (48%), Gaps = 23/238 (10%)
 Frame = +3

Query  420   LEELRLNGIETVSLLSPVDATLGSIERNLQIAALSGGVAAWNVLNLNPQQIlyislgllf  599
             +E+  LN I     +  + A LG +     I+     VA  +VL L              
Sbjct  1     MEQTALNVIAISIFIMTLSALLGPL---FHISPFIPAVATLSVLGLT-------------  44

Query  600   llTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLE  779
               T D ++FN     ++LD +     E++  R+I HEAGHFL+AYLLGI   GYTL++ E
Sbjct  45    --TLDGLAFNSRGITVLLDLLS---GEQHRQRIIHHEAGHFLVAYLLGIPVTGYTLSAWE  99

Query  780   ALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGL  959
             A++++ S     G  F      E+         M+ RF  + +AG+A E L++G ++GG 
Sbjct  100   AVQQKQS--GLGGVIFDSTALTEKTLTPTEMPLMIERFCTVWMAGIAAETLIYGESQGGE  157

Query  960   ADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              D  Q+   L+  G  Q   + + RWA+L    +L +H+++   L + M +  SV  C
Sbjct  158   EDRFQVRSALKLAGLPQFNYEQKERWALLQAKNLLEKHQSSYEALVKAMEQRVSVEEC  215



>ref|WP_015151609.1| hypothetical protein [Oscillatoria acuminata]
 ref|YP_007088919.1| hypothetical protein Oscil6304_5515 [Oscillatoria acuminata PCC 
6304]
 gb|AFY84999.1| hypothetical protein Oscil6304_5515 [Oscillatoria acuminata PCC 
6304]
Length=230

 Score =   100 bits (248),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 93/176 (53%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D++ + G    LI+D     +S  + +RV++HEAGHFL+AYLL I   GY L + EA 
Sbjct  45    TLDTLGWQGKGANLIVDVFAG-MSPDHRSRVLRHEAGHFLVAYLLEIPITGYALNAWEAF  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K+  S     G  F D E L E+ +G +SA + +R+  + +AG+A E L +  AEGG  D
Sbjct  104   KQGQSAG--GGVQFDDQELLAELQQGSLSAQLFDRYCIVWMAGIAAETLTYERAEGGAED  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               +L  +L     +   A  + RWA+L    ++  + +A   L   M +  +V  C
Sbjct  162   RTKLKAILAQNRKSATDAQLKERWAILQAKTLIESNLDAYQSLVTAMEQRLAVSEC  217



>ref|WP_015171342.1| hypothetical protein [Geitlerinema sp. PCC 7407]
 ref|YP_007108827.1| hypothetical protein GEI7407_1281 [Geitlerinema sp. PCC 7407]
 gb|AFY65775.1| hypothetical protein GEI7407_1281 [Geitlerinema sp. PCC 7407]
Length=231

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 103/196 (53%), Gaps = 5/196 (3%)
 Frame = +3

Query  549   LNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLI  728
             LNL+P       +G+L + T D+ ++ G  G L++D +  + S+ + +RV+ HEAGHFL 
Sbjct  26    LNLSPAIPAIAVVGILGIATLDAWAWQGQSGTLLIDWLS-SFSQAHRDRVLHHEAGHFLA  84

Query  729   AYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLE-EVNKGQVSATMLNRFSCIA  905
             AY+LGI    Y L + EA ++      Q G  F D   LE E+ +G +S+  ++R+  + 
Sbjct  85    AYILGIPVTSYALNAWEAFRQ--GQPAQGGVQF-DLGPLEGELQQGLISSVSIDRYCTVW  141

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG A E L++G  EGG  D  +   L   +  + ++   +VRW+ L    +L  H  A 
Sbjct  142   MAGAAAEKLVYGNVEGGADDRAKFQQLWAQMRRSPEEGSQKVRWSDLRARTLLETHWEAY  201

Query  1086  AKLAEGMSEGRSVGFC  1133
               L   M +  SV  C
Sbjct  202   EALVAAMKQRASVEDC  217



>ref|WP_019509095.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=237

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 106/198 (54%), Gaps = 9/198 (5%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             + N++P      + G+L L T D++S+N    +L+LD      S +   R+IQHEAGHFL
Sbjct  25    IFNISPFVPAAATFGILSLATVDTLSWNSRGVSLLLDLFA---SAEQRQRIIQHEAGHFL  81

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFL--EEVNKGQVSATMLNRFSC  899
              AY LGI   GYTL++ E +K +G L  + G +F D E L  +  +  Q+  T L+RF  
Sbjct  82    TAYFLGIPITGYTLSAWEVIK-QGQLG-RGGVSF-DTEALTIQPFDPQQMRLT-LDRFCT  137

Query  900   IALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHEN  1079
             + +AG+A E L +G  +GG  D +QL   L   G  +     + RWA L    +L RH+ 
Sbjct  138   VWMAGIAAEKLAYGDTQGGQEDRSQLKQALMMAGLPEAAYPLKERWAQLQATNLLTRHQQ  197

Query  1080  ARAKLAEGMSEGRSVGFC  1133
             +   L E M +  SV  C
Sbjct  198   SYTALIEAMKQNASVEEC  215



>ref|WP_023065940.1| hypothetical protein [Lyngbya aestuarii]
 gb|ERT07784.1| hypothetical protein M595_2155 [Lyngbya aestuarii BL J]
Length=229

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 96/176 (55%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+ +  G  G++IL      +S +  +R+++HEAGHFL+AYL+ I   GY L +LEA 
Sbjct  45    TIDTFALQGQ-GSMILIEGIEGISPEKRDRILRHEAGHFLVAYLMNIPISGYALNTLEAF  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K+      Q G  F D E   ++ KGQ+SA  ++++  + +AGVA E L +  A+GGL D
Sbjct  104   KQ--GQTGQGGVRFNDQELWIQLQKGQLSAQRIDQYCTVWMAGVAAEILAYENAQGGLED  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               ++  +   L      A+ + RWA L    ++ ++++A   L E M +   V  C
Sbjct  162   RGKIRAVWTQLKRPLSDANLKERWATLQAQTLIEQNQSAYTALVEAMEQRICVEEC  217



>ref|WP_006619355.1| hypothetical protein [Arthrospira platensis]
 ref|YP_005069750.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI91212.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR55050.1| hypothetical protein APPUASWS_024835 [Arthrospira platensis str. 
Paraca]
Length=227

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 89/156 (57%), Gaps = 3/156 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+ S  G    +++D +    S    +R++ HEAGHFL+AYLLG+   GY LT+ EA 
Sbjct  45    TLDTFSLQGQGSTILVDWLAGA-SGSRRDRIVHHEAGHFLMAYLLGVPVEGYALTAWEAF  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             ++      Q G  F D E +E++N G +S+  ++++  + +AG+A E L++  A GG++D
Sbjct  104   RQ--GQKAQGGVRFNDVELMEQLNHGVISSEAIDKYCKVWMAGIAAEILVYDQALGGVSD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRH  1073
                +  L   L  + + A  + RWA+L    +L+++
Sbjct  162   RQNIRRLWTQLRRSPQDAQIKERWAILQAQTLLKQN  197



>ref|WP_013322143.1| hypothetical protein [Cyanothece sp. PCC 7822]
 ref|YP_003887312.1| hypothetical protein Cyan7822_2055 [Cyanothece sp. PCC 7822]
 gb|ADN14037.1| conserved hypothetical protein [Cyanothece sp. PCC 7822]
Length=224

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 92/176 (52%), Gaps = 5/176 (3%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D +++NG    ++LD +     E++  RVI HEAGHFL AY LGI   GY L+  EA 
Sbjct  45    TLDGLAWNGRGITILLDILS---GEQHRQRVIHHEAGHFLAAYFLGIPVTGYALSGWEAF  101

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K +G   +  G  F     LE+         +L+RFS + +AG+A E L++G ++GG  D
Sbjct  102   K-QGQPGL-GGVMFDTTALLEKKVNFTEMPLILDRFSTVWMAGIAAETLIYGESKGGEED  159

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               +L   LQ  G +Q     + RWA+L    ++ +H ++   L   M +  SV  C
Sbjct  160   RQKLRAALQWAGVSQNSYQQKERWALLQAKNLIEKHRSSYEALVTAMKQRASVEEC  215



>ref|WP_009342478.1| hypothetical protein [Raphidiopsis brookii]
 gb|EFA73466.1| conserved hypothetical protein [Raphidiopsis brookii D9]
Length=222

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 95/178 (53%), Gaps = 7/178 (4%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+  F G  G + LD +    S  Y  R+I HEAGHFL+A+LLGI   GYTL++ EA 
Sbjct  45    TLDNFRFEGRGGTIFLDWLAR-FSPTYKERIIYHEAGHFLVAHLLGITVTGYTLSAWEAW  103

Query  786   K--KEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGL  959
             K  + G    Q G    D E  +++ +G++  +M+ ++  I +AG+A E L+F  AEGG 
Sbjct  104   KVGQPG----QGGIILGDDEIAKQLERGKIGVSMVEKYCNIWMAGIAAELLVFNSAEGGG  159

Query  960   ADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              D  +L+  L  LGF +   + + R+ +L    +L ++ +    L + M     V  C
Sbjct  160   DDKAKLNQFLTVLGFQETLFEQKQRFHLLQAKNLLEQNWHTYQHLVQAMRNRLDVEEC  217



>ref|WP_038331353.1| ATP-dependent Zn protease, partial [filamentous cyanobacterium 
ESFC-1]
Length=222

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 96/178 (54%), Gaps = 7/178 (4%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D++   G    L+LD +    S +Y +RV++HEAGHFL+AY L I  + YTL + EAL
Sbjct  45    TADTLGLQGKGMTLLLDGVSR-FSGEYRDRVVRHEAGHFLVAYHLDIPIKDYTLNAWEAL  103

Query  786   KKEGSLNVQAGTAFVDFEFL--EEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGL  959
             K +G   +  G A VD E L  E++  G++   +++R S + +AG+A E L +G A+GG 
Sbjct  104   K-QGQNGI--GGAIVDTEALLPEKLPPGELK-QLIDRLSAVWMAGIAAETLSYGEAQGGR  159

Query  960   ADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              D  +L   L   G  + +   + RW  L    +L+ H++A   L   M    SV  C
Sbjct  160   DDREKLAATLDYFGRPESETPLKQRWGELQATTLLKEHQDAYEALVNAMETQASVSEC  217



>ref|WP_006510695.1| hypothetical protein [Xenococcus sp. PCC 7305]
 gb|ELS02221.1| hypothetical protein Xen7305DRAFT_00019340 [Xenococcus sp. PCC 
7305]
Length=223

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 99/197 (50%), Gaps = 7/197 (4%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             +LN+ P      + G+L L T D++S+N     L LD     ++ +   RVI HEAGHFL
Sbjct  25    ILNIPPAVPAITTFGILGLATIDTLSWNNKGATLFLDLF---VTSEQRQRVIHHEAGHFL  81

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAF-VDFEFLEEVNKGQVSATMLNRFSCI  902
              AY LGI    Y+LT+ EA +K G    Q G  F  +    + V+K  +  T L+R   +
Sbjct  82    TAYFLGIPITEYSLTAWEAFRK-GHYG-QGGVVFEPNSAISKTVDKKDLPLT-LDRLCTV  138

Query  903   ALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENA  1082
              +AG+A E L++  AEGG  D  QL   L   GF       + RW  L    +L RH+ A
Sbjct  139   WMAGIAAEKLVYDEAEGGQEDCQQLQIALNMAGFPNTIYSQKERWGQLQATSLLERHKRA  198

Query  1083  RAKLAEGMSEGRSVGFC  1133
                L   M+E +SV  C
Sbjct  199   FDALVIAMAERKSVTEC  215



>ref|WP_017718959.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=231

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 103/196 (53%), Gaps = 5/196 (3%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             + NL P      +  +L L T D++S + G G +++D +     E+   RV++HEAGHFL
Sbjct  25    LFNLPPAVPAIATFVILGLATLDTLS-SAGAGTILMDWLEGASPER-RERVLRHEAGHFL  82

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIA  905
             +A+LLGI   GY L + EA ++  S   Q G  F D E   ++  G +S+ ML R+  + 
Sbjct  83    VAHLLGISVTGYALNAWEAFRQGQS--AQGGVRFEDEELAGQLQSGVLSSQMLERYCTVW  140

Query  906   LAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENAR  1085
             +AG+A E  ++G A GG  D  +L  +L  L    ++A  + RWA L    ++  H+ A 
Sbjct  141   MAGIAAENFVYGRAGGGTEDRQKLRAVLAQL-RRPEQAPLKERWACLQARTLIESHQPAY  199

Query  1086  AKLAEGMSEGRSVGFC  1133
               L   M++   V  C
Sbjct  200   EALVAAMAQRLPVAEC  215



>ref|WP_017288276.1| hypothetical protein [Leptolyngbya boryana]
Length=225

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 104/199 (52%), Gaps = 9/199 (5%)
 Frame = +3

Query  546   VLNLNPQQIlyislgllfllTFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFL  725
             +LN +P      +  +L L T DS  + G FG L LD +    S  + +RV++HEAGHFL
Sbjct  25    LLNFSPAIPAIATFSILGLATLDSFQWQGKFGTLCLDWLAR-FSPAHRDRVLRHEAGHFL  83

Query  726   IAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLE---EVNKGQVSATMLNRFS  896
             +A  L I   GYTL + +A ++      QAG   V F+  E   E+ +G++S+ +L R+ 
Sbjct  84    VAQQLQIPVVGYTLNAWQAFRQG-----QAGLGGVQFDTQELEAELQQGKLSSQLLERYC  138

Query  897   CIALAGVATEYLLFGCAEGGLADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHE  1076
              + +AG+A E L +G +EGG  D  +    L  L     +   + R ++L    +L+ H+
Sbjct  139   TVWMAGIAAEQLAYGNSEGGADDRQKFRETLTKLRIPASELPQRERLSILRAKDLLKNHQ  198

Query  1077  NARAKLAEGMSEGRSVGFC  1133
             +A   L   + E +S+  C
Sbjct  199   SAYDALVVALQENQSIEQC  217



>ref|WP_015203927.1| hypothetical protein [Crinalium epipsammum]
 ref|YP_007143329.1| hypothetical protein Cri9333_2980 [Crinalium epipsammum PCC 9333]
 gb|AFZ13819.1| hypothetical protein Cri9333_2980 [Crinalium epipsammum PCC 9333]
Length=224

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 94/176 (53%), Gaps = 8/176 (5%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D++S+ G    L+LD      S +Y +R+I+HEAGHFL+AYLLGI   GYTL++ EA 
Sbjct  45    TLDTLSWRGKGVNLLLDGFAR-FSPEYRDRIIKHEAGHFLVAYLLGIPITGYTLSAWEAF  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             +K      Q G +F   EF         +A ++ R+  + +AG+A E L++G AEGG  D
Sbjct  104   QK--GQPGQGGVSFAPQEF-----TSPQAAIIIQRYCTVWMAGIAAENLVYGNAEGGGED  156

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               +L  +L  +G +  +     R+ +L    +++ H      +   M + +SV  C
Sbjct  157   RQKLQEVLSGMGRSVNECLQLERFCILQAKTMIQEHLKVYESIVAAMQQRKSVEEC  212



>ref|WP_006278247.1| hypothetical protein [Cylindrospermopsis raciborskii]
 gb|EFA68956.1| conserved hypothetical protein [Cylindrospermopsis raciborskii 
CS-505]
Length=222

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 92/178 (52%), Gaps = 7/178 (4%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+  F G  G + LD +    S  Y  R+I HEAGHFL+A+L GI   GYTL++ EA 
Sbjct  45    TLDNFGFEGRGGTIFLDWLAR-FSPTYQERIIYHEAGHFLVAHLSGISVTGYTLSAWEAW  103

Query  786   K--KEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGL  959
             K  + G    Q G    D E   ++ +G++  +M+ ++  I +AG+A E L+F  AEGG 
Sbjct  104   KIGQPG----QGGIILGDDEIARQLERGKIGVSMVEKYCNIWMAGIAAELLVFNSAEGGG  159

Query  960   ADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              D  +L+  L  LGF +   + + R+ +L    +L ++      L + M     V  C
Sbjct  160   DDKAKLNQFLTVLGFQETLFEQKQRFHLLQAKNLLEQNWQTYQNLVQAMRNRLDVEEC  217



>ref|WP_015784372.1| hypothetical protein [Cyanothece sp. PCC 8802]
 ref|YP_003138522.1| hypothetical protein Cyan8802_2837 [Cyanothece sp. PCC 8802]
 gb|ACV01687.1| conserved hypothetical protein [Cyanothece sp. PCC 8802]
Length=230

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 95/176 (54%), Gaps = 7/176 (4%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             + DS+S+      L+L   G   S +   R+I HEAGHFL+AY LGI   GYTL++ EA 
Sbjct  45    SVDSLSWQSKGLTLVL---GLLSSPQERQRIIHHEAGHFLVAYCLGIPVTGYTLSAWEAF  101

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K +G +    G  F D   L ++ K Q +  +  RF  + +AG+A E +++G A GG  D
Sbjct  102   K-QGQIGY-GGVKF-DLTLLSDL-KVQETPLIFERFFTVWMAGIAAERVIYGNAIGGEQD  157

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
                L  +++  G   +    + RWA+L    ++ +H++A   L E M++G SV  C
Sbjct  158   RQILREMMKLAGILPQNYQQKERWAILQAKTLIEKHQDAYQSLGEMMAQGASVEDC  213



>ref|WP_036002232.1| ATP-dependent Zn protease [Leptolyngbya sp. JSC-1]
Length=237

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 92/177 (52%), Gaps = 2/177 (1%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D++S+ G  G L++D    + S ++  RV+QHEAGHFL A+LL I   GYTL++ E+ 
Sbjct  45    TLDTLSWRGQVGNLVVDWFA-SFSAEHRARVVQHEAGHFLAAHLLEIPVTGYTLSAWESF  103

Query  786   KKEGSLNVQAGTAFVDFEF-LEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLA  962
             ++          A    EF L++    Q+S  +L+RF  + +AG+A E L +G AEGG  
Sbjct  104   RQGQPGRGGVSFALEPLEFQLQQGQSTQLSTQLLDRFCTVWMAGIAAEQLTYGNAEGGGD  163

Query  963   DINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             D  +L  L   L     +   + RWA+L    +L  +  A   L   M++   V  C
Sbjct  164   DRLKLRLLWSQLKRPDSEGALKERWALLQAKTLLESNRVAYDALVTAMAQRVPVEAC  220



>ref|WP_012596518.1| hypothetical protein [Cyanothece sp. PCC 8801]
 ref|YP_002373413.1| hypothetical protein PCC8801_3286 [Cyanothece sp. PCC 8801]
 gb|ACK67257.1| conserved hypothetical protein [Cyanothece sp. PCC 8801]
Length=230

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 95/176 (54%), Gaps = 7/176 (4%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             + DS+S+      L+L   G   S +   R+I HEAGHFL+AY LGI   GYTL++ EA 
Sbjct  45    SVDSLSWQSKGLTLVL---GLLASPQERQRIIYHEAGHFLVAYCLGIPVTGYTLSAWEAF  101

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K +G +    G  F D   L ++ K Q +  +  RF  + +AG+A E +++G A GG  D
Sbjct  102   K-QGQIGY-GGVKF-DLTLLSDL-KVQETPLIFERFFTVWMAGIAAERVIYGNAIGGEQD  157

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
                L  +++  G   +    + RWA+L    ++ +H++A   L E M++G SV  C
Sbjct  158   RQILREMMKLAGILPQNYQQKERWAILQAKTLIEKHQDAYQSLGEMMAQGASVEDC  213



>ref|WP_017711813.1| hypothetical protein [Prochlorothrix hollandica]
Length=239

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 91/176 (52%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T DS++++     L++D      S  Y +R+I HEAGHFL+A LLG+   GY L++ EAL
Sbjct  45    TVDSLTWSSQGTTLVVDWFAQR-SAGYRDRIIHHEAGHFLVATLLGVPVTGYALSAWEAL  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             ++      Q G  F D     ++ +G V+   ++R+  + LAG   E L++G  EG   D
Sbjct  104   RQ--GQQAQGGVRFEDGNLQAQLEEGYVTGATVDRYCQVWLAGGVAEQLVYGTVEGAGDD  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               ++  LL  L  + +    + RWA L    +L+RH ++   L + + +   V  C
Sbjct  162   RQKVRRLLAYLPVSPQDRQQKQRWATLQAKSMLQRHWDSYETLVQLLRDNALVEDC  217



>ref|WP_024545220.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=237

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 91/177 (51%), Gaps = 8/177 (5%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+ ++ G    L LD    T +E+   R+++HEAGHFL  +LLGI   GY+LT  EAL
Sbjct  45    TVDTFNWQGQGMTLFLDLF--TPAER-RQRILRHEAGHFLAGHLLGIPITGYSLTPWEAL  101

Query  786   KKEGSLNVQAGTAFVDFEFLE-EVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLA  962
             K++     Q G  F D E +E  +   Q    +L R S   +AG+A E L +G A GG A
Sbjct  102   KQQPG---QGGVTF-DLEAVEISLKNPQQLNLLLERLSTTLMAGIAAENLAYGQALGGAA  157

Query  963   DINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             D  QL  LL  LG +      + +WA+L    +L RH+     L   M + + +  C
Sbjct  158   DRAQLRQLLAKLGISPGTYPQREQWAILQAKNLLERHQETYETLVTAMGDRQPLEAC  214



>ref|WP_002759281.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH96950.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9717]
Length=224

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 92/179 (51%), Gaps = 11/179 (6%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+++FN     L+LD +  +   K+  RVI HEAGHFL AY+LGI    Y+LT+ EA 
Sbjct  45    TVDTLTFNNRGVTLLLDALSPS---KHRQRVIHHEAGHFLTAYILGIPIASYSLTAWEAF  101

Query  786   KKEGSLNVQAGTAFVDFEF--LEEVNKGQVS-ATMLNRFSCIALAGVATEYLLFGCAEGG  956
             ++      Q G   V FE   LE+  K        L R S + +AG+A E L++G AEGG
Sbjct  102   RQG-----QEGVGGVQFELADLEQKVKNFTDFPAFLERISTVWMAGIAAETLVYGKAEGG  156

Query  957   LADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              +D   L   L+  G ++     + RW++L    +L + + A   L   M +  SV  C
Sbjct  157   ESDRFYLQSALKLAGVSENNYAQKERWSLLQAKTLLEKQQTAYQALVIAMEKRASVEEC  215



>ref|XP_002184685.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43744.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=170

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 86/163 (53%), Gaps = 10/163 (6%)
 Frame = +3

Query  675   SEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL--KKEGSLNVQAGTAFVDFEFLE  848
             S     ++++HEAGHFL AY+LG    G  L++  AL  ++ G+  V AGT+F D E   
Sbjct  1     SPGIQTKILRHEAGHFLAAYVLGCPVEGIVLSAWAALQDRRFGARQVSAGTSFFDPELSA  60

Query  849   EVNKGQ-VSATMLNRFSCIALAGVATEYLLFGCAEGGLADINQLDFLLQSL----GFTQK  1013
             ++N  Q V  + ++R+S I +AG+A E   +G A+GG  D   L   L  L    G    
Sbjct  61    QINNQQAVKRSAVDRYSIIVMAGIAAEAEQYGRADGGAGDEMALVAFLSQLNGGRGGGPW  120

Query  1014  KADS---QVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              AD+   Q RW  L  +L+LR +  A   L + +  G S+G C
Sbjct  121   NADAIRNQARWGALQAVLLLRHYRPAYDALVDALERGGSLGDC  163



>ref|WP_009784766.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW36553.1| hypothetical protein L8106_28286 [Lyngbya sp. PCC 8106]
Length=229

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 96/176 (55%), Gaps = 3/176 (2%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+ +  G  G++IL      +S +  +R+++HEAGHFL+AYL+ I   GY L +LEA 
Sbjct  45    TIDTFALQGQ-GSMILIEGIEGISPEKRDRILRHEAGHFLVAYLMNIPISGYALNTLEAF  103

Query  786   KKEGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLAD  965
             K+      Q G  F D E   ++  GQ+SA  ++++  + +AGVA E L +  A+GG  D
Sbjct  104   KQ--GQTGQGGVRFNDQELWIQLQTGQLSAQRIDQYCTVWMAGVAAEILAYENAQGGQED  161

Query  966   INQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
               ++  +   L     +A+ + R A L    ++ ++++A A L E M +  SV  C
Sbjct  162   RGKIRAVWTQLKRPLSEANLKERLATLQAQTLIEQNQSAYAALVEAMKQRISVEEC  217



>ref|WP_002797278.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI25161.1| Similar to tr|Q8YUD8|Q8YUD8 [Microcystis aeruginosa PCC 9809]
Length=224

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 91/179 (51%), Gaps = 11/179 (6%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+++FN     L+LD +  +   K+  RVI HEAGHFL AY+LGI    Y+LT+ EA 
Sbjct  45    TVDTLTFNNRGVTLLLDALSPS---KHRQRVIHHEAGHFLTAYILGIPIASYSLTAWEAF  101

Query  786   KKEGSLNVQAGTAFVDFEF--LEEVNKGQVS-ATMLNRFSCIALAGVATEYLLFGCAEGG  956
             ++      Q G   V FE   LE+  K        L R S + +AG+A E L++G AEGG
Sbjct  102   RQG-----QEGVGGVQFELADLEQKVKNFTDFPAFLERISTVWMAGIAAETLVYGKAEGG  156

Query  957   LADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
              +D   L   L+  G  +     + RW++L    +L + + A   L   M +  SV  C
Sbjct  157   ESDRFYLQSALKLAGVPENNYAQKERWSLLQAKTLLEKQQTAYQALVIAMEKRASVEEC  215



>ref|WP_002737425.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI09732.1| Similar to tr|Q8YUD8|Q8YUD8 [Microcystis aeruginosa PCC 7941]
 gb|ELP54752.1| hypothetical protein O53_3577 [Microcystis aeruginosa TAIHU98]
Length=224

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 92/178 (52%), Gaps = 9/178 (5%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+++FN     L+LD +  +   K+  RVI HEAGHFL AY+LGI    Y+LT+ EA 
Sbjct  45    TVDTLTFNNRGVTLLLDALSPS---KHRQRVIHHEAGHFLTAYILGIPIASYSLTAWEAF  101

Query  786   KK--EGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGL  959
             ++  EG   VQ   A  D E  ++V         L R S + +AG+A E L++G AEGG 
Sbjct  102   RQGQEGVGGVQFDLA--DLE--QKVKNFTDFPAFLERISTVWMAGIAAETLVYGKAEGGE  157

Query  960   ADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             +D   L   L+  G  +     + RW++L    +L + + A   L   M +  SV  C
Sbjct  158   SDRFYLQSALKLAGVPENNYAQKERWSLLQAKTLLEKQQTAYQALVIAMEKRTSVEEC  215



>ref|WP_016514760.1| hypothetical protein [Microcystis aeruginosa]
 gb|EPF24076.1| hypothetical protein MAESPC_00791 [Microcystis aeruginosa SPC777]
Length=224

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 92/178 (52%), Gaps = 9/178 (5%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+++FN     L+LD +  +   K+  RVI HEAGHFL AY+LGI    Y+LT+ EA 
Sbjct  45    TVDTLTFNNRGVTLLLDALSPS---KHRQRVIHHEAGHFLTAYILGIPIASYSLTAWEAF  101

Query  786   KK--EGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGL  959
             ++  EG   VQ   A  D E  ++V         L R S + +AG+A E L++G AEGG 
Sbjct  102   RQGQEGVGGVQFDLA--DLE--QKVKNFTDFPAFLERISTVWMAGIAAETLVYGKAEGGE  157

Query  960   ADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             +D   L   L+  G  +     + RW++L    +L + + A   L   M +  SV  C
Sbjct  158   SDRFYLQSALKLAGVPENNYAQKERWSLLQAKTLLEKQQTAYQALVIAMEKRASVEEC  215



>ref|WP_002754791.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH93178.1| Similar to tr|Q8YUD8|Q8YUD8 [Microcystis aeruginosa PCC 9432]
Length=224

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 92/178 (52%), Gaps = 9/178 (5%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+++FN     L+LD +  +   K+  RVI HEAGHFL AY+LGI    Y+LT+ EA 
Sbjct  45    TVDTLTFNNRGVTLLLDALSPS---KHRQRVIYHEAGHFLTAYILGIPIASYSLTAWEAF  101

Query  786   KK--EGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGL  959
             ++  EG   VQ   A  D E  ++V         L R S + +AG+A E L++G AEGG 
Sbjct  102   RQGQEGVGGVQFDLA--DLE--QKVKNFTDFPAFLERISTVWMAGIAAETLVYGKAEGGE  157

Query  960   ADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             +D   L   L+  G  +     + RW++L    +L + + A   L   M +  SV  C
Sbjct  158   SDRFYLQSALKLAGVPENNYAQKERWSLLQAKTLLEKQQTAYQALVIAMEKRTSVEEC  215



>gb|KDO61590.1| hypothetical protein CISIN_1g016454mg [Citrus sinensis]
 gb|KDO61591.1| hypothetical protein CISIN_1g016454mg [Citrus sinensis]
 gb|KDO61592.1| hypothetical protein CISIN_1g016454mg [Citrus sinensis]
Length=389

 Score = 94.4 bits (233),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 86/150 (57%), Gaps = 6/150 (4%)
 Frame = +3

Query  684   YHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKG  863
             Y  R++ HEAGH LIAYL+G   RG  L  + A++    +  QAGT F D +   E+ +G
Sbjct  228   YKRRILVHEAGHLLIAYLMGCPIRGVILDPIVAMQM--GIQGQAGTQFWDEKMNNELAEG  285

Query  864   QVSATMLNRFSCIALAGVATEYLLFGCAEGGLADIN---QLDFLLQSLGFTQKKADSQVR  1034
             ++S T  +R+S +  AG+A E L++G AEGG  D N    +  LLQ    +  +  +Q R
Sbjct  286   RLSGTAFDRYSMVLFAGIAAEALIYGEAEGGENDENLFRSICVLLQP-PLSMAQMSNQAR  344

Query  1035  WAVLNTILILRRHENARAKLAEGMSEGRSV  1124
             WAVL +  +L+ H++A  +  + +  G S+
Sbjct  345   WAVLQSYNLLKWHKHAHLEAVKALESGSSL  374



>ref|XP_006858219.1| hypothetical protein AMTR_s00062p00186450 [Amborella trichopoda]
 gb|ERN19686.1| hypothetical protein AMTR_s00062p00186450 [Amborella trichopoda]
Length=335

 Score = 93.6 bits (231),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 85/155 (55%), Gaps = 6/155 (4%)
 Frame = +3

Query  672   LSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEE  851
             L   Y  RV+ HEAGH LIAYL+G   RG  L  L A++    +  QAGT F D +  +E
Sbjct  170   LWPPYRRRVLVHEAGHLLIAYLMGCPIRGVILDPLVAVQM--GIQGQAGTQFWDEKLEKE  227

Query  852   VNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGLADIN---QLDFLLQSLGFTQKKAD  1022
             +  G++S+T  +R+  +  AG+A E L++G AEGG  D N    +  LLQ    +  +  
Sbjct  228   LADGRLSSTAFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSICVLLQP-PLSTSQMS  286

Query  1023  SQVRWAVLNTILILRRHENARAKLAEGMSEGRSVG  1127
             +Q RWAV  +  +L+ H+ A     + +  G+ +G
Sbjct  287   NQARWAVQQSYKLLKMHKGAHRAAVKAIENGKGLG  321



>ref|WP_002791119.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI28861.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808]
Length=224

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 92/178 (52%), Gaps = 9/178 (5%)
 Frame = +3

Query  606   TFDSVSFNGGFGALILDTIGHTLSEKYHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEAL  785
             T D+++FN     L+LD +  +   K+  RVI HEAGHFL AY+LGI    Y+LT+ EA 
Sbjct  45    TVDTLTFNNRGVTLLLDALSPS---KHRQRVIYHEAGHFLTAYILGIPIASYSLTAWEAF  101

Query  786   KK--EGSLNVQAGTAFVDFEFLEEVNKGQVSATMLNRFSCIALAGVATEYLLFGCAEGGL  959
             ++  EG   VQ   A  D E  ++V         L R S + +AG+A E L++G AEGG 
Sbjct  102   RQGQEGVGGVQFDLA--DLE--QKVKNFTDFPAFLERISTVWMAGIAAETLVYGKAEGGE  157

Query  960   ADINQLDFLLQSLGFTQKKADSQVRWAVLNTILILRRHENARAKLAEGMSEGRSVGFC  1133
             +D   L   L+  G  +     + RW++L    +L + + A   L   M +  SV  C
Sbjct  158   SDRFYLQSALKLAGVPENNYAQKERWSLLQAKTLLEKQQTAYQALVIAMEKRASVEEC  215



>ref|XP_006422252.1| hypothetical protein CICLE_v10005140mg [Citrus clementina]
 ref|XP_006422254.1| hypothetical protein CICLE_v10005140mg [Citrus clementina]
 ref|XP_006493781.1| PREDICTED: uncharacterized protein LOC102609738 isoform X1 [Citrus 
sinensis]
 ref|XP_006493782.1| PREDICTED: uncharacterized protein LOC102609738 isoform X2 [Citrus 
sinensis]
 ref|XP_006493783.1| PREDICTED: uncharacterized protein LOC102609738 isoform X3 [Citrus 
sinensis]
 ref|XP_006493784.1| PREDICTED: uncharacterized protein LOC102609738 isoform X4 [Citrus 
sinensis]
 ref|XP_006493785.1| PREDICTED: uncharacterized protein LOC102609738 isoform X5 [Citrus 
sinensis]
 ref|XP_006493786.1| PREDICTED: uncharacterized protein LOC102609738 isoform X6 [Citrus 
sinensis]
 ref|XP_006493787.1| PREDICTED: uncharacterized protein LOC102609738 isoform X7 [Citrus 
sinensis]
 gb|ESR35492.1| hypothetical protein CICLE_v10005140mg [Citrus clementina]
 gb|ESR35494.1| hypothetical protein CICLE_v10005140mg [Citrus clementina]
Length=389

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 86/150 (57%), Gaps = 6/150 (4%)
 Frame = +3

Query  684   YHNRVIQHEAGHFLIAYLLGILPRGYTLTSLEALKKEGSLNVQAGTAFVDFEFLEEVNKG  863
             Y  R++ HEAGH LIAYL+G   RG  L  + A++    +  QAGT F D +   E+ +G
Sbjct  228   YKRRILVHEAGHLLIAYLMGCPIRGVILDPIVAMQM--GIQGQAGTQFWDEKMNNELAEG  285

Query  864   QVSATMLNRFSCIALAGVATEYLLFGCAEGGLADIN---QLDFLLQSLGFTQKKADSQVR  1034
             ++S T  +R+S +  AG+A E L++G AEGG  D N    +  LLQ    +  +  +Q R
Sbjct  286   RLSGTAFDRYSMVLFAGIAAEALIYGEAEGGENDENLFRSICVLLQP-PLSMAQMSNQAR  344

Query  1035  WAVLNTILILRRHENARAKLAEGMSEGRSV  1124
             WAVL +  +L+ H++A  +  + +  G S+
Sbjct  345   WAVLQSYNLLKWHKHAHLEAVKALESGSSL  374



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3512314477896