BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22173_g1_i2 len=1604 path=[259:0-946 129:947-1312 1571:1313-1603]

Length=1604
                                                                      Score     E

ref|XP_006360889.1|  PREDICTED: lysine histidine transporter-like...    552   0.0      
ref|XP_004248639.1|  PREDICTED: lysine histidine transporter-like 8     546   0.0      
ref|XP_009614668.1|  PREDICTED: lysine histidine transporter-like 8     539   0.0      
ref|XP_010103306.1|  hypothetical protein L484_014346                   539   0.0      
ref|XP_009802124.1|  PREDICTED: lysine histidine transporter-like 8     536   0.0      
ref|XP_006422496.1|  hypothetical protein CICLE_v10028265mg             534   0.0      
gb|KDO68235.1|  hypothetical protein CISIN_1g010928mg                   530   0.0      
ref|XP_008236102.1|  PREDICTED: lysine histidine transporter-like 8     530   0.0      
ref|XP_006486660.1|  PREDICTED: lysine histidine transporter-like...    528   4e-180   
ref|XP_007199057.1|  hypothetical protein PRUPE_ppa018580mg             526   9e-180   
ref|XP_007041699.1|  Lysine histidine transporter-like 8, putativ...    520   8e-177   
emb|CDP14524.1|  unnamed protein product                                521   1e-176   
ref|XP_011046310.1|  PREDICTED: lysine histidine transporter-like 8     515   1e-174   
ref|XP_009341546.1|  PREDICTED: lysine histidine transporter-like 8     512   1e-173   
ref|XP_004290037.1|  PREDICTED: lysine histidine transporter-like...    509   2e-172   
ref|XP_008236137.1|  PREDICTED: lysine histidine transporter-like 8     509   2e-172   
ref|XP_008236103.1|  PREDICTED: lysine histidine transporter-like 8     507   6e-172   
ref|XP_008382489.1|  PREDICTED: lysine histidine transporter-like 8     507   2e-171   
ref|XP_007201126.1|  hypothetical protein PRUPE_ppa017397mg             504   2e-171   
ref|XP_003631535.1|  PREDICTED: lysine histidine transporter-like 8     503   3e-170   
emb|CBI37767.3|  unnamed protein product                                504   5e-170   
ref|XP_009350855.1|  PREDICTED: lysine histidine transporter-like 8     501   2e-169   
ref|XP_008382490.1|  PREDICTED: lysine histidine transporter-like 8     500   5e-169   
ref|XP_011088671.1|  PREDICTED: lysine histidine transporter-like 8     500   8e-169   
ref|XP_009350856.1|  PREDICTED: lysine histidine transporter-like 8     499   1e-168   
ref|XP_007199979.1|  hypothetical protein PRUPE_ppa025334mg             498   4e-168   
ref|XP_008380969.1|  PREDICTED: lysine histidine transporter-like 8     498   5e-168   
ref|XP_002306215.2|  hypothetical protein POPTR_0004s18770g             495   6e-168   Populus trichocarpa [western balsam poplar]
ref|XP_002300663.2|  hypothetical protein POPTR_0002s01430g             496   5e-167   Populus trichocarpa [western balsam poplar]
emb|CAN73165.1|  hypothetical protein VITISV_027980                     493   2e-166   Vitis vinifera
ref|XP_011034911.1|  PREDICTED: lysine histidine transporter-like 8     494   2e-166   
gb|EYU38007.1|  hypothetical protein MIMGU_mgv1a004728mg                493   7e-166   
ref|XP_008777808.1|  PREDICTED: lysine histidine transporter-like 8     485   7e-163   
ref|XP_002510637.1|  amino acid transporter, putative                   481   5e-161   Ricinus communis
ref|XP_002284824.1|  PREDICTED: lysine histidine transporter-like 8     480   6e-161   Vitis vinifera
ref|XP_010061145.1|  PREDICTED: lysine histidine transporter-like 8     480   7e-161   
ref|XP_010061144.1|  PREDICTED: lysine histidine transporter-like 8     479   2e-160   
ref|XP_010905237.1|  PREDICTED: lysine histidine transporter-like 8     478   3e-160   
ref|XP_011046311.1|  PREDICTED: lysine histidine transporter-like 8     474   9e-160   
gb|KEH30616.1|  transmembrane amino acid transporter family protein     474   7e-159   
ref|XP_008382491.1|  PREDICTED: lysine histidine transporter-like 8     473   1e-158   
ref|XP_010266108.1|  PREDICTED: lysine histidine transporter-like 8     474   1e-158   
ref|XP_004505804.1|  PREDICTED: lysine histidine transporter-like...    471   2e-157   
gb|EYU17533.1|  hypothetical protein MIMGU_mgv1a020550mg                470   7e-157   
gb|KHN09261.1|  Lysine histidine transporter-like 8                     469   2e-156   
ref|XP_010266964.1|  PREDICTED: lysine histidine transporter-like 8     470   2e-156   
ref|XP_011099581.1|  PREDICTED: lysine histidine transporter-like 8     468   3e-156   
ref|XP_003540623.1|  PREDICTED: lysine histidine transporter-like...    468   4e-156   
ref|XP_007017968.1|  Transmembrane amino acid transporter family ...    468   6e-156   
ref|XP_009413044.1|  PREDICTED: lysine histidine transporter-like 8     470   8e-156   
emb|CDP07315.1|  unnamed protein product                                464   2e-155   
emb|CBI18883.3|  unnamed protein product                                481   7e-155   
ref|XP_002448328.1|  hypothetical protein SORBIDRAFT_06g025310          465   9e-155   Sorghum bicolor [broomcorn]
ref|XP_003527647.1|  PREDICTED: lysine histidine transporter-like...    463   2e-154   
ref|XP_008221160.1|  PREDICTED: lysine histidine transporter-like 8     462   3e-154   
ref|XP_004292920.1|  PREDICTED: lysine histidine transporter-like...    463   4e-154   
gb|KHN20128.1|  Lysine histidine transporter-like 8                     462   6e-154   
ref|XP_006435316.1|  hypothetical protein CICLE_v10003187mg             460   3e-153   
ref|XP_010066317.1|  PREDICTED: lysine histidine transporter-like 8     459   5e-153   
ref|XP_007136140.1|  hypothetical protein PHAVU_009G021300g             459   7e-153   
dbj|BAA04838.1|  ORF                                                    459   1e-152   Lilium longiflorum [Easter lily]
ref|XP_004292280.1|  PREDICTED: lysine histidine transporter-like...    458   1e-152   
gb|KCW64166.1|  hypothetical protein EUGRSUZ_G01812                     456   2e-152   
ref|XP_011099569.1|  PREDICTED: lysine histidine transporter-like 8     458   3e-152   
gb|KDP47155.1|  hypothetical protein JCGZ_00046                         457   4e-152   
ref|XP_004238627.2|  PREDICTED: lysine histidine transporter-like 8     457   4e-152   
gb|EEC77802.1|  hypothetical protein OsI_16982                          457   5e-152   Oryza sativa Indica Group [Indian rice]
ref|XP_003580326.1|  PREDICTED: lysine histidine transporter-like 8     457   6e-152   
ref|NP_001053557.1|  Os04g0562100                                       457   7e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004976496.1|  PREDICTED: lysine histidine transporter-like...    457   9e-152   
ref|XP_007224547.1|  hypothetical protein PRUPE_ppa024611mg             456   1e-151   
ref|XP_009613449.1|  PREDICTED: lysine histidine transporter-like 8     456   1e-151   
ref|XP_010101309.1|  hypothetical protein L484_011674                   457   1e-151   
ref|XP_008377097.1|  PREDICTED: lysine histidine transporter-like 8     454   3e-151   
ref|XP_010066316.1|  PREDICTED: lysine histidine transporter-like 8     455   3e-151   
ref|XP_004292281.1|  PREDICTED: lysine histidine transporter-like...    455   3e-151   
emb|CAH67169.1|  H0211B05.6                                             455   4e-151   Oryza sativa [red rice]
ref|XP_006486847.1|  PREDICTED: lysine histidine transporter-like...    452   4e-151   
ref|XP_008669025.1|  PREDICTED: lysine histidine transporter-like 8     455   7e-151   
gb|KDP47154.1|  hypothetical protein JCGZ_00045                         454   7e-151   
ref|XP_010029613.1|  PREDICTED: lysine histidine transporter-like 8     452   6e-150   
ref|XP_007131581.1|  hypothetical protein PHAVU_011G025100g             451   1e-149   
ref|XP_009795070.1|  PREDICTED: lysine histidine transporter-like 8     451   2e-149   
ref|XP_004500895.1|  PREDICTED: lysine histidine transporter-like...    449   5e-149   
ref|XP_006828996.1|  hypothetical protein AMTR_s00001p00244480          452   5e-149   
ref|XP_002528418.1|  amino acid transporter, putative                   449   6e-149   Ricinus communis
ref|XP_003612280.1|  Lysine/histidine transporter                       449   7e-149   
emb|CBI37768.3|  unnamed protein product                                449   1e-148   
ref|XP_006364520.1|  PREDICTED: lysine histidine transporter-like...    450   2e-148   
gb|KDP47161.1|  hypothetical protein JCGZ_00052                         448   3e-148   
ref|XP_002282126.1|  PREDICTED: lysine histidine transporter-like 8     449   4e-148   Vitis vinifera
ref|XP_003612282.1|  Lysine histidine transporter-like protein          447   8e-148   
ref|XP_007017969.1|  Transmembrane amino acid transporter family ...    446   1e-147   
ref|XP_006652643.1|  PREDICTED: lysine histidine transporter-like...    446   1e-147   
gb|KCW68047.1|  hypothetical protein EUGRSUZ_F01730                     444   2e-147   
gb|KEH36283.1|  transmembrane amino acid transporter family protein     445   3e-147   
ref|XP_011088674.1|  PREDICTED: lysine histidine transporter-like 8     446   6e-147   
emb|CAN68028.1|  hypothetical protein VITISV_011224                     446   7e-147   Vitis vinifera
gb|EYU38009.1|  hypothetical protein MIMGU_mgv11b003533mg               444   1e-146   
gb|KCW56546.1|  hypothetical protein EUGRSUZ_I02282                     456   2e-146   
ref|XP_008663510.1|  PREDICTED: lysine histidine transporter-like 8     442   3e-146   
ref|XP_009341548.1|  PREDICTED: lysine histidine transporter-like 8     443   4e-146   
ref|XP_009590574.1|  PREDICTED: lysine histidine transporter-like 8     444   6e-146   
ref|XP_003635214.1|  PREDICTED: lysine histidine transporter-like 8     442   8e-146   
ref|XP_010266965.1|  PREDICTED: lysine histidine transporter-like 8     442   8e-146   
emb|CDP14523.1|  unnamed protein product                                443   2e-145   
ref|XP_002284826.2|  PREDICTED: lysine histidine transporter-like 8     441   2e-145   Vitis vinifera
ref|XP_009758919.1|  PREDICTED: lysine histidine transporter-like 8     442   4e-145   
ref|XP_004292279.1|  PREDICTED: lysine histidine transporter-like...    437   7e-145   
ref|XP_002528416.1|  amino acid transporter, putative                   439   7e-145   Ricinus communis
ref|XP_009351172.1|  PREDICTED: lysine histidine transporter-like 8     439   1e-144   
dbj|BAJ98238.1|  predicted protein                                      438   2e-144   
ref|XP_008392470.1|  PREDICTED: lysine histidine transporter-like 8     438   2e-144   
ref|XP_006342108.1|  PREDICTED: lysine histidine transporter-like...    437   2e-144   
ref|XP_008221159.1|  PREDICTED: lysine histidine transporter-like 8     440   3e-144   
ref|XP_007041698.1|  Transmembrane amino acid transporter family ...    437   7e-144   
ref|XP_003517148.1|  PREDICTED: uncharacterized LOC100500076            437   7e-144   
ref|XP_008447895.1|  PREDICTED: lysine histidine transporter-like 8     436   9e-144   
emb|CBI38472.3|  unnamed protein product                                443   2e-143   
ref|XP_007157963.1|  hypothetical protein PHAVU_002G113000g             436   2e-143   
ref|XP_008337953.1|  PREDICTED: lysine histidine transporter-like 8     436   3e-143   
ref|XP_004512243.1|  PREDICTED: lysine histidine transporter-like...    436   3e-143   
ref|XP_008241984.1|  PREDICTED: lysine histidine transporter-like 8     436   3e-143   
ref|XP_004144930.1|  PREDICTED: lysine histidine transporter-like...    433   1e-142   
ref|XP_009337090.1|  PREDICTED: lysine histidine transporter-like 8     434   2e-142   
ref|XP_004287749.1|  PREDICTED: lysine histidine transporter-like...    434   2e-142   
ref|XP_004161041.1|  PREDICTED: LOW QUALITY PROTEIN: lysine histi...    432   2e-142   
ref|XP_010690282.1|  PREDICTED: lysine histidine transporter-like 7     433   4e-142   
ref|XP_007202042.1|  hypothetical protein PRUPE_ppa005408mg             430   4e-142   
gb|KCW68049.1|  hypothetical protein EUGRSUZ_F01732                     431   1e-141   
ref|XP_008382465.1|  PREDICTED: lysine histidine transporter-like 8     431   1e-141   
ref|XP_007224148.1|  hypothetical protein PRUPE_ppa016264mg             432   1e-141   
ref|XP_010061146.1|  PREDICTED: lysine histidine transporter-like 8     431   1e-141   
ref|XP_004231077.1|  PREDICTED: lysine histidine transporter-like 8     431   3e-141   
ref|XP_003537670.1|  PREDICTED: lysine histidine transporter-like...    429   1e-140   
ref|XP_010066318.1|  PREDICTED: lysine histidine transporter-like 8     428   2e-140   
ref|XP_010690280.1|  PREDICTED: lysine histidine transporter-like 8     429   5e-140   
ref|XP_009344805.1|  PREDICTED: lysine histidine transporter-like 8     427   6e-140   
ref|XP_004290038.1|  PREDICTED: lysine histidine transporter-like...    427   7e-140   
ref|XP_008393604.1|  PREDICTED: lysine histidine transporter-like 8     426   2e-139   
ref|XP_004291248.1|  PREDICTED: lysine histidine transporter-like...    426   2e-139   
ref|XP_006422497.1|  hypothetical protein CICLE_v10028167mg             425   4e-139   
gb|KDO68234.1|  hypothetical protein CISIN_1g009363mg                   425   4e-139   
ref|XP_006486661.1|  PREDICTED: lysine histidine transporter-like...    425   5e-139   
ref|XP_010113266.1|  hypothetical protein L484_026595                   423   2e-138   
gb|KDO85038.1|  hypothetical protein CISIN_1g043392mg                   421   6e-138   
ref|XP_008236106.1|  PREDICTED: lysine histidine transporter-like 8     422   7e-138   
ref|XP_007199782.1|  hypothetical protein PRUPE_ppa003929mg             421   1e-137   
gb|KHN05480.1|  Lysine histidine transporter-like 8                     416   4e-137   
ref|XP_008777663.1|  PREDICTED: lysine histidine transporter-like 8     419   1e-136   
gb|KDO68236.1|  hypothetical protein CISIN_1g046376mg                   414   2e-136   
ref|XP_006422495.1|  hypothetical protein CICLE_v10029785mg             412   8e-136   
ref|XP_009394281.1|  PREDICTED: lysine histidine transporter-like 8     412   7e-134   
ref|XP_010548852.1|  PREDICTED: lysine histidine transporter-like 7     407   1e-133   
ref|XP_010089927.1|  hypothetical protein L484_014437                   410   1e-133   
ref|XP_003593467.1|  Lysine/histidine transporter                       409   3e-133   
ref|NP_001168064.1|  hypothetical protein                               409   3e-133   Zea mays [maize]
gb|EPS73072.1|  hypothetical protein M569_01683                         409   4e-133   
gb|KFK30149.1|  hypothetical protein AALP_AA7G223300                    407   4e-133   
ref|XP_011083786.1|  PREDICTED: lysine histidine transporter-like 8     408   8e-133   
ref|XP_011046307.1|  PREDICTED: lysine histidine transporter-like 8     408   1e-132   
ref|XP_002306216.2|  hypothetical protein POPTR_0004s18790g             408   1e-132   Populus trichocarpa [western balsam poplar]
ref|XP_010539056.1|  PREDICTED: lysine histidine transporter-like 8     407   1e-132   
ref|XP_007017386.1|  Transmembrane amino acid transporter family ...    407   3e-132   
ref|XP_004512239.1|  PREDICTED: lysine histidine transporter-like...    405   5e-132   
ref|XP_009365648.1|  PREDICTED: lysine histidine transporter-like 8     406   6e-132   
ref|XP_002443190.1|  hypothetical protein SORBIDRAFT_08g014900          405   7e-132   Sorghum bicolor [broomcorn]
ref|XP_003576214.1|  PREDICTED: lysine histidine transporter-like 8     405   1e-131   
ref|XP_002510286.1|  amino acid transporter, putative                   405   1e-131   Ricinus communis
ref|XP_009592898.1|  PREDICTED: lysine histidine transporter-like 8     405   1e-131   
ref|XP_011030741.1|  PREDICTED: lysine histidine transporter-like 8     405   1e-131   
ref|XP_009145029.1|  PREDICTED: lysine histidine transporter-like 8     405   1e-131   
ref|XP_004141237.1|  PREDICTED: lysine histidine transporter-like...    405   1e-131   
ref|NP_175198.1|  Lysine histidine transporter-like 8                   405   2e-131   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25678.1|  BnaC05g25570D                                          405   2e-131   
ref|XP_009788292.1|  PREDICTED: lysine histidine transporter-like 8     405   2e-131   
ref|XP_010061791.1|  PREDICTED: lysine histidine transporter-like 8     405   2e-131   
ref|XP_010461567.1|  PREDICTED: lysine histidine transporter-like 8     405   2e-131   
ref|XP_006473395.1|  PREDICTED: lysine histidine transporter-like...    405   2e-131   
ref|XP_008377380.1|  PREDICTED: lysine histidine transporter-like 8     405   2e-131   
ref|XP_006375013.1|  amino acid transporter family protein              405   2e-131   
ref|XP_004238196.1|  PREDICTED: lysine histidine transporter-like 8     405   2e-131   
ref|XP_008378495.1|  PREDICTED: lysine histidine transporter-like 8     405   2e-131   
ref|XP_010908449.1|  PREDICTED: lysine histidine transporter-like 8     405   2e-131   
ref|XP_004291933.1|  PREDICTED: lysine histidine transporter-like...    404   3e-131   
ref|XP_006354939.1|  PREDICTED: lysine histidine transporter-like...    404   3e-131   
ref|XP_007222812.1|  hypothetical protein PRUPE_ppa004223mg             404   3e-131   
gb|KHN08575.1|  Lysine histidine transporter-like 8                     401   5e-131   
ref|XP_002894065.1|  amino acid transporter family protein              404   6e-131   
ref|XP_006303973.1|  hypothetical protein CARUB_v10008863mg             403   6e-131   
ref|XP_007148227.1|  hypothetical protein PHAVU_006G190600g             403   6e-131   
ref|XP_010500291.1|  PREDICTED: lysine histidine transporter-like 8     403   7e-131   
ref|XP_006434873.1|  hypothetical protein CICLE_v10000841mg             404   7e-131   
dbj|BAA82706.1|  amino acid transporter-like protein 1                  403   7e-131   Arabidopsis thaliana [mouse-ear cress]
gb|EYU45070.1|  hypothetical protein MIMGU_mgv1a004478mg                403   8e-131   
ref|XP_008220718.1|  PREDICTED: lysine histidine transporter-like 8     403   9e-131   
ref|XP_010690281.1|  PREDICTED: lysine histidine transporter-like 8     401   1e-130   
ref|XP_006393548.1|  hypothetical protein EUTSA_v10011394mg             402   1e-130   
gb|KDP38411.1|  hypothetical protein JCGZ_04336                         402   1e-130   
ref|XP_002284114.1|  PREDICTED: lysine histidine transporter-like 8     402   2e-130   Vitis vinifera
gb|KHG25598.1|  Lysine histidine transporter-like 8                     402   2e-130   
ref|XP_003545851.1|  PREDICTED: lysine histidine transporter-like...    402   2e-130   
gb|AEP14525.1|  lysine/histidine transporter                            402   3e-130   
ref|XP_003543081.1|  PREDICTED: lysine histidine transporter-like...    402   3e-130   
ref|XP_010255084.1|  PREDICTED: lysine histidine transporter-like...    402   3e-130   
ref|XP_009411314.1|  PREDICTED: lysine histidine transporter-like 8     402   3e-130   
ref|XP_004485720.1|  PREDICTED: lysine histidine transporter-like...    401   5e-130   
ref|XP_004160601.1|  PREDICTED: LOW QUALITY PROTEIN: lysine histi...    401   5e-130   
ref|XP_010683959.1|  PREDICTED: lysine histidine transporter-like 8     401   6e-130   
gb|KFK29080.1|  hypothetical protein AALP_AA7G086300                    400   9e-130   
ref|XP_009364081.1|  PREDICTED: lysine histidine transporter-like 8     400   9e-130   
ref|XP_010263781.1|  PREDICTED: lysine histidine transporter-like 8     400   9e-130   
ref|XP_006856239.1|  hypothetical protein AMTR_s00059p00214190          400   3e-129   
emb|CDP07603.1|  unnamed protein product                                398   9e-129   
gb|KHG19466.1|  Lysine histidine transporter-like 8                     397   2e-128   
gb|KCW68788.1|  hypothetical protein EUGRSUZ_F02389                     396   6e-128   
gb|AAO41951.1|  putative amino acid permease                            393   7e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002312929.1|  hypothetical protein POPTR_0009s14290g             394   2e-127   Populus trichocarpa [western balsam poplar]
gb|EEC69290.1|  hypothetical protein OsI_38347                          394   2e-127   Oryza sativa Indica Group [Indian rice]
ref|NP_567977.2|  LYS/HIS transporter 7                                 393   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283663.1|  hypothetical protein CARUB_v10004720mg             392   4e-127   
gb|AAM65081.1|  amino acid permease-like protein                        391   7e-127   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001066783.1|  Os12g0485600                                       392   8e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011045403.1|  PREDICTED: lysine histidine transporter-like 8     394   8e-127   
emb|CDY17820.1|  BnaC08g04340D                                          389   4e-126   
ref|XP_002867086.1|  hypothetical protein ARALYDRAFT_491132             389   6e-126   
ref|XP_009107414.1|  PREDICTED: lysine histidine transporter-like 8     390   1e-125   
emb|CAN78281.1|  hypothetical protein VITISV_021650                     389   2e-125   Vitis vinifera
ref|XP_004962675.1|  PREDICTED: lysine histidine transporter-like...    384   2e-123   
dbj|BAJ90151.1|  predicted protein                                      383   4e-123   
ref|XP_010437509.1|  PREDICTED: lysine histidine transporter-like...    380   1e-122   
ref|XP_010255085.1|  PREDICTED: lysine histidine transporter-like...    378   1e-121   
ref|XP_007017387.1|  Transmembrane amino acid transporter family ...    378   2e-121   
ref|XP_002993599.1|  hypothetical protein SELMODRAFT_236771             376   3e-121   
ref|XP_002973454.1|  hypothetical protein SELMODRAFT_99162              375   3e-120   
ref|XP_010432316.1|  PREDICTED: lysine histidine transporter-like 7     374   5e-120   
ref|XP_006664563.1|  PREDICTED: lysine histidine transporter-like...    375   5e-120   
ref|XP_010446966.1|  PREDICTED: lysine histidine transporter-like 7     374   7e-120   
ref|XP_006384599.1|  hypothetical protein POPTR_0004s18780g             365   2e-118   
gb|EMT08997.1|  hypothetical protein F775_18992                         366   1e-117   
emb|CDX69117.1|  BnaC01g03360D                                          363   5e-116   
emb|CAN76056.1|  hypothetical protein VITISV_009104                     366   6e-116   Vitis vinifera
ref|XP_006412138.1|  hypothetical protein EUTSA_v10025079mg             362   1e-115   
emb|CDY52643.1|  BnaAnng11580D                                          362   2e-115   
ref|XP_009105143.1|  PREDICTED: lysine histidine transporter-like 7     362   2e-115   
ref|XP_009138349.1|  PREDICTED: lysine histidine transporter-like 7     362   3e-115   
emb|CDY40643.1|  BnaA03g53200D                                          359   2e-114   
emb|CDX72525.1|  BnaC07g45470D                                          358   6e-114   
ref|XP_002973261.1|  hypothetical protein SELMODRAFT_98878              357   2e-113   
ref|XP_002993623.1|  hypothetical protein SELMODRAFT_137348             357   3e-113   
gb|KHN33817.1|  Lysine histidine transporter-like 8                     355   3e-113   
emb|CAB36725.1|  amino acid permease-like protein                       351   2e-111   Arabidopsis thaliana [mouse-ear cress]
gb|KDP36841.1|  hypothetical protein JCGZ_08132                         343   7e-110   
ref|XP_007041700.1|  Lysine histidine transporter-like 8, putativ...    337   4e-107   
ref|XP_008357541.1|  PREDICTED: lysine histidine transporter-like 8     333   1e-105   
gb|EYU17532.1|  hypothetical protein MIMGU_mgv1a0250411mg               324   2e-102   
ref|XP_006590782.1|  PREDICTED: lysine histidine transporter-like...    323   6e-102   
ref|XP_009802164.1|  PREDICTED: lysine histidine transporter-like 8     301   8e-95    
ref|XP_001765573.1|  predicted protein                                  302   7e-92    
gb|ACU24261.1|  unknown                                                 290   9e-89    Glycine max [soybeans]
emb|CDY17524.1|  BnaC03g65390D                                          280   3e-85    
gb|EMT20834.1|  hypothetical protein F775_19892                         279   4e-85    
gb|EMS61501.1|  hypothetical protein TRIUR3_19531                       279   4e-85    
gb|EYU38008.1|  hypothetical protein MIMGU_mgv11b003533mg               279   1e-84    
gb|KDO84369.1|  hypothetical protein CISIN_1g009772mg                   278   4e-84    
gb|EMS58963.1|  hypothetical protein TRIUR3_14050                       273   1e-80    
ref|XP_004304006.1|  PREDICTED: lysine histidine transporter 1-like     250   8e-73    
ref|XP_008379141.1|  PREDICTED: lysine histidine transporter 1-like     249   3e-72    
ref|XP_004504412.1|  PREDICTED: lysine histidine transporter-like...    243   8e-72    
ref|XP_010033379.1|  PREDICTED: lysine histidine transporter 1-like     247   1e-71    
ref|XP_004502326.1|  PREDICTED: lysine histidine transporter 2-like     246   3e-71    
ref|XP_002988157.1|  hypothetical protein SELMODRAFT_127260             243   2e-70    
ref|XP_002972653.1|  hypothetical protein SELMODRAFT_270979             244   2e-70    
ref|XP_008348004.1|  PREDICTED: lysine histidine transporter 1-like     244   2e-70    
ref|XP_010025349.1|  PREDICTED: lysine histidine transporter-like 2     243   3e-70    
ref|XP_009613346.1|  PREDICTED: lysine histidine transporter 1-like     243   4e-70    
ref|XP_006395461.1|  hypothetical protein EUTSA_v10004214mg             243   5e-70    
ref|XP_004489582.1|  PREDICTED: lysine histidine transporter 1-li...    243   5e-70    
ref|XP_009414682.1|  PREDICTED: lysine histidine transporter 1-like     243   6e-70    
ref|XP_009111561.1|  PREDICTED: lysine histidine transporter 1-like     242   7e-70    
ref|XP_002511233.1|  amino acid transporter, putative                   242   9e-70    
gb|AES68006.2|  transmembrane amino acid transporter family protein     242   9e-70    
emb|CDY00162.1|  BnaC09g01390D                                          242   1e-69    
ref|XP_010037451.1|  PREDICTED: lysine histidine transporter 1-like     241   1e-69    
ref|XP_010554094.1|  PREDICTED: lysine histidine transporter 1-like     241   1e-69    
ref|XP_002988158.1|  hypothetical protein SELMODRAFT_271974             241   3e-69    
gb|KCW53000.1|  hypothetical protein EUGRSUZ_J02300                     240   3e-69    
ref|XP_010528186.1|  PREDICTED: lysine histidine transporter 1          240   4e-69    
ref|XP_006297566.1|  hypothetical protein CARUB_v10013589mg             241   4e-69    
gb|KFK33647.1|  hypothetical protein AALP_AA5G041200                    240   6e-69    
ref|XP_010034655.1|  PREDICTED: lysine histidine transporter 1-like     239   6e-69    
gb|KCW52997.1|  hypothetical protein EUGRSUZ_J02297                     239   7e-69    
gb|KFK33072.1|  hypothetical protein AALP_AA6G326500                    239   8e-69    
ref|XP_008379764.1|  PREDICTED: lysine histidine transporter 1-like     239   8e-69    
ref|XP_011073064.1|  PREDICTED: lysine histidine transporter 2-like     239   9e-69    
ref|XP_007210727.1|  hypothetical protein PRUPE_ppa022404mg             239   1e-68    
ref|XP_007140887.1|  hypothetical protein PHAVU_008G149800g             239   1e-68    
ref|XP_010930433.1|  PREDICTED: lysine histidine transporter 1-like     239   1e-68    
ref|XP_010668061.1|  PREDICTED: lysine histidine transporter-like 8     234   1e-68    
ref|XP_010502695.1|  PREDICTED: lysine histidine transporter 1-like     237   5e-68    
ref|XP_004236736.1|  PREDICTED: lysine histidine transporter 2-like     236   9e-68    
gb|KDP30960.1|  hypothetical protein JCGZ_11336                         236   9e-68    
ref|XP_004514799.1|  PREDICTED: lysine histidine transporter 1-like     236   1e-67    
ref|XP_002265308.1|  PREDICTED: lysine histidine transporter 1          236   1e-67    
ref|XP_003555159.1|  PREDICTED: lysine histidine transporter 1-like     236   1e-67    
ref|XP_006292474.1|  hypothetical protein CARUB_v10018703mg             236   2e-67    
ref|XP_002443797.1|  hypothetical protein SORBIDRAFT_07g002250          236   2e-67    
ref|XP_008800948.1|  PREDICTED: lysine histidine transporter 1-like     236   2e-67    
ref|XP_008792218.1|  PREDICTED: lysine histidine transporter 1          236   2e-67    
ref|XP_002884261.1|  hypothetical protein ARALYDRAFT_896068             236   2e-67    
ref|XP_011086736.1|  PREDICTED: lysine histidine transporter 1-like     235   2e-67    
ref|XP_006283741.1|  hypothetical protein CARUB_v10004814mg             235   4e-67    
emb|CDY36379.1|  BnaC04g32870D                                          234   5e-67    
ref|XP_006484040.1|  PREDICTED: lysine histidine transporter 2-like     234   5e-67    
ref|XP_010436013.1|  PREDICTED: lysine histidine transporter 1-like     234   6e-67    
ref|XP_001752686.1|  predicted protein                                  234   7e-67    
ref|XP_006438111.1|  hypothetical protein CICLE_v10033376mg             234   7e-67    
ref|XP_011042297.1|  PREDICTED: lysine histidine transporter 1-like     234   9e-67    
ref|XP_010450621.1|  PREDICTED: lysine histidine transporter 1          234   1e-66    
ref|XP_011041568.1|  PREDICTED: lysine histidine transporter 1-like     234   1e-66    
ref|XP_002315629.1|  hypothetical protein POPTR_0010s06590g             234   1e-66    
gb|KEH25432.1|  transmembrane amino acid transporter family protein     233   2e-66    
ref|XP_007216208.1|  hypothetical protein PRUPE_ppa016172mg             234   2e-66    
emb|CDP15024.1|  unnamed protein product                                233   2e-66    
emb|CDY52705.1|  BnaA04g10600D                                          233   2e-66    
ref|XP_008231174.1|  PREDICTED: lysine histidine transporter 1-li...    233   2e-66    
ref|XP_002312642.1|  hypothetical protein POPTR_0008s17910g             233   2e-66    
ref|XP_010029034.1|  PREDICTED: lysine histidine transporter 1-like     233   3e-66    
ref|XP_006663932.1|  PREDICTED: lysine histidine transporter 2-like     233   3e-66    
ref|XP_008231173.1|  PREDICTED: lysine histidine transporter 1-li...    233   3e-66    
ref|XP_009124047.1|  PREDICTED: lysine histidine transporter-like...    233   3e-66    
ref|XP_003551873.1|  PREDICTED: lysine histidine transporter 2-like     232   3e-66    
ref|XP_007222282.1|  hypothetical protein PRUPE_ppa005886mg             232   4e-66    
ref|XP_002514999.1|  amino acid transporter, putative                   232   5e-66    
emb|CDY27596.1|  BnaA09g28110D                                          232   5e-66    
gb|KDP47157.1|  hypothetical protein JCGZ_00048                         225   6e-66    
ref|XP_009140039.1|  PREDICTED: lysine histidine transporter 1          231   7e-66    
ref|XP_010497181.1|  PREDICTED: lysine histidine transporter-like 4     232   7e-66    
ref|XP_004305932.1|  PREDICTED: lysine histidine transporter 1-like     231   7e-66    
gb|KHN10848.1|  Lysine histidine transporter 1                          232   8e-66    
ref|XP_009113791.1|  PREDICTED: lysine histidine transporter 2-like     231   9e-66    
ref|XP_003547674.1|  PREDICTED: lysine histidine transporter 1 is...    232   1e-65    
ref|XP_006405427.1|  hypothetical protein EUTSA_v10027769mg             231   1e-65    
ref|XP_006599056.1|  PREDICTED: lysine histidine transporter 1 is...    231   1e-65    
ref|XP_010111626.1|  hypothetical protein L484_017652                   231   2e-65    
emb|CDY68763.1|  BnaAnng28300D                                          231   2e-65    
emb|CDX84942.1|  BnaC05g21130D                                          230   2e-65    
ref|XP_011029638.1|  PREDICTED: lysine histidine transporter 2-like     230   2e-65    
ref|XP_008222041.1|  PREDICTED: lysine histidine transporter 2-like     230   2e-65    
ref|XP_008357859.1|  PREDICTED: lysine histidine transporter 1-like     229   2e-65    
ref|XP_006845127.1|  hypothetical protein AMTR_s00005p00198670          230   3e-65    
ref|XP_007140885.1|  hypothetical protein PHAVU_008G149600g             230   3e-65    
ref|XP_002454589.1|  hypothetical protein SORBIDRAFT_04g033960          230   3e-65    
gb|ACU19477.1|  unknown                                                 229   4e-65    
ref|XP_002886552.1|  hypothetical protein ARALYDRAFT_475192             230   4e-65    
emb|CDY11714.1|  BnaC06g13220D                                          229   4e-65    
ref|NP_001149518.1|  AATL2                                              229   4e-65    
ref|NP_176322.1|  transmembrane amino acid transporter family pro...    229   5e-65    
ref|XP_004973098.1|  PREDICTED: lysine histidine transporter 1-like     229   5e-65    
ref|XP_006405428.1|  hypothetical protein EUTSA_v10027769mg             229   5e-65    
ref|XP_004310189.1|  PREDICTED: lysine histidine transporter 1-like     229   5e-65    
ref|XP_004972968.1|  PREDICTED: lysine histidine transporter 2-like     229   5e-65    
ref|XP_010030725.1|  PREDICTED: lysine histidine transporter 1-like     229   5e-65    
ref|XP_009125162.1|  PREDICTED: lysine histidine transporter 1-li...    229   7e-65    
ref|XP_010041420.1|  PREDICTED: lysine histidine transporter 1-like     230   7e-65    
gb|AGN03890.1|  lysine histidine transporter                            229   7e-65    
ref|NP_198894.2|  Lysine histidine transporter 1                        229   9e-65    
ref|XP_003538566.1|  PREDICTED: lysine histidine transporter 2-like     228   1e-64    
ref|XP_007037907.1|  Lysine histidine transporter 1                     229   1e-64    
gb|KCW55870.1|  hypothetical protein EUGRSUZ_I01676                     228   2e-64    
ref|XP_010550273.1|  PREDICTED: lysine histidine transporter 1-like     228   2e-64    
ref|XP_010033378.1|  PREDICTED: lysine histidine transporter 1-like     228   3e-64    
ref|XP_002443126.1|  hypothetical protein SORBIDRAFT_08g009800          227   3e-64    
ref|XP_002270050.1|  PREDICTED: lysine histidine transporter 1          227   3e-64    
ref|XP_004159807.1|  PREDICTED: lysine histidine transporter 1-like     228   3e-64    
ref|XP_007158719.1|  hypothetical protein PHAVU_002G176400g             227   3e-64    
gb|KGN45724.1|  hypothetical protein Csa_6G008070                       227   4e-64    
ref|NP_851109.1|  Lysine histidine transporter 1                        227   4e-64    
ref|XP_002870677.1|  hypothetical protein ARALYDRAFT_916150             227   4e-64    
gb|AAB71468.1|  amino acid permease                                     226   6e-64    
ref|XP_010524278.1|  PREDICTED: lysine histidine transporter-like...    226   6e-64    
ref|XP_003597755.1|  Lysine/histidine transporter                       228   7e-64    
ref|XP_004489583.1|  PREDICTED: lysine histidine transporter 1-li...    226   7e-64    
ref|XP_007031759.1|  Lysine histidine transporter 1                     226   8e-64    
emb|CBI27555.3|  unnamed protein product                                227   9e-64    
ref|XP_004310043.1|  PREDICTED: lysine histidine transporter 1-like     225   1e-63    
ref|XP_004146646.1|  PREDICTED: lysine histidine transporter 1-like     226   1e-63    
ref|XP_010673704.1|  PREDICTED: lysine histidine transporter 2-li...    226   1e-63    
ref|XP_004972971.1|  PREDICTED: lysine histidine transporter 1-li...    225   2e-63    
ref|XP_002265721.1|  PREDICTED: lysine histidine transporter 1          225   2e-63    
ref|XP_009124048.1|  PREDICTED: lysine histidine transporter-like...    225   2e-63    
ref|XP_010030724.1|  PREDICTED: lysine histidine transporter 1-like     225   2e-63    
ref|XP_009370386.1|  PREDICTED: lysine histidine transporter 1-like     228   2e-63    
ref|XP_002509568.1|  amino acid transporter, putative                   225   2e-63    
ref|XP_007151556.1|  hypothetical protein PHAVU_004G056700g             225   2e-63    
ref|XP_004972969.1|  PREDICTED: lysine histidine transporter 1-li...    226   3e-63    
ref|XP_002443796.1|  hypothetical protein SORBIDRAFT_07g002240          225   3e-63    
ref|XP_011097401.1|  PREDICTED: lysine histidine transporter 1-like     225   3e-63    
ref|XP_003553873.1|  PREDICTED: lysine histidine transporter 1-like     225   3e-63    
ref|XP_010673703.1|  PREDICTED: lysine histidine transporter 2-li...    224   3e-63    
ref|NP_186825.2|  Lysine histidine transporter-like 4                   225   3e-63    
gb|KFK37637.1|  hypothetical protein AALP_AA3G009100                    230   4e-63    
ref|XP_004489581.1|  PREDICTED: uncharacterized protein LOC101496478    232   4e-63    
ref|XP_010524279.1|  PREDICTED: lysine histidine transporter-like...    224   5e-63    
gb|KFK37639.1|  hypothetical protein AALP_AA3G009100                    231   5e-63    
ref|XP_002266410.1|  PREDICTED: lysine histidine transporter 1          224   5e-63    
gb|KCW55869.1|  hypothetical protein EUGRSUZ_I01675                     224   5e-63    
gb|KFK37638.1|  hypothetical protein AALP_AA3G009100                    231   5e-63    
ref|XP_008799990.1|  PREDICTED: lysine histidine transporter 1-like     224   6e-63    
gb|AFK39063.1|  unknown                                                 219   6e-63    
ref|XP_006343164.1|  PREDICTED: lysine histidine transporter 1-like     223   8e-63    
ref|XP_004159706.1|  PREDICTED: lysine histidine transporter 1-like     223   9e-63    
gb|KDP46333.1|  hypothetical protein JCGZ_10173                         223   1e-62    
ref|XP_008341344.1|  PREDICTED: lysine histidine transporter 1-like     223   1e-62    
gb|KFK44499.1|  hypothetical protein AALP_AA1G265000                    223   1e-62    
ref|XP_004158062.1|  PREDICTED: lysine histidine transporter 1-like     224   1e-62    
gb|AAF01559.1|AC009325_29  putative amino acid permease                 223   2e-62    
ref|NP_001060901.1|  Os08g0127100                                       223   2e-62    
ref|XP_010673705.1|  PREDICTED: lysine histidine transporter 2-li...    222   2e-62    
ref|XP_004972964.1|  PREDICTED: lysine histidine transporter 1-li...    223   2e-62    
dbj|BAJ93280.1|  predicted protein                                      222   2e-62    
ref|XP_008446084.1|  PREDICTED: lysine histidine transporter 1-like     222   2e-62    
ref|XP_004972963.1|  PREDICTED: lysine histidine transporter 1-li...    223   3e-62    
ref|XP_009414681.1|  PREDICTED: lysine histidine transporter 1-like     222   3e-62    
ref|XP_009411834.1|  PREDICTED: lysine histidine transporter 1          222   3e-62    
ref|XP_007031757.1|  Lysine histidine transporter 1 isoform 1           223   3e-62    
emb|CDX77082.1|  BnaC04g38770D                                          221   5e-62    
ref|XP_004972970.1|  PREDICTED: lysine histidine transporter 1-li...    222   5e-62    
ref|XP_007140886.1|  hypothetical protein PHAVU_008G149700g             221   5e-62    
gb|EYU22567.1|  hypothetical protein MIMGU_mgv1a026549mg                221   6e-62    
ref|NP_001147827.1|  LHT1                                               222   6e-62    
ref|XP_006447153.1|  hypothetical protein CICLE_v10015213mg             221   6e-62    
ref|XP_009604772.1|  PREDICTED: lysine histidine transporter 1-like     221   7e-62    
emb|CAD89802.1|  histidine amino acid transporter                       221   7e-62    
ref|XP_011045191.1|  PREDICTED: lysine histidine transporter 1          221   7e-62    
emb|CAN75546.1|  hypothetical protein VITISV_035992                     220   7e-62    
ref|XP_010460462.1|  PREDICTED: lysine histidine transporter 2-like     221   8e-62    
ref|XP_006307531.1|  hypothetical protein CARUB_v10009155mg             221   8e-62    
ref|NP_564217.1|  lysine histidine transporter 2                        221   8e-62    
ref|XP_003547675.1|  PREDICTED: lysine histidine transporter 1-like     221   1e-61    
ref|XP_004960693.1|  PREDICTED: lysine histidine transporter 2-like     220   1e-61    
ref|XP_009381698.1|  PREDICTED: lysine histidine transporter 1          220   1e-61    
ref|XP_009371699.1|  PREDICTED: lysine histidine transporter 1-like     221   1e-61    
emb|CDP13304.1|  unnamed protein product                                220   1e-61    
gb|KDO55693.1|  hypothetical protein CISIN_1g013039mg                   220   1e-61    
ref|XP_009761107.1|  PREDICTED: lysine histidine transporter-like 2     220   1e-61    
ref|XP_006469985.1|  PREDICTED: lysine histidine transporter 1-li...    220   2e-61    
gb|EMS62880.1|  hypothetical protein TRIUR3_08614                       222   2e-61    
ref|XP_004972967.1|  PREDICTED: lysine histidine transporter 1-like     220   2e-61    
ref|XP_010103180.1|  hypothetical protein L484_006730                   219   2e-61    
ref|XP_004310190.1|  PREDICTED: lysine histidine transporter 1-like     219   3e-61    
gb|KHG21056.1|  Lysine histidine transporter 1 -like protein            219   3e-61    
ref|XP_006440052.1|  hypothetical protein CICLE_v10024278mg             219   3e-61    
ref|XP_002298597.2|  lysine and histidine specific transporter fa...    219   4e-61    
ref|XP_009798464.1|  PREDICTED: lysine histidine transporter 1-like     219   4e-61    
ref|XP_010425472.1|  PREDICTED: lysine histidine transporter 1-like     219   4e-61    
ref|XP_004515896.1|  PREDICTED: lysine histidine transporter 1-like     218   4e-61    
ref|XP_007216314.1|  hypothetical protein PRUPE_ppa019812mg             219   6e-61    
gb|EMT11525.1|  hypothetical protein F775_27209                         218   7e-61    
ref|XP_008648428.1|  PREDICTED: lysine histidine transporter 2-li...    218   7e-61    
ref|XP_009359311.1|  PREDICTED: lysine histidine transporter 2 is...    218   9e-61    
gb|KHN44411.1|  Lysine histidine transporter 1                          218   9e-61    
ref|XP_006469984.1|  PREDICTED: lysine histidine transporter 1-li...    218   9e-61    
gb|KHN01915.1|  Lysine histidine transporter 1                          217   9e-61    
ref|XP_003631324.1|  PREDICTED: lysine histidine transporter 2          218   1e-60    
dbj|BAK05191.1|  predicted protein                                      218   1e-60    
ref|XP_010041088.1|  PREDICTED: lysine histidine transporter 1-like     216   1e-60    
dbj|BAJ99236.1|  predicted protein                                      218   1e-60    
ref|XP_010248878.1|  PREDICTED: lysine histidine transporter 1-like     218   1e-60    
ref|XP_004514798.1|  PREDICTED: lysine histidine transporter 1-like     218   1e-60    
ref|XP_010499181.1|  PREDICTED: lysine histidine transporter 2-like     217   1e-60    
ref|XP_009336550.1|  PREDICTED: lysine histidine transporter 1-like     217   2e-60    
ref|XP_002443799.1|  hypothetical protein SORBIDRAFT_07g002260          217   3e-60    
ref|XP_006283740.1|  hypothetical protein CARUB_v10004814mg             215   3e-60    
ref|NP_001066488.1|  Os12g0244400                                       217   3e-60    
ref|XP_009359534.1|  PREDICTED: lysine histidine transporter 1-like     216   3e-60    
ref|XP_006476987.1|  PREDICTED: lysine histidine transporter 1-like     216   3e-60    
ref|XP_004305931.1|  PREDICTED: lysine histidine transporter 1-like     216   4e-60    
emb|CDP16662.1|  unnamed protein product                                216   4e-60    
emb|CAN70437.1|  hypothetical protein VITISV_043017                     216   4e-60    
gb|EAY82729.1|  hypothetical protein OsI_37940                          216   5e-60    
ref|XP_003532716.2|  PREDICTED: lysine histidine transporter-like...    214   5e-60    
ref|XP_011071191.1|  PREDICTED: lysine histidine transporter-like 2     216   5e-60    
ref|XP_008231175.1|  PREDICTED: lysine histidine transporter 1-like     216   6e-60    
ref|XP_008450063.1|  PREDICTED: lysine histidine transporter 2-li...    216   6e-60    
ref|XP_009385141.1|  PREDICTED: lysine histidine transporter 1-like     216   6e-60    
ref|XP_007215373.1|  hypothetical protein PRUPE_ppa005662mg             216   7e-60    
emb|CDP13303.1|  unnamed protein product                                215   7e-60    
ref|XP_009391402.1|  PREDICTED: lysine histidine transporter-like...    215   8e-60    
ref|XP_009412996.1|  PREDICTED: lysine histidine transporter 1-like     215   9e-60    
ref|XP_006447151.1|  hypothetical protein CICLE_v10018030mg             215   1e-59    
gb|KDP46332.1|  hypothetical protein JCGZ_10172                         215   1e-59    
ref|XP_008389807.1|  PREDICTED: LOW QUALITY PROTEIN: lysine histi...    215   1e-59    
gb|EYU44856.1|  hypothetical protein MIMGU_mgv1a006274mg                215   1e-59    
ref|XP_008662066.1|  PREDICTED: LHT1 isoform X1                         215   1e-59    
ref|XP_004145678.1|  PREDICTED: lysine histidine transporter 1-like     215   1e-59    
ref|XP_003566406.2|  PREDICTED: lysine histidine transporter 1-like     214   2e-59    
ref|XP_008441370.1|  PREDICTED: lysine histidine transporter 1          213   2e-59    
ref|XP_003573327.1|  PREDICTED: lysine histidine transporter 2-like     214   2e-59    
ref|XP_010250839.1|  PREDICTED: lysine histidine transporter 1-like     214   2e-59    



>ref|XP_006360889.1| PREDICTED: lysine histidine transporter-like 8-like [Solanum 
tuberosum]
Length=496

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/503 (54%), Positives = 359/503 (71%), Gaps = 30/503 (6%)
 Frame = -1

Query  1559  MEDGAVEVRVERIGSWTSTRIAPVDIDNEP-AAQVQAFAP------------------LD  1437
             M D  V  R    GS++S +I P++ D++   ++   F+P                  +D
Sbjct  1     MGDVEVSERRRIEGSFSSFKIIPINDDDDTLHSEGTDFSPVDDDVVVDEKKDTDVVKEID  60

Query  1436  SCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIW  1257
             S LPITES  GN ++   H+LSSGIG  AL+LP A TSLGW WGI+ L+++F W+LYT+W
Sbjct  61    SLLPITESIKGNAYTAAFHLLSSGIGTPALVLPFALTSLGWSWGIVVLTVIFAWRLYTMW  120

Query  1256  LLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLF  1077
             LLV LHE+  GTR+SRY+ LA +AFG K+GK  +IFPTMYLSGG+CVM II GG +LQLF
Sbjct  121   LLVHLHETVNGTRYSRYLQLAIIAFGEKLGKCLSIFPTMYLSGGTCVMSIIAGGRTLQLF  180

Query  1076  YKTMCGGD----PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTIL  909
             Y  MC  D     K L+GA+WFL+FVC+AI I+ FFPNLNSLAW+S +GS+  + Y T++
Sbjct  181   YNAMCENDHHCLHKSLSGAQWFLVFVCLAILIAQFFPNLNSLAWVSFVGSILGVTYFTMI  240

Query  908   WTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNT  729
             W LS++KGR P GVTY+P    T+ + +FR + N +A++++AFRGHN++LEIQGTLPTN 
Sbjct  241   WALSIAKGR-PNGVTYNPSDNVTTTMAQFRAVLNGVAIVAIAFRGHNLVLEIQGTLPTNP  299

Query  728   KVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDIS  549
             K P + RM  GVIASY LIA+C FPLAI GYWAYGN+MP +    GI+ A  K+H     
Sbjct  300   KHPTKTRMWRGVIASYSLIAMCVFPLAIGGYWAYGNMMPAN----GIMGAIAKYHQESTP  355

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K L+G IYM+++I CLC++QIYA+PV DN ERIY+S+   + +CP+WVR  +K+ FGGLT
Sbjct  356   KWLIGTIYMMVVIQCLCSFQIYAMPVFDNLERIYVSRH--LKACPRWVRSCIKLFFGGLT  413

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             Y +SVAFPFLGSLA F+G I +PL+  YPCFMWI+IKKP+  +L++ +NM LGCLG+L+ 
Sbjct  414   YFISVAFPFLGSLAAFVGGIALPLSLVYPCFMWISIKKPQRNSLMYWLNMFLGCLGILIS  473

Query  188   TVLATATLWNLIADGLHANFFNP  120
              V     LWNL+ D L ANFFNP
Sbjct  474   VVQVAGALWNLVIDKLDANFFNP  496



>ref|XP_004248639.1| PREDICTED: lysine histidine transporter-like 8 [Solanum lycopersicum]
Length=471

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/476 (55%), Positives = 349/476 (73%), Gaps = 14/476 (3%)
 Frame = -1

Query  1535  RVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGL  1356
             R+ER   ++S +I P++ D+   ++      ++S LPITESR GN ++   H+ SS +G 
Sbjct  6     RIER--CFSSFKIIPIN-DDTLHSEGTGLKEIESWLPITESRKGNAYTAAFHLFSSAVGT  62

Query  1355  QALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGG  1176
              AL+LP AFTSLGW WGI+ L ++F W+LYT+WLLV LHE   GTR+SRY+ LA VAFG 
Sbjct  63    PALVLPFAFTSLGWSWGIVVLIVIFAWRLYTMWLLVHLHEMVNGTRYSRYLQLAIVAFGE  122

Query  1175  KMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGDP----KGLTGAEWFLLFVC  1008
             K+GK  +IFPTMYLSGG+CVM II GG +LQLFY T+C  D     K L+GA+WFL+FVC
Sbjct  123   KLGKCLSIFPTMYLSGGTCVMSIIAGGRTLQLFYNTICENDQHCLHKSLSGAQWFLVFVC  182

Query  1007  IAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLD  828
             +AI I+ FFPNLNSLAW+S +GS+  + Y T+LW LS+ KGR P GVTY+P    T+ + 
Sbjct  183   LAILIAQFFPNLNSLAWVSFVGSILGVTYFTMLWALSIVKGR-PNGVTYNPSNNVTTTMA  241

Query  827   RFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLA  648
             +FR + N +AV+++AFRGHN++LEIQGTLP+N K P + RM  GV+ASY  +A+C FPLA
Sbjct  242   QFRAVLNGIAVVAIAFRGHNLVLEIQGTLPSNPKHPTKTRMWRGVMASYSFVAMCVFPLA  301

Query  647   IAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVL  468
             I GYWAYGN+MP +    GI+ A  K+H     K L+G IYM+I+I CLC++QIYA+PV 
Sbjct  302   IGGYWAYGNMMPGN----GIMGAIAKYHQESTPKWLIGTIYMMIVIQCLCSFQIYAMPVF  357

Query  467   DNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFA  288
             DN ERIY+S+   + +CP+WVR  +K+ FGGLTY +SVAFPFLGSLA F+G I +PL+  
Sbjct  358   DNLERIYVSRH--LKACPRWVRSCIKLFFGGLTYFISVAFPFLGSLAAFVGGIALPLSLV  415

Query  287   YPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             YPCFMWI+I KP+  +L++C+NM LGCLG+L+  V     LWNL+ D L  NFFNP
Sbjct  416   YPCFMWISINKPQRNSLMYCLNMFLGCLGILISVVQVAGALWNLVVDKLDTNFFNP  471



>ref|XP_009614668.1| PREDICTED: lysine histidine transporter-like 8 [Nicotiana tomentosiformis]
Length=494

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/498 (53%), Positives = 352/498 (71%), Gaps = 34/498 (7%)
 Frame = -1

Query  1532  VERIGS-WTSTRIAPVDIDNE----------------------PAAQVQAFAPLDSCLPI  1422
             +ER+ S ++S +I P+D D+                           +     ++S LPI
Sbjct  4     IERVSSSFSSLKIIPIDNDDRFDNNQSQGRDSPSCMAAVDGGMEKKNMNIPEEVESYLPI  63

Query  1421  TESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDL  1242
             TESR GN ++   H+L SGIG  AL+LP AFTSLGW WGII L+++F W+LYT+WLLV L
Sbjct  64    TESRKGNAYTAAFHLLCSGIGTPALVLPFAFTSLGWSWGIIILTVVFAWRLYTMWLLVHL  123

Query  1241  HESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMC  1062
             HES +GTR+SRY+ L+  AFG K+GK  AIFP MYLSGG+CVM II GGG+LQLFY  +C
Sbjct  124   HESNSGTRYSRYLQLSIAAFGLKLGKCLAIFPIMYLSGGTCVMSIIAGGGTLQLFYNAIC  183

Query  1061  GGD----PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSV  894
             G D     + L+G +WFLLF+C+AI I+ F PNL+SL+W+S +GS+  +AY T++W LS+
Sbjct  184   GNDHNCHHRPLSGVQWFLLFICLAILIAQFCPNLHSLSWVSFVGSVMGVAYLTLIWALSI  243

Query  893   SKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLR  714
             SKGR P GV+Y+P   +T+ + RFR I N +A+I++AFRGHN++LEIQGTLPTN K P R
Sbjct  244   SKGR-PNGVSYNPSDNATTTMARFRAILNGVAIIAIAFRGHNVVLEIQGTLPTNPKHPTR  302

Query  713   RRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMG  534
               M  GV++SY  IA+C FPLAI GYW+YGNLMP S    GI+ A  K+H     K L G
Sbjct  303   TSMWRGVVSSYSFIAMCIFPLAIGGYWSYGNLMPAS----GIMTAIAKYHQESTPKWLTG  358

Query  533   AIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSV  354
              IY+++II  LCT+QIYA+PV DN+ERIY+SK+    +CP+WV++ +K+ FGGLTY +SV
Sbjct  359   TIYIMVIIQSLCTFQIYAMPVFDNFERIYVSKQH--KACPRWVKLCIKLFFGGLTYFISV  416

Query  353   AFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLAT  174
             AFPFLGSLA F+G I +PL+  YPCFMWI+IKKP   +L++C+NM LGCLGML+  V   
Sbjct  417   AFPFLGSLAAFVGGIALPLSLVYPCFMWISIKKPSRNSLMYCLNMILGCLGMLISIVQVA  476

Query  173   ATLWNLIADGLHANFFNP  120
               LWNL+ +   ANFF+P
Sbjct  477   GALWNLVVEKFDANFFSP  494



>ref|XP_010103306.1| hypothetical protein L484_014346 [Morus notabilis]
 gb|EXB95373.1| hypothetical protein L484_014346 [Morus notabilis]
Length=523

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/485 (56%), Positives = 348/485 (72%), Gaps = 26/485 (5%)
 Frame = -1

Query  1517  SWTSTRIAPVDIDNEPAAQVQAFA------------PLDSCLPITESRNGNFFSITSHML  1374
             S+ S RI  ++ D+    QV  F             P DS LPITESRNG+ FS   H+L
Sbjct  46    SFDSFRIHSINTDSPTGDQVIGFPSSSLHWPGGELNPQDSWLPITESRNGSVFSAVFHLL  105

Query  1373  SSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHL  1197
              SGIG QAL+LPVAF +LGW WGIICLSL F+WQLYTIWLLV+LHES  +G R+SRYVHL
Sbjct  106   CSGIGYQALILPVAFATLGWAWGIICLSLAFLWQLYTIWLLVNLHESADSGVRYSRYVHL  165

Query  1196  ATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG------DPKGLTG  1035
             +  AFG K+GKL AIFP MYLSGG+C MLIINGGG++QLFY+ +CG       D K ++G
Sbjct  166   SVTAFGEKLGKLLAIFPVMYLSGGTCAMLIINGGGAMQLFYRNLCGDGADAICDGKAVSG  225

Query  1034  AEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDP  855
             A+WFL+F CIAI ++   PNLNS+  +SL+G++TA++Y +ILW L +SK RP   ++Y P
Sbjct  226   AQWFLVFTCIAILVAQL-PNLNSITRVSLIGAITALSYTSILWALPISKDRP-NNISYQP  283

Query  854   PQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYIL  675
              Q   S +D+F  I NA+ +I L+F+GHN+ILEIQ TLP++ K    + M  GVI SY+ 
Sbjct  284   LQTKESGMDKFGSIFNAVGIILLSFKGHNVILEIQATLPSSPKHSSHKTMWAGVIVSYLQ  343

Query  674   IALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCT  495
             IA+C FPLAIAG+WAYGN +P     GG+L A  +FH  DISK +MG IY++III  + T
Sbjct  344   IAMCLFPLAIAGFWAYGNKIPA---DGGMLRALSEFHRQDISKFVMGLIYLLIIINGIST  400

Query  494   YQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIG  315
             +QIYA+ V DN E  Y S +K    C +WVR  +++LFGGL YL+SVAFPFLGSLA  IG
Sbjct  401   FQIYAMIVFDNLELRYTSIRKK--RCARWVRTAIRLLFGGLVYLISVAFPFLGSLAPLIG  458

Query  314   SITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHA  135
              +TMPLT+AYPCFMWI+IKKPR    +W VN+GLGCLG+++C +L  + +WNL   GL+A
Sbjct  459   GLTMPLTYAYPCFMWISIKKPRQNGAMWFVNIGLGCLGLILCVLLVVSAIWNLADKGLNA  518

Query  134   NFFNP  120
             NFFNP
Sbjct  519   NFFNP  523



>ref|XP_009802124.1| PREDICTED: lysine histidine transporter-like 8 [Nicotiana sylvestris]
Length=494

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/498 (53%), Positives = 349/498 (70%), Gaps = 12/498 (2%)
 Frame = -1

Query  1601  ERERDRIEVIKVGRMEDGAVEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPI  1422
             ER        KV  +++      ++  G    + +A VD   +    +     ++S LPI
Sbjct  5     ERVSSSFSSFKVIPLDNDDHFDNIQSEGRDAPSCMAAVDGGEKKEMNIPE-EDIESYLPI  63

Query  1421  TESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDL  1242
             TESR GN ++   H+L SGIG  AL+LP AFTSLGW WGI+ L+L+F W+LYT+WLLV L
Sbjct  64    TESRKGNAYTAAFHLLCSGIGTPALVLPFAFTSLGWSWGIVILTLVFAWRLYTMWLLVHL  123

Query  1241  HESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMC  1062
             HES++GTR+SRY+ L+  AFG K+GK  AIFP MYLSGG+CVM II GGG+LQLFY  +C
Sbjct  124   HESSSGTRYSRYLQLSIAAFGPKLGKCLAIFPIMYLSGGTCVMSIIAGGGTLQLFYNAIC  183

Query  1061  GGD----PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSV  894
             G D     K L+GAEWFLLF+C+AI I+ F PNL+SLAW+S +GS+  +AY T++W LS+
Sbjct  184   GNDHNCQHKSLSGAEWFLLFICLAILIAQFCPNLHSLAWVSFVGSIMGVAYFTLIWALSI  243

Query  893   SKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLR  714
             SKGR P GV+Y+P    T+ + RFR I   +A+I++AFRGHN++LEIQGTLPTN K P R
Sbjct  244   SKGR-PNGVSYNPSDNVTTTMARFRAILTGVAIIAIAFRGHNVVLEIQGTLPTNPKHPTR  302

Query  713   RRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMG  534
               M  GVI+SY  IA+C FPLAI GYW+YGNLMP S    G + A  K+H     K L  
Sbjct  303   TSMWRGVISSYSFIAMCIFPLAIGGYWSYGNLMPAS----GTMAAIAKYHQESTPKWLTS  358

Query  533   AIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSV  354
              I++++II CLC +QIYA+PV DN+ERIY++K+    +CP+WV+  +K+ FGGLTY +SV
Sbjct  359   TIHIMVIIQCLCAFQIYAMPVFDNFERIYVNKQH--KACPRWVKSSIKLFFGGLTYFISV  416

Query  353   AFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLAT  174
             AFPFLGSLA F+G I +PL+  YPCFMWI+IKKP   +L++C+NM LGCLG+L+  V   
Sbjct  417   AFPFLGSLAAFVGGIALPLSLVYPCFMWISIKKPSRNSLMYCLNMILGCLGILISVVQVA  476

Query  173   ATLWNLIADGLHANFFNP  120
               LWNL+     ANFF+P
Sbjct  477   GALWNLVVQKFDANFFSP  494



>ref|XP_006422496.1| hypothetical protein CICLE_v10028265mg [Citrus clementina]
 gb|ESR35736.1| hypothetical protein CICLE_v10028265mg [Citrus clementina]
Length=497

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/451 (58%), Positives = 331/451 (73%), Gaps = 10/451 (2%)
 Frame = -1

Query  1460  VQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLF  1281
             V    P+D+ LPITESRNGN F    H++SSGIG QALLLPVAF +LGW WG+ICLS+ F
Sbjct  52    VGELNPVDAWLPITESRNGNIFYAVFHLISSGIGSQALLLPVAFAALGWTWGVICLSISF  111

Query  1280  VWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIIN  1101
              WQLYTIWLLV L ES  GTR+SRY+HLA VAFG K GKL AIFP MYLSGG+CVMLII 
Sbjct  112   AWQLYTIWLLVILAESVPGTRYSRYLHLAVVAFGPKQGKLLAIFPVMYLSGGTCVMLIIT  171

Query  1100  GGGSLQLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLT  933
              GG+++  YK  CGG    + K LTG EWFL+F C+AI I+   PNLNS+A +S++G++T
Sbjct  172   AGGNMETLYKIACGGGSTCEAKSLTGVEWFLVFTCMAIAIAQILPNLNSVAKVSMVGAIT  231

Query  932   AIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEI  753
             A+AYCT +W LS++KGR P GV+Y P Q S S +  F +I NA+  I+LAFRGHN++LEI
Sbjct  232   AVAYCTFIWALSINKGR-PNGVSYSPSQESKSDMAEFGNIFNAIGKIALAFRGHNLVLEI  290

Query  752   QGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFE  573
             QGTLP++ + P  + M  G I SY+LIA+C FPL I G+WAYGN +P +   GG+L+A  
Sbjct  291   QGTLPSSRRNPSCQTMWKGTIISYLLIAMCLFPLTITGFWAYGNKVPVN---GGLLSALS  347

Query  572   KFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGL  393
             + H H+ SK +MG IY++++I  L ++QIYA+PV DN E  Y+SKKK    CP WVR G+
Sbjct  348   QVHGHNTSKHVMGTIYLLVLINSLSSFQIYAMPVFDNLEFQYVSKKK--QRCPGWVRAGI  405

Query  392   KVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGL  213
             ++ FGGLT+ ++VAFPFLGSLA  IG I +PLT+ YPCFM+I IKKP     +W +N+GL
Sbjct  406   RLFFGGLTFFIAVAFPFLGSLAPLIGGIALPLTYVYPCFMYILIKKPSRSGAMWWLNVGL  465

Query  212   GCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             GCLG ++  +L  A  WNL   GLHANFF P
Sbjct  466   GCLGTILSVMLVVAAAWNLADKGLHANFFRP  496



>gb|KDO68235.1| hypothetical protein CISIN_1g010928mg [Citrus sinensis]
Length=497

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/451 (57%), Positives = 331/451 (73%), Gaps = 10/451 (2%)
 Frame = -1

Query  1460  VQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLF  1281
             V    P+D+ LPITESRNGN F    H++SSGIG QALLLPVAF +LGW WG+ICLS+ F
Sbjct  52    VGELNPVDAWLPITESRNGNIFYAVFHLISSGIGSQALLLPVAFAALGWTWGVICLSISF  111

Query  1280  VWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIIN  1101
              WQLYTIWLLV L ES  GTR+SRY+HLA VAFG K+GKL AIFP MYLSGG+CVMLII 
Sbjct  112   AWQLYTIWLLVILAESVPGTRYSRYLHLAVVAFGPKLGKLLAIFPVMYLSGGTCVMLIIT  171

Query  1100  GGGSLQLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLT  933
              GG+++  YK  CGG    + K LTG EWFL+F C+AI I+   PNLNS+A +S++G++T
Sbjct  172   AGGNMETLYKIACGGGSTCEAKSLTGVEWFLVFTCMAIAIAQILPNLNSVAKVSMVGAIT  231

Query  932   AIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEI  753
             A+AYCT +W LS++KGR   GV+Y P Q S S +  F +I NA+  I+LAFRGHN++LEI
Sbjct  232   AVAYCTFIWALSINKGR-SNGVSYSPSQESKSDMVEFGNIFNAIGKIALAFRGHNLVLEI  290

Query  752   QGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFE  573
             QGTLP++ + P  + M  G I SY+LIA+C FPL I G+WAYGN +P +   GG+L+A  
Sbjct  291   QGTLPSSRRNPSCQTMWKGTIISYLLIAMCLFPLTITGFWAYGNKVPVN---GGLLSALS  347

Query  572   KFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGL  393
             + H H+ SK +MG IY++++I  L ++QIYA+PV DN E  Y+SKKK    CP WVR G+
Sbjct  348   QVHGHNTSKHVMGTIYLLVLINSLSSFQIYAMPVFDNLEFQYVSKKK--QRCPGWVRAGI  405

Query  392   KVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGL  213
             ++ FGGLT+ ++VAFPFLGSLA  IG I +PLT+ YPCFM+I IKKP     +W +N+GL
Sbjct  406   RLFFGGLTFFIAVAFPFLGSLAPLIGGIALPLTYVYPCFMYILIKKPSRSGAMWWLNVGL  465

Query  212   GCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             GCLG ++  +L  A  WNL   GLHANFF P
Sbjct  466   GCLGTILSVMLVVAAAWNLADKGLHANFFRP  496



>ref|XP_008236102.1| PREDICTED: lysine histidine transporter-like 8 [Prunus mume]
Length=497

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/504 (54%), Positives = 352/504 (70%), Gaps = 31/504 (6%)
 Frame = -1

Query  1559  MEDGAVEVR--VERIGSWT----STRIAPVDIDNEPAAQVQA--------------FAPL  1440
             ME+G  E     +R+ S +    S ++ P+   N  + +  A                P 
Sbjct  1     MEEGFGEANWSTDRVHSLSRRSESAQVIPITTSNPTSEEDGADYIASSAADWGGGELNPQ  60

Query  1439  DSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTI  1260
             D+ LP+TESRNGN  S T H+L SGIG+QALLLPVA  +LGW WGIICLSL F WQLYTI
Sbjct  61    DAWLPLTESRNGNTISATFHLLCSGIGIQALLLPVALATLGWAWGIICLSLAFSWQLYTI  120

Query  1259  WLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQL  1080
             WLLV LHES + TR+SRY+ LA +AFG K+GKL+++ P MYLS G+CV LII GGG+L+L
Sbjct  121   WLLVHLHESNSRTRYSRYLDLAMIAFGQKLGKLSSLVPVMYLSAGTCVQLIIIGGGTLKL  180

Query  1079  FYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTI  912
             F  T+C      D K LT  E FL+F+ +A+ ++  FPNLNSLAW+SL+GS+TAIAYCT+
Sbjct  181   FITTVCKDGATCDAKSLTTVECFLVFMIMAVVVAQ-FPNLNSLAWVSLIGSITAIAYCTM  239

Query  911   LWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTN  732
             +W LS+ KGR    ++YDPP++  S +DRF  I N+L +I LAFRGHN+ILEIQGTLP +
Sbjct  240   IWALSIGKGRSGD-ISYDPPEME-SNMDRFGGILNSLGIIVLAFRGHNVILEIQGTLPLS  297

Query  731   TKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDI  552
              K P  + M  GV  SY+LIA+C FPLAIAG+WAYGN +P+S   GG+L A  KFH HD 
Sbjct  298   AKHPTHKPMWRGVAISYLLIAMCLFPLAIAGFWAYGNKVPSS--NGGLLIAISKFHGHDT  355

Query  551   SKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGL  372
              + ++G +++++II CL T+QIY + + D  E  Y SKKK    C +W+RM  +V FGG+
Sbjct  356   PRIVLGLMFILVIINCLSTFQIYGMVIFDKLESNYTSKKK--KPCARWLRMAFRVFFGGI  413

Query  371   TYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLM  192
              + V+VAFPFLGSLA  IG +T+PL +AYPCFMWIAIKKP+P  ++WC NMGLGCLG+++
Sbjct  414   AFFVAVAFPFLGSLAPLIGGLTLPLAYAYPCFMWIAIKKPKPKGVMWCANMGLGCLGLVL  473

Query  191   CTVLATATLWNLIADGLHANFFNP  120
               +L  A  WNL + GLHANFF P
Sbjct  474   SALLVVAAAWNLASKGLHANFFKP  497



>ref|XP_006486660.1| PREDICTED: lysine histidine transporter-like 8-like [Citrus sinensis]
Length=497

 Score =   528 bits (1361),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 258/451 (57%), Positives = 330/451 (73%), Gaps = 10/451 (2%)
 Frame = -1

Query  1460  VQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLF  1281
             V    P+D+ LPITESRNGN F    H++SSGIG QALLLPVAF +LGW WG+ICLS+ F
Sbjct  52    VGELNPVDAWLPITESRNGNIFYAVFHLISSGIGSQALLLPVAFAALGWTWGVICLSISF  111

Query  1280  VWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIIN  1101
              WQLYTIWLLV L ES  GTR+SRY+HLA VAFG K+GKL AIFP MYLSGG+CVMLII 
Sbjct  112   AWQLYTIWLLVILAESVPGTRYSRYLHLAVVAFGPKLGKLLAIFPVMYLSGGTCVMLIIT  171

Query  1100  GGGSLQLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLT  933
              GG+++  YK  CGG    + K LTG EWFL+F C+AI I+   PNLNS+A +S++G++T
Sbjct  172   AGGNMETLYKIACGGGSTCEAKSLTGVEWFLVFTCMAIAIAQILPNLNSVAKVSMVGAIT  231

Query  932   AIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEI  753
             A+AYCT +W LS++KGR   GV+Y P Q S S +  F +I NA+  I+LAFRGHN++LEI
Sbjct  232   AVAYCTFIWALSINKGR-SNGVSYSPSQESKSDMVEFGNIFNAIGKIALAFRGHNLVLEI  290

Query  752   QGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFE  573
             QGTLP++ + P  + M  G   SY+LIA+C FPL I G+WAYGN +P +   GG+L+A  
Sbjct  291   QGTLPSSRRNPSCQTMWKGTTISYLLIAMCLFPLTITGFWAYGNKVPVN---GGLLSALS  347

Query  572   KFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGL  393
             + H H+ SK +MG IY++++I  L ++QIYA+PV DN E  Y+SKKK    CP WVR G+
Sbjct  348   QVHGHNTSKHVMGTIYLLVLINSLSSFQIYAMPVFDNLEFQYVSKKK--QRCPGWVRAGI  405

Query  392   KVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGL  213
             ++ FGGLT+ ++VAFPFLGSLA  IG I +PLT+ YPCFM+I IKKP     +W +N+GL
Sbjct  406   RLFFGGLTFFIAVAFPFLGSLAPLIGGIALPLTYVYPCFMYILIKKPSRSGAMWWLNVGL  465

Query  212   GCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             GCLG ++  +L  A  WNL   GLHANFF P
Sbjct  466   GCLGTILSVMLVVAAAWNLADKGLHANFFRP  496



>ref|XP_007199057.1| hypothetical protein PRUPE_ppa018580mg, partial [Prunus persica]
 gb|EMJ00256.1| hypothetical protein PRUPE_ppa018580mg, partial [Prunus persica]
Length=448

 Score =   526 bits (1354),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 258/446 (58%), Positives = 332/446 (74%), Gaps = 11/446 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LP+TESRNGN  S T H+L SGIG+QALLLPVA  +LGW WGIICLSL F WQLY
Sbjct  10    PQDAWLPLTESRNGNTISATFHLLCSGIGIQALLLPVALATLGWAWGIICLSLAFSWQLY  69

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             TIWLLV LHES +GTR+SRY+ LA   FG K+GK +++ P MYLS G+CV LII GGG+L
Sbjct  70    TIWLLVHLHESDSGTRYSRYLDLAMTTFGQKLGKFSSLVPVMYLSAGTCVQLIIIGGGTL  129

Query  1085  QLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYC  918
             +LF  T+C      D K LT  E FL+F+ +A+ ++  FPNLNSLAW+SL+GS+TAIAYC
Sbjct  130   KLFITTVCKDGATCDAKSLTTVECFLVFMIMAVVVAQ-FPNLNSLAWVSLIGSITAIAYC  188

Query  917   TILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLP  738
             T++W LS+ KGR    ++YDPP++  S +DRF  I N+L +I LAFRGHN++LEIQGTLP
Sbjct  189   TMIWALSIGKGRSSD-ISYDPPEME-SNMDRFGGILNSLGIIVLAFRGHNVVLEIQGTLP  246

Query  737   TNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIH  558
              + K P  + M  GV  SY+LIA+C FPLAIAG+WAYGN +P+S   GG+L A  KFH H
Sbjct  247   LSPKHPTHKPMWRGVAISYLLIAMCLFPLAIAGFWAYGNKVPSS--NGGLLIAISKFHRH  304

Query  557   DISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFG  378
             D  + ++G +++++II CL T+QIY + + D  E  Y SKKK    C +W+RM  +V FG
Sbjct  305   DTPRIVLGLMFILVIINCLSTFQIYGMVIFDKLESNYTSKKK--KPCARWLRMAFRVFFG  362

Query  377   GLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGM  198
             G+T+ V+VA PFLGSLA  IG +T+PL +AYPCFMWIAIKKP+P  ++WC NMGLGCLG+
Sbjct  363   GMTFFVAVAVPFLGSLAPLIGGLTLPLAYAYPCFMWIAIKKPKPKGVMWCANMGLGCLGL  422

Query  197   LMCTVLATATLWNLIADGLHANFFNP  120
             ++  +L  A  WNL ++GLHANFF P
Sbjct  423   VLSALLVVAAAWNLASEGLHANFFKP  448



>ref|XP_007041699.1| Lysine histidine transporter-like 8, putative isoform 1 [Theobroma 
cacao]
 gb|EOX97530.1| Lysine histidine transporter-like 8, putative isoform 1 [Theobroma 
cacao]
Length=502

 Score =   520 bits (1340),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 261/459 (57%), Positives = 334/459 (73%), Gaps = 12/459 (3%)
 Frame = -1

Query  1481  DNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGI  1302
                P  Q      L+S LPITESRNGN FS   H+L SGIG QALLLPVAF  LGW WGI
Sbjct  51    QGRPGGQAINITELESWLPITESRNGNIFSAMFHILCSGIGFQALLLPVAFAVLGWTWGI  110

Query  1301  ICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGS  1122
             ICL ++F+WQLYTIWLLV+LHE   GTR+SR+V L+ VAFG K+GKL AIFP MYLSGG+
Sbjct  111   ICLCIVFMWQLYTIWLLVNLHEPVPGTRYSRFVRLSIVAFGQKLGKLLAIFPVMYLSGGT  170

Query  1121  CVMLIINGGGSLQLFYKTMC----GGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWI  954
             CV+LII GGG+++L +K +C        K LTG E FLLF CIA+ I    PNL+S+A +
Sbjct  171   CVLLIITGGGTMELLFKIICEEGAACQSKSLTGTELFLLFTCIALIIGQ-LPNLHSVARV  229

Query  953   SLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRG  774
             SL G++ +I Y T++W LS+SKGR P GV+Y  P  + + +  F +I NA+ +I L+FRG
Sbjct  230   SLTGAIASIGYFTMIWALSISKGR-PDGVSYSIPHAAETGMTGFGNILNAIGIIMLSFRG  288

Query  773   HNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKG  594
             HN+ILEIQGTLP+++K P R+ M  GV+ SYI+IA+C FPLAI G+WAYGN +P +   G
Sbjct  289   HNLILEIQGTLPSSSKHPCRKSMWRGVMVSYIIIAMCLFPLAIVGFWAYGNKIPAN---G  345

Query  593   GILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCP  414
             GIL AF  FH  D SK ++G IY+ +I++CL +YQIYA+P  DN E IY S K     CP
Sbjct  346   GILTAFADFHREDTSKFVIGLIYLWLILSCLSSYQIYAMPAFDNLEFIYASSKN--RRCP  403

Query  413   KWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSI-TMPLTFAYPCFMWIAIKKPRPYTL  237
              WVR+GL++ FGGLT+ ++VAFPFLGSLA  +G + T+PLTFAYPCFMWI+IK+PR    
Sbjct  404   GWVRVGLRLFFGGLTFFIAVAFPFLGSLAPLLGGMATVPLTFAYPCFMWISIKRPRRNGA  463

Query  236   VWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +W +N+GLGCLG+++  +L  A +WNL   GLHANFF P
Sbjct  464   MWSLNLGLGCLGIVLSVLLIVAAVWNLADKGLHANFFRP  502



>emb|CDP14524.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   521 bits (1341),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 268/475 (56%), Positives = 344/475 (72%), Gaps = 18/475 (4%)
 Frame = -1

Query  1511  TSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVA  1332
             T+  I  +DI ++  +  Q     D  LPIT+SR GN F+   H+L SGIG+QALLLPVA
Sbjct  63    TTAAILTIDIPDKFGSHKQQQHDPDDWLPITQSRRGNAFTAAFHLLCSGIGIQALLLPVA  122

Query  1331  FTSLGWVWGIICLSLLFVWQLYTIWLLVDLHE----STTGTRFSRYVHLATVAFGGKMGK  1164
             F  LGWVWG +CL+L+F WQLYT WLLV LHE       GTR SRYV L+ +AFG K+GK
Sbjct  123   FVPLGWVWGTLCLTLVFAWQLYTTWLLVHLHEPGPAGAAGTRCSRYVVLSIIAFGPKLGK  182

Query  1163  LAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGDPKG-----LTGAEWFL-LFVCIA  1002
             L AIFPTMYLSGG+CV++II GGG ++L YK +CG DPK      LTGA WF  +FVC+A
Sbjct  183   LLAIFPTMYLSGGTCVVIIITGGGIMELLYKLICGDDPKCSSDTVLTGAAWFFFVFVCLA  242

Query  1001  IFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRF  822
             I +S FFP+L+SLA +SL+GS+    Y T+LWTLS+ +GRP  GV+Y+P + + S++ R 
Sbjct  243   ILVSQFFPSLHSLAPVSLIGSMALATYFTMLWTLSIREGRP-GGVSYEPSKAAASEMSRI  301

Query  821   RDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIA  642
             R I NAL +I+L F+GHN+ILEIQGT+PT+ + P R  M  GV ASY+LIA+  FPLAI 
Sbjct  302   RGIINALGIIALTFKGHNLILEIQGTIPTDPQHPSRHGMWRGVTASYLLIAVLLFPLAIG  361

Query  641   GYWAYGNLMPTSYKKGGILNAFEKFHIHD-ISKSLMGAIYMIIIIACLCTYQIYALPVLD  465
             GYWAYGN+MP      GILNA      H   S+S+M AIY+I+++     +QIY +PV D
Sbjct  362   GYWAYGNMMPAK----GILNALSSSLKHQRTSRSVMAAIYVIMLVHLFSAFQIYGMPVFD  417

Query  464   NWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAY  285
             N ERIY+SKK    +CP+WVR  ++V FGGLTY +++AFPFLGSL  FIG+IT+PLT AY
Sbjct  418   NLERIYVSKKNQ--ACPRWVRSAIRVFFGGLTYFIAMAFPFLGSLGPFIGAITLPLTLAY  475

Query  284   PCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             PCFMW+AIKKP+  + +WC+N GLG LG++M  +LA A LW+L+ADGL ANFF P
Sbjct  476   PCFMWLAIKKPKVLSSMWCLNFGLGSLGLVMSFLLAAAALWSLVADGLDANFFKP  530



>ref|XP_011046310.1| PREDICTED: lysine histidine transporter-like 8 [Populus euphratica]
Length=507

 Score =   515 bits (1327),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 261/472 (55%), Positives = 341/472 (72%), Gaps = 17/472 (4%)
 Frame = -1

Query  1511  TSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVA  1332
             TST +   D  +    Q +   P ++ LPITESRNGN  +   H+LSSGIG+QALLLPVA
Sbjct  44    TSTSMRVYDSSDSSGYQSEV-NPQEAWLPITESRNGNTVTSVFHLLSSGIGIQALLLPVA  102

Query  1331  FTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST--TGTRFSRYVHLATVAFGGKMGKLA  1158
             F+ LGW WGIICLSL F WQLYTIW+LV LHES    GTR+SRY+ LA  AFG K+GKL 
Sbjct  103   FSILGWAWGIICLSLAFTWQLYTIWVLVQLHESVPGNGTRYSRYLQLAIAAFGPKLGKLL  162

Query  1157  AIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGDPKG----LTGAEWFLLFVCIAIFIS  990
             AIFP MYLSGGSCV+LII G G+++LF+K M GG+       L GA WFL+F C+AI ++
Sbjct  163   AIFPVMYLSGGSCVLLIIRGAGTMELFFKMMFGGEATSEDNPLAGAGWFLVFTCMAIALA  222

Query  989   LFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIA  810
                PNLNS++  SL+G++TAIAYCT++W L +SKGR P GV+Y+  Q + S +    D+ 
Sbjct  223   Q-RPNLNSISGFSLIGAVTAIAYCTLIWALPISKGR-PSGVSYN-SQKAESGMSEMFDVL  279

Query  809   NALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWA  630
             NA+ +I LAFRGHN++LEIQGTLP+++K P ++ M  GV  SYI+IA+C FP+AIAG+WA
Sbjct  280   NAIGMIVLAFRGHNLVLEIQGTLPSSSKCPSKKLMWRGVTLSYIIIAMCLFPIAIAGFWA  339

Query  629   YGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERI  450
             YGN +P++   GG+L AF +FH HD SK   G +Y++++I CL ++QIYA+PV DN E  
Sbjct  340   YGNKIPSN---GGMLTAFMQFHGHDTSKFAKGLVYLLVVINCLSSFQIYAMPVFDNLEFR  396

Query  449   YLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMW  270
             Y   K     C  WVR G ++ FGGL + ++VAFPFL SLA  IG I +PLT AYPCFMW
Sbjct  397   YTCMKN--KRCSWWVRTGFRLFFGGLAFFIAVAFPFLPSLAALIGGIALPLTLAYPCFMW  454

Query  269   IAIKKP--RPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             I+IKKP  + + ++WC+N+GLGCLGM++  +L  A +WNL   GLHANFF+P
Sbjct  455   ISIKKPHQKGHGVMWCLNLGLGCLGMVLSVLLVVAAVWNLATKGLHANFFHP  506



>ref|XP_009341546.1| PREDICTED: lysine histidine transporter-like 8 [Pyrus x bretschneideri]
Length=493

 Score =   512 bits (1318),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 250/443 (56%), Positives = 331/443 (75%), Gaps = 10/443 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESRNGN FS   H+L SGIG+Q+LLLP+AF +L W WGIICLSL F WQLY
Sbjct  60    PQDAWLPITESRNGNVFSAIFHLLCSGIGIQSLLLPLAFATLEWAWGIICLSLAFAWQLY  119

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHES TG R+SRY+HLA  AFG K+GKL  IFP MYLSGG+C  LII GGG++
Sbjct  120   TAWLLVHLHESDTGIRYSRYLHLAITAFGPKLGKLLTIFPVMYLSGGTCAQLIIIGGGTM  179

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +LF K +C  D   +TG E FLLFVC+AI ++  FPNLNS+AW+SL+G+ TAIAYCT++W
Sbjct  180   KLFLKAVC--DVNSVTGTECFLLFVCMAIVVAQ-FPNLNSIAWVSLIGATTAIAYCTLIW  236

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTK  726
              LS++KGR P G++Y+PP++  S +DRF  + N++ +I LAF+GHN+ILEIQGTLP++ K
Sbjct  237   GLSIAKGR-PSGISYNPPEME-SNMDRFGGVLNSVGIIFLAFKGHNVILEIQGTLPSSPK  294

Query  725   VPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIH-DIS  549
                + RM  GV  SY LIA+C  PLAIAG+W  GN +P+SY+  G+L +F +F+ H + S
Sbjct  295   QRSQNRMWRGVTISYALIAMCFLPLAIAGFWVCGNKIPSSYE--GLLTSFSQFNGHKNTS  352

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K+++G + ++++I CL T+QIY++ V DN E  Y SKK     C +W+R+  ++ FGGL 
Sbjct  353   KAVLGLLCILVVINCLSTFQIYSMVVFDNLEFKYTSKKN--KPCARWLRIAFRIFFGGLA  410

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + ++VAFPFL SLA  IG +T+PL + YPCFMWI +KKP P + +WCVN+GLG LG+ + 
Sbjct  411   FFIAVAFPFLPSLAPLIGGMTLPLAYVYPCFMWITMKKPEPKSTMWCVNIGLGFLGLSLS  470

Query  188   TVLATATLWNLIADGLHANFFNP  120
              VL  A++WNL   GLHANFF P
Sbjct  471   VVLVIASVWNLADKGLHANFFRP  493



>ref|XP_004290037.1| PREDICTED: lysine histidine transporter-like 8-like [Fragaria 
vesca subsp. vesca]
Length=509

 Score =   509 bits (1312),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 271/505 (54%), Positives = 348/505 (69%), Gaps = 17/505 (3%)
 Frame = -1

Query  1604  RERERDRIEVIK-VGRMEDGAVEVRV-ERIGSWTSTRI-APVDIDNEPAAQVQA---FAP  1443
               R  DR+       R  D A  + +     S TS  + A  DIDN   A  +      P
Sbjct  12    NRRPADRVHSFNSTSRRSDSAQVIPITSATASPTSDHLDANYDIDNVTYANWRGGGELNP  71

Query  1442  LDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYT  1263
              D+ LP+TESR GN FS++ H+L SGIG+QALLLPVAF SLGW WG +CLSL F WQLYT
Sbjct  72    QDAWLPLTESRKGNVFSVSFHLLCSGIGVQALLLPVAFASLGWPWGTVCLSLAFTWQLYT  131

Query  1262  IWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQ  1083
             IWLLV LHES +GTR+SRY+ LA   FG K+GK+ A+ P MYLS G+CV LII GGG+++
Sbjct  132   IWLLVHLHESDSGTRYSRYLDLAITVFGQKLGKVLALVPVMYLSAGTCVQLIIIGGGTIR  191

Query  1082  LFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCT  915
             LF  T+C      DPK LTGAE FL+F+C+AI ++  FPNLNSLAW+S +G+  A+ YCT
Sbjct  192   LFINTVCRDGTTCDPKSLTGAECFLVFMCMAIVVAQ-FPNLNSLAWVSFIGTAAAVVYCT  250

Query  914   ILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPT  735
             ++W LS+ KGR    V+YDPP +  S +DRF  I NA+ +I LAFRGHN+ILEIQGTLPT
Sbjct  251   LVWGLSIGKGR-INNVSYDPPVME-SDMDRFGGIMNAIGIICLAFRGHNVILEIQGTLPT  308

Query  734   NTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD  555
             N K+P  + M  GV  SY +IA+C FPLAIAG+W YGN +P+S   GG+L A  +FH HD
Sbjct  309   NPKLPTCKTMWRGVTTSYAIIAICLFPLAIAGFWTYGNKVPSS--NGGLLIAISQFHAHD  366

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
             ISK ++G I +++I+ CL ++QIY + + D  E  Y S+K     C +W+R  L+V FGG
Sbjct  367   ISKVVLGLICILVIVHCLSSFQIYGMVIFDKLELNYTSRKN--KPCARWLRTALRVFFGG  424

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             +T+  +V FPFLGSLA  IG +T+PLT+AYPC MWIAIKKP+P  ++WCVNMGLG LG++
Sbjct  425   VTFFAAVTFPFLGSLAPLIGGVTLPLTYAYPCLMWIAIKKPQPKGVMWCVNMGLGFLGLV  484

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  +L  A  WNL   GL ANFF P
Sbjct  485   LSLLLVIAAAWNLGNKGLDANFFKP  509



>ref|XP_008236137.1| PREDICTED: lysine histidine transporter-like 8 [Prunus mume]
Length=502

 Score =   509 bits (1311),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 339/481 (70%), Gaps = 18/481 (4%)
 Frame = -1

Query  1526  RIGSWTSTRIAPVDIDNEPAAQVQ-------AFAPLDSCLPITESRNGNFFSITSHMLSS  1368
             R  S  S ++ P+ I       +           P D+ LPITESR G+ +S   H+L+S
Sbjct  28    RNSSSESAQVIPITISPPEKETITPTDWAGGELNPQDAWLPITESRKGSTYSAVYHILAS  87

Query  1367  GIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATV  1188
             GIGLQALLL VAF++ GWV+G I LSL F WQLYT+WLLV LHES +GTR+SRYVHLA  
Sbjct  88    GIGLQALLLAVAFSTFGWVYGTIFLSLAFSWQLYTLWLLVQLHESESGTRYSRYVHLAVT  147

Query  1187  AFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG----DPKGLTGAEWFL  1020
             AFG K+GKL  IFP MYLSGG CV LII GGG++QL  +T+C      + K LTG E +L
Sbjct  148   AFGPKLGKLLTIFPVMYLSGGMCVQLIIIGGGTIQLLIRTVCKDGAICNAKPLTGTECYL  207

Query  1019  LFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLST  840
             +F+C+AI ++  FPNLNS+A +SL+G++TAI YCT++W LS+ KGR P+ ++Y+P  L  
Sbjct  208   VFMCMAIVVAQCFPNLNSIARVSLIGTITAIVYCTMIWALSIGKGR-PRDISYNPLPLE-  265

Query  839   SKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCH  660
             S +  +  I NAL +I LAFRGHN+ILEIQGTLP++ K P  +RM +GV  SY+LIA+C 
Sbjct  266   STIATYGGILNALGIIFLAFRGHNVILEIQGTLPSSPKHPSHKRMWSGVSMSYVLIAMCL  325

Query  659   FPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYA  480
             FPLAI GYWAYGN  P  +  G IL A  +FH H+ S+ ++G IY+II+I CL TYQIY 
Sbjct  326   FPLAIGGYWAYGNKEP--FSNGAILKAISQFHGHNTSQYVLGLIYIIIVINCLTTYQIYG  383

Query  479   LPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSIT-M  303
             + V DN E  Y S+KK    CP+W+R+ +++LFGGLT+ ++VAFPFLGSL+  IG  T +
Sbjct  384   MVVFDNMEIRYTSRKK--ERCPRWLRIVIRLLFGGLTFFIAVAFPFLGSLSPLIGGFTSV  441

Query  302   PLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFN  123
             PLT+AYPCFMWIAIKKPR +  +WC N+ LGC G+ +  +   A  WNL  +GL+ANFF 
Sbjct  442   PLTYAYPCFMWIAIKKPRLHGGMWCTNVALGCFGLFLSLLFVAAAAWNLAVNGLNANFFK  501

Query  122   P  120
             P
Sbjct  502   P  502



>ref|XP_008236103.1| PREDICTED: lysine histidine transporter-like 8 [Prunus mume]
Length=487

 Score =   507 bits (1306),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 253/442 (57%), Positives = 329/442 (74%), Gaps = 10/442 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESRNGN  S T H++SSGIG+QALLLP+AF +LGW WGIICLSL F WQLY
Sbjct  56    PQDAWLPITESRNGNTISATFHLISSGIGIQALLLPLAFATLGWAWGIICLSLAFTWQLY  115

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHES +G R+SRY+HLA  AFG K+GKL  IFP MY SGG+CV LII GGG +
Sbjct  116   TTWLLVHLHESESGIRYSRYLHLAVTAFGLKLGKLLTIFPVMYQSGGTCVQLIIIGGGIM  175

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +LF+K +C  D K LTG E FL+F+C+AI ++  FPNLNS+AW+S +G++TA+ YCT++W
Sbjct  176   ELFFKNVC--DVKSLTGTECFLVFMCMAIVVAQ-FPNLNSIAWVSFIGAITAVGYCTLIW  232

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTK  726
              LS+ KGRP   ++Y+PP++  S +DRF  I N++ +I +AFRGHN++LEIQGTLP+++K
Sbjct  233   ALSIGKGRPSD-ISYNPPEMD-SNMDRFGGIMNSIGIIFIAFRGHNVMLEIQGTLPSSSK  290

Query  725   VPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISK  546
              P  ++M  GV  SY LIA+C  PLAIAG+WAYGN M   Y  G IL++  KFH H  S 
Sbjct  291   HPSHKQMWRGVTISYALIAMCLLPLAIAGFWAYGNKM---YSYGKILSSVSKFHGHKTST  347

Query  545   SLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTY  366
              ++G I +I++I CL T+QIY++ V DN E  Y S+K     C +W+RM  + LFGG+ +
Sbjct  348   FVLGLICIIVVINCLSTFQIYSMVVFDNLEFKYTSRKS--KPCARWLRMVFRFLFGGVAF  405

Query  365   LVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCT  186
               +VA PFL SLA  IG +T+PL +AYPCFMWIAIKKP+P +  WC+NMGLGCLG+++  
Sbjct  406   FAAVALPFLPSLAPLIGGMTLPLAYAYPCFMWIAIKKPQPRSGKWCINMGLGCLGLVLSV  465

Query  185   VLATATLWNLIADGLHANFFNP  120
             VL  A +WNL   GL+ANFF P
Sbjct  466   VLVVAAIWNLTDKGLNANFFKP  487



>ref|XP_008382489.1| PREDICTED: lysine histidine transporter-like 8 [Malus domestica]
Length=516

 Score =   507 bits (1306),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 260/495 (53%), Positives = 344/495 (69%), Gaps = 15/495 (3%)
 Frame = -1

Query  1589  DRIEVIK-VGRMEDGAVEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITES  1413
             DR+   +   R  D A  + + R  +   T        N    ++    P D+ LPITES
Sbjct  16    DRVYSFRSASRRSDSAQVIPITRSPTSEDTNYHVTSAANWGGGELN---PQDAWLPITES  72

Query  1412  RNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES  1233
             RNGN FS T H+L SGIG+QALLLPVA  +LGW WGIICLSL F WQLYTIWLLV LHES
Sbjct  73    RNGNXFSATFHLLCSGIGIQALLLPVALATLGWAWGIICLSLAFTWQLYTIWLLVHLHES  132

Query  1232  TTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG-  1056
              +GTR+SRY+ LA  AFG K+GK  A+ P MYLS G+CV LII GGG++ LF KT+C   
Sbjct  133   DSGTRYSRYIDLAMTAFGQKLGKFLALVPVMYLSAGTCVQLIILGGGTIXLFIKTVCNDG  192

Query  1055  ---DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKG  885
                D K LT  E FL+F+C+ I ++  FPNLNS+AW+SL+G+ TAIAYCT++W LS+ KG
Sbjct  193   ANCDAKSLTNVECFLVFMCMXIVVAQ-FPNLNSIAWVSLIGATTAIAYCTLIWALSIGKG  251

Query  884   RPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRM  705
             R P G +Y+PP++   K+DRF  I NAL +I L FRGHN++LEIQGTLP + K    + M
Sbjct  252   R-PNGTSYNPPEMD-DKMDRFGGILNALGIIVLVFRGHNVVLEIQGTLPLSLKHQTHKPM  309

Query  704   CTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIY  525
               GV  SY++IA+C +PLAIAG+WAYGN +P+S   GG+L A  KFH HD SK ++G IY
Sbjct  310   WRGVTVSYLIIAMCLYPLAIAGFWAYGNKVPSS--NGGLLIAMSKFHQHDTSKIVLGLIY  367

Query  524   MIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFP  345
             ++++I C+ T+QIY++ + D  E  Y S+K    +C +W+R   ++ FGG+T+  +V  P
Sbjct  368   VLVVINCISTFQIYSMIIFDKLETSYTSRKN--KACARWLRTTFRLFFGGMTFFAAVTLP  425

Query  344   FLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATL  165
             FLGSLA  IG +T+PL +AYPC MWIAIKKP+P +++WC+N+GLG LG+++  +L  A  
Sbjct  426   FLGSLAPLIGGLTLPLAYAYPCLMWIAIKKPKPKSVMWCINVGLGGLGLVLSALLVIAAA  485

Query  164   WNLIADGLHANFFNP  120
             WNL + GLHANFF P
Sbjct  486   WNLASRGLHANFFKP  500



>ref|XP_007201126.1| hypothetical protein PRUPE_ppa017397mg, partial [Prunus persica]
 gb|EMJ02325.1| hypothetical protein PRUPE_ppa017397mg, partial [Prunus persica]
Length=445

 Score =   504 bits (1299),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 255/447 (57%), Positives = 328/447 (73%), Gaps = 11/447 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESR G+ +S   H+L+SGIGLQALLLP+AF++ GWV+G I LSL F WQLY
Sbjct  5     PQDAWLPITESRKGSTYSAIYHVLASGIGLQALLLPIAFSTFGWVYGTIFLSLAFSWQLY  64

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T+WLLV LHES +GTR+SRYVHLA  AFG K+GKL  IFP MYLSGG CV LII GGG++
Sbjct  65    TLWLLVQLHESESGTRYSRYVHLAVTAFGPKLGKLLTIFPVMYLSGGMCVQLIIIGGGTI  124

Query  1085  QLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYC  918
             QL  +TMC      + K LTG E +L+F+C+AI ++  FPNLNS+A +S +G++TAI YC
Sbjct  125   QLLIRTMCKDGATCNAKPLTGTECYLVFMCMAIVVAQCFPNLNSIARVSFIGTITAIVYC  184

Query  917   TILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLP  738
             T++W LS+ KGR P+ ++YDP  L  S +  +  I NAL +I LAFRGHN+ILEIQGTLP
Sbjct  185   TMIWALSIGKGR-PRDISYDPLPLE-STIATYGSILNALGIIFLAFRGHNVILEIQGTLP  242

Query  737   TNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIH  558
             ++ K P  +RM +GV  SY LIA+C FPLAI GYWAYGN  P  +  G IL A  +FH H
Sbjct  243   SSPKHPSHKRMWSGVTMSYGLIAMCLFPLAIGGYWAYGNKEP--FSNGAILKAISQFHGH  300

Query  557   DISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFG  378
             + S+ ++G IY+II+I CL TYQIY + V DN E  Y S+KK    CP+W+R+ +++LFG
Sbjct  301   NTSQYVLGLIYIIIVINCLTTYQIYGMVVFDNMEIRYTSRKK--ERCPRWLRIVIRLLFG  358

Query  377   GLTYLVSVAFPFLGSLAGFIGSIT-MPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLG  201
             GLT+ ++VAFPFLGSL+  IG  T +PLT+AYPCFMWIAIKKP  +  +WC N+ LGC G
Sbjct  359   GLTFFIAVAFPFLGSLSPLIGGFTSVPLTYAYPCFMWIAIKKPCLHGGMWCTNVALGCFG  418

Query  200   MLMCTVLATATLWNLIADGLHANFFNP  120
             + +  +   A  WNL  +GL+ANFF P
Sbjct  419   LFLSLLFVAAAAWNLAVNGLNANFFKP  445



>ref|XP_003631535.1| PREDICTED: lysine histidine transporter-like 8 [Vitis vinifera]
Length=493

 Score =   503 bits (1295),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 247/445 (56%), Positives = 324/445 (73%), Gaps = 11/445 (2%)
 Frame = -1

Query  1448  APLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQL  1269
             +P +  LPITESR G  F+   H+L+SGIG+QA LLPVAF+ LGW WGI CL L F WQL
Sbjct  45    SPQEGWLPITESRKGGAFTSAFHLLASGIGIQAFLLPVAFSKLGWFWGIACLLLAFAWQL  104

Query  1268  YTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGS  1089
             YT WLLV LHE   GTR+SRY+HL+ VAFG K+GKL A+FP MYLSGG+CVMLI  GGGS
Sbjct  105   YTKWLLVQLHEPGPGTRYSRYLHLSVVAFGPKLGKLLALFPVMYLSGGTCVMLINYGGGS  164

Query  1088  LQLFYKTMCGGD---PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYC  918
             ++L ++T+CG        LTGAEWF++F C+AI ++   PNLNS+A +SLLG+ TAI+YC
Sbjct  165   MELLFRTVCGDSSCIANKLTGAEWFMVFTCLAIIVAQ-LPNLNSMAGVSLLGAATAISYC  223

Query  917   TILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLP  738
             T LW LS++KGR P GV+Y PP+ + S++ R  ++  A+ +I+LAFRGHN++LEIQGT+P
Sbjct  224   TFLWILSITKGR-PAGVSYSPPE-AESRMARIGEVLTAIGMIALAFRGHNVVLEIQGTMP  281

Query  737   TNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIH  558
             +N K P +  M  GVI S  + A C FPLAIAGYWAYGN +P +   GG+L+AF +FH  
Sbjct  282   SNPKHPSQEPMWRGVIVSCSITAACLFPLAIAGYWAYGNRIPAN---GGLLSAFSEFHGQ  338

Query  557   DISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFG  378
             +  K +M  IY++I++  LC+YQIYA+PV DN E  Y+SKK     C +WVR  ++V FG
Sbjct  339   NTKKLVMRMIYLLIVVNSLCSYQIYAMPVFDNLEFRYISKKN--KPCSRWVRAAIRVFFG  396

Query  377   GLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGM  198
             GLT  ++VA  FLGSL   IG I +PLT AYPCFMWIAIKKPR Y  +W +N+GLGC G+
Sbjct  397   GLTTFIAVAVSFLGSLGPLIGGIALPLTLAYPCFMWIAIKKPRQYGAMWYLNLGLGCSGI  456

Query  197   LMCTVLATATLWNLIADGLHANFFN  123
             ++  +L  A +W ++  G+ A+FFN
Sbjct  457   ILSVLLVAAAVWKIVDKGIDASFFN  481



>emb|CBI37767.3| unnamed protein product [Vitis vinifera]
Length=530

 Score =   504 bits (1297),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 247/445 (56%), Positives = 324/445 (73%), Gaps = 11/445 (2%)
 Frame = -1

Query  1448  APLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQL  1269
             +P +  LPITESR G  F+   H+L+SGIG+QA LLPVAF+ LGW WGI CL L F WQL
Sbjct  82    SPQEGWLPITESRKGGAFTSAFHLLASGIGIQAFLLPVAFSKLGWFWGIACLLLAFAWQL  141

Query  1268  YTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGS  1089
             YT WLLV LHE   GTR+SRY+HL+ VAFG K+GKL A+FP MYLSGG+CVMLI  GGGS
Sbjct  142   YTKWLLVQLHEPGPGTRYSRYLHLSVVAFGPKLGKLLALFPVMYLSGGTCVMLINYGGGS  201

Query  1088  LQLFYKTMCGGDP---KGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYC  918
             ++L ++T+CG        LTGAEWF++F C+AI ++   PNLNS+A +SLLG+ TAI+YC
Sbjct  202   MELLFRTVCGDSSCIANKLTGAEWFMVFTCLAIIVAQ-LPNLNSMAGVSLLGAATAISYC  260

Query  917   TILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLP  738
             T LW LS++KGR P GV+Y PP+ + S++ R  ++  A+ +I+LAFRGHN++LEIQGT+P
Sbjct  261   TFLWILSITKGR-PAGVSYSPPE-AESRMARIGEVLTAIGMIALAFRGHNVVLEIQGTMP  318

Query  737   TNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIH  558
             +N K P +  M  GVI S  + A C FPLAIAGYWAYGN +P +   GG+L+AF +FH  
Sbjct  319   SNPKHPSQEPMWRGVIVSCSITAACLFPLAIAGYWAYGNRIPAN---GGLLSAFSEFHGQ  375

Query  557   DISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFG  378
             +  K +M  IY++I++  LC+YQIYA+PV DN E  Y+SKK     C +WVR  ++V FG
Sbjct  376   NTKKLVMRMIYLLIVVNSLCSYQIYAMPVFDNLEFRYISKKN--KPCSRWVRAAIRVFFG  433

Query  377   GLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGM  198
             GLT  ++VA  FLGSL   IG I +PLT AYPCFMWIAIKKPR Y  +W +N+GLGC G+
Sbjct  434   GLTTFIAVAVSFLGSLGPLIGGIALPLTLAYPCFMWIAIKKPRQYGAMWYLNLGLGCSGI  493

Query  197   LMCTVLATATLWNLIADGLHANFFN  123
             ++  +L  A +W ++  G+ A+FFN
Sbjct  494   ILSVLLVAAAVWKIVDKGIDASFFN  518



>ref|XP_009350855.1| PREDICTED: lysine histidine transporter-like 8 [Pyrus x bretschneideri]
Length=493

 Score =   501 bits (1290),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 250/443 (56%), Positives = 326/443 (74%), Gaps = 10/443 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESRNGN FS T H+L SGIG+Q+LLLP+AF ++GW WGII LSL F WQLY
Sbjct  60    PQDAWLPITESRNGNVFSATFHLLCSGIGVQSLLLPLAFATVGWTWGIIYLSLAFAWQLY  119

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHES +G R+SRY+HLA  AFG K+GKL  IFP MYLSGG+C  LII GGG++
Sbjct  120   TSWLLVHLHESNSGIRYSRYLHLAITAFGPKLGKLLTIFPVMYLSGGTCAQLIIVGGGTM  179

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +LF K +   D   LT  E FLLF+C+AI ++   PNLNS+AW+SL+G+ TAIAYCT++W
Sbjct  180   KLFLKNVW--DVNSLTATECFLLFICMAIVVAQ-LPNLNSIAWVSLIGATTAIAYCTLIW  236

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTK  726
              LS+ KGR P G++Y+PP++   K+DRF  I NAL +I LAFRGHN+ILEIQGTLP++ K
Sbjct  237   GLSICKGR-PSGISYNPPEMD-EKMDRFGVILNALGIIVLAFRGHNVILEIQGTLPSSPK  294

Query  725   VPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIH-DIS  549
                + +M  GV  SY + A+C  PLA+AG+WAYGN +P+SY  G IL++F  F+ H   S
Sbjct  295   QTSQNQMWRGVTVSYAVTAMCFLPLAVAGFWAYGNNIPSSY--GRILSSFSHFNGHKSTS  352

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K ++G I ++++I CL T+QIY++ V DN E  Y S+K     C KW+R+  ++ FGGL 
Sbjct  353   KFVLGLICILVVINCLSTFQIYSMVVFDNLEFKYTSRKN--KPCAKWLRIAFRISFGGLV  410

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + ++VAFPFL SLA  IG +T+PL +AYPCFMWI +KKP P + +WCVN+GLG LG+ + 
Sbjct  411   FFIAVAFPFLPSLAPLIGGMTLPLAYAYPCFMWITMKKPEPKSAMWCVNIGLGFLGLSLS  470

Query  188   TVLATATLWNLIADGLHANFFNP  120
              VL  A++WNL   GL ANFF P
Sbjct  471   VVLVIASVWNLADKGLRANFFRP  493



>ref|XP_008382490.1| PREDICTED: lysine histidine transporter-like 8 [Malus domestica]
Length=493

 Score =   500 bits (1287),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 250/443 (56%), Positives = 325/443 (73%), Gaps = 10/443 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESRNGN FS T H+L SGIG+Q+LLLP+AF ++GW WGII LSL F WQLY
Sbjct  60    PQDAWLPITESRNGNVFSATFHLLCSGIGVQSLLLPLAFATVGWTWGIIGLSLAFAWQLY  119

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHES +G R+SRY+HLA  AFG K+GKL  IFP MYLSGG+C  LII GGG++
Sbjct  120   TSWLLVHLHESNSGIRYSRYLHLAITAFGPKLGKLLTIFPVMYLSGGTCAQLIIIGGGTM  179

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +LF K +   D   LT  E FLLF+C+AI ++   PNLNS+AW+SL+G+ TAIAYCT++W
Sbjct  180   KLFLKNVW--DVNSLTATECFLLFICMAIVVAQ-LPNLNSIAWVSLIGATTAIAYCTLIW  236

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTK  726
              LS+ KGR P G++Y+PP++   K+DRF  I NAL +I LAFRGHN+ILEIQGTLP++ K
Sbjct  237   GLSIGKGR-PSGISYNPPEMD-EKMDRFGMILNALGIIVLAFRGHNVILEIQGTLPSSPK  294

Query  725   VPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD-IS  549
                + +M  GV  SY + A+C  PLA+AG WAYGN +P+SY  G IL++F +F+ H   S
Sbjct  295   QTSQNQMWRGVTVSYAVTAMCFLPLAVAGSWAYGNNIPSSY--GRILSSFSQFNGHKRTS  352

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K ++G I ++++I CL T+QIY++ V DN E  Y S+K     C KW+R   ++LFGG  
Sbjct  353   KFVLGLICILVVINCLSTFQIYSMVVFDNLEFKYTSRKN--KPCAKWLRXAFRILFGGXV  410

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + ++VAFPFL SLA  IG +T+PL +AYPCFMWI +KKP P + +WCVN+GLG LG+ + 
Sbjct  411   FFIAVAFPFLPSLAPLIGGMTLPLAYAYPCFMWITMKKPEPKSAMWCVNIGLGFLGLSLS  470

Query  188   TVLATATLWNLIADGLHANFFNP  120
              VL  A++WNL   GL ANFF P
Sbjct  471   VVLVIASVWNLADKGLRANFFRP  493



>ref|XP_011088671.1| PREDICTED: lysine histidine transporter-like 8 [Sesamum indicum]
Length=517

 Score =   500 bits (1288),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 267/504 (53%), Positives = 349/504 (69%), Gaps = 27/504 (5%)
 Frame = -1

Query  1601  ERERDRIEVIKVGRMEDGAVEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPI  1422
             +  R+  E I    +   A  V VE +    S  I  +  ++E + ++    P D+ LPI
Sbjct  30    QNGREEHENIHNNNLP--AESVAVEEV---LSNTIIGIPEEDEFSGEMN---PQDAWLPI  81

Query  1421  TESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDL  1242
             TESR GN  +   H+LSSGIG QALLLP AF SLGW WGI+ LSL++ WQLYTIWLLV+L
Sbjct  82    TESRKGNTLTAALHLLSSGIGTQALLLPFAFISLGWFWGILLLSLVYSWQLYTIWLLVNL  141

Query  1241  HEST--TGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKT  1068
             HE +   G R+SR++HL+ VAFG K+GK  A+FPT YLSGG+C + II+GG +++L Y+ 
Sbjct  142   HEPSPQNGIRYSRFLHLSIVAFGEKLGKWVAMFPTFYLSGGTCALYIISGGTTMELLYQA  201

Query  1067  MCGGD----PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTL  900
             MC  +     K LTGA+WFLLF+C+AIFI+ F  NLNS+A ISL+GS+T IAYC++LW L
Sbjct  202   MCEDNLKCQAKSLTGAQWFLLFICLAIFIAFFVRNLNSVAPISLIGSITVIAYCSLLWVL  261

Query  899   SVSKGRPPQGVTYDPPQLSTSKLDR----FRDIANALAVISLAFRGHNIILEIQGTLPTN  732
             SVSKGRP       PP L  +  D     FR++ N++ +I+LAFRGHN++LEIQGTLPTN
Sbjct  262   SVSKGRPVDA----PPILPQNNNDDAGGVFRNVLNSIGMIALAFRGHNLVLEIQGTLPTN  317

Query  731   TKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDI  552
              K P R+ M  GV  SY++IA+C FPLAI G+WAYGN +P +   GGIL AF KFH ++ 
Sbjct  318   RKQPSRKSMWRGVAISYLIIAICLFPLAIVGHWAYGNQIPIN---GGILTAFTKFHQNNT  374

Query  551   SKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGL  372
             SK ++GAIY+IIII  LC +QIYA+PV DN  R+Y S+K    +CP W R   KV  GGL
Sbjct  375   SKYIVGAIYLIIIINYLCAFQIYAMPVFDNLARLYTSRKNK--ACPSWFRAATKVWLGGL  432

Query  371   TYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLM  192
             TY V+V FPFL SL  F GSI +PLT AYPC MW+AIKKP  ++ +WC+N+GL   G+++
Sbjct  433   TYFVAVTFPFLPSLGAFTGSIVLPLTLAYPCLMWVAIKKPARFSRMWCLNVGLASSGIVL  492

Query  191   CTVLATATLWNLIADGLHANFFNP  120
               + A+A LW LI +G+ ANFF P
Sbjct  493   SLMCASAALWFLIINGVDANFFKP  516



>ref|XP_009350856.1| PREDICTED: lysine histidine transporter-like 8 [Pyrus x bretschneideri]
Length=504

 Score =   499 bits (1286),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 251/450 (56%), Positives = 331/450 (74%), Gaps = 11/450 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESRNGN FS T  +L SGIG+QALLLPVA  +LGW WGIICLSL F WQLY
Sbjct  62    PQDAWLPITESRNGNTFSATFLLLCSGIGIQALLLPVALATLGWAWGIICLSLAFTWQLY  121

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             TIWLLV LHES +GTR+SRY+ LA  AFG K+G   A+ P MYLS G+C+ LII GGG++
Sbjct  122   TIWLLVHLHESDSGTRYSRYLGLAMTAFGQKLGTFLALVPVMYLSAGTCIQLIILGGGTI  181

Query  1085  QLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYC  918
             +LF KT+C      D K LT  E FL+F+C+AI ++  FPNLNS+AW+SL+G+ TAIAYC
Sbjct  182   KLFIKTVCNDGANCDAKSLTNVECFLVFMCMAIVVAQ-FPNLNSIAWVSLIGATTAIAYC  240

Query  917   TILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLP  738
             T++W LS+ KGR P G +Y+PP++   ++DRF  I NAL +I LAFRGHN++LEIQGTLP
Sbjct  241   TLIWALSIGKGR-PNGTSYNPPEMD-DEMDRFGGILNALGIIVLAFRGHNVVLEIQGTLP  298

Query  737   TNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIH  558
              + K    + M  GV  SY++I++C +PLAIAG+WAYGN +P+S   GG+L A  KFH H
Sbjct  299   LSLKHQTHKPMWRGVTVSYLIISMCLYPLAIAGFWAYGNKVPSS--NGGLLIAMSKFHQH  356

Query  557   DISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFG  378
             D SK ++G IY++++I C+ T+QIY++ + D  E  Y S+K    +C +W+R   ++ FG
Sbjct  357   DTSKIVLGLIYVLVVINCISTFQIYSMIIFDKLETSYTSRKN--KACTRWLRTTFRLFFG  414

Query  377   GLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGM  198
             G+T+  +V  PFLGSLA  IG +T+PLT+AYPC MWIAIKKP+P + +WC+N+GLG LG+
Sbjct  415   GMTFFAAVTLPFLGSLAPLIGGLTLPLTYAYPCLMWIAIKKPKPKSAMWCINVGLGGLGL  474

Query  197   LMCTVLATATLWNLIADGLHANFFNP*HCN  108
             ++  +L  A  WNL + GLHANFF P   N
Sbjct  475   VLSALLVIAAAWNLASRGLHANFFKPSDLN  504



>ref|XP_007199979.1| hypothetical protein PRUPE_ppa025334mg, partial [Prunus persica]
 gb|EMJ01178.1| hypothetical protein PRUPE_ppa025334mg, partial [Prunus persica]
Length=511

 Score =   498 bits (1283),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 251/444 (57%), Positives = 328/444 (74%), Gaps = 11/444 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESRNGN  S T H++SSGIG+QALLLP+AF +LGW WGIICLSL F WQLY
Sbjct  77    PQDAWLPITESRNGNTISATFHLISSGIGIQALLLPLAFATLGWAWGIICLSLAFTWQLY  136

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHES +G R+SRY+HLA  AFG K+GKL  IFP MY SGG+CV LII GGG +
Sbjct  137   TTWLLVHLHESESGIRYSRYLHLAVTAFGLKLGKLLTIFPVMYQSGGTCVQLIIIGGGIM  196

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +LF+K +C  D K LTG E FL+F+C+AI ++  FPNLNS+AW+S +G++TA+ YCT++W
Sbjct  197   ELFFKNVC--DVKSLTGTECFLVFMCMAIVVAQ-FPNLNSIAWVSFIGAITAVGYCTLIW  253

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQ--GTLPTN  732
              LS+ KGR P  ++Y+PP++  S +D F  I N++ +I +AFRGHN++LEIQ  GTLP++
Sbjct  254   ALSIGKGR-PSDISYNPPEMD-SNMDTFGGIMNSIGIIFIAFRGHNVMLEIQASGTLPSS  311

Query  731   TKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDI  552
             +K P  ++M  GV  SY LIA+C  PLA A +WAYGN +P SY  G IL++  KFH H  
Sbjct  312   SKHPSHKQMWRGVTISYALIAMCLLPLATAEFWAYGNKIPYSY--GKILSSVSKFHGHKT  369

Query  551   SKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGL  372
             S  ++G I +I++I CL T+QIY++ V DN E  Y S+K     C +W+RM  + LFGG+
Sbjct  370   STFVLGLICIIVVINCLSTFQIYSMVVFDNLEFKYTSRKS--KPCARWLRMVFRFLFGGV  427

Query  371   TYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLM  192
              +  +VA PFL SLA  IG +T+PL +AYPCFMWIAIKKP+P +  WC+NMGLGCLG+++
Sbjct  428   AFFAAVALPFLPSLAPLIGGMTLPLAYAYPCFMWIAIKKPQPRSGKWCINMGLGCLGLVL  487

Query  191   CTVLATATLWNLIADGLHANFFNP  120
               VL  A +WNL   GL+ANFF P
Sbjct  488   SVVLVVAAIWNLTDKGLNANFFKP  511



>ref|XP_008380969.1| PREDICTED: lysine histidine transporter-like 8 [Malus domestica]
Length=493

 Score =   498 bits (1281),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 248/443 (56%), Positives = 326/443 (74%), Gaps = 10/443 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESRNGN  S T H+L SGIG+Q+LLLP+AF +LGW  GIICLSL F WQLY
Sbjct  60    PQDAWLPITESRNGNVXSATFHLLCSGIGIQSLLLPLAFATLGWALGIICLSLAFAWQLY  119

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHES TG R+SRY+HLA  AFG K+GKL  IFP MYLSGG+C  LII GGG++
Sbjct  120   TAWLLVHLHESDTGIRYSRYLHLAITAFGPKLGKLLTIFPVMYLSGGTCAQLIIIGGGTM  179

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +LF K +C  D   +TG E FLLFVC+AI ++  FPNLNS+AW+SL+G+ TAIAY T++W
Sbjct  180   KLFLKAVC--DVNSVTGTECFLLFVCMAIVVAQ-FPNLNSIAWVSLIGATTAIAYYTLIW  236

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTK  726
              L + KGR P G++Y+PP++  S +DRF  + N++ +I LAF+GHN+ILEIQGTLP++ K
Sbjct  237   GLLIGKGR-PSGISYNPPEME-SNMDRFGGVLNSVGIIFLAFKGHNVILEIQGTLPSSPK  294

Query  725   VPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFH-IHDIS  549
                + RM  GV  SY L A+C  PLAIAG+WAYGN +P+SY  GG+L +F +F+   + S
Sbjct  295   QRSQNRMWRGVTISYALKAMCFLPLAIAGFWAYGNKIPSSY--GGLLTSFSQFNGRKNTS  352

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K+++G + ++++I CL T+QIY++ V DN E  Y SKK     C +W+R+  ++ FGGL 
Sbjct  353   KAVLGLLCILVVINCLSTFQIYSMVVFDNLEFKYTSKKN--KPCARWLRIAFRIFFGGLA  410

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + ++VAFPFL SLA  IG +T+PL  AYPCFMWI +KKP P + +W VN+GLG LG+ + 
Sbjct  411   FFIAVAFPFLPSLAPLIGGMTLPLAXAYPCFMWITMKKPEPKSTMWFVNIGLGFLGLSLS  470

Query  188   TVLATATLWNLIADGLHANFFNP  120
               L  A++WNL   GLHANFF P
Sbjct  471   VXLVIASVWNLADKGLHANFFRP  493



>ref|XP_002306215.2| hypothetical protein POPTR_0004s18770g [Populus trichocarpa]
 gb|EEE86726.2| hypothetical protein POPTR_0004s18770g [Populus trichocarpa]
Length=438

 Score =   495 bits (1275),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 249/445 (56%), Positives = 323/445 (73%), Gaps = 16/445 (4%)
 Frame = -1

Query  1430  LPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLL  1251
             +P+TESRNGN  +   H+LSSGIG+QALLLPVAF +LGWVWG I LSL F WQLYTIW L
Sbjct  1     MPLTESRNGNVATAVFHLLSSGIGIQALLLPVAFATLGWVWGAISLSLAFTWQLYTIWTL  60

Query  1250  VDLHESTTG--TRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLF  1077
             V LHE   G  TR+SRY+ LA  AFG K+GKL AIFP MYLSG +C+MLII G G ++L 
Sbjct  61    VQLHEPIPGIRTRYSRYLQLAIAAFGPKLGKLLAIFPVMYLSGSTCIMLIIKGAGVMELL  120

Query  1076  YKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTIL  909
             +K MC G    D K LTGAEWFL+F C+AI ++   PNLNS+A  SL+G+++AI YCT++
Sbjct  121   FKLMCEGGATCDAKSLTGAEWFLVFTCMAIALAQ-RPNLNSIAGFSLVGAMSAIGYCTLI  179

Query  908   WTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNT  729
             W L +SK R P GV+YD  +  ++    F D+ NA+ +I LAFRGHN++LEIQGTLP++ 
Sbjct  180   WALPISKDR-PSGVSYDSRKGGSTMAGMF-DVLNAIGIIVLAFRGHNLVLEIQGTLPSSL  237

Query  728   KVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDIS  549
               P +R M  GV  SYI+IA+C FPLAIAG+WAYGN +P++   GG+L AF +FH HD S
Sbjct  238   TNPSKRTMWRGVSVSYIIIAMCQFPLAIAGFWAYGNKIPSN---GGMLTAFMQFHGHDTS  294

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             +   G +Y++++I CL ++QIYA+PV DN E  Y+S K     CP WVR+G ++ FGGL 
Sbjct  295   RFAKGLVYLLVVINCLSSFQIYAMPVFDNLEFRYISMKN--RRCPWWVRIGFRLFFGGLA  352

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKP--RPYTLVWCVNMGLGCLGML  195
             + ++VA PFL SLA  +G IT+PLT AYPCFMWI IKKP  + +  +WC+N+GLGCLG++
Sbjct  353   FFIAVALPFLPSLAPLVGGITLPLTLAYPCFMWILIKKPHQKGHDALWCLNLGLGCLGIV  412

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  +L  A  WNL   GLHA+FF P
Sbjct  413   LSVLLVVAAAWNLAIKGLHASFFKP  437



>ref|XP_002300663.2| hypothetical protein POPTR_0002s01430g [Populus trichocarpa]
 gb|EEE79936.2| hypothetical protein POPTR_0002s01430g [Populus trichocarpa]
Length=526

 Score =   496 bits (1277),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 241/470 (51%), Positives = 332/470 (71%), Gaps = 11/470 (2%)
 Frame = -1

Query  1523  IGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALL  1344
             I S     IA +    E         P D+ LPITESRNGN +    H LSSGIG+QALL
Sbjct  65    IASPMKKAIASMQCYLEEVGHFTKLDPQDAWLPITESRNGNAYYSAFHTLSSGIGVQALL  124

Query  1343  LPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGK  1164
             LP+AFT+L W WGI+CLSL+F+WQLYT+WLL+ LHES +G R+SRY+ L+  AFG K+GK
Sbjct  125   LPLAFTTLSWTWGILCLSLVFMWQLYTLWLLIQLHESESGMRYSRYLRLSMAAFGEKLGK  184

Query  1163  LAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFIS  990
             L A+FP MYLSGG+CV LI+ GGG++++F++ +CG     + L   EW+ LFVC+AI ++
Sbjct  185   LLALFPVMYLSGGTCVTLIMIGGGTMKIFFQIVCGDTCSMRPLATIEWYFLFVCLAIILA  244

Query  989   LFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIA  810
                PNLNS+A +SL+G++TAI+YCT++W +S+ +GR P+GV+YDPP+ + S + R  DI 
Sbjct  245   Q-LPNLNSIAGVSLIGAITAISYCTLIWVVSIIQGR-PEGVSYDPPE-TKSDMARICDIL  301

Query  809   NALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWA  630
             NAL +I+ AFRGHN++LEIQGT+P++ K P R+ M  GV  +Y++IA+C FPLAI GYWA
Sbjct  302   NALGIIAFAFRGHNLVLEIQGTMPSSAKQPSRKPMWRGVKLAYVIIAMCLFPLAIGGYWA  361

Query  629   YGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERI  450
             YGNLMP     GG+LNA  K+H H  SK L+G   + +++ CL ++QIYA+PV DN E  
Sbjct  362   YGNLMP----NGGMLNALHKYHGHSTSKLLLGLTSLFVVLNCLSSFQIYAMPVFDNLELR  417

Query  449   YLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMW  270
             + SK K    CP W+R+  ++ FG L + +SVA PFL SLAG IG + +P+T AYPCFMW
Sbjct  418   FTSKMK--KPCPWWLRIVFRIFFGCLAFFISVALPFLMSLAGLIGGVALPVTLAYPCFMW  475

Query  269   IAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             I IKKP  Y+ +WC+N  LG LGM++  ++    +W ++  G+  +FF P
Sbjct  476   ILIKKPTKYSAIWCLNWILGVLGMVLSMLVIAGAIWTIVTMGIEIHFFKP  525



>emb|CAN73165.1| hypothetical protein VITISV_027980 [Vitis vinifera]
Length=493

 Score =   493 bits (1270),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 243/445 (55%), Positives = 319/445 (72%), Gaps = 11/445 (2%)
 Frame = -1

Query  1448  APLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQL  1269
             +P +  LPITESR G   +   H+LSSGIG+QA LLPVAF+ LGW WGI CL L F WQL
Sbjct  45    SPQEGWLPITESRKGGAXTSAFHLLSSGIGIQAFLLPVAFSKLGWFWGIACLLLAFAWQL  104

Query  1268  YTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGS  1089
             YT WLLV LHE   G R+SRY+ L+ VAFG K+GKL A+FP MYLSGG+CVMLI  GGGS
Sbjct  105   YTKWLLVQLHEPGPGNRYSRYLQLSVVAFGPKLGKLLALFPVMYLSGGTCVMLINYGGGS  164

Query  1088  LQLFYKTMCGGD---PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYC  918
             ++L ++T+CG        LTGAEWF++F C+AI ++   PNLNS+A +SLLG+ TAI+YC
Sbjct  165   MELLFRTVCGDSSCIANKLTGAEWFMVFTCLAIIVAQ-LPNLNSMAGVSLLGAATAISYC  223

Query  917   TILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLP  738
               LW LS++KGR P GV+Y PP+ + S++ R  ++  A+ +I+LAFRGHN++LEIQGT+P
Sbjct  224   XFLWILSITKGR-PAGVSYSPPE-AESRMARIGEVLTAIGMIALAFRGHNVVLEIQGTMP  281

Query  737   TNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIH  558
             +N K P +  M  GVI S  + A C FPLAIAGYWAYGN +P +   GG+L+A  +FH  
Sbjct  282   SNPKHPSQEPMWRGVIVSCSITAACLFPLAIAGYWAYGNRIPAN---GGLLSALSEFHGQ  338

Query  557   DISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFG  378
             +  K +M  IY++I++  LC+YQIYA+PV DN E  Y+SKK     C +WVR  ++V FG
Sbjct  339   NTKKLVMRMIYLLIVVNSLCSYQIYAMPVFDNLEFRYISKKN--KPCSRWVRAAIRVFFG  396

Query  377   GLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGM  198
             GLT  ++VA  FLGSL   IG I +PLT AYPCFMWIAIKKPR Y  +W +N+GLGC G+
Sbjct  397   GLTTFIAVAVSFLGSLGPLIGGIALPLTLAYPCFMWIAIKKPRQYGAMWYLNLGLGCSGI  456

Query  197   LMCTVLATATLWNLIADGLHANFFN  123
             ++  +L  A +W ++  G+ A+FFN
Sbjct  457   ILSVLLVAAAVWKIVDKGIDASFFN  481



>ref|XP_011034911.1| PREDICTED: lysine histidine transporter-like 8 [Populus euphratica]
Length=526

 Score =   494 bits (1273),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 241/470 (51%), Positives = 332/470 (71%), Gaps = 11/470 (2%)
 Frame = -1

Query  1523  IGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALL  1344
             I S     IA +    E         P D+ LPITESRNGN +    H LSSGIG+QALL
Sbjct  65    IASPMKKAIASMQSYLEEVGHFTKLDPQDAWLPITESRNGNAYYSAFHTLSSGIGVQALL  124

Query  1343  LPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGK  1164
             LP+AFT+L W WGI+CLSL+F+WQLYT+WLL+ LHES +G R+SRY+ L+  AFG K+GK
Sbjct  125   LPLAFTTLSWTWGILCLSLVFMWQLYTLWLLIQLHESESGMRYSRYLRLSMAAFGEKLGK  184

Query  1163  LAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFIS  990
             L A+ P MYLSGG+CV LI+ GGG++++F++ +CG     + LT  EW+LLFVC+AI ++
Sbjct  185   LLALLPVMYLSGGTCVTLIMIGGGTMKIFFQIVCGDTCSMRPLTTIEWYLLFVCLAIILA  244

Query  989   LFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIA  810
                PNLNS+A +SL+G++TAI+YCT++W +S+ +GR P+GV+YDPP+ +   + R  DI 
Sbjct  245   Q-LPNLNSVAGVSLIGAITAISYCTLIWVVSIIQGR-PEGVSYDPPE-TKCDMARICDIL  301

Query  809   NALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWA  630
             NAL +I+ AFRGHN++LEIQGT+P++ K P R+ M  GV  +Y++IA+C FPLAI GYWA
Sbjct  302   NALGIIAFAFRGHNLVLEIQGTMPSSAKQPSRKPMWRGVKLAYVIIAMCLFPLAIGGYWA  361

Query  629   YGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERI  450
             YGNLMP     GG+LNA  K+H H  SK L+G   + +++ CL ++QIYA+PV DN E  
Sbjct  362   YGNLMP----NGGMLNALHKYHGHSTSKLLLGLTSLFVVLNCLSSFQIYAMPVFDNLELR  417

Query  449   YLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMW  270
             + SK K    CP W+R+  ++ FG L + +SVA PFL SLAG IG + +P+T AYPCFMW
Sbjct  418   FTSKMK--KPCPWWLRIVFRIFFGCLAFFISVALPFLMSLAGLIGGVALPVTLAYPCFMW  475

Query  269   IAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             I IKKP  Y+ +WC+N  LG LGM++  ++    +W ++  G+  +FF P
Sbjct  476   ILIKKPAKYSAIWCLNWILGVLGMVLSILVIAGAIWTIVTMGIEIHFFKP  525



>gb|EYU38007.1| hypothetical protein MIMGU_mgv1a004728mg [Erythranthe guttata]
Length=512

 Score =   493 bits (1268),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 250/448 (56%), Positives = 333/448 (74%), Gaps = 12/448 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P DS LPITESR G+ F+   H++ SGIG+QALLLP+AF SLGW WGIICL++ + WQLY
Sbjct  70    PQDSWLPITESRKGSSFTAAFHLMCSGIGIQALLLPLAFVSLGWFWGIICLTVAYSWQLY  129

Query  1265  TIWLLVDLHEST--TGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGG  1092
             TIWLLV+LHE +  +G R+SRY+HL+ VAFG K+GKL AIFPT+YLS G+CV+ II GG 
Sbjct  130   TIWLLVNLHEPSPQSGIRYSRYLHLSIVAFGEKLGKLVAIFPTLYLSSGTCVIYIITGGT  189

Query  1091  SLQLFYKTMCGGD----PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIA  924
             +++L ++++C  +     K LTGAEW L+F+C+AI IS FFPNL+SL  +S++GS+TA++
Sbjct  190   TMELLFQSICENNLECKSKALTGAEWCLVFICLAILISQFFPNLDSLTSVSIIGSVTALS  249

Query  923   YCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGT  744
             YC +L  LS+ KG+P   V  D   L+     + R++ N L +I+LAFRGHN++LEIQGT
Sbjct  250   YCALLCVLSIIKGKPDDLVD-DVIILNNDATSKIRNVLNGLGIIALAFRGHNLVLEIQGT  308

Query  743   LPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFH  564
             +PTN K P R+ M  GV  SY++IA+  +PLAI GYWAYGN MP    KGGIL+AF KF+
Sbjct  309   IPTNLKQPSRKSMWRGVTISYLVIAMTVYPLAIVGYWAYGNKMPV---KGGILSAFTKFN  365

Query  563   IHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVL  384
                 SK ++G+IY++II+  LCT+QIYA+P  DN+ERIY +KK     C + VR  +KVL
Sbjct  366   QSSTSKYIIGSIYILIIVNYLCTFQIYAMPAFDNFERIYTTKKNK--PCTRLVRSIIKVL  423

Query  383   FGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCL  204
             FGG+TY V+VA PFL SL  F+GS+ +PLT AYPC MWI IKKP+ ++ +W +NMGLG  
Sbjct  424   FGGVTYFVAVAIPFLPSLGAFVGSLALPLTLAYPCLMWICIKKPKQFSRMWAINMGLGYS  483

Query  203   GMLMCTVLATATLWNLIADGLHANFFNP  120
             G+L+ T+ A A LW+LI +GL ANFF P
Sbjct  484   GILLSTLCAGAGLWSLIVNGLEANFFKP  511



>ref|XP_008777808.1| PREDICTED: lysine histidine transporter-like 8 [Phoenix dactylifera]
Length=507

 Score =   485 bits (1248),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 235/442 (53%), Positives = 317/442 (72%), Gaps = 12/442 (3%)
 Frame = -1

Query  1439  DSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTI  1260
             D+ LPITESRNGN +    H LSSGIG QAL+LPVAFT+LGW WGI+CLS  F+WQLYT+
Sbjct  75    DAWLPITESRNGNAYYSAFHTLSSGIGFQALVLPVAFTALGWTWGILCLSGAFIWQLYTL  134

Query  1259  WLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQL  1080
             WLLV LHES  GTR+ RY+ L+  AFG K GK+ A+FPTMYLS G C  +II GGGS++L
Sbjct  135   WLLVQLHESVPGTRYCRYLQLSKAAFGSKWGKILALFPTMYLSAGICSAIIIVGGGSMKL  194

Query  1079  FYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             F+  +CG   +   LT  EW+L+F+C+A+ I+   PNLNS+A +SL+G+ TA++YCT++W
Sbjct  195   FFNDVCGSTCNSNPLTTIEWYLVFICLAVIIAQ-LPNLNSIAGVSLIGAATAVSYCTLIW  253

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTK  726
              +SVSKGR P GV+YDP  ++ S +DR  DI NAL +I+ AFRGHN++LEIQ T+P+  K
Sbjct  254   VVSVSKGRQP-GVSYDP--VNKSGIDRVLDILNALGIIAFAFRGHNVVLEIQATMPSTLK  310

Query  725   VPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISK  546
              P    M  GV ++Y+++ALC +PLAI G+WAYGNL+P+S    GILNA  +FH  D S+
Sbjct  311   HPSHVPMWRGVKSAYLIVALCLYPLAIGGFWAYGNLIPSS----GILNALYEFHGKDTSR  366

Query  545   SLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTY  366
             +++G   ++++I CL +YQIYA+PV DN E  Y SKK     CP+W+R G +  FG +++
Sbjct  367   AVLGLTSLLVVINCLSSYQIYAMPVFDNMEAGYTSKKN--RPCPRWLRSGFRAFFGAVSF  424

Query  365   LVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCT  186
             L++VAFPFL  LA   G++ +P+T AYPCFMWI +KKP  Y+  W +N  LG LGM +  
Sbjct  425   LIAVAFPFLSDLAALTGAVALPVTLAYPCFMWIVMKKPERYSATWYINWWLGSLGMGLSV  484

Query  185   VLATATLWNLIADGLHANFFNP  120
             VL    +W L+  GL  +FF P
Sbjct  485   VLVIGGVWQLVKTGLTLHFFKP  506



>ref|XP_002510637.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF52824.1| amino acid transporter, putative [Ricinus communis]
Length=524

 Score =   481 bits (1237),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 232/454 (51%), Positives = 325/454 (72%), Gaps = 10/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E         P ++ LPITESR+GN +    H LSSGIG+QAL+LP+AFT+LGW WG++ 
Sbjct  78    EEVGHFTKLDPQEAWLPITESRSGNAYYSAFHTLSSGIGVQALVLPLAFTTLGWTWGLVS  137

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LSL+F+WQLYT+WLL+ LHES +G R+SRY+ L+  AFG K+GKL ++FP MYLSGG+CV
Sbjct  138   LSLIFMWQLYTLWLLIQLHESESGMRYSRYLRLSMAAFGEKLGKLLSLFPIMYLSGGTCV  197

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GGG++++ ++ +CG   + K L   EW+LLF C AI I+   PNLNS+A +SL+G
Sbjct  198   TLIMIGGGTMKILFQIVCGETCNLKPLLTTEWYLLFTCSAIVIAQ-LPNLNSIAGVSLIG  256

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TA++YCT++W +S+ +GR P  V++DPP+ + S   R   I NAL +I+ AFRGHN++
Sbjct  257   AVTAVSYCTLIWVVSIIQGR-PTDVSHDPPE-ANSDTARLCSIFNALGIIAFAFRGHNLV  314

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQGT+P++ K P R  M  GV  +Y++IA+C FPLAI GYWAYGNL+P     GG+LN
Sbjct  315   LEIQGTMPSSAKQPSRLPMWRGVKFAYLIIAMCLFPLAIGGYWAYGNLIP---GNGGMLN  371

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A  KFH HD SK+L+G   ++++I CL ++QIYA+PV DN E  Y S  KM   CP+W+R
Sbjct  372   ALYKFHGHDTSKTLLGLTSLLVVINCLSSFQIYAMPVFDNLELRYTS--KMNKPCPRWLR  429

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
               +++ FG L + ++VAFPFL SLAG IG I +P+T AYPCFMWI +KKP  Y  +WC+N
Sbjct  430   SVIRMFFGCLAFFIAVAFPFLPSLAGLIGGIALPVTLAYPCFMWIIMKKPHKYGAIWCLN  489

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG  GM++  ++  A +W ++  G+  +FF P
Sbjct  490   WTLGLFGMVLSILVVAAAIWTIVTMGIEIHFFKP  523



>ref|XP_002284824.1| PREDICTED: lysine histidine transporter-like 8 [Vitis vinifera]
Length=515

 Score =   480 bits (1236),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 228/454 (50%), Positives = 327/454 (72%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESR+GN +    H LSSGIG+QAL+LP+AFT+LGW+WGI+C
Sbjct  70    EEVGHLTKLDPQDAWLPITESRDGNAYYSAFHSLSSGIGVQALVLPLAFTTLGWIWGILC  129

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LSL F WQLYT+WLL+ LHES +GTR+SRY+ L+  AFG K+GKL A+FPTMYLSGG+CV
Sbjct  130   LSLAFGWQLYTLWLLIQLHESASGTRYSRYLRLSMAAFGEKLGKLLALFPTMYLSGGTCV  189

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              L+I GGG++++F++ +C    +   LT  EW+++F C A+ ++   PNLNS+A ISL+G
Sbjct  190   TLVIIGGGTMKIFFQIVCDSNCNVNPLTTIEWYIVFTCSAVILAQ-LPNLNSIAGISLIG  248

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             S++A+ YCT++W +SV+K R P GV+YDP +  TS + R   I NAL +I+ AFRGHN++
Sbjct  249   SISAVTYCTVIWVVSVTKDR-PHGVSYDPVK-PTSDVARLCGILNALGIIAFAFRGHNLV  306

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQGT+P++ K P R+ M +GV  +Y++IA+  FPLA+ GYWAYGNL+    K+ G+  
Sbjct  307   LEIQGTMPSSAKHPSRKPMWSGVKFAYLIIAMSLFPLAVGGYWAYGNLI----KEDGMFA  362

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   +H HD S+ ++G   ++I+I  L ++QIYA+P  DN E  Y+S +     CP W+R
Sbjct  363   ALYNYHGHDTSRIILGLTSLLIVINSLTSFQIYAMPAFDNLEFRYISSRN--QPCPWWLR  420

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +  FG L + ++VA PFL SLAG IG + +P+TFAYPCFMWI IK+P+ Y+++W +N
Sbjct  421   SGFRAFFGCLVFFIAVALPFLPSLAGLIGGVALPVTFAYPCFMWIQIKQPQKYSVIWYLN  480

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLGC+GM++  +L T  +W+++  G+  +FF P
Sbjct  481   WGLGCMGMVLSVLLVTGAVWSIVTMGIEIHFFKP  514



>ref|XP_010061145.1| PREDICTED: lysine histidine transporter-like 8 [Eucalyptus grandis]
 gb|KCW68048.1| hypothetical protein EUGRSUZ_F01731 [Eucalyptus grandis]
Length=510

 Score =   480 bits (1235),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 232/456 (51%), Positives = 323/456 (71%), Gaps = 14/456 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E   Q     P D  LPITESRNGN +    H LSSGIG+QALLLP+AF+ LGWVWGI+C
Sbjct  64    EEVGQFTKLDPHDDWLPITESRNGNVYYAAFHTLSSGIGVQALLLPLAFSVLGWVWGIVC  123

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LS++FVWQLYT+WLLV LHES  GTR+SRY+ L+  AFG K GKL A+FP MYLSGG+CV
Sbjct  124   LSVVFVWQLYTLWLLVQLHESEDGTRYSRYLRLSMAAFGKKKGKLLALFPIMYLSGGTCV  183

Query  1115  MLIINGGGSLQLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISL  948
              LI+ GGGS+++ ++ +CGG    DP   +  EW+L+F+C AI ++   PNLNS+A +SL
Sbjct  184   ALIMIGGGSMKIIFEILCGGTCNIDPP--STVEWYLVFICCAIILAQ-LPNLNSIAGVSL  240

Query  947   LGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHN  768
             +G++TAI YCT++W LS++KGR P GV+Y+P + + S+L R   + NA+ +++  FRGHN
Sbjct  241   IGAITAIGYCTLIWALSITKGR-PTGVSYEPVK-TGSELARICSVLNAVGIVAFVFRGHN  298

Query  767   IILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGI  588
             ++LEIQGT+P++ +   R+ M  GV  +Y++IALC FPLAI  YWAYGN +PT+    GI
Sbjct  299   VVLEIQGTMPSSRQKSSRQPMWKGVKFAYVVIALCLFPLAIGSYWAYGNSIPTN---EGI  355

Query  587   LNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKW  408
             LNA  K+H+ D SK ++G   ++++I  L ++QIYA+PV DN E  Y   K     CP+W
Sbjct  356   LNALYKYHLRDTSKVILGLASVLVVINSLSSFQIYAMPVFDNLESRYTYSKH--KPCPRW  413

Query  407   VRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWC  228
             +R  L++ FG L + +S+A PFL SLAG +G I +P+T AYPC MWI IKKP  Y+ +WC
Sbjct  414   LRTALRIFFGCLAFFISIALPFLLSLAGLVGGIALPITLAYPCLMWILIKKPAKYSAMWC  473

Query  227   VNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +N  LG  GM++  ++  A +W+++  G+  +FF P
Sbjct  474   INGVLGVSGMVLSVLIVGAAIWSIVTMGVEVHFFKP  509



>ref|XP_010061144.1| PREDICTED: lysine histidine transporter-like 8 [Eucalyptus grandis]
Length=510

 Score =   479 bits (1232),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 230/456 (50%), Positives = 322/456 (71%), Gaps = 14/456 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E   Q     P D  LPITESRNGN +    H LSSGIG+QALLLP+AF+ LGW WGI+C
Sbjct  64    EEVGQFTKLDPHDDWLPITESRNGNVYYAAFHTLSSGIGVQALLLPLAFSVLGWAWGIVC  123

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LS +FVWQLYT+WLLV LHES  GTR+SRY+ L+  AFG K GKL A+FP MYLSGG+CV
Sbjct  124   LSAVFVWQLYTLWLLVQLHESEDGTRYSRYLRLSMAAFGKKKGKLLALFPIMYLSGGTCV  183

Query  1115  MLIINGGGSLQLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISL  948
              LI+ GGGS+++ ++ +CGG    DP   +  EW+L+F+C AI ++   PNLNS+A +SL
Sbjct  184   ALIVIGGGSMKIIFEILCGGTCDIDPP--STVEWYLVFICCAIILAQ-LPNLNSIAGVSL  240

Query  947   LGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHN  768
             +G++TAI YCT++W LS++KGR P GV+Y+P + + S+L R   + NA+ +++  FRGHN
Sbjct  241   IGAITAIGYCTLIWALSITKGR-PAGVSYEPVK-TGSELARICSVLNAVGIVAFVFRGHN  298

Query  767   IILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGI  588
             ++LEIQGT+P++ + P R+ M  G+  +Y++IALC FPLAI GYWAYGN +PT+    GI
Sbjct  299   VVLEIQGTMPSSRQKPSRQPMWKGIKFAYVVIALCLFPLAIGGYWAYGNSIPTNE---GI  355

Query  587   LNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKW  408
             LNA  ++H+ D SK ++    ++++I  L ++QIYA+PV DN E  Y   K     CP+W
Sbjct  356   LNALYEYHLRDASKVILCLASVLVVINSLSSFQIYAMPVFDNLESRYTYSKH--KPCPRW  413

Query  407   VRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWC  228
             +R  L++ FG L + +S+A PFL SLAG +G I +P+T AYPC MWI IKKP  Y+ +WC
Sbjct  414   LRTALRIFFGCLAFFISIALPFLQSLAGLVGGIALPITLAYPCLMWILIKKPAKYSAMWC  473

Query  227   VNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +N  LG  GM++  ++  A +W+++  G+  +FF P
Sbjct  474   INGVLGVSGMVLSVLIVGAAIWSIVTMGVEVHFFKP  509



>ref|XP_010905237.1| PREDICTED: lysine histidine transporter-like 8 [Elaeis guineensis]
Length=508

 Score =   478 bits (1231),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 234/454 (52%), Positives = 315/454 (69%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN +    H LSSGIG QAL+LPV+FT LGW WGI+ 
Sbjct  64    EDVGHLTKLDPQDAWLPITESRNGNAYYSAFHTLSSGIGFQALVLPVSFTVLGWTWGILS  123

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LS  F+WQLYT+WLL+ LHES  GTR+ RY+ LA  AFG K GK+ A+FPTMYLS G C 
Sbjct  124   LSGAFIWQLYTLWLLIRLHESVPGTRYCRYLQLAKAAFGSKWGKILALFPTMYLSAGICS  183

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              +II GGGS++LF+  +CG   + K LT  EW+L+F+C+A+ +S   PNLNS+A ISL+G
Sbjct  184   AIIIVGGGSMKLFFDDVCGSTCNSKPLTTIEWYLVFICLAVIVSQ-LPNLNSIAGISLIG  242

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             + TAI YCT++W +SVSKGR P GV+YDP + + S +D+   I NAL +I+ AFRGHN++
Sbjct  243   AATAITYCTLIWVVSVSKGRQP-GVSYDPVK-TNSDMDKLLRILNALGIIAFAFRGHNVV  300

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G+ A+Y++IALC +P+AI G+WAYGNL+P+S    GILN
Sbjct  301   LEIQATMPSTLKHPSHVPMWRGMKAAYLIIALCLYPIAIGGFWAYGNLIPSS----GILN  356

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A  +FH  D S+ ++G   ++++I CL ++QIYA+PV DN E  Y  KK     CP+W+R
Sbjct  357   ALYEFHSKDTSRVVLGLTSLLVVINCLSSFQIYAMPVFDNMEAGYTRKKN--RPCPRWLR  414

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +  FG + +L++VAFPFL  LA  +G I +P+T AYPCFMWI +KKP+ Y+ +W +N
Sbjct  415   SGFRAFFGAIAFLIAVAFPFLSDLAALMGGIALPVTLAYPCFMWIVLKKPQRYSAMWYIN  474

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LGM +   L  A +W ++  GL   FF P
Sbjct  475   WWLGSLGMGLSVALVIAGVWQIVKTGLKLRFFKP  508



>ref|XP_011046311.1| PREDICTED: lysine histidine transporter-like 8 [Populus euphratica]
Length=446

 Score =   474 bits (1221),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 254/450 (56%), Positives = 329/450 (73%), Gaps = 16/450 (4%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P ++ LPITESRNGN  +   H+LSSGIG+QALLLPVAF +LGWVWG I LSL F WQLY
Sbjct  4     PQEAWLPITESRNGNVATAVFHLLSSGIGIQALLLPVAFATLGWVWGAISLSLAFTWQLY  63

Query  1265  TIWLLVDLHESTTG--TRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGG  1092
             TIW+LV LHE   G  TR+SRY+ LA  AFG K+GKL AIFP MYLSG +C+MLII G G
Sbjct  64    TIWILVQLHEPIPGIRTRYSRYLQLAIAAFGPKLGKLLAIFPVMYLSGSTCIMLIIKGAG  123

Query  1091  SLQLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIA  924
              ++L +K MC G    D K LTGAEWFL+F C+AI ++   PNLNS+A  SL+G+++AI 
Sbjct  124   VMELLFKLMCEGGATCDAKSLTGAEWFLVFTCMAIALAQ-RPNLNSIAGFSLVGAISAIG  182

Query  923   YCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGT  744
             YCT++W L +SK R P GV+YD  +  +S    F D+ NA+ +I LAFRGHN++LEIQGT
Sbjct  183   YCTLIWALPISKDR-PSGVSYDSRKGGSSMAGMF-DVLNAIGIIMLAFRGHNLVLEIQGT  240

Query  743   LPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFH  564
             LP++   P +R M  GV  SYI+IA+C FPLAIAG+WAYGN +P++   GG+L AF +FH
Sbjct  241   LPSSLTNPSKRTMWRGVSFSYIIIAMCQFPLAIAGFWAYGNKIPSN---GGMLTAFMQFH  297

Query  563   IHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVL  384
              HD SK   G +Y++++I CL ++QIYA+PV DN E  Y+S K     CP WVR+G ++ 
Sbjct  298   GHDTSKFARGLVYLLVVINCLSSFQIYAMPVFDNLEFRYISMKN--KRCPWWVRVGFRLF  355

Query  383   FGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKP--RPYTLVWCVNMGLG  210
             FGGL + ++VA PFL SLA  +G IT+PLT AYPCFMWI+IKKP  + + ++WC+N+GLG
Sbjct  356   FGGLAFFIAVALPFLPSLAPLVGGITLPLTLAYPCFMWISIKKPHQKGHGVMWCLNLGLG  415

Query  209   CLGMLMCTVLATATLWNLIADGLHANFFNP  120
             CLG+++C +L  A   NL   GLHA+FF P
Sbjct  416   CLGVVLCVLLVVAAARNLAIKGLHASFFKP  445



>gb|KEH30616.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=501

 Score =   474 bits (1221),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 240/479 (50%), Positives = 323/479 (67%), Gaps = 17/479 (4%)
 Frame = -1

Query  1532  VERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQ  1353
             V  I    +T        + P+ Q Q   P D  LPITESRNGN    T H+L+S IG Q
Sbjct  32    VIHIHDHPTTSFGSESDPSSPSVQ-QNQHPKDEWLPITESRNGNARFATYHILNSNIGFQ  90

Query  1352  ALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGK  1173
             AL+LPVAF +LGW WG +CLS+ F+WQLYTI+LL++LHES +G R SRY+ LA  AFG +
Sbjct  91    ALMLPVAFATLGWAWGSVCLSIAFIWQLYTIFLLIELHESPSGKRHSRYLFLAMSAFGAR  150

Query  1172  MGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGDP------KGLTGAEWFLLFV  1011
             +GK+AA+FP MYLSGGSCVM II GGG+++  +K +C  D         L+G EWFL+F 
Sbjct  151   LGKIAALFPVMYLSGGSCVMFIITGGGTMKQLFKILCENDDGTMCSAHSLSGVEWFLVFT  210

Query  1010  CIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTS-K  834
             C+AI I+   PNLNS+A ISL+G++ +I+YCT+ W+LSV KGR P GV+Y+   +S    
Sbjct  211   CLAILIAQ-LPNLNSMAAISLVGAVASISYCTLFWSLSVKKGR-PMGVSYNTTLVSQEVT  268

Query  833   LDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFP  654
             + +  DI NA+ +I LAFRGHN++LEIQGT+P+N K   +  M  GV  +YILIA C  P
Sbjct  269   VVKISDILNAIGIIVLAFRGHNLVLEIQGTMPSNLKETSKEPMRRGVTIAYILIAACVIP  328

Query  653   LAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALP  474
             +AIAG+WAYGN +P      G+L AF +FH    +K  +GA+Y+ +I+ CL ++Q+YA+P
Sbjct  329   IAIAGFWAYGNQIPDK----GLLTAFPQFHKEQATKFSIGALYVWVILHCLTSFQVYAMP  384

Query  473   VLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITM-PL  297
             V DN E  Y   K     CP+W+R   ++ FGG T+ ++V FPFL SL+  IG +T+ PL
Sbjct  385   VFDNLELRYTVIKN--QKCPRWLRTCFRLFFGGFTFFIAVTFPFLPSLSALIGGMTLVPL  442

Query  296   TFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             T+AYPCFMW+++KKPR    +W  N+ LGCLGML+  +L  A +  L   GLHANFF P
Sbjct  443   TYAYPCFMWLSLKKPRKNGAIWLFNLVLGCLGMLLSVLLVVAAIRTLADKGLHANFFKP  501



>ref|XP_008382491.1| PREDICTED: lysine histidine transporter-like 8 [Malus domestica]
Length=488

 Score =   473 bits (1218),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 235/445 (53%), Positives = 311/445 (70%), Gaps = 9/445 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LP+TESRNGN +  T H+L SGIG QALLLP+AF +LGW WGIIC  L FVWQ+Y
Sbjct  50    PQDAWLPVTESRNGNTYYATFHLLCSGIGTQALLLPLAFATLGWAWGIICFLLAFVWQIY  109

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHES  G R SRY+HLA  AFG K+G + A+FP +Y S G+C  LII GGG+L
Sbjct  110   TKWLLVHLHESENGFRNSRYLHLAVTAFGKKLGMILAMFPVIYQSNGACAQLIIVGGGTL  169

Query  1085  QLFYKTMC--GGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTI  912
             +LF+KT+C  G     LTG E FLLF C+A+ ++   PNLNS+A +S +G++ ++ YCT 
Sbjct  170   KLFFKTVCEDGATCHPLTGTECFLLFTCVAVVLAQ-CPNLNSVARLSXIGAIASVVYCTT  228

Query  911   LWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTN  732
             +WTLSV KGR     +YDPP +  S +D F    NA+ +I L FRGHN+ILEIQGTLP+N
Sbjct  229   VWTLSVGKGRDHDYTSYDPPAME-STMDIFGGKLNAVGIIFLTFRGHNVILEIQGTLPSN  287

Query  731   TKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIH-D  555
              K P+ +RM  GV  +  LIA+C  PLAI G+WA+GN +PTSY+  G+L    +FH H +
Sbjct  288   PKYPIHKRMWRGVTVACALIAMCFLPLAIGGFWAFGNKVPTSYR--GVLILVSQFHGHKN  345

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
              SK ++G+  M+++I  L T+QI+ +   DN E  Y  +K     CP+W+R+ L++ FGG
Sbjct  346   TSKFVLGSFCMLVVIHSLSTFQIFGMVAFDNLESKYTIRKN--KPCPRWLRVALRIFFGG  403

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             + + ++VA PFLGSLA  IG +T+PL +AYPCFMWI+IKKP+    VW +NMGLGCLG+ 
Sbjct  404   VEFXIAVALPFLGSLAPLIGGLTLPLAYAYPCFMWISIKKPKQKGAVWWINMGLGCLGLA  463

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  +L  A  WNL   GL+ANFF P
Sbjct  464   LSVILVVAAAWNLADKGLNANFFKP  488



>ref|XP_010266108.1| PREDICTED: lysine histidine transporter-like 8 [Nelumbo nucifera]
Length=525

 Score =   474 bits (1221),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 233/468 (50%), Positives = 328/468 (70%), Gaps = 10/468 (2%)
 Frame = -1

Query  1517  SWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLP  1338
             S T   I P+      A  +    P D+ LPITESRNGN F    H L+SGIG+QAL+LP
Sbjct  65    SLTPRFITPLGSPIRKALHLTKLDPQDAWLPITESRNGNAFYAAFHALTSGIGIQALVLP  124

Query  1337  VAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLA  1158
             VAFT LGW WG+I L+L F+WQLYT+W+LV LHES +GTR++RY+ L   AFG ++GK+ 
Sbjct  125   VAFTVLGWSWGVITLTLAFIWQLYTLWILVQLHESESGTRYNRYLQLVNAAFGERLGKML  184

Query  1157  AIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLF  984
             A+FP MYLSGG+C  LII GG +++LF++ +CG     K LT  EW+L+F C A+ +S  
Sbjct  185   AVFPIMYLSGGTCTALIIIGGSTMKLFFQIVCGTTCHAKPLTTVEWYLIFTCAAVLLSQ-  243

Query  983   FPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANA  804
              PNLNS+A +SL+G++TA+ YCT++W +SV++GR P GV+YDP + + S + R   I NA
Sbjct  244   LPNLNSIAGVSLIGAITAVGYCTLIWVVSVAEGRMP-GVSYDPVK-AKSDIARIFGIFNA  301

Query  803   LAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYG  624
             L +I+ AFRGHN+ILEIQ T+P++ K P R  M  GV A+Y+LIA+C FPLAI GYWAYG
Sbjct  302   LGIIAFAFRGHNLILEIQATMPSSEKHPSRVPMWRGVKAAYVLIAMCLFPLAIGGYWAYG  361

Query  623   NLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYL  444
             +++P +   GG+L A   FH  D+S++++G   + ++I  + ++QIY +P+ D+ E  Y 
Sbjct  362   HMIPAN---GGMLTALYAFHGRDVSRAVLGLTSLFVVINAVSSFQIYGMPMFDHIESQYT  418

Query  443   SKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIA  264
             S+KK  M  P W+R   + +FG   + ++VA PFLGSLAG IG + +P+T AYPCFMW+ 
Sbjct  419   SRKKKAM--PWWLRAISRAMFGFGCFFIAVAIPFLGSLAGLIGGLALPVTLAYPCFMWVM  476

Query  263   IKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             IKKP+ ++ +WC+N GLG LGM +  +L  A LW++I  G+  +FFNP
Sbjct  477   IKKPKRFSQMWCLNWGLGFLGMALSAILVAAGLWSVIHTGVKVSFFNP  524



>ref|XP_004505804.1| PREDICTED: lysine histidine transporter-like 8-like [Cicer arietinum]
Length=490

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 235/462 (51%), Positives = 318/462 (69%), Gaps = 16/462 (3%)
 Frame = -1

Query  1481  DNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGI  1302
              + P+ Q+Q   P D  LP+TESRNGN +    H+L+S I  QAL+L VAF +LGW WG 
Sbjct  37    HSSPSDQIQIQHPKDEWLPLTESRNGNTYFAVFHILNSNIAFQALMLHVAFATLGWAWGS  96

Query  1301  ICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGS  1122
             +CLS+ F+WQ YTI+LL +LHES +G R SRY+ LA  AFG  +GK+A +FP MYLSGG+
Sbjct  97    VCLSIAFIWQFYTIFLLTELHESVSGIRHSRYLFLAMSAFGSTLGKIAVLFPVMYLSGGT  156

Query  1121  CVMLIINGGGSLQLFYKTMCGGDPKGLTGAE------WFLLFVCIAIFISLFFPNLNSLA  960
             CVM II GGG++++ +K +C  D   + GA       WFL+F C+AI I+   PNLNS+A
Sbjct  157   CVMFIITGGGTMKMLFKILCENDNGEMCGAHAPSGVVWFLVFTCLAILIAQ-LPNLNSVA  215

Query  959   WISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDP-PQLSTSKLDRFRDIANALAVISLA  783
              +SL+G +TAI+YCT+ W+LS+ KGRP  GV+Y        S + +  D+ NA+ +I L+
Sbjct  216   AVSLVGVVTAISYCTLFWSLSL-KGRPI-GVSYTTLMSQQESTVVKISDVINAIGIIVLS  273

Query  782   FRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSY  603
             FRGHN++LEIQGTLP+N K   +  M  GV  SYILIA+C FPLAI G+WAY N   T  
Sbjct  274   FRGHNVVLEIQGTLPSNLKETSKELMRRGVTISYILIAMCVFPLAIVGFWAYRNQAST--  331

Query  602   KKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMM  423
              +GG+L  F++FH + +SK  +GAIY+++I+ CLC++Q+YA+PV DN E  Y S K    
Sbjct  332   -RGGLLFGFQQFHKNQLSKFSVGAIYVLVIVHCLCSFQVYAMPVFDNLELRYTSIKN--K  388

Query  422   SCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITM-PLTFAYPCFMWIAIKKPRP  246
              CP+WVR+  ++ FGGL + V+VA PFL SLA  +G IT+ P+T+AYPCFMW+AIKKPR 
Sbjct  389   KCPQWVRICFRLFFGGLAFFVAVALPFLPSLAALLGGITLVPVTYAYPCFMWLAIKKPRT  448

Query  245   YTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               ++WC N+ LG LGML+   +  A +  L   GL ANFF P
Sbjct  449   KGIIWCFNLVLGSLGMLLGVFMVAAAIRTLADKGLKANFFKP  490



>gb|EYU17533.1| hypothetical protein MIMGU_mgv1a020550mg [Erythranthe guttata]
Length=514

 Score =   470 bits (1209),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 233/462 (50%), Positives = 323/462 (70%), Gaps = 10/462 (2%)
 Frame = -1

Query  1499  IAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSL  1320
             IA +    E    +    P DS LPITESRNGN +    H LSSGIG QALLLP+AFT+L
Sbjct  60    IASMQTYLEEMGHLTKLDPQDSWLPITESRNGNAYYAAFHTLSSGIGFQALLLPLAFTTL  119

Query  1319  GWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTM  1140
             GWVWGII LSL FVWQLYT+WLL+ LHE+  GTR+SRY+ L+  AFG ++GK+ A+FPT+
Sbjct  120   GWVWGIISLSLAFVWQLYTLWLLIQLHEAVPGTRYSRYLRLSVAAFGERLGKILALFPTL  179

Query  1139  YLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNS  966
             YL+GG+CV LI+ GG +L++F+ T+CG   +   L+  EW+++FVC A  +S   PNLNS
Sbjct  180   YLAGGTCVSLIMMGGSTLKIFFHTVCGATCNANSLSTIEWYVVFVCSATVLSQ-LPNLNS  238

Query  965   LAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISL  786
             +A +SL+G++TA+ YCT+ WTLSVS  RPP GV+Y P + + S ++    + NAL +I+ 
Sbjct  239   IAGVSLIGAITAVTYCTLTWTLSVSTTRPP-GVSYAPVR-TESDVENICGVLNALGIIAF  296

Query  785   AFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTS  606
             AFRGHN++LEIQGT+P++ K P    M  GV  SYI+IA C FP+AI GYWAYGNL+PT+
Sbjct  297   AFRGHNLVLEIQGTMPSSMKNPSSVPMWKGVKFSYIIIAFCLFPMAIGGYWAYGNLIPTN  356

Query  605   YKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMM  426
                GG+L+A +++H ++ SK ++G   + ++I  L ++QIYA+PV DN E  Y SK+   
Sbjct  357   ---GGMLSALDQYHRNETSKVILGFTSLFVVINSLTSFQIYAMPVFDNLEFRYTSKQN--  411

Query  425   MSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRP  246
               CP W+R GL++ FG L + +SVA PFL +LAG IG + +P+T AYPC MWI IKKP  
Sbjct  412   GPCPWWLRTGLRIFFGCLAFFISVALPFLKNLAGLIGGVALPVTLAYPCLMWIRIKKPEK  471

Query  245   YTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              + +W +N  LG LGM +  +L    +W+++  G+  +FF P
Sbjct  472   SSAMWWLNWTLGTLGMALSVLLVFGAIWSIVTQGIPIHFFKP  513



>gb|KHN09261.1| Lysine histidine transporter-like 8 [Glycine soja]
Length=522

 Score =   469 bits (1207),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 244/480 (51%), Positives = 322/480 (67%), Gaps = 32/480 (7%)
 Frame = -1

Query  1487  DIDNEPAAQ--VQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGW  1314
             + D  P +Q   Q   P D+ LPITESRNGN +    H+L+S IG QAL+LPVAF +LGW
Sbjct  51    ESDPSPTSQHHQQEQHPKDAWLPITESRNGNAYYAAFHILNSNIGFQALMLPVAFATLGW  110

Query  1313  VWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYL  1134
              WG +CLSL FVWQLY I+LLV LHES  G R SRY+ LA  AFG K+GK+AA+FP MYL
Sbjct  111   AWGTVCLSLAFVWQLYAIFLLVQLHESVPGIRHSRYLFLAMAAFGKKLGKVAALFPVMYL  170

Query  1133  SGGSCVMLIINGGGSLQLFYKTMCGGDP----------KGLTGAEWFLLFVCIAIFISLF  984
             SGG+CVM+II GGG+L+   KT+C  D             L+GAEWFL+F C+AI I+  
Sbjct  171   SGGTCVMIIITGGGTLKQLLKTLCDNDDHVHEQITCNAHALSGAEWFLVFTCVAILIAQ-  229

Query  983   FPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSK--LDRFRDIA  810
              PNLNS+A +SL+G++T++ YCT+ W LSV  GR P  V+Y     S     + +   + 
Sbjct  230   LPNLNSMAMVSLVGAVTSVTYCTLFWVLSVKNGR-PNNVSYSSSLQSQEHTPVAKINGVL  288

Query  809   NALAVISLAFRGHNIILEI---------QGTLPTNTKVPLRRRMCTGVIASYILIALCHF  657
             NA+ +I LAFRGHN++ EI         QGTLP+N +   +R M  GV  SY+LI++C F
Sbjct  289   NAIGIIVLAFRGHNVLPEIQAMFGMLVLQGTLPSNFEQTSKRPMRRGVSISYVLISMCMF  348

Query  656   PLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYAL  477
             PLAIAG+WAYGN +      GG+L +F +FH   I+K  MGAIY+++II CL ++QIYA+
Sbjct  349   PLAIAGFWAYGNQI----NDGGLLTSFPQFHKRQITKFSMGAIYVLVIIHCLTSFQIYAM  404

Query  476   PVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITM-P  300
             PV DN E  Y S K     CP+ VR  +++ FGGLT+ +SV FPFL  L+  +GS+T+ P
Sbjct  405   PVFDNLEIRYTSIKN--QRCPRLVRTCIRLFFGGLTFFISVTFPFLPRLSALLGSMTLVP  462

Query  299   LTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +T+AYPCFMW+++KKPRP   VWC N+ LGC+GML+  +L  A +  L  +GL ANFF P
Sbjct  463   ITYAYPCFMWLSLKKPRPRGFVWCFNVALGCVGMLLSALLVAAAIRTLALNGLDANFFKP  522



>ref|XP_010266964.1| PREDICTED: lysine histidine transporter-like 8 [Nelumbo nucifera]
Length=551

 Score =   470 bits (1209),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 232/454 (51%), Positives = 312/454 (69%), Gaps = 9/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN +    H LSSGIG QAL+LP AF  LGW WGI+C
Sbjct  104   EDVGHITKLDPQDAWLPITESRNGNAYYAAFHTLSSGIGFQALVLPFAFIFLGWTWGILC  163

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L   F WQLYT+WLLV+LHES  GTR+SRY+ LA   FG K GKL A+FP  YLSGGSCV
Sbjct  164   LLTAFAWQLYTLWLLVNLHESVPGTRYSRYLQLAMATFGEKRGKLLALFPLKYLSGGSCV  223

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+  G +++LF++T+CG   + K LT  EW+L+F C+AI I+   PNLNS+A +SL+G
Sbjct  224   ALIMFNGATMKLFFRTVCGNMCNEKPLTTVEWYLVFTCLAIVIAQ-LPNLNSIAGVSLIG  282

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TA++YCTI+W LSVSK R P  V+Y P   + S +DR   I NAL +IS AFRGHN++
Sbjct  283   AITAVSYCTIIWILSVSKTR-PTNVSYKPLD-AKSDIDRICGILNALGIISFAFRGHNLV  340

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQGT+P++ K P R  M  GV  +Y+ IA C FPLAI GYWAYGN MP +    GIL+
Sbjct  341   LEIQGTMPSSLKHPARVPMWRGVKLAYLFIATCLFPLAIGGYWAYGNSMPNN--NAGILS  398

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A  KFH H+ S+ ++G   ++I+I  L ++QIYA+P+ D+ E  Y  KK     CP+W+R
Sbjct  399   ALYKFHGHETSRFVLGLTCLLIVINGLSSFQIYAMPIFDDLEAAYTRKKN--KPCPRWLR  456

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
                + LFG + + ++VA PFL SLAG +G I +P+T AYPCFMWI ++KP+ Y ++ CVN
Sbjct  457   AAFRALFGCIAFFIAVALPFLPSLAGLLGGIALPITLAYPCFMWIVVRKPQRYGVMCCVN  516

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LGCLG+++  ++  A +W ++   +  +FF P
Sbjct  517   WALGCLGLILSVLVTIAAVWKIVDTDVKFHFFRP  550



>ref|XP_011099581.1| PREDICTED: lysine histidine transporter-like 8 [Sesamum indicum]
Length=516

 Score =   468 bits (1205),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 232/462 (50%), Positives = 322/462 (70%), Gaps = 10/462 (2%)
 Frame = -1

Query  1499  IAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSL  1320
             IA +    E    +    P DS LPITESRNGN +    H LSSGIG QALLLP+AFT+L
Sbjct  62    IASMHTYLEEVGHLTKLDPQDSWLPITESRNGNAYYAAFHTLSSGIGFQALLLPLAFTTL  121

Query  1319  GWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTM  1140
             GWVWGII LSL FVWQLYT+WLL+ LHES  GTR+SRY+ L+ VAFG ++GK+ A+FPT+
Sbjct  122   GWVWGIISLSLAFVWQLYTLWLLIQLHESVPGTRYSRYLRLSMVAFGERLGKILALFPTL  181

Query  1139  YLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNS  966
             YL+GG+CV LI+ GG +L++F+ T+CG   +   L+  EW+++FVC AI ++   PNLNS
Sbjct  182   YLAGGTCVSLIMMGGSTLKIFFHTVCGTTCNANSLSTVEWYIVFVCSAIILTQ-LPNLNS  240

Query  965   LAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISL  786
             +A +SL+G+ TA+ YCT+ W LSVSK R P GV+Y+P + + S +     + NAL +I+ 
Sbjct  241   IAGVSLIGATTAVTYCTLTWVLSVSKIR-PMGVSYEPVR-TKSDVGNICSVLNALGIIAF  298

Query  785   AFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTS  606
             AFRGHN++LEIQGT+P+  K P    M  GV  SY++IA C FP+A+ GYWAYGNL+P +
Sbjct  299   AFRGHNLVLEIQGTMPSTVKNPSSVPMWKGVKFSYLIIACCLFPMAVGGYWAYGNLIPAN  358

Query  605   YKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMM  426
                GG+L+A +++H +D S+ ++G   + ++I CL ++QIYA+P  DN E  Y S K   
Sbjct  359   ---GGLLSALDEYHRNDTSRVILGLTSLFVVINCLTSFQIYAMPAFDNLEFRYTSNKN--  413

Query  425   MSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRP  246
               CP W+R G++V +G LT+ +SVA PFL SLAG IG I +P+T AYPC MWI IKKP+ 
Sbjct  414   GPCPWWLRTGIRVFYGCLTFFISVALPFLKSLAGLIGGIALPVTLAYPCLMWIRIKKPQK  473

Query  245   YTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             ++ +W +N  LG +GM++  +L    +W +   G+  +FF P
Sbjct  474   FSSMWWLNWLLGSIGMILSVLLVFGAIWTIATQGIPIHFFKP  515



>ref|XP_003540623.1| PREDICTED: lysine histidine transporter-like 8-like [Glycine 
max]
Length=507

 Score =   468 bits (1203),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 242/470 (51%), Positives = 324/470 (69%), Gaps = 26/470 (6%)
 Frame = -1

Query  1487  DIDNEPAAQVQA--FAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGW  1314
             + D  P +Q Q     P D+ LPITESRNGN +    H+L+S IG QAL+LPVAF +LGW
Sbjct  50    ESDPSPTSQHQQEQHHPKDAWLPITESRNGNAYYAAFHILNSNIGFQALMLPVAFATLGW  109

Query  1313  VWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYL  1134
              WG +CLSL FVWQLY I+LLV LHE   G R SRY+ LA  AFG K+GK+ A+FP MYL
Sbjct  110   AWGTVCLSLAFVWQLYAIFLLVQLHEYVPGIRHSRYLFLAMAAFGKKLGKVGALFPVMYL  169

Query  1133  SGGSCVMLIINGGGSLQLFYKTMCGGD------PKGLTGAEWFLLFVCIAIFISLFFPNL  972
             SGG+CVMLII GGG+++  +KT+C  D         L+GAEWFL+F C+AI I+   PNL
Sbjct  170   SGGTCVMLIITGGGTMKQLFKTLCENDNGKTCNAHALSGAEWFLVFTCVAILIAQ-LPNL  228

Query  971   NSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPP-QLSTSKLDRFRDIANALAV  795
             NS+A +SL+G++T+I YCT+ W LSV KG+ P  V+Y        + + +  D+ NA+ +
Sbjct  229   NSMAMVSLVGAVTSITYCTLFWVLSVKKGK-PNNVSYSSSLSQEHTPVAKISDVLNAIGI  287

Query  794   ISLAFRGHNIILEIQGTLPTN----TKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAY  627
             I LAFRGHN++LEIQGTLP+N    +K+P+RR    GV  SY+LI++C FPLAIAG+WAY
Sbjct  288   IVLAFRGHNVLLEIQGTLPSNLEQTSKIPMRR----GVSMSYVLISMCVFPLAIAGFWAY  343

Query  626   GNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIY  447
             GN +      GG+L +F +FH   I+K  MGAIY+++II CL ++QIYA+PV DN E  Y
Sbjct  344   GNQI----NDGGLLYSFPEFHKRQITKFSMGAIYVLVIIHCLTSFQIYAMPVFDNLEIRY  399

Query  446   LSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITM-PLTFAYPCFMW  270
              S K     C   VR  +++ FGGLT+ +SV FPFL  L+  +GS+T+ P+T+AYPCFMW
Sbjct  400   TSIKN--QRCSPLVRTCIRLFFGGLTFFISVTFPFLPRLSTLLGSMTLVPITYAYPCFMW  457

Query  269   IAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +++KKPRP  ++ C N+ LG +GML+  +L  A +  L  +GL ANFF P
Sbjct  458   LSLKKPRPRGIICCFNVALGSVGMLLSALLVAAAIRTLALNGLDANFFRP  507



>ref|XP_007017968.1| Transmembrane amino acid transporter family protein [Theobroma 
cacao]
 gb|EOY15193.1| Transmembrane amino acid transporter family protein [Theobroma 
cacao]
Length=521

 Score =   468 bits (1203),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 229/454 (50%), Positives = 325/454 (72%), Gaps = 10/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E   Q     P ++ LPITESRNGN +    H LSSGIG QAL+LP+AFT+LGWVWG+IC
Sbjct  75    EEVGQFTKLDPQEAWLPITESRNGNAYYSAFHTLSSGIGFQALVLPLAFTTLGWVWGVIC  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LSL F+WQLYT+WLL+ LHES +G R+SRY+ L+  AFG  +GKL A+FP MYLSGG+CV
Sbjct  135   LSLAFIWQLYTLWLLIQLHESESGMRYSRYLRLSMAAFGETLGKLLALFPIMYLSGGTCV  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GGG++++F++ +CG     K L+  EW+++F C+AI ++   PNLNS+A +SL+G
Sbjct  195   TLIMIGGGTMKIFFQIVCGNTCSVKHLSVVEWYVVFTCLAILLAQ-LPNLNSIAGVSLVG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI+YC+++W +S+++GR P+GV+YDPP  + S++ R   I NAL +I+ AFRGHN++
Sbjct  254   AITAISYCSLIWIVSITQGR-PEGVSYDPPA-ANSEVARPFGIFNALGIIAFAFRGHNLV  311

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P++ K P R  M  GV  +Y+++A C FPLAIAG+WAYGNLM    + G IL+
Sbjct  312   LEIQATMPSSGKHPSRIPMWRGVKLAYLIVATCLFPLAIAGFWAYGNLMS---ENGWILS  368

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   +H  D SK L+G   ++++I  L ++QIYA+PV DN E  Y SK +    CP+W+R
Sbjct  369   ALYNYHKLDTSKLLLGLASLLVVINSLSSFQIYAMPVFDNLEFRYTSKWR--RPCPRWLR  426

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G++V FG L + ++VA PFL SLAG IG I +P+T AYPC MW+ IKKP+ ++  WC+N
Sbjct  427   TGIRVFFGCLAFFIAVALPFLPSLAGLIGGIALPITLAYPCLMWLIIKKPQIFSPSWCLN  486

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LGM++  ++ T  +W ++  G+   FF P
Sbjct  487   WALGVLGMVLSVLVTTGAIWGIVTKGIQLRFFKP  520



>ref|XP_009413044.1| PREDICTED: lysine histidine transporter-like 8 [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   470 bits (1210),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 228/454 (50%), Positives = 313/454 (69%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN +    H LSSGIG QAL+LP+AFT LGW WGI+C
Sbjct  160   EDIGHLTKLDPHDAWLPITESRNGNAYYSAFHTLSSGIGFQALVLPLAFTFLGWTWGILC  219

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LS+ F WQLYT+WLLV LHES  GTR+ RY+HLA   FG K+GK  A+FP  YLS G C 
Sbjct  220   LSVAFAWQLYTLWLLVQLHESVPGTRYCRYMHLAEATFGAKLGKWLALFPIFYLSAGICT  279

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              +II GGG+++LF++ +CG   D K LT AEW+L+F C+A  +S   PNLNS+A +SL+G
Sbjct  280   AIIIVGGGAMKLFFEIVCGATCDSKPLTAAEWYLVFTCLAGVLSQ-LPNLNSIAGVSLIG  338

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             S+TA+ YCT++W +SVSKGR P GV+Y P + + S +DR   I NAL +I+ AFRGHN++
Sbjct  339   SVTAVTYCTLIWVISVSKGRLP-GVSYHPVE-AKSDVDRVLGILNALGIIAFAFRGHNLV  396

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P++ K P R  M  GV A+Y++IA C +P+AI G+WAYGN++P++    G+L 
Sbjct  397   LEIQATMPSSLKHPSRVPMWRGVKAAYLIIAFCLYPIAIGGFWAYGNMIPSN----GMLT  452

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH  D S+ L+G   +++++ CL  +QIYA+P+ D+ E  Y  KK     CP+W+R
Sbjct  453   ALYAFHGKDTSRILLGLTALLVVVNCLSCFQIYAMPIFDSMEAGYTKKKN--RPCPRWLR  510

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
                +  F G++Y ++VAFPFL  LAG IG + +P+T AYPCFMWI +KKP  Y+ +W +N
Sbjct  511   SAFRAFFAGISYFMAVAFPFLSDLAGLIGGMALPVTLAYPCFMWILVKKPERYSAMWYIN  570

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG  GM++  +L  + +WNL+  G+   FF P
Sbjct  571   WVLGSAGMVLSLILTISGVWNLVKTGIDVRFFKP  604



>emb|CDP07315.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   464 bits (1195),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 229/455 (50%), Positives = 320/455 (70%), Gaps = 11/455 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E         P ++ LPITESRNGN +    H LSSGIG+QAL+LP+AFT+LGW WGIIC
Sbjct  20    EEIGHFTKLDPQEAWLPITESRNGNAYYAAFHTLSSGIGVQALVLPLAFTALGWTWGIIC  79

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LSL F+WQLYT+WLL+ LHES  G R+SRY+ L+   FG K+GKL A+FPTMYLSGG+CV
Sbjct  80    LSLAFMWQLYTLWLLIQLHESVAGMRYSRYLWLSMAVFGNKVGKLLALFPTMYLSGGTCV  139

Query  1115  MLIINGGGSLQLFYKTMCGGDPKGLTG---AEWFLLFVCIAIFISLFFPNLNSLAWISLL  945
              LI+ GGG++++FY+T+CGG    +T     EW+L+F   A+ ++   PNLNS+A +SL+
Sbjct  140   ALIMIGGGTMKMFYQTVCGGATDHITPLSMTEWYLVFTFSAVILAQ-LPNLNSIAGVSLI  198

Query  944   GSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNI  765
             G++TA++YCTI+W +SV K RP + V+Y+P     S++ R   I NAL +++ AFRGHN+
Sbjct  199   GAVTAVSYCTIIWVVSVVKDRPGK-VSYEPIVFK-SEIGRICSILNALGIVAFAFRGHNL  256

Query  764   ILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGIL  585
             +LEIQGT+P++ K P R  M  GV  SY++IALC FPLAI GYWAYG+L+P++   GGI+
Sbjct  257   VLEIQGTMPSSLKQPSRLPMWKGVKFSYLIIALCLFPLAIGGYWAYGDLIPSN---GGIM  313

Query  584   NAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWV  405
             +A +K+H +D SK ++GA  + I++  L ++QIYA+PV DN E  Y S       CP W+
Sbjct  314   SALDKYHRNDTSKVILGATSLFIVLNSLTSFQIYAMPVFDNLEFRYTSNNN--RPCPWWL  371

Query  404   RMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCV  225
             R  L++ FG L + ++VA PFL SLAG IG IT+P+TFAYPC MWI   KP  ++ +W +
Sbjct  372   RAALRMFFGCLAFFIAVALPFLPSLAGLIGGITLPVTFAYPCIMWIMTNKPVKHSAMWYL  431

Query  224   NMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             N  LG LG+++  +L    +W ++  G+  +FF P
Sbjct  432   NWSLGSLGIVLSILLVFGAIWTIVTQGIEVHFFKP  466



>emb|CBI18883.3| unnamed protein product [Vitis vinifera]
Length=1030

 Score =   481 bits (1238),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 229/458 (50%), Positives = 329/458 (72%), Gaps = 11/458 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESR+GN +    H LSSGIG+QAL+LP+AFT+LGW+WGI+C
Sbjct  569   EEVGHLTKLDPQDAWLPITESRDGNAYYSAFHSLSSGIGVQALVLPLAFTTLGWIWGILC  628

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LSL F WQLYT+WLL+ LHES +GTR+SRY+ L+  AFG K+GKL A+FPTMYLSGG+CV
Sbjct  629   LSLAFGWQLYTLWLLIQLHESASGTRYSRYLRLSMAAFGEKLGKLLALFPTMYLSGGTCV  688

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              L+I GGG++++F++ +C    +   LT  EW+++F C A+ ++   PNLNS+A ISL+G
Sbjct  689   TLVIIGGGTMKIFFQIVCDSNCNVNPLTTIEWYIVFTCSAVILAQ-LPNLNSIAGISLIG  747

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             S++A+ YCT++W +SV+K R P GV+YDP +  TS + R   I NAL +I+ AFRGHN++
Sbjct  748   SISAVTYCTVIWVVSVTKDR-PHGVSYDPVK-PTSDVARLCGILNALGIIAFAFRGHNLV  805

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQGT+P++ K P R+ M +GV  +Y++IA+  FPLA+ GYWAYGNL+    K+ G+  
Sbjct  806   LEIQGTMPSSAKHPSRKPMWSGVKFAYLIIAMSLFPLAVGGYWAYGNLI----KEDGMFA  861

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   +H HD S+ ++G   ++I+I  L ++QIYA+P  DN E  Y+S +     CP W+R
Sbjct  862   ALYNYHGHDTSRIILGLTSLLIVINSLTSFQIYAMPAFDNLEFRYISSRN--QPCPWWLR  919

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +  FG L + ++VA PFL SLAG IG + +P+TFAYPCFMWI IK+P+ Y+++W +N
Sbjct  920   SGFRAFFGCLVFFIAVALPFLPSLAGLIGGVALPVTFAYPCFMWIQIKQPQKYSVIWYLN  979

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP*HCN  108
              GLGC+GM++  +L T  +W+++  G+  +FF P + N
Sbjct  980   WGLGCMGMVLSVLLVTGAVWSIVTMGIEIHFFKPKYSN  1017


 Score =   439 bits (1130),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 226/478 (47%), Positives = 319/478 (67%), Gaps = 12/478 (3%)
 Frame = -1

Query  1541  EVRVERIGSWTSTRI-APVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSG  1365
             +V   R G+ + T    P+      A Q+  F P D+ LPITESRNGN F    H L SG
Sbjct  39    DVTTRRGGTHSLTPFFTPLGSPIRRAIQMTKFDPQDAWLPITESRNGNAFYAAFHTLCSG  98

Query  1364  IGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATV  1188
             IG+QAL+LPV+FT LGW WG+ICL++ FVWQ+YT+WLLV LH+S  TG R+SRY+H+   
Sbjct  99    IGIQALVLPVSFTILGWTWGVICLTIAFVWQMYTLWLLVKLHDSPETGVRYSRYLHICQA  158

Query  1187  AFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLF  1014
              FG K+GKL A+FP MYLSGG+CV LII GG +L+LF++ +CG   + K LT  EW+L+F
Sbjct  159   TFGNKLGKLMALFPIMYLSGGTCVALIIVGGSTLKLFFQIICGHGCNAKPLTTLEWYLVF  218

Query  1013  VCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSK  834
              C A+ +S   PNLNS+A +SL+G+ TAIAYCTI+W ++V++GR  +GV+YDP +     
Sbjct  219   TCAAVLLSQ-LPNLNSIAGVSLIGAATAIAYCTIMWLVAVTEGR-LEGVSYDPVR-PVEN  275

Query  833   LDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFP  654
             +     + NAL +I+ AFRGHN+ILEIQ T+P++ K      M  GV  +Y++IALC FP
Sbjct  276   VALIFGVLNALGIIAFAFRGHNLILEIQATMPSSEKRTTYVPMWRGVKVAYLIIALCLFP  335

Query  653   LAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALP  474
             LAI GYWAYG  +P   + GG+L A   +H  D S+ ++    +++II  + ++QIY +P
Sbjct  336   LAIGGYWAYGQKIP---ENGGMLTAIYLYHGRDTSQFVLALTSLLVIINSVSSFQIYGMP  392

Query  473   VLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLT  294
             + D+ E  Y  +K     CP W+R   + +FG   + V+VA PFLGS AG  G + +P+T
Sbjct  393   MFDDMESKYTKRKN--KPCPWWLRALFRTMFGYGCFFVAVAMPFLGSFAGLTGGVAVPVT  450

Query  293   FAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             FAYPCF+W+ IKKP+ Y+++W +N  LG  GM++  VL  A ++ +I  G+  +FF P
Sbjct  451   FAYPCFLWLKIKKPKKYSMMWVLNWVLGASGMVLSVVLIAAGVYVVIDTGIKVSFFKP  508



>ref|XP_002448328.1| hypothetical protein SORBIDRAFT_06g025310 [Sorghum bicolor]
 gb|EES12656.1| hypothetical protein SORBIDRAFT_06g025310 [Sorghum bicolor]
Length=532

 Score =   465 bits (1196),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 234/445 (53%), Positives = 301/445 (68%), Gaps = 12/445 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESR+GN +    H LSSGIG QAL+LPVAF SLGW W IICL+L F WQLY
Sbjct  93    PRDAWLPITESRSGNAYYAAFHNLSSGIGFQALVLPVAFASLGWTWAIICLTLAFGWQLY  152

Query  1265  TIWLLVDLHESTTGT-RFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGS  1089
             T+WLLV LHE   G  R+SRY+HLA   FG +  K+ A+FP MYLS G C  LII GGGS
Sbjct  153   TLWLLVRLHEPVAGAARYSRYMHLANTVFGERWAKILALFPVMYLSAGICTALIIVGGGS  212

Query  1088  LQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCT  915
             ++  +   CG       LT  EW+L+F+C A+ +S   PNLNS+A +SL+G+  A+AYCT
Sbjct  213   MKSLFSLACGESCLAHNLTTVEWYLVFICAAVLLSQL-PNLNSIAGVSLVGATAAVAYCT  271

Query  914   ILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPT  735
             ++W +SVSKGR   GV+YDP + S + +D    I N L +I+ AFRGHN++LEIQGT+P+
Sbjct  272   MIWVVSVSKGRV-AGVSYDPVK-SNNDVDAALSILNGLGIIAFAFRGHNVVLEIQGTMPS  329

Query  734   NTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD  555
               K P    M  GV  +Y +IALC +P+AI G+WAYGN +P+    GGIL A  +FH  D
Sbjct  330   TLKHPSHVPMWKGVKVAYGIIALCLYPIAIGGFWAYGNQIPS----GGILTALYQFHSRD  385

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
             +S+ ++G   +++II CL TYQIYA+PV DN E  Y+ KK     CP W+R G +  FGG
Sbjct  386   VSRLVLGTTTLLVIINCLTTYQIYAMPVYDNMEAGYVHKKNR--PCPWWLRSGFRAFFGG  443

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             + +L++VA PFL  LAG +G I++P+T AYPCFMW+AIKKPR  T  W VN  LG LGM 
Sbjct  444   INFLIAVALPFLSQLAGLMGGISLPITLAYPCFMWVAIKKPRKGTATWNVNWALGILGMA  503

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  VL    LW L+  GL  NFF P
Sbjct  504   ISVVLIVGNLWGLVQTGLRLNFFKP  528



>ref|XP_003527647.1| PREDICTED: lysine histidine transporter-like 8-like [Glycine 
max]
Length=505

 Score =   463 bits (1191),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 228/443 (51%), Positives = 314/443 (71%), Gaps = 9/443 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D  LPITESR GN +    H+LSSGIG QAL+LP+AFT+LGW WG+ICL + F WQLY
Sbjct  70    PQDDWLPITESRKGNAYYAAFHVLSSGIGFQALVLPLAFTTLGWTWGVICLCVAFTWQLY  129

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T+WLL+ LHES +G R SRY+ LA  AFG KMGKL A+FP MYLSGG+CV LI+ G G++
Sbjct  130   TLWLLIQLHESDSGLRHSRYLRLAMAAFGEKMGKLLALFPIMYLSGGTCVTLIMIGAGTM  189

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             ++F++ M  G P  LT  EW+L+F C AI ++   PNLNS+A +SL+G++TA++YC ++ 
Sbjct  190   KIFFQ-MVFGTPSPLTTIEWYLVFTCTAILLAQ-LPNLNSIAGVSLIGAITAVSYCVLIC  247

Query  905   TLSVSKGRPPQGVTYDPPQ-LSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNT  729
              +SV +GR    V+Y+P +  S S+        NAL +I+ AFRGHN++LEIQGT+P++ 
Sbjct  248   IVSVVQGR-LHHVSYEPRRGHSESEASMILSAWNALGIIAFAFRGHNLVLEIQGTMPSDA  306

Query  728   KVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDIS  549
             K P R  M  GV+ +YI+IALC FPLAI GYWAYGNL+PT+   GG+L A +K+H HD S
Sbjct  307   KQPSRLAMWKGVMFAYIVIALCLFPLAIGGYWAYGNLIPTN---GGMLGALQKYHEHDTS  363

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K ++  I ++++I  L ++QIYA+PV DN E  Y S  KM   CP+W+R+  + LFG L 
Sbjct  364   KFIIALISLLVVINSLSSFQIYAMPVFDNLEFRYTS--KMNRPCPRWLRIAFRGLFGCLA  421

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + ++VA PFL SLAG IG + +P+T AYPCFMWI IKKP+  +  W +N  LG +GM++ 
Sbjct  422   FFIAVALPFLPSLAGLIGGVALPITLAYPCFMWIQIKKPQKCSTNWYINWTLGVVGMILS  481

Query  188   TVLATATLWNLIADGLHANFFNP  120
              ++    +W ++A G+  +FFNP
Sbjct  482   VLVVIGAIWGIVAQGIEIHFFNP  504



>ref|XP_008221160.1| PREDICTED: lysine histidine transporter-like 8 [Prunus mume]
Length=492

 Score =   462 bits (1190),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 229/455 (50%), Positives = 318/455 (70%), Gaps = 11/455 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN F    H LSSGIG+ +LLLP++FT+LGW WGIIC
Sbjct  45    EEVGHLTKLDPQDAWLPITESRNGNAFYSAFHTLSSGIGIPSLLLPLSFTALGWAWGIIC  104

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LSL F+WQLYT+WLL+ LHES +GTR+SRY+ L+  AFG K+GK  A+FP MYLSGG+CV
Sbjct  105   LSLAFIWQLYTLWLLIQLHESESGTRYSRYLRLSMAAFGEKLGKFLALFPIMYLSGGTCV  164

Query  1115  MLIINGGGSLQLFYKTMCGGDP--KGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GGG++++FY+ +CGG      L+  EW+L+F   AI ++   PNLNS+A ISL+G
Sbjct  165   TLIMIGGGTMKIFYEIVCGGTGVVNPLSTIEWYLVFTGSAILVAQ-LPNLNSIAGISLIG  223

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLS-TSKLDRFRDIANALAVISLAFRGHNI  765
             +LTA++YCT++W  S++K RP   V+Y PP+    +       + NAL +I+ AFRGHN+
Sbjct  224   ALTAVSYCTLIWVASITKHRPLPAVSYQPPEPKPNAAAATVFSVLNALGIITFAFRGHNL  283

Query  764   ILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGIL  585
             +LEIQGT+P++TK P R  M  GV  +Y++IALC FPLAIAGY AYGN +P++   GG+L
Sbjct  284   VLEIQGTMPSSTKSPSRLPMWNGVKFAYLIIALCLFPLAIAGYRAYGNSIPSN---GGML  340

Query  584   NAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWV  405
             NA  KFH HD SK ++G   M++++  L ++QIYA+PV DN E  + S   M   CP+W+
Sbjct  341   NALYKFHSHDTSKFVLGLTSMLVVVNSLSSFQIYAMPVFDNLELRFTS--CMNKPCPRWL  398

Query  404   RMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCV  225
             R G ++ FG   + ++VA PFL SLAG +G I +P+T AYPCFMWI IKKP  Y+ ++  
Sbjct  399   RSGFRIFFGCFAFFIAVALPFLPSLAGLLGGIAVPITLAYPCFMWILIKKPCKYSAIF--  456

Query  224   NMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +  LG LG+++   + T  +WN++  G+  +FF P
Sbjct  457   HWLLGSLGIVLSISIVTGAIWNIVTIGIQVHFFKP  491



>ref|XP_004292920.1| PREDICTED: lysine histidine transporter-like 8-like [Fragaria 
vesca subsp. vesca]
Length=518

 Score =   463 bits (1191),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 225/456 (49%), Positives = 314/456 (69%), Gaps = 13/456 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E         P D+ LPITESRNGN +    H LSSGIG+QALLLP++FT LGWVWGIIC
Sbjct  71    EEVGHFTKLDPQDAWLPITESRNGNAYYSAFHTLSSGIGVQALLLPLSFTVLGWVWGIIC  130

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LS+ F+WQLYT+WLL+ LHES +G R+SRY+ L+  AFG K+GKL ++FP MYLSGG+CV
Sbjct  131   LSVAFMWQLYTLWLLIQLHESQSGMRYSRYLRLSMAAFGEKLGKLLSLFPIMYLSGGTCV  190

Query  1115  MLIINGGGSLQLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSL  936
              LI+ GGG++++FY+ + G +   LT  EW+L+F   A  ++   PNLNS+A +SL+G++
Sbjct  191   TLIMIGGGTMKIFYQIVSGNNTSPLTIVEWYLVFTSTATVLAQ-LPNLNSIAGVSLIGAI  249

Query  935   TAIAYCTILWTLSVSKGRPPQGVTYD----PPQLSTSKLDRFRDIANALAVISLAFRGHN  768
             TA+ YCT++W +S+++ R P GV YD    PPQ  +        I NA+ +   AFRGHN
Sbjct  250   TAVTYCTLIWVVSITRDR-PAGVNYDYPALPPQAKSDPAASVFSILNAIGITVFAFRGHN  308

Query  767   IILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGI  588
             ++LEIQGT+P++ K P R  M  GV  +Y++IA+C FPLAI GYWAYGNL+P++   GG+
Sbjct  309   LVLEIQGTMPSSIKSPSRLPMWKGVKFAYLIIAMCLFPLAIGGYWAYGNLIPSN---GGM  365

Query  587   LNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKW  408
             LNA   +H HD SK ++G   ++++I CL ++QIYA+PV DN E  Y S   M   CP+W
Sbjct  366   LNALNNYHGHDTSKFVLGFTSLLVVINCLTSFQIYAMPVFDNLEFRYTS--SMNKPCPRW  423

Query  407   VRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWC  228
             +R G ++LFG     ++VA PFL SLAG IG + +P+T AYPCFMWI I KP  +  ++ 
Sbjct  424   LRAGFRILFGCFACFIAVALPFLPSLAGLIGGVAVPITLAYPCFMWILITKPPKHIAIF-  482

Query  227   VNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              N  LG LG+++  ++ T  +WN++  G+  +FF P
Sbjct  483   -NWVLGSLGIVLSILIVTGAIWNIVTIGIEVHFFKP  517



>gb|KHN20128.1| Lysine histidine transporter-like 8 [Glycine soja]
Length=505

 Score =   462 bits (1189),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 228/443 (51%), Positives = 313/443 (71%), Gaps = 9/443 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D  LPITESR GN +    H+LSSGIG QAL+LP+AFT+LGW WG+ICL + F WQLY
Sbjct  70    PQDDWLPITESRKGNAYYAAFHVLSSGIGFQALVLPLAFTTLGWTWGVICLCVAFTWQLY  129

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T+WLL+ LHES +G R SRY+ LA  AFG KMGKL A+FP MYLSGG+CV LI+ G G++
Sbjct  130   TLWLLIQLHESDSGLRHSRYLRLAMAAFGEKMGKLLALFPIMYLSGGTCVTLIMIGAGTM  189

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             ++F++ M  G P  LT  EW+L+F C AI ++   PNLNS+A +SL+G++TA++YC ++ 
Sbjct  190   KIFFQ-MVFGTPSPLTTIEWYLVFTCTAILLAQ-LPNLNSIAGVSLIGAITAVSYCVLIC  247

Query  905   TLSVSKGRPPQGVTYDPPQ-LSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNT  729
              +SV  GR    V+Y+P +  S S+        NAL +I+ AFRGHN++LEIQGT+P++ 
Sbjct  248   IVSVVTGR-LHHVSYEPRRGHSESEASMILSAWNALGIIAFAFRGHNLVLEIQGTMPSDA  306

Query  728   KVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDIS  549
             K P R  M  GV+ +YI+IALC FPLAI GYWAYGNL+PT+   GG+L A +K+H HD S
Sbjct  307   KQPSRLAMWKGVMFAYIVIALCLFPLAIGGYWAYGNLIPTN---GGMLGALQKYHEHDTS  363

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K ++  I ++++I  L ++QIYA+PV DN E  Y S  KM   CP+W+R+  + LFG L 
Sbjct  364   KFIIALISLLVVINSLSSFQIYAMPVFDNLEFRYTS--KMNRPCPRWLRIAFRGLFGCLA  421

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + ++VA PFL SLAG IG + +P+T AYPCFMWI IKKP+  +  W +N  LG +GM++ 
Sbjct  422   FFIAVALPFLPSLAGLIGGVALPITLAYPCFMWIQIKKPQKCSTNWYINWTLGVVGMILS  481

Query  188   TVLATATLWNLIADGLHANFFNP  120
              ++    +W ++A G+  +FFNP
Sbjct  482   VLVVIGAIWGIVAQGIEIHFFNP  504



>ref|XP_006435316.1| hypothetical protein CICLE_v10003187mg [Citrus clementina]
 ref|XP_006473912.1| PREDICTED: lysine histidine transporter-like 8-like [Citrus sinensis]
 gb|ESR48556.1| hypothetical protein CICLE_v10003187mg [Citrus clementina]
Length=503

 Score =   460 bits (1184),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 226/455 (50%), Positives = 313/455 (69%), Gaps = 12/455 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E   Q     P D+ LPITESRNGN +    H LSSGIG+QAL+LP+AFT+LGW WGIIC
Sbjct  55    EEVGQFTKLDPQDAWLPITESRNGNAYYSAFHTLSSGIGVQALVLPLAFTTLGWTWGIIC  114

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L L+F+WQLYT+WLL+ LHES +GTR+SRY+ L+  AFG K GKL A+FP MYLSGG+CV
Sbjct  115   LLLVFIWQLYTLWLLIQLHESESGTRYSRYLRLSMAAFGEKRGKLLALFPIMYLSGGTCV  174

Query  1115  MLIINGGGSLQLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISL  948
             +L++ GGG+L+ F++ +CG     +   LT  EW+L+F+C A+ ++   PNLNS+A +SL
Sbjct  175   ILVMIGGGTLKTFFEIVCGASETCNVTRLTTVEWYLVFICAAVVLAQ-LPNLNSIAGVSL  233

Query  947   LGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHN  768
             +G++TA++YCTI+W +SV K R P GV+Y+P +   S +     I N+L +I+ AFRGHN
Sbjct  234   IGAITAVSYCTIIWVVSVIKDR-PVGVSYEPVK-EISDVATIFSILNSLGIIAFAFRGHN  291

Query  767   IILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGI  588
             ++LE+QGT+P+  K P R  M  GV  +Y++IA+C FPLAI GY AYGNLMP      G+
Sbjct  292   LVLEVQGTMPSTAKKPSRIPMWRGVKFAYLIIAMCLFPLAIGGYSAYGNLMP---GNEGM  348

Query  587   LNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKW  408
              +A  K+H HD SK L+G   + ++I+ L ++QI+A+PV DN E  Y SK      CP W
Sbjct  349   FDALHKYHNHDTSKVLLGLTSLFVVISSLSSFQIFAMPVFDNLEFKYTSKYN--KPCPWW  406

Query  407   VRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWC  228
             +R G++V FG + + +S A PFL +LA  IG I +P+T AYPCFMWI I+KP  Y+ +W 
Sbjct  407   LRSGIRVFFGSVEFFISAALPFLRNLAALIGGIALPITLAYPCFMWIHIRKPTTYSAIWG  466

Query  227   VNMGLGCLGMLMCTVLATATLWNLIADGLHANFFN  123
             +N  LG LGM++  +      W+L   G+  +FF 
Sbjct  467   LNWALGILGMVLSILAVIGATWSLATMGIEFHFFK  501



>ref|XP_010066317.1| PREDICTED: lysine histidine transporter-like 8 [Eucalyptus grandis]
Length=491

 Score =   459 bits (1181),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 234/464 (50%), Positives = 318/464 (69%), Gaps = 15/464 (3%)
 Frame = -1

Query  1484  IDNEPAAQVQAFAP----LDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLG  1317
             I N+   +V A A      D  LPITESR+G+  S   H+L SG+G+QAL+LPVAF SLG
Sbjct  34    IANKSTGEVVAMAHESNRRDDWLPITESRDGSTVSAVFHLLCSGLGIQALMLPVAFASLG  93

Query  1316  WVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMY  1137
             WVWGII LS+ F+WQLY IW LV+LHES +GTR+SR++HL+T AFG ++GKL A+FP MY
Sbjct  94    WVWGIITLSIGFLWQLYNIWALVELHESVSGTRYSRFLHLSTAAFGHRLGKLLALFPVMY  153

Query  1136  LSGGSCVMLIINGGGSLQLFYKTMCGGDP-----KGLTGAEWFLLFVCIAIFISLFFPNL  972
             LSGG+CVMLIINGG +++  +KTMC GD      K L G EWFLLF CIAI I+   PNL
Sbjct  154   LSGGTCVMLIINGGRAMEDLFKTMCSGDGAACGIKPLDGVEWFLLFTCIAIVIAQ-LPNL  212

Query  971   NSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVI  792
             N++A +SL G++ A+ Y  ++W LSV+KGR P+GV+Y+P   + S+  R   + NA+ +I
Sbjct  213   NAIAIVSLFGAIAAVGYGALIWILSVAKGR-PEGVSYEPLIEAKSEEARIGSVLNAMGII  271

Query  791   SLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMP  612
             +L+FRGHN++LEIQGTLP+  +   +  M   VI +Y LIALC + LA+ G+WAYG+ +P
Sbjct  272   ALSFRGHNLVLEIQGTLPSTPECSSKESMWRAVIIAYSLIALCLYSLAVGGFWAYGSKIP  331

Query  611   TSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKK  432
                  GG+  AF +FH HD  K +MG  Y++I+ +CL  +QIYA+PV D  E  Y   K 
Sbjct  332   ----NGGLYVAFPQFHGHDTPKLVMGLTYLLIVASCLSAFQIYAMPVFDTLELRYTVIKD  387

Query  431   MMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKP  252
                 C    R  L+V FG L + ++VA PFLGSLA  IG +T  LTF  PCFMW+ IK+P
Sbjct  388   CRCRCSWRARTSLRVFFGCLAFFLAVALPFLGSLAPLIGGMTSTLTFVLPCFMWLMIKRP  447

Query  251   RPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
                +  W +N+GLG LG+++  ++ TA +W L+  G++ANFF+P
Sbjct  448   HRKSGKWWLNVGLGWLGVVLWVMMVTAAIWVLVDRGINANFFDP  491



>ref|XP_007136140.1| hypothetical protein PHAVU_009G021300g [Phaseolus vulgaris]
 gb|ESW08134.1| hypothetical protein PHAVU_009G021300g [Phaseolus vulgaris]
Length=507

 Score =   459 bits (1182),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 228/442 (52%), Positives = 311/442 (70%), Gaps = 9/442 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D  LPIT+SRNGN +    H+LSSGIG QALLLP+AFT+LGW WGI CL + F WQLY
Sbjct  74    PQDDWLPITQSRNGNAYYAAFHVLSSGIGFQALLLPLAFTTLGWTWGITCLCVAFTWQLY  133

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T+WLL+ LHES +G R SRY+ LA  AFG KMGK+ A+FP MYLSGG+CV LI+ G  ++
Sbjct  134   TLWLLIQLHESDSGVRHSRYLRLAMTAFGVKMGKVLALFPIMYLSGGTCVTLIMIGASTM  193

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             ++F++ M  G P  L+  EW+L+F C AI ++   PNLNS+A +SL+G++TA+ YC ++ 
Sbjct  194   KIFFQ-MVHGAPCPLSTIEWYLVFTCTAILLAQ-LPNLNSIAGVSLIGAITAVGYCALIC  251

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTK  726
              LSV +GR    V+Y+PP+  +     FR   NAL +I+ AFRGHN++LEIQGT+P++ K
Sbjct  252   ILSVVQGRVGD-VSYEPPRGQSDTSMVFRA-WNALGIIAFAFRGHNLVLEIQGTMPSDAK  309

Query  725   VPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISK  546
              P R  M  GV+ +YI+IALC FPLAI GYWAYGNL+PT+   GG+L A  K+H HD SK
Sbjct  310   QPSRLAMWRGVMFAYIVIALCLFPLAIGGYWAYGNLIPTN---GGMLGALHKYHEHDTSK  366

Query  545   SLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTY  366
              ++G   ++++I  L ++QIYA+PV DN E  Y SKK     CP+W+RM  + LFG L +
Sbjct  367   FVIGLTSLLVVINSLSSFQIYAMPVFDNLEFKYTSKKN--RPCPRWLRMVFRGLFGCLAF  424

Query  365   LVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCT  186
              ++VA PFL SLAG IG + +P+T AYPC MWI IKKP+  +  W +N  LG +GM++  
Sbjct  425   FIAVALPFLPSLAGLIGGVALPITLAYPCLMWIQIKKPQKCSTNWYLNWTLGVIGMILTV  484

Query  185   VLATATLWNLIADGLHANFFNP  120
             ++    +W ++A G+  +FFNP
Sbjct  485   LVVIGAIWGIVAQGMEIHFFNP  506



>dbj|BAA04838.1| ORF [Lilium longiflorum]
Length=518

 Score =   459 bits (1181),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 223/455 (49%), Positives = 317/455 (70%), Gaps = 13/455 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    V    P D  LPIT+SRNGN +    H LSSGIG QAL++PVAFT LGW+WGI+ 
Sbjct  73    EEVGHVTRLDPQDEWLPITQSRNGNSYYSAFHTLSSGIGFQALVVPVAFTFLGWLWGIVL  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LS+ F WQLYT+WLLV+LHES  GTR+SRY+HLA   FG K+GK  A+ P +YLS G+C 
Sbjct  133   LSVGFCWQLYTLWLLVELHESVPGTRYSRYLHLAKDTFGEKLGKFMALVPIIYLSAGTCS  192

Query  1115  MLIINGGGSLQLFYKTMCGGDPK--GLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LII GG +++ F++ +CG   +   LT  EW+L+FVC+A+ ++   P+LNS+A +SL+G
Sbjct  193   ALIIVGGSTMKGFFQIVCGPTCRYMPLTTVEWYLVFVCLAVVLAQ-LPHLNSIAGVSLIG  251

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTS-KLDRFRDIANALAVISLAFRGHNI  765
             ++TA+ YCT++W +SV KG+ P  ++Y+   + TS  + R   I NA+ +I+ AFRGHN+
Sbjct  252   AVTAVTYCTMIWVISVRKGKIPN-ISYE--AVDTSWDVARVLSILNAIGIIAFAFRGHNL  308

Query  764   ILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGIL  585
             +LEIQGT+P+  K P R  M  GV  +Y+LIA C FP+A+ G+W+YGN +P +    G+L
Sbjct  309   VLEIQGTMPSTQKHPARVPMWRGVKVAYVLIAFCLFPVALIGFWSYGNQIPPN----GVL  364

Query  584   NAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWV  405
              A  +FH HD S++++G   ++++I CL ++QIYA+P+ DN E  Y SKK     CP+W+
Sbjct  365   TALNQFHSHDTSRTILGLTTLLVVINCLSSFQIYAMPIFDNMEAGYTSKKN--KPCPQWL  422

Query  404   RMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCV  225
             R G +  FG + +L+S AFPFL  LAG IG++ +P+TFAYPCFMWI IKKP  + ++W +
Sbjct  423   RSGFRAFFGAVAFLISSAFPFLPQLAGLIGAVALPVTFAYPCFMWIVIKKPERFGVMWWL  482

Query  224   NMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             N  LGCLGM +  VL  A +W L+  G++ +FF+P
Sbjct  483   NWCLGCLGMGLSVVLVVAGVWRLVETGVNISFFDP  517



>ref|XP_004292280.1| PREDICTED: lysine histidine transporter-like 8-like [Fragaria 
vesca subsp. vesca]
Length=502

 Score =   458 bits (1179),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 241/443 (54%), Positives = 313/443 (71%), Gaps = 10/443 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             PLD+ LPITESRNGN FS+T H+L SGIG QALLLPVAF +LGW WGIICLSL F WQLY
Sbjct  69    PLDAWLPITESRNGNIFSVTFHLLCSGIGFQALLLPVAFATLGWAWGIICLSLAFTWQLY  128

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             TIWLLV LHES +G R+SR++HLA  AFG K+GKL  IFP MYLSGG+CV LII GG ++
Sbjct  129   TIWLLVQLHESESGIRYSRFIHLAVTAFGPKLGKLLCIFPVMYLSGGTCVQLIIIGGSTM  188

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +LF  T+C  D K +T  E FL+F C+AI +    PNLNS+A +S +G+++A+ YC ++ 
Sbjct  189   KLFLNTVC--DAKTVTATECFLMFTCLAI-VGAQSPNLNSVANVSFVGTISAVVYCILIS  245

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDR-FRDIANALAVISLAFRGHNIILEIQGTLPTNT  729
             +LSV+KGR    ++YDPP L  S +DR F  I NA+ +I LAFRGHN+ILEIQGTLP++ 
Sbjct  246   SLSVAKGRLSD-ISYDPP-LVESNMDRGFGGILNAMGIIFLAFRGHNVILEIQGTLPSSP  303

Query  728   KVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDIS  549
             K P  + M  GV  SY +I +C  PLA+ G WAYGN +P+S   G IL A  +F  H   
Sbjct  304   KHPTYKPMWRGVTISYAVIVMCLLPLAVCGSWAYGNKVPSSI--GEILTAAAQFRGHKTL  361

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K ++G I +++++ CL ++QIY + V DN E  Y  KKK    C +W+R+  ++ FGG  
Sbjct  362   KCVLGLICILVVVNCLSSFQIYGMVVFDNLEMRYSIKKK--KPCARWLRVIFRIFFGGFV  419

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + ++VAFPFL SLA  IG +  PLT+A+PC MWIAIKKP+P  ++ C+N GLGCLG+ + 
Sbjct  420   FFIAVAFPFLISLAVLIGGLAFPLTYAHPCLMWIAIKKPKPKGVMRCINTGLGCLGLCLS  479

Query  188   TVLATATLWNLIADGLHANFFNP  120
              VL  A  WN+   GL ANFF P
Sbjct  480   VVLVVAASWNIAQRGLKANFFRP  502



>gb|KCW64166.1| hypothetical protein EUGRSUZ_G01812 [Eucalyptus grandis]
Length=447

 Score =   456 bits (1173),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 229/445 (51%), Positives = 311/445 (70%), Gaps = 11/445 (2%)
 Frame = -1

Query  1439  DSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTI  1260
             D  LPITESR+G+  S   H+L SG+G+QAL+LPVAF SLGWVWGII LS+ F+WQLY I
Sbjct  9     DDWLPITESRDGSTVSAVFHLLCSGLGIQALMLPVAFASLGWVWGIITLSIGFLWQLYNI  68

Query  1259  WLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQL  1080
             W LV+LHES +GTR+SR++HL+T AFG ++GKL A+FP MYLSGG+CVMLIINGG +++ 
Sbjct  69    WALVELHESVSGTRYSRFLHLSTAAFGHRLGKLLALFPVMYLSGGTCVMLIINGGRAMED  128

Query  1079  FYKTMCGGDP-----KGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCT  915
              +KTMC GD      K L G EWFLLF CIAI I+   PNLN++A +SL G++ A+ Y  
Sbjct  129   LFKTMCSGDGAACGIKPLDGVEWFLLFTCIAIVIAQ-LPNLNAIAIVSLFGAIAAVGYGA  187

Query  914   ILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPT  735
             ++W LSV+KGR P+GV+Y+P   + S+  R   + NA+ +I+L+FRGHN++LEIQGTLP+
Sbjct  188   LIWILSVAKGR-PEGVSYEPLIEAKSEEARIGSVLNAMGIIALSFRGHNLVLEIQGTLPS  246

Query  734   NTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD  555
               +   +  M   VI +Y LIALC + LA+ G+WAYG+ +P     GG+  AF +FH HD
Sbjct  247   TPECSSKESMWRAVIIAYSLIALCLYSLAVGGFWAYGSKIP----NGGLYVAFPQFHGHD  302

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
               K +MG  Y++I+ +CL  +QIYA+PV D  E  Y   K     C    R  L+V FG 
Sbjct  303   TPKLVMGLTYLLIVASCLSAFQIYAMPVFDTLELRYTVIKDCRCRCSWRARTSLRVFFGC  362

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             L + ++VA PFLGSLA  IG +T  LTF  PCFMW+ IK+P   +  W +N+GLG LG++
Sbjct  363   LAFFLAVALPFLGSLAPLIGGMTSTLTFVLPCFMWLMIKRPHRKSGKWWLNVGLGWLGVV  422

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  ++ TA +W L+  G++ANFF+P
Sbjct  423   LWVMMVTAAIWVLVDRGINANFFDP  447



>ref|XP_011099569.1| PREDICTED: lysine histidine transporter-like 8 [Sesamum indicum]
Length=526

 Score =   458 bits (1179),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 239/470 (51%), Positives = 324/470 (69%), Gaps = 12/470 (3%)
 Frame = -1

Query  1517  SWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLP  1338
             S T   I P+      A ++    P D+ LPITESRNGN F    H L +GIG+QAL+LP
Sbjct  64    SRTPNFITPLGSPIRRAIKMTRLDPQDAWLPITESRNGNTFYAAFHTLCAGIGIQALVLP  123

Query  1337  VAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKL  1161
             V+FT LGW WGIICL++ FVWQLYT WLL +LHEST TG R+SR++ L   AFG KMGK+
Sbjct  124   VSFTILGWSWGIICLTVAFVWQLYTFWLLTNLHESTETGMRYSRFLQLFNAAFGEKMGKI  183

Query  1160  AAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD---PKGLTGAEWFLLFVCIAIFIS  990
              A+FP MYLSGG+CV LI+ GG + +LFY+ +CGG     K LT  EW+L+F C A+ +S
Sbjct  184   FALFPIMYLSGGTCVALIVVGGSTSKLFYQIVCGGHGCVAKPLTTVEWYLVFTCAAVLLS  243

Query  989   LFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIA  810
                PNLNS+A +SL+G++TAI YCTI+W +SV++GR   GV+YD  + +T+  + F  + 
Sbjct  244   QL-PNLNSIAGVSLIGAVTAIGYCTIMWIVSVTEGRL-DGVSYDRIKPNTNT-EWFFGVL  300

Query  809   NALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWA  630
             NAL +I+ AFRGHN+ LEIQ T+P++ K P R  M  GV A+Y ++ALC FPLAIAGYWA
Sbjct  301   NALGIIAFAFRGHNVTLEIQATMPSSEKKPSRVPMWRGVQAAYSIVALCLFPLAIAGYWA  360

Query  629   YGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERI  450
             YGN +P   + GGIL A   FH  D S++++G I + +II  L ++QIY +P+ D+ E  
Sbjct  361   YGNKIP---ENGGILTAIYAFHGRDTSQTILGLISLFVIINALSSFQIYGMPMFDDMESK  417

Query  449   YLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMW  270
                 K+M   CP W+R+ L+V+FG   + V+VA PFLGSLAG IG I +P+TFAYPC MW
Sbjct  418   I--TKRMKKPCPWWLRVILRVMFGYGCFFVAVAIPFLGSLAGLIGGIAVPVTFAYPCLMW  475

Query  269   IAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             I IKKP+ ++ +W +N GLG  G+L+  +L  A ++ +I  G+  +FF P
Sbjct  476   IRIKKPKKHSFMWWLNWGLGISGILLTVLLVAAGVYVVIDTGIEVSFFKP  525



>gb|KDP47155.1| hypothetical protein JCGZ_00046 [Jatropha curcas]
Length=496

 Score =   457 bits (1175),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 239/454 (53%), Positives = 324/454 (71%), Gaps = 11/454 (2%)
 Frame = -1

Query  1469  AAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLS  1290
             + ++Q    L+  LPITESRNGN F+   H+LSSGIG Q LLLP+AF+SLGW WGIIC  
Sbjct  50    SREMQVEDSLEDWLPITESRNGNTFTSVFHLLSSGIGFQGLLLPLAFSSLGWSWGIICFW  109

Query  1289  LLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVML  1110
             + +VWQLYTIW+LV LHE   G+R SR++ LA  AFG K+GK+ AIFP MYLSGG+CV+L
Sbjct  110   IAYVWQLYTIWILVQLHEVVPGSRCSRFLQLAISAFGPKLGKILAIFPVMYLSGGTCVIL  169

Query  1109  IINGGGSLQLFYKTMC--GG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
             II GG +L+LF+ T+C  GG  D K L+G EWFL+F C+AI ++   PNLNS+A ISL+G
Sbjct  170   IITGGKTLELFFHTICESGGTCDAKSLSGTEWFLVFTCVAIMLAQ-RPNLNSIAGISLIG  228

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TA+ Y T +W  ++SKGR P GV++ P Q   S +D+   + NA+ +I+L+FRGHNI+
Sbjct  229   AITAVGYYTTIWVSTISKGR-PDGVSHVPLQAEKSHMDKVSIVLNAIGIIALSFRGHNIV  287

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQGTLP+NTK P  + M  GV+ SY++IA+C FPLA  G+WA+GN +P    + G ++
Sbjct  288   LEIQGTLPSNTKNPSSKPMWRGVLMSYLIIAICLFPLATLGFWAHGNKIP---NQVGNVS  344

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
              F +F+    SK +   IYM++++ C  ++QIYA+PV DN E  Y++ K     C +WVR
Sbjct  345   IFLEFYNQKASKVIKIIIYMLVVVNCWSSFQIYAMPVFDNLELRYITIKS--SRCSRWVR  402

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              GL+VLFGG  + +++ FPFL SL   IG + +PLTF YPCFMWI+IKKPR    +WC+N
Sbjct  403   FGLRVLFGGFAFFIAITFPFLPSLTALIGGMALPLTFVYPCFMWISIKKPRRNGSMWCLN  462

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +GLGCLG+L+   L  A + NL   GL+ANFF P
Sbjct  463   LGLGCLGLLLSASLVMAAIRNLATKGLNANFFKP  496



>ref|XP_004238627.2| PREDICTED: lysine histidine transporter-like 8 [Solanum lycopersicum]
Length=511

 Score =   457 bits (1177),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 232/442 (52%), Positives = 312/442 (71%), Gaps = 11/442 (2%)
 Frame = -1

Query  1442  LDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYT  1263
             LD+ LPITESR+GN +    H L SGIG+QALLLP+AF +LGW+WGI+ LSL+F+WQLYT
Sbjct  77    LDAWLPITESRSGNAYYAAFHTLCSGIGVQALLLPLAFITLGWIWGIVSLSLVFMWQLYT  136

Query  1262  IWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQ  1083
             +WLL+ LHE   G R SRY+ L+  AFG K+GK+ A+FPTMYLSGG+CV LI+ GG S++
Sbjct  137   LWLLIQLHEFAPGMRNSRYLGLSMAAFGEKLGKILALFPTMYLSGGTCVTLIMIGGSSMK  196

Query  1082  LFYKTMCGGDPK--GLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTIL  909
             +F++T+C  +     L+  EW+++F   AI ++   PNLNS+A ISL+GS++A+ YCT+ 
Sbjct  197   IFFQTVCASNSHITTLSTIEWYIVFTVSAIVLAQ-LPNLNSIAGISLVGSISAVTYCTLT  255

Query  908   WTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNT  729
             W +SV K R PQGV+++P + +TS +     I NAL +I  AFRGHN++LEIQGT+P++ 
Sbjct  256   WVISVVKER-PQGVSFEPVE-NTSDVATICTILNALGMIVFAFRGHNLVLEIQGTMPSSL  313

Query  728   KVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDIS  549
             K P    M  GV  SY +IALC FPLAI GYWAYGNLMP     GGIL+A +K+H  D S
Sbjct  314   KNPSHVPMWKGVKFSYSIIALCLFPLAIGGYWAYGNLMP----NGGILSALDKYHGEDTS  369

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K ++G   +++ I CL ++QIYA+PV DNWE  Y SKKK    CP W+R GL+V FG LT
Sbjct  370   KVILGITSLLVAIHCLTSFQIYAMPVFDNWELKYTSKKK--KPCPWWLRTGLRVFFGCLT  427

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + +SVA PFL SLAG IG I +P+T AYPC M I IKKP+ Y+  W VN  LG  G+++ 
Sbjct  428   FFISVALPFLPSLAGLIGGIALPVTLAYPCLMCIMIKKPKRYSSSWFVNWSLGLWGLVLS  487

Query  188   TVLATATLWNLIADGLHANFFN  123
              +L  + +W +   G+  +FF 
Sbjct  488   ILLVFSAIWTIATQGMDVHFFK  509



>gb|EEC77802.1| hypothetical protein OsI_16982 [Oryza sativa Indica Group]
Length=508

 Score =   457 bits (1176),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 229/445 (51%), Positives = 305/445 (69%), Gaps = 12/445 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESR+GN +    H LSSGIG QAL+LPVAF+ LGW W IICL++ F WQLY
Sbjct  69    PRDAWLPITESRSGNAYYAAFHSLSSGIGFQALVLPVAFSLLGWTWAIICLTVAFAWQLY  128

Query  1265  TIWLLVDLHESTTG-TRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGS  1089
             T+WLLV LHE   G TR+SRY++LAT  FG K GK+ A+ P MYLS G+C  LII GGGS
Sbjct  129   TLWLLVKLHEPVAGGTRYSRYMYLATTVFGEKWGKILALLPVMYLSAGTCTALIIVGGGS  188

Query  1088  LQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCT  915
             ++L +   CG     + LT  EW+L+FVC+A  +S   PNLNS+A +SL+G+  A+AYCT
Sbjct  189   MKLLFNIACGEVCLARPLTTVEWYLVFVCVAALLSQL-PNLNSIAGVSLVGATAAVAYCT  247

Query  914   ILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPT  735
             ++W +SV+KGR   GV+YDP + +T + D    I N L +I+ AFRGHN++LEIQ T+P+
Sbjct  248   MIWVVSVAKGRV-AGVSYDPVR-ATDEEDGAIGILNGLGIIAFAFRGHNLVLEIQATMPS  305

Query  734   NTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD  555
               K P    M  GV A+Y++IALC +P+A+ G+WAYG+ +P +    GIL+A  KFH  D
Sbjct  306   TLKHPSHVPMWKGVKAAYVIIALCLYPVAVGGFWAYGDQIPPN----GILSALYKFHSQD  361

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
             +S+ ++G   +++I+ CL TYQIYA+PV DN E  Y+ KK     CP W+R G + LFG 
Sbjct  362   VSRVVLGTATLLVIVNCLTTYQIYAMPVFDNMETGYVHKKNR--PCPWWMRAGFRALFGA  419

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             +  L++VA PFL  LAG +G I++P+T AYPCFMW+AI +P   T +W  N GLG LGM 
Sbjct  420   INLLIAVALPFLSELAGLLGGISLPVTLAYPCFMWVAIMRPAKGTAMWYTNWGLGSLGMG  479

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  VL    LW L+  GLH  FF P
Sbjct  480   LSFVLIVGNLWGLVEKGLHVKFFKP  504



>ref|XP_003580326.1| PREDICTED: lysine histidine transporter-like 8 [Brachypodium 
distachyon]
Length=513

 Score =   457 bits (1176),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 227/445 (51%), Positives = 303/445 (68%), Gaps = 11/445 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPIT SR+GN +    H LSSGIG QAL+LP AF SLGW W IICL++ FVWQLY
Sbjct  73    PRDAWLPITASRSGNAYYAAFHSLSSGIGFQALVLPAAFASLGWTWAIICLTVAFVWQLY  132

Query  1265  TIWLLVDLHESTTG-TRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGS  1089
             T+ LLV+LHE   G TR+SRY+HLAT  FG K GK+ A+ PTMYLS G C  LII GGGS
Sbjct  133   TLRLLVNLHEPVPGGTRYSRYMHLATTVFGEKWGKILALLPTMYLSAGICTALIIVGGGS  192

Query  1088  LQLFYKTMCG-GDPKGL-TGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCT  915
             +++ +   CG   P    T  EW+++F+C+A+ IS   PNLNS+A +SL+ +  A+ YCT
Sbjct  193   MKILFSIACGPAQPSSSPTTVEWYVVFICVAVVISQL-PNLNSIAGVSLVAATAAVGYCT  251

Query  914   ILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPT  735
             ++W +SV+KGR   GV+YD P  +TS +DR   + N L +I+ AFRGHN++LEIQGT+P+
Sbjct  252   MIWAVSVAKGRV-SGVSYDVPDRATSDVDRTIAVLNGLGIIAFAFRGHNLVLEIQGTMPS  310

Query  734   NTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD  555
               K P    M  GV  +Y+++A C +P+AI G+WAYGN MP +    GIL+A  KFH  D
Sbjct  311   TLKHPSHVPMWKGVKFAYVIVAFCLYPVAIGGFWAYGNQMPPN----GILSALYKFHSRD  366

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
             +S+ ++G   +++++ CL T+QIYA+PV DN E  Y+ KK     CP W+R G + LFG 
Sbjct  367   VSRLIVGLATLLVVVNCLTTFQIYAMPVFDNMEAGYVHKKNK--PCPWWLRAGFRALFGA  424

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             +  L++VA PFL  LAG +G I++P+T AYPCFMW+AI KP+  T +WC+N  LG LGM 
Sbjct  425   INLLIAVALPFLSELAGLLGGISLPVTLAYPCFMWVAIMKPQRGTGMWCLNWALGSLGMG  484

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +   L    LW LI  GLH  FF P
Sbjct  485   LSFALIVGNLWGLIDRGLHVQFFKP  509



>ref|NP_001053557.1| Os04g0562100 [Oryza sativa Japonica Group]
 emb|CAE01852.2| OSJNBa0084K11.20 [Oryza sativa Japonica Group]
 dbj|BAF15471.1| Os04g0562100 [Oryza sativa Japonica Group]
 gb|EEE61492.1| hypothetical protein OsJ_15778 [Oryza sativa Japonica Group]
Length=512

 Score =   457 bits (1175),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 229/445 (51%), Positives = 305/445 (69%), Gaps = 12/445 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESR+GN +    H LSSGIG QAL+LPVAF+ LGW W IICL++ F WQLY
Sbjct  73    PRDAWLPITESRSGNAYYAAFHSLSSGIGFQALVLPVAFSLLGWTWAIICLTVAFAWQLY  132

Query  1265  TIWLLVDLHESTTG-TRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGS  1089
             T+WLLV LHE   G TR+SRY++LAT  FG K GK+ A+ P MYLS G+C  LII GGGS
Sbjct  133   TLWLLVKLHEPVAGGTRYSRYMYLATTVFGEKWGKILALLPVMYLSAGTCTALIIVGGGS  192

Query  1088  LQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCT  915
             ++L +   CG     + LT  EW+L+FVC+A  +S   PNLNS+A +SL+G+  A+AYCT
Sbjct  193   MKLLFNIACGEVCLARPLTTVEWYLVFVCVAALLSQL-PNLNSIAGVSLVGATAAVAYCT  251

Query  914   ILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPT  735
             ++W +SV+KGR   GV+YDP + +T + D    I N L +I+ AFRGHN++LEIQ T+P+
Sbjct  252   MIWVVSVAKGRV-AGVSYDPVR-TTDEEDGAIGILNGLGIIAFAFRGHNLVLEIQATMPS  309

Query  734   NTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD  555
               K P    M  GV A+Y++IALC +P+A+ G+WAYG+ +P +    GIL+A  KFH  D
Sbjct  310   TLKHPSHVPMWKGVKAAYVIIALCLYPVAVGGFWAYGDQIPPN----GILSALYKFHSQD  365

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
             +S+ ++G   +++I+ CL TYQIYA+PV DN E  Y+ KK     CP W+R G + LFG 
Sbjct  366   VSRVVLGTATLLVIVNCLTTYQIYAMPVFDNMETGYVHKKNR--PCPWWMRAGFRALFGA  423

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             +  L++VA PFL  LAG +G I++P+T AYPCFMW+AI +P   T +W  N GLG LGM 
Sbjct  424   INLLIAVALPFLSELAGLLGGISLPVTLAYPCFMWVAIMRPAKGTAMWYTNWGLGSLGMG  483

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  VL    LW L+  GLH  FF P
Sbjct  484   LSFVLIVGNLWGLVEKGLHVKFFKP  508



>ref|XP_004976496.1| PREDICTED: lysine histidine transporter-like 8-like [Setaria 
italica]
Length=525

 Score =   457 bits (1176),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 228/445 (51%), Positives = 301/445 (68%), Gaps = 12/445 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESR+GN +    H LSSGIG QAL+LP AF SLGW W IICL+L F WQLY
Sbjct  86    PRDAWLPITESRSGNAYYAAFHNLSSGIGFQALVLPTAFASLGWTWAIICLTLAFAWQLY  145

Query  1265  TIWLLVDLHESTTG-TRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGS  1089
             T+WLLV LHE   G  R+SRY+HLAT  FG +  K+ A+ P MYLS G C  LII GGGS
Sbjct  146   TLWLLVRLHEPVAGGVRYSRYMHLATTVFGERWAKILALLPVMYLSAGICTALIIVGGGS  205

Query  1088  LQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCT  915
             +++ +   CG     + LT  EW+L+F+C A+ +S   PNLNS+A +SL+G+  A+AYCT
Sbjct  206   MKMLFGIACGEACLARPLTTVEWYLVFICAAVLLSQL-PNLNSIAGVSLVGATAAVAYCT  264

Query  914   ILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPT  735
             ++W +S++KGR P GV+YDP + + + +D    I N L +I+ AFRGHN++LEIQGT+P+
Sbjct  265   MIWVVSIAKGRVP-GVSYDPVK-APNDVDAALGIVNGLGIIAFAFRGHNVVLEIQGTMPS  322

Query  734   NTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD  555
               K P    M  GV  +Y ++ALC +PLAI G+WAYGN +P +    GIL+A  KFH  D
Sbjct  323   TMKHPSHVPMWKGVKVAYAIVALCFYPLAIGGFWAYGNQIPPN----GILSALYKFHSRD  378

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
             +S+ ++G   +++II CL T+QIYA+PV DN E  Y+ KK     CP W+R G +  FG 
Sbjct  379   VSRLVLGITTLLVIINCLTTFQIYAMPVYDNMEAGYVHKKNR--PCPWWLRSGFRAFFGA  436

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             + +L++VA PFL  LAG +G I++P+T AYPCFMW+AIKKPR  T  W VN  LG LGM 
Sbjct  437   VNFLIAVALPFLSELAGLLGGISLPVTLAYPCFMWVAIKKPRKGTATWNVNWALGILGMS  496

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  VL    LW L+  GL   FF P
Sbjct  497   ISFVLIVGNLWGLVEKGLRVKFFKP  521



>ref|XP_007224547.1| hypothetical protein PRUPE_ppa024611mg [Prunus persica]
 gb|EMJ25746.1| hypothetical protein PRUPE_ppa024611mg [Prunus persica]
Length=492

 Score =   456 bits (1172),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 229/460 (50%), Positives = 314/460 (68%), Gaps = 21/460 (5%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN F    H LSSGIG+ +LLLP++FT+LG  WGIIC
Sbjct  45    EEVGHLTKLDPQDAWLPITESRNGNAFYSAFHTLSSGIGIPSLLLPLSFTALGLAWGIIC  104

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LSL F+WQLYT+WLL+ LHES +GTR+SRY+ L+  AFG K+GK  A+FP MYLSGG+CV
Sbjct  105   LSLAFIWQLYTLWLLIQLHESESGTRYSRYLRLSMAAFGEKLGKFLALFPIMYLSGGTCV  164

Query  1115  MLIINGGGSLQLFYKTMCGGDP--KGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GGG++++FY+ +CGG      L+  EW+L+F   AI ++   PNLNS+A ISL+G
Sbjct  165   TLIMIGGGTMKIFYEIVCGGTGVVNPLSTIEWYLVFTGSAILVAQ-LPNLNSIAGISLIG  223

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLS-TSKLDRFRDIANALAVISLAFRGHNI  765
             +LTA++YCT++W +S+SK R    V+Y PP+    +       + NAL +I+ AFRGHN+
Sbjct  224   ALTAVSYCTLIWVVSISKHRALPAVSYQPPEPKPNAAAATVFSVLNALGIITFAFRGHNL  283

Query  764   ILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGIL  585
             +LEIQGT+P++TK P R  M  GV  +Y++IALC FPLAIA YWAYGN +P++   GG+L
Sbjct  284   VLEIQGTMPSSTKSPSRLPMWNGVKFAYLIIALCLFPLAIASYWAYGNSIPSN---GGML  340

Query  584   NAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWV  405
             NA  KFH HD SK ++G   M++++  L ++QIYA+PV DN E  + S   M   CP+W+
Sbjct  341   NALYKFHSHDTSKFVLGLTSMLVVVNSLSSFQIYAMPVFDNLELRFTS--CMNKPCPRWL  398

Query  404   RMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCV  225
             R G ++ FG   + ++VA PFL SLAG +G I +P+T AYPCFMWI IKKP       C 
Sbjct  399   RSGFRIFFGCFAFFIAVALPFLPSLAGLLGGIAVPITLAYPCFMWILIKKP-------CK  451

Query  224   NMG-----LGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             N       LG LG+++   + T  +WN++  G+  +FF P
Sbjct  452   NSAIFHWLLGSLGIVLSISIVTGAIWNIVTIGIQVHFFKP  491



>ref|XP_009613449.1| PREDICTED: lysine histidine transporter-like 8 [Nicotiana tomentosiformis]
Length=511

 Score =   456 bits (1174),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 230/455 (51%), Positives = 316/455 (69%), Gaps = 12/455 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E         P D+ LPITESRNGN +    H LSSGIG+QAL+LP+AF +LGW+WGII 
Sbjct  65    EEIGHFTKLDPQDAWLPITESRNGNAYYAAFHTLSSGIGVQALVLPLAFITLGWIWGIIS  124

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LS++F+WQLYT+WLL+ LHES  G R+SRY+ L+   FG K+GK+ A+FPTMYLSGG+CV
Sbjct  125   LSIIFMWQLYTLWLLIQLHESVPGMRYSRYLRLSMAVFGEKLGKILALFPTMYLSGGTCV  184

Query  1115  MLIINGGGSLQLFYKTMCGGDP---KGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLL  945
              LI+ GGG++++F++T+CG +      L+  EW+++F   AI ++   PNLNS+A ISL+
Sbjct  185   TLIMIGGGTMKIFFQTICGSNHCHLISLSTIEWYIVFTVSAIVLAQ-LPNLNSIAGISLI  243

Query  944   GSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNI  765
             GS++A+ YCT+ W +SV K + P+GV+++P + + S L R   I NA+ +I+ AFRGHN+
Sbjct  244   GSISAVTYCTLTWVVSVVKEK-PEGVSFEPVE-NISDLGRVCSILNAIGMIAFAFRGHNL  301

Query  764   ILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGIL  585
             +LEIQGT+P++ K P    M  GV  SY +IALC FPLAI GYWAYGNLMP     GGIL
Sbjct  302   VLEIQGTMPSSLKNPSHLPMWKGVKFSYSIIALCLFPLAIGGYWAYGNLMP----NGGIL  357

Query  584   NAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWV  405
             +A +K+H  D SK ++G   +++++  L ++QIYA+PV DN E  Y S KK    CP W+
Sbjct  358   SALDKYHREDTSKVILGITSLLVVVHSLTSFQIYAMPVFDNLEFRYTSNKK--KPCPWWI  415

Query  404   RMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCV  225
             R G +V FG L + +SVA PFL SLAG IG I +P+T AYPC MWI I KP+ YT  W V
Sbjct  416   RTGFRVFFGCLAFFISVALPFLPSLAGLIGGIALPVTLAYPCLMWIMINKPKTYTSSWYV  475

Query  224   NMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             N  LG LG+++  +L    +W++   G+  +FF P
Sbjct  476   NWSLGILGLVLSVLLVFGAIWSIATQGMDVHFFKP  510



>ref|XP_010101309.1| hypothetical protein L484_011674 [Morus notabilis]
 gb|EXB88244.1| hypothetical protein L484_011674 [Morus notabilis]
Length=527

 Score =   457 bits (1175),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 230/462 (50%), Positives = 314/462 (68%), Gaps = 9/462 (2%)
 Frame = -1

Query  1499  IAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSL  1320
             IA +    E         P ++ LPITESR GN +    H L SGIG+QALLLP+AF  L
Sbjct  72    IASMQGHLEEVGHFTKLEPQEAWLPITESRRGNSYYAAFHTLCSGIGVQALLLPLAFAIL  131

Query  1319  GWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTM  1140
             GW WGI CL L FVWQLYT+WLL+ LHES +G R+SRY+ L+  AFG K+GKL ++FP M
Sbjct  132   GWAWGITCLVLAFVWQLYTLWLLIQLHESDSGMRYSRYLRLSIEAFGEKLGKLMSLFPIM  191

Query  1139  YLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNS  966
             YLSGG+CV LI+ GGG++++F++ +C    + K LT  EW+L+F CIA  I+   PNLNS
Sbjct  192   YLSGGTCVTLIMIGGGTMKMFFELLCNETCNVKPLTTIEWYLVFTCIATVIAQ-LPNLNS  250

Query  965   LAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISL  786
             +A ISL+G++TA++YCT++W +SVSKGR  +GV+Y+P    +     F  + NAL +I+ 
Sbjct  251   IAGISLIGAITAVSYCTLIWVISVSKGR-LKGVSYEPLGAKSDVATLFETL-NALGIIAF  308

Query  785   AFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTS  606
              FRGHN++LEIQGT+P++ K P R  M  GV  +Y++IA+C FPLAI GY AYGN MP S
Sbjct  309   TFRGHNLVLEIQGTMPSSIKRPSRLPMWKGVKFAYLIIAMCLFPLAIGGYLAYGNKMPVS  368

Query  605   YKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMM  426
              +  G+L+A  KFH  D SK L+G   M+++I  L ++QIYA+PV DN E  Y S   + 
Sbjct  369   NE--GLLSAMYKFHKRDTSKFLLGMTSMLVVINSLSSFQIYAMPVFDNLEFRYTS--ALN  424

Query  425   MSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRP  246
               CP+W+R  L++ FG L   ++VA PFL SLAG IG + +P+T AYP FMW+ IKKP+ 
Sbjct  425   QPCPRWLRSALRIFFGCLASFIAVALPFLPSLAGLIGGVALPVTLAYPSFMWMLIKKPQK  484

Query  245   YTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             Y+ VW +N  LG LGML+   + T  +W+++  GL  +F  P
Sbjct  485   YSAVWFLNWSLGVLGMLISVSVVTGAIWSIVTKGLEVHFLKP  526



>ref|XP_008377097.1| PREDICTED: lysine histidine transporter-like 8 [Malus domestica]
Length=484

 Score =   454 bits (1168),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 222/455 (49%), Positives = 318/455 (70%), Gaps = 13/455 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H LSSGIG+ ALLLP++F +LGW WGIIC
Sbjct  37    EEVGHLTKLDPQDAWLPITESRNGNALYSAFHTLSSGIGIPALLLPLSFATLGWAWGIIC  96

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LS+ F+WQLYT+WLL+ LHES +G R+SRY+ L+  AFG K+GK+ A+FP MYLSGG+CV
Sbjct  97    LSVAFMWQLYTLWLLIQLHESESGVRYSRYLRLSMAAFGEKLGKILALFPIMYLSGGTCV  156

Query  1115  MLIINGGGSLQLFYKTMCGGDPKGLTGA---EWFLLFVCIAIFISLFFPNLNSLAWISLL  945
              LI+ GGG++++F++ +CG   + ++     EW+L+F   AI ++   PNLNS+A ISL+
Sbjct  157   TLIMIGGGTMKIFFQIVCGETCRHVSPPSTIEWYLVFTGTAILLAQ-LPNLNSIAGISLI  215

Query  944   GSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNI  765
             G++TA++YCT++W +SV+K R P GV+Y P +  +     F  + NAL +   AFRGHN+
Sbjct  216   GAITAVSYCTLIWVVSVTKDR-PNGVSYKPLETKSDAATVF-GVLNALGITIFAFRGHNL  273

Query  764   ILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGIL  585
             +LEIQGT+P+N++ P R  M  GV  +Y++IALC FPLAI GYWAYGN +P+S   GG+L
Sbjct  274   VLEIQGTMPSNSQRPSRLPMWKGVKFAYLIIALCLFPLAIGGYWAYGNFIPSS---GGML  330

Query  584   NAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWV  405
             +A  K+H HD SK ++G   M++++ CL ++QIYA+PV DN E  + S       CP+W+
Sbjct  331   DALNKYHGHDTSKFVLGLTSMLVVVNCLSSFQIYAMPVFDNLEFRFTSSVN--KPCPRWL  388

Query  404   RMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCV  225
             R G+++ FG + + +SVA PFL SLAG IG + +P+T AYPCFMWI IKKP   + ++  
Sbjct  389   RSGIRIFFGCVAFFISVALPFLPSLAGLIGGVAVPITLAYPCFMWILIKKPCKCSTIF--  446

Query  224   NMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             N  LG LG+++  ++ T  +WN++  G+  +FF P
Sbjct  447   NWALGALGIVLSILIITGAIWNIVTIGIEVHFFKP  481



>ref|XP_010066316.1| PREDICTED: lysine histidine transporter-like 8 [Eucalyptus grandis]
 gb|KCW64167.1| hypothetical protein EUGRSUZ_G01814 [Eucalyptus grandis]
Length=499

 Score =   455 bits (1170),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 237/458 (52%), Positives = 314/458 (69%), Gaps = 24/458 (5%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             PLD  LPITESR+G+  S   H+L SG+G+QAL+LPVAF SLGWVWGII LS+ F+WQLY
Sbjct  50    PLDGWLPITESRDGSTVSAVFHLLCSGLGIQALMLPVAFASLGWVWGIITLSIGFLWQLY  109

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             TIW LV+LHES  GTR+SR++ L+  AFG ++GKL A+FP MYLSGG+CVMLIINGGG++
Sbjct  110   TIWALVELHESVPGTRYSRFLDLSIAAFGPRLGKLLALFPVMYLSGGTCVMLIINGGGAM  169

Query  1085  QLFYKTMCGGDP-----KGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAY  921
             +  +KTMCGGD      K L G EWFLLF CIAI I+   PNLN +A +SL G++ A+ Y
Sbjct  170   EDLFKTMCGGDGAACGIKPLDGVEWFLLFTCIAIVIAQ-LPNLNPIATVSLFGAIAAVGY  228

Query  920   CTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQ---  750
               ++W LSV+KGR P+GV+Y+P   + S   R   + NA+ +I+L+FRGHN++LEIQ   
Sbjct  229   GALIWILSVTKGR-PEGVSYEPLIEAKSVEARIGSVLNAIGIIALSFRGHNLVLEIQGTL  287

Query  749   --------GTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKG  594
                     GTLP+  K   +  M   VI +Y LIALC + LAI G+WAYG+ +P     G
Sbjct  288   PSTPKCSSGTLPSTPKCSSKESMWRAVIIAYSLIALCLYSLAIGGFWAYGSKIP----NG  343

Query  593   GILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCP  414
             G+  AF +FH HD  K +MG  Y++I+ +CL  +QIYA+PV D  E  Y S +     C 
Sbjct  344   GLYVAFPQFHGHDTPKLVMGLTYLLIVASCLSAFQIYAMPVFDTLELRYTSIRN--CRCS  401

Query  413   KWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLV  234
             +  R  L+V FG LT+ V+VA PFLGSLA  IG +T  LTF  PCFMW+ IK+PR  +  
Sbjct  402   RRARTFLRVFFGCLTFFVAVALPFLGSLAPLIGGMTSTLTFVLPCFMWLMIKRPRRKSGK  461

Query  233   WCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             W +N+GLG LG+++  V+  A +W L+  G++ANFF+P
Sbjct  462   WWLNVGLGWLGVVLWAVMVAAAIWVLVDRGINANFFDP  499



>ref|XP_004292281.1| PREDICTED: lysine histidine transporter-like 8-like [Fragaria 
vesca subsp. vesca]
Length=503

 Score =   455 bits (1170),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 232/444 (52%), Positives = 317/444 (71%), Gaps = 9/444 (2%)
 Frame = -1

Query  1439  DSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTI  1260
             D+ LP+TESRNG+  S+T H+L SG+G+QAL LP AF +LGW WG ICL L F WQLYTI
Sbjct  65    DAWLPLTESRNGSTLSVTFHLLCSGLGIQALSLPAAFATLGWAWGCICLLLAFAWQLYTI  124

Query  1259  WLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQL  1080
              LLV  HES TGTR SRY+ LA  AFG K+GKL  +FP +YLS G+CV LII GG +++L
Sbjct  125   RLLVLSHESDTGTRSSRYIQLAIKAFGQKLGKLLVMFPMIYLSNGACVQLIITGGLTMEL  184

Query  1079  FYKTMCGGDPKG----LTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTI  912
             F+KT+C          +TG E FL+F  +AI ++   PNLNS+ W+SL+GS+TAI YCT+
Sbjct  185   FFKTVCNDGATAYCHPMTGTECFLVFTIMAIVVAQ-LPNLNSITWVSLVGSITAIVYCTM  243

Query  911   LWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTN  732
             +W++S++KGR P G++Y+PP++  S +DRF  I NA+ ++ LAFRGHN+ILEIQGTLP+N
Sbjct  244   IWSISIAKGR-PSGISYNPPEME-SDMDRFGRILNAIGIVFLAFRGHNVILEIQGTLPSN  301

Query  731   TKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDI  552
              K P+ +RM  GVI SY +IA+C  PLAIAG+W +GN + +S     + +A +    +  
Sbjct  302   PKHPIHKRMWRGVIISYAIIAICMVPLAIAGFWVHGNKVSSSSLSAILSSASQLPGHNKT  361

Query  551   SKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGL  372
             S+S++G I +++I+ CL T+QIY + V DN E  Y  +K     C + +R+  +VLFGGL
Sbjct  362   SRSILGVICILVILHCLSTFQIYGMVVYDNLESKYTMRKN--RPCARRLRVTFRVLFGGL  419

Query  371   TYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLM  192
              +  +V FPFL SLA  IG +T+P+ +AYPCFMWIA+KKP+P  L+WC+N+ LGCLG+++
Sbjct  420   AFFAAVTFPFLVSLAPLIGGLTLPMAYAYPCFMWIALKKPKPNGLMWCINVALGCLGLVL  479

Query  191   CTVLATATLWNLIADGLHANFFNP  120
               VL  A  WNL   GL+ANFF P
Sbjct  480   SVVLVVAATWNLAQKGLNANFFKP  503



>emb|CAH67169.1| H0211B05.6 [Oryza sativa Indica Group]
Length=508

 Score =   455 bits (1170),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 227/445 (51%), Positives = 304/445 (68%), Gaps = 12/445 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESR+GN +    H  SSGIG QAL+LPVAF+ LGW W IICL++ F WQLY
Sbjct  69    PRDAWLPITESRSGNAYYAAFHSFSSGIGFQALVLPVAFSLLGWTWAIICLTVAFAWQLY  128

Query  1265  TIWLLVDLHESTTG-TRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGS  1089
             T+WLLV LHE   G TR+SRY++LAT  FG K GK+ A+ P MYLS G+C  LII GGGS
Sbjct  129   TLWLLVKLHEPVAGGTRYSRYMYLATTVFGEKWGKILALLPVMYLSAGTCTALIIVGGGS  188

Query  1088  LQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCT  915
             ++L +   CG     + LT  EW+L+FVC+A  +S   PNLNS+A +SL+G+  A+AYCT
Sbjct  189   MKLLFNIACGEVCLARPLTTVEWYLVFVCVAALLSQL-PNLNSIAGVSLVGATAAVAYCT  247

Query  914   ILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPT  735
             ++W +SV+KGR   GV+YDP + +T + D    I N L +I+ AFRGHN++LEIQ T+P+
Sbjct  248   MIWVVSVAKGRV-AGVSYDPVR-ATDEEDGAIGILNGLGIIAFAFRGHNLVLEIQATMPS  305

Query  734   NTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD  555
               K P    M  GV A+Y++IALC +P+A+ G+WAYG+ +P +    GI++A  KFH  D
Sbjct  306   TLKHPSHVPMWKGVKAAYVIIALCLYPVAVGGFWAYGDQIPPN----GIVSALYKFHSQD  361

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
             +S+ ++G   +++I+ CL TYQIYA+PV DN E  Y+ KK     CP W+R G + LFG 
Sbjct  362   VSRVVLGTATLLVIVNCLTTYQIYAMPVFDNMETGYVHKKNR--PCPWWMRAGFRALFGA  419

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             +  L++VA PFL  LAG +G I++P+T AYPCFMW+AI +P   T +W  N GLG LGM 
Sbjct  420   INLLIAVALPFLSELAGLLGGISLPVTLAYPCFMWVAIMRPAKGTAMWYTNWGLGSLGMG  479

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  VL    LW L+  GLH  FF P
Sbjct  480   LSFVLIVGNLWGLVEKGLHVKFFKP  504



>ref|XP_006486847.1| PREDICTED: lysine histidine transporter-like 8-like [Citrus sinensis]
Length=450

 Score =   452 bits (1164),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 227/454 (50%), Positives = 298/454 (66%), Gaps = 12/454 (3%)
 Frame = -1

Query  1463  QVQAFAP--LDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLS  1290
             +VQ   P  LD  LP+T SRNGN FS   H++SSGIG+QAL LPV F +LGW WGIICL 
Sbjct  3     EVQKLQPNSLDDWLPLTASRNGNTFSTVFHIVSSGIGIQALFLPVGFATLGWTWGIICLL  62

Query  1289  LLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVML  1110
               F WQ+YTIWLLV L E   GTR+SRY+ +A  AFG K+ K   +FP  YLSGG+C+ML
Sbjct  63    TAFAWQIYTIWLLVHLAEPVPGTRYSRYMQVAKAAFGPKLAKSLCVFPVWYLSGGTCIML  122

Query  1109  IINGGGSLQLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
             II  G  L+  YK MCGG    + K L G  W LLF+CIAI  S   PNLNS+   S  G
Sbjct  123   IITAGADLETLYKIMCGGIATCEAKSLPGVVWCLLFICIAIVFSQLLPNLNSVLKFSKTG  182

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TA+ Y T+LW L++ KGR    V+Y   +   S + ++ +I NA+  I LAFRGHN++
Sbjct  183   TVTAVVYVTLLWALTIRKGR-ANDVSYSRVEEGKSGMAKYANILNAIGTIVLAFRGHNLV  241

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQGTLP++   P  ++M   V  SY+ I +C FPLA+ GYWAYGN +     K G+L+
Sbjct  242   LEIQGTLPSSKFNPSSQKMWRAVKISYMTIGMCSFPLALTGYWAYGNKVTA---KEGLLS  298

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
              F + H HD S+  MG+IY++ II CLC +QIYA+P  D+ E  Y+ KK+    CP+ VR
Sbjct  299   VFSQVHGHDTSRGAMGSIYLLQIINCLCQFQIYAMPAFDSLEFRYIFKKQ--QQCPRRVR  356

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
                +  F GL  L+SVAFPF  SLA F+G +T+P  F+YPC M+  IKKP     +W +N
Sbjct  357   AAYRFFFTGLISLLSVAFPFFPSLAPFMGGLTLPFKFSYPCLMYNLIKKPDQSGTLWWLN  416

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +GLGC G+++  +L  AT WNL+  G+HANFF+P
Sbjct  417   LGLGCFGIILSVMLVVATFWNLVTKGVHANFFSP  450



>ref|XP_008669025.1| PREDICTED: lysine histidine transporter-like 8 [Zea mays]
 tpg|DAA36449.1| TPA: hypothetical protein ZEAMMB73_149198 [Zea mays]
Length=527

 Score =   455 bits (1170),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 301/446 (67%), Gaps = 14/446 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESR+GN +    H LSSGIG QAL+LP AF SLGW W IICL+L F WQLY
Sbjct  88    PRDAWLPITESRSGNAYYAAFHNLSSGIGFQALVLPTAFASLGWTWAIICLTLAFGWQLY  147

Query  1265  TIWLLVDLHESTTG-TRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGS  1089
             T+WLLV LHE   G TR+SRY+HLAT  FG +  K+ A+ P MYLS G C  LII GGGS
Sbjct  148   TLWLLVRLHEPVAGATRYSRYMHLATTVFGERWAKILALLPVMYLSAGICTALIIVGGGS  207

Query  1088  LQLFYKTMCGGDP---KGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYC  918
             ++L +   CG +P   +  T  EW+L+FVC A+ +S   PNLNS+A +SL+G+  A+AYC
Sbjct  208   MKLLFGIACG-EPCPARPPTTVEWYLVFVCAAVLLSQL-PNLNSIAGVSLVGATAAVAYC  265

Query  917   TILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLP  738
             T++WT+SV+KGR P  V+YDP + + S +D    I N L +I+ AFRGHN++LEIQGT+P
Sbjct  266   TMIWTVSVAKGRVP-AVSYDPVK-APSDVDGALAILNGLGIIAFAFRGHNVVLEIQGTMP  323

Query  737   TNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIH  558
             +  K P    M  GV  +Y +IALC +P+AI G+WAYGN +P +    GIL+A  KFH  
Sbjct  324   STLKHPSHVPMWKGVKVAYAIIALCLYPVAIGGFWAYGNQIPPN----GILSALYKFHSR  379

Query  557   DISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFG  378
             D S+ ++G    ++I+ CL T+QIYA+PV DN E  Y+ KK     CP W+R G +  FG
Sbjct  380   DTSRLVLGVTTTLVIVNCLTTFQIYAMPVYDNMEAGYVHKKNR--PCPWWMRSGFRAFFG  437

Query  377   GLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGM  198
              + +L++VA PFL  LAG +G I++P+T AYPCFMW+AIKKPR  T  W VN  LG LGM
Sbjct  438   AVNFLIAVALPFLSQLAGLLGGISLPVTLAYPCFMWVAIKKPRKGTATWNVNWALGILGM  497

Query  197   LMCTVLATATLWNLIADGLHANFFNP  120
              +  VL    LW L+  GL   FF P
Sbjct  498   SISLVLIVGNLWGLVEKGLRVKFFKP  523



>gb|KDP47154.1| hypothetical protein JCGZ_00045 [Jatropha curcas]
Length=500

 Score =   454 bits (1167),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 239/471 (51%), Positives = 323/471 (69%), Gaps = 16/471 (3%)
 Frame = -1

Query  1520  GSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLL  1341
             GS  STR      +     + QA   +D  LPITESRNGN F+   H++SSGIG Q L++
Sbjct  42    GSGDSTR------ETMANRETQAGHSIDDWLPITESRNGNIFTSVFHLVSSGIGTQGLVI  95

Query  1340  PVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKL  1161
             P+AF+ LGW WGIIC  + F WQ+YT W+LV LHE   G+R SRY+ LA  AFG K+GKL
Sbjct  96    PLAFSKLGWSWGIICFWIAFAWQIYTRWILVQLHEVVPGSRCSRYLLLAISAFGPKLGKL  155

Query  1160  AAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD----PKGLTGAEWFLLFVCIAIFI  993
              AIFP  YLSGG+CV+LII GG +L+LF  TMCG D     K L+G  WFL+F C+AI  
Sbjct  156   LAIFPMAYLSGGTCVILIITGGKTLELFSHTMCGSDATCAAKSLSGIVWFLVFTCVAIAF  215

Query  992   SLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDI  813
             +   PNLNS+A IS+LG++TA+ Y T++W  ++SKGR P  V++ P Q   S +++F  I
Sbjct  216   ATLRPNLNSVAGISMLGAITAVGYYTLIWVSTISKGR-PNDVSHVPLQGEKSHMEKFSGI  274

Query  812   ANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYW  633
               AL +++ +FRGHN++LEIQGTLP+ ++ P  + M  GV+ S++ IA+C FPLAI G+W
Sbjct  275   LTALGLLAFSFRGHNLVLEIQGTLPSTSENPSSKPMWRGVLISHLTIAICFFPLAIVGFW  334

Query  632   AYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWER  453
             AYGN +P  +    I     +F+    SK + G IYM++++ CLC +QIYA+PV DN E 
Sbjct  335   AYGNKIPNLFGNATIS---LQFYSQKASKVIKGIIYMLVVVNCLCLFQIYAMPVFDNLEL  391

Query  452   IYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFM  273
              Y+S KK    C +WVR GL+VLFGG  + +++ FPFL SLA  IG   +PLTF YPCFM
Sbjct  392   RYVSIKK--GRCSRWVRSGLRVLFGGFVFFMAITFPFLPSLAALIGGAALPLTFVYPCFM  449

Query  272   WIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             WI+IKKP+    +WC+N+GLGCLG+L+  ++ TA +WNL+  GL ANF+NP
Sbjct  450   WISIKKPQRNGPMWCLNLGLGCLGLLLSALVVTAAIWNLVTRGLKANFYNP  500



>ref|XP_010029613.1| PREDICTED: lysine histidine transporter-like 8 [Eucalyptus grandis]
Length=528

 Score =   452 bits (1164),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 239/477 (50%), Positives = 329/477 (69%), Gaps = 14/477 (3%)
 Frame = -1

Query  1535  RVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGL  1356
             R  R+ S T   + P+      A ++    P D+ LPITESRNGN +    H L SGIG 
Sbjct  60    RTPRL-SLTPRFLTPLGSPMRMALRLTKLDPQDAWLPITESRNGNEYYAAFHTLCSGIGF  118

Query  1355  QALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAFG  1179
             QAL+LPVAFT LGW WGII L+L F+WQLYT+WLLV LHES  TG R++RY+ L T AFG
Sbjct  119   QALVLPVAFTILGWTWGIIGLTLAFIWQLYTLWLLVQLHESPETGMRYNRYIQLCTAAFG  178

Query  1178  GKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCG----GDPKGLTGAEWFLLFV  1011
              ++GKL  +FPTMYLSGG+CV L++ GG + +LFY+ +CG         LT  EW+L+F 
Sbjct  179   ERLGKLLGLFPTMYLSGGTCVALVMIGGSTSRLFYQIVCGTAACAIKTPLTTVEWYLVFT  238

Query  1010  CIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKL  831
             C A+ +S   PNLNS+A +SL+G++TAI YCT +W +SV++GR P GV+YDP + + S+ 
Sbjct  239   CGAVVLSQL-PNLNSIAGVSLIGAMTAIGYCTSIWAVSVAEGRLP-GVSYDPVK-TGSRF  295

Query  830   DRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPL  651
                  + NAL +I+ AFRGHN++LEIQ T+P++ K+P    M  GV  SY LIA+C FPL
Sbjct  296   HHVNSVLNALGIIAFAFRGHNLVLEIQATMPSSEKLPAHVPMWKGVRVSYTLIAICLFPL  355

Query  650   AIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPV  471
             AI GYWAYG+L+PT+   GG+L A  +FH  ++S+S++G I + +II  L ++QIY +P+
Sbjct  356   AIGGYWAYGHLIPTN---GGMLTALYQFHYRNVSRSVLGMISLFVIINALSSFQIYGMPI  412

Query  470   LDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTF  291
              DN E  Y S+KK    CP W+R  ++ +FG   + V+VA PFLGSLAG IG + +P+T 
Sbjct  413   FDNMESKYTSRKKR--PCPWWLRSLIRAMFGFGFFFVAVAIPFLGSLAGLIGGVALPVTL  470

Query  290   AYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             AYPCFMW+ +KKP+ Y+L+W +N  LG LGML+  +L  A ++ +I  G+ A+FFNP
Sbjct  471   AYPCFMWLKMKKPKIYSLMWWLNWVLGTLGMLLSILLIEAGVYVVIDTGIEASFFNP  527



>ref|XP_007131581.1| hypothetical protein PHAVU_011G025100g [Phaseolus vulgaris]
 gb|ESW03575.1| hypothetical protein PHAVU_011G025100g [Phaseolus vulgaris]
Length=500

 Score =   451 bits (1159),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 242/480 (50%), Positives = 324/480 (68%), Gaps = 26/480 (5%)
 Frame = -1

Query  1526  RIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQAL  1347
              I   T T  +P +    P  Q     P D+ LPITESRNGN F    H+L+S IG QAL
Sbjct  36    HIDPLTPTGSSPSEAHPSPTHQ----HPKDAWLPITESRNGNAFYAAFHVLNSNIGFQAL  91

Query  1346  LLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMG  1167
             +LP+AF +LGW WG +CL++ F+WQLY+I+LLV LHES  G R SRY+ LA  AFG ++G
Sbjct  92    MLPLAFATLGWAWGTVCLTVAFIWQLYSIFLLVQLHESVPGIRHSRYLFLAMAAFGKRLG  151

Query  1166  KLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD------PKGLTGAEWFLLFVCI  1005
             K+AA+FP MYLSGG+CVMLII GGG+L+L + T+C  D         LTGAEWFL+F C 
Sbjct  152   KVAALFPVMYLSGGTCVMLIITGGGTLKLLFNTLCDSDNGNTCSAHALTGAEWFLVFTCA  211

Query  1004  AIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDR  825
             AI ++   PNLNS+A +SL+G++T+I YCT+ W LSV KGRP            ++ + +
Sbjct  212   AILVAQ-LPNLNSMAMVSLVGAVTSITYCTLFWVLSVKKGRPSNVSYKSTLSQDSTAVAK  270

Query  824   FRDIANALAVISLAFRGHNIILEIQGTLPTN----TKVPLRRRMCTGVIASYILIALCHF  657
               D+ NA+ +I LA+RGHN++LEIQGTLP++    +K P+RR    GV  SY+LI++C F
Sbjct  271   ISDVLNAIGIIVLAYRGHNVLLEIQGTLPSDFERTSKEPMRR----GVSMSYVLISMCVF  326

Query  656   PLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYAL  477
             PLAIAG+WAYGN +      GG+L +F + H + I+K  MGA+Y+++II CL +YQIYA+
Sbjct  327   PLAIAGFWAYGNQI----NDGGLLYSFPQLHKNQITKFSMGALYVLVIIHCLSSYQIYAM  382

Query  476   PVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITM-P  300
             PV DN E  Y S K     C    R  +++ FGGLT+ +SV FPFL SL+  IGSIT+ P
Sbjct  383   PVFDNLEIRYTSIKN--EKCSVLARTCIRLFFGGLTFFISVTFPFLPSLSALIGSITLVP  440

Query  299   LTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +T+AYPCFM++++KKP    LVWC N  LGCLG+L+  +L  A+   L   GL+ANFF P
Sbjct  441   ITYAYPCFMFLSLKKPPRRGLVWCFNAALGCLGLLLSVLLLAASARTLANKGLNANFFKP  500



>ref|XP_009795070.1| PREDICTED: lysine histidine transporter-like 8 [Nicotiana sylvestris]
Length=511

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 232/455 (51%), Positives = 316/455 (69%), Gaps = 12/455 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E         P D+ LPITESRNGN +    H LSSGIG+QAL+LP+AF +LGW+WGII 
Sbjct  65    EEIGHFTKLDPQDAWLPITESRNGNAYYAAFHTLSSGIGVQALVLPLAFITLGWIWGIIS  124

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LS++F+WQLYT+WLL+ LHES  G R+SRY+ L+  AFG K+GK+ A+FPTMYLSGG+CV
Sbjct  125   LSIIFMWQLYTLWLLIQLHESVPGMRYSRYLRLSMAAFGEKLGKILALFPTMYLSGGTCV  184

Query  1115  MLIINGGGSLQLFYKTMCGGDPKGLTG---AEWFLLFVCIAIFISLFFPNLNSLAWISLL  945
              LI+ GGG++++F++T+CG +   LT     EW+++F   AI ++   PNLNS+A ISL+
Sbjct  185   TLIMIGGGTMKIFFQTICGSNHCHLTSLSTIEWYIVFTVSAIILAQ-LPNLNSIAGISLV  243

Query  944   GSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNI  765
             GS++A+ YCT+ W +SV K R P+ V+++  + + S L+R   I NA+ +I+ AFRGHN+
Sbjct  244   GSISAVTYCTLTWVVSVVKER-PEDVSFETVE-NKSDLERVCSILNAIGMIAFAFRGHNL  301

Query  764   ILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGIL  585
             +LEIQGT+P++ K P    M  GV  SY +IALC FPLAI GYWAYGNLMP     GGIL
Sbjct  302   VLEIQGTMPSSLKNPSHVPMWKGVKFSYSIIALCLFPLAIGGYWAYGNLMP----NGGIL  357

Query  584   NAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWV  405
             +A +K+H  D SK ++G   +++++  L ++QIYA+PV DN E  Y S KK    CP W+
Sbjct  358   SALDKYHGKDTSKVILGITSLLVVVHSLTSFQIYAMPVFDNLEFRYTSNKK--KPCPWWL  415

Query  404   RMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCV  225
             R G +V FG L + +SVA PFL SLAG IG I +P+T AYPC MWI IKKP+ YT  W V
Sbjct  416   RTGFRVFFGCLAFFISVALPFLPSLAGLIGGIALPVTLAYPCLMWIMIKKPQTYTSTWFV  475

Query  224   NMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             N  LG LG+++  +L    +W +   G+  +FF P
Sbjct  476   NWSLGLLGLVLSVLLVFGAIWTIAIQGMDVHFFKP  510



>ref|XP_004500895.1| PREDICTED: lysine histidine transporter-like 8-like [Cicer arietinum]
Length=509

 Score =   449 bits (1156),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 218/459 (47%), Positives = 316/459 (69%), Gaps = 12/459 (3%)
 Frame = -1

Query  1484  IDN--EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWV  1311
             I+N  E       F P D  LPIT  R GN +    H+L+SGIG QAL+LP+AFTSLGW 
Sbjct  59    IENIIEEVGHFTKFDPQDDWLPITACRKGNAYYAAFHVLNSGIGFQALVLPLAFTSLGWT  118

Query  1310  WGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLS  1131
             WGI+CL + F+WQLYT+WLL+ LHES +G R SRY+ LA  AFG K+GKL  +FP  YLS
Sbjct  119   WGILCLCVAFIWQLYTLWLLIQLHESDSGPRHSRYLQLAMEAFGEKLGKLLVLFPVQYLS  178

Query  1130  GGSCVMLIINGGGSLQLFYKTMCGGDPK--GLTGAEWFLLFVCIAIFISLFFPNLNSLAW  957
             GG+CV LI+ GGG++++ ++ MCG       L   EW+L+F   AI ++   PNLNS+A 
Sbjct  179   GGTCVTLIMIGGGTMKILFQIMCGEASSLYQLKTIEWYLVFTVAAILLAQ-LPNLNSIAG  237

Query  956   ISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFR  777
             +SL+G++TA++YC+++W +SV +GR    ++Y+ P +  S+  R   + NAL +I+LAFR
Sbjct  238   VSLIGAITAVSYCSMIWIVSVFQGR-LANISYE-PSMGQSQATRIFSVLNALGIIALAFR  295

Query  776   GHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKK  597
             GHN++LEIQGT+ +++K P R  M  GV  +Y++IA C FP+AI GYWAYGNL+P++   
Sbjct  296   GHNLVLEIQGTICSDSKNPSRLAMWKGVKFAYLVIAFCLFPIAIGGYWAYGNLIPSN---  352

Query  596   GGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSC  417
             GG+L+A  K+H HD SK ++    ++++I  L ++QIYA+P+ DN E  Y S +     C
Sbjct  353   GGMLSALHKYHEHDTSKLIIALTSLLVVINSLSSFQIYAMPIFDNLEFRYTSTRN--RPC  410

Query  416   PKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTL  237
             P+W+R+  + LFG LT  +++A PFL SLAG IG + +P+T AYPCFMWI IKKP+ ++ 
Sbjct  411   PRWLRIVFRGLFGCLTLFIAIALPFLPSLAGLIGGVALPITLAYPCFMWIQIKKPKKHST  470

Query  236   VWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              W +N  LG +GM++  ++ T  +W ++A G+  +FFNP
Sbjct  471   TWYLNWTLGVIGMILSVLVVTGAIWGIVALGIQIHFFNP  509



>ref|XP_006828996.1| hypothetical protein AMTR_s00001p00244480 [Amborella trichopoda]
 gb|ERM96412.1| hypothetical protein AMTR_s00001p00244480 [Amborella trichopoda]
Length=595

 Score =   452 bits (1164),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 226/456 (50%), Positives = 309/456 (68%), Gaps = 15/456 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P+D+ LPITESR+GN +    H L++GIG QAL+LPVAFT LGW WGIIC
Sbjct  150   EDVGHLTKLDPMDAWLPITESRSGNAYYAAFHNLTAGIGFQALVLPVAFTFLGWTWGIIC  209

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LS+ + WQLYT+W+L  LHES  GTR+SRY+ LA  AFG K+G      P MYLS G+C 
Sbjct  210   LSIAYFWQLYTLWILTRLHESVPGTRYSRYIQLAKAAFGKKLGAWLCKIPIMYLSAGTCT  269

Query  1115  MLIINGGGSLQLFYKTMCG----GDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISL  948
              L I GG S++LF++ +CG     DP  LT  EW+L+F C+A+ +S   PNLNS+A +SL
Sbjct  270   ALTIVGGSSMKLFFEIVCGSSCHSDP--LTAVEWYLVFTCLAVVLSQ-LPNLNSIAGVSL  326

Query  947   LGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHN  768
             +G++TA+AYCT++W LSV + RPP GV+YDP +  +     F  I NAL +I+ AFRGHN
Sbjct  327   VGAITAVAYCTLIWVLSVVRPRPP-GVSYDPIRGKSDPATAF-SILNALGIIAFAFRGHN  384

Query  767   IILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGI  588
             ++LEIQ T+P+  K P    M  GV   Y+L+A C FPLAI G+W+YG+L+P     GG+
Sbjct  385   LVLEIQATMPSTLKHPAHVPMWRGVKVGYVLVAACLFPLAIGGFWSYGHLIPA----GGM  440

Query  587   LNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKW  408
             ++A   FH+ DI + L+G   ++++I CL ++QIYA+PV D++E      KK    CP+W
Sbjct  441   VSALYGFHMKDIPRGLLGLTSLLVVINCLSSFQIYAMPVFDDFEHDI--TKKSNRPCPRW  498

Query  407   VRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWC  228
             +R G +  FG + + + VAFPFL SLAG +G +++P+T AYPCFMWI IKKP  Y+  W 
Sbjct  499   LRSGFRAFFGFIAFFIGVAFPFLSSLAGLLGGVSLPITLAYPCFMWIFIKKPEKYSANWN  558

Query  227   VNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +NMGLGCLG++M T++    LW+ I  GL   FF P
Sbjct  559   INMGLGCLGIIMSTLVVIGGLWSTIDSGLKLRFFKP  594



>ref|XP_002528418.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF33960.1| amino acid transporter, putative [Ricinus communis]
Length=493

 Score =   449 bits (1154),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 242/475 (51%), Positives = 320/475 (67%), Gaps = 8/475 (2%)
 Frame = -1

Query  1541  EVRVERIGSWTSTRIAPVDIDNEPAAQVQAFA-PLDSCLPITESRNGNFFSITSHMLSSG  1365
              + V  I +  S R  P   DN       A A P D+ LP+TESRNGN  +   H+LSSG
Sbjct  26    SLHVITIAAGGSMRETPTSTDNNHDNISHAEANPQDAWLPVTESRNGNTCTSIFHLLSSG  85

Query  1364  IGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVA  1185
             IG QALLLPVAF++LGW WGIICLSL F WQLYTIWLL+ LHE   GTR+SRY+ L+ VA
Sbjct  86    IGFQALLLPVAFSTLGWSWGIICLSLAFGWQLYTIWLLLHLHEHVPGTRYSRYLQLSVVA  145

Query  1184  FGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGDPKGLTGAEWFLLFVCI  1005
             FG K+GK+ AIFP MYLSGG+CV+LII G   ++L ++T+   + K L G  WF +F C+
Sbjct  146   FGPKIGKVLAIFPVMYLSGGTCVVLIITGSKIMELLFETIHNSESKSLAGTGWFFVFTCL  205

Query  1004  AIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDR  825
             AI ++   PNLNS+A ISL+ ++TA  Y T++W  +VSK R P G ++ P Q     + R
Sbjct  206   AIILAQ-RPNLNSIAGISLIAAITAFGYYTLIWVSTVSKDR-PTGTSHSPLQAGRFDMAR  263

Query  824   FRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAI  645
               DI  AL +I L+FRGHN+ILEIQGTLP+++K P  + M   V+ SYILIA+C FPL I
Sbjct  264   LSDILIALGIIMLSFRGHNLILEIQGTLPSSSKHPSYKPMWRAVLISYILIAMCLFPLVI  323

Query  644   AGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLD  465
              G+WAYGN +P   KK G ++ F +F+  +  KS+   ++ +++  CL ++QIYA+PV D
Sbjct  324   VGFWAYGNKLP---KKIGSMSMFLQFYSQNALKSIKITLHSLVLANCLSSFQIYAVPVFD  380

Query  464   NWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAY  285
             N E  Y S K     C + +R  L++ FGGL + V+VAFPFL SLA  IG + +PLTF Y
Sbjct  381   NLELRYTSIKN--KRCSRRIRTALRLFFGGLAFFVAVAFPFLPSLAAIIGGMALPLTFVY  438

Query  284   PCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             PCFMWI+IKKP   + +W  N+GLGCLG+++  +L  A +WNL   GLHANFF P
Sbjct  439   PCFMWISIKKPDKVSPMWWFNLGLGCLGLVLSVLLVIAAVWNLATKGLHANFFRP  493



>ref|XP_003612280.1| Lysine/histidine transporter [Medicago truncatula]
 gb|AES95238.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=512

 Score =   449 bits (1155),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 226/475 (48%), Positives = 320/475 (67%), Gaps = 12/475 (3%)
 Frame = -1

Query  1535  RVERIGSWTSTR-IAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIG  1359
             R  R+ S+T  R I P+      A ++    P D+ LPITESRNGN +    H L SGIG
Sbjct  46    RTPRM-SFTPPRFITPLGTPVRNALRLIKLDPQDAWLPITESRNGNKYYAAFHTLCSGIG  104

Query  1358  LQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFG  1179
             +QAL+LPVAFT LGW WGII L++ F+WQLYT+WLLV LHES  G R+SRY+ L  V FG
Sbjct  105   IQALVLPVAFTILGWTWGIISLTIAFIWQLYTLWLLVHLHESKDGVRYSRYLQLCFVTFG  164

Query  1178  GKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCI  1005
              K+GKL A+FP +YLS G+C  LII GG + + FY+ +CG   + K +T  EW+L+F C+
Sbjct  165   EKLGKLLALFPILYLSAGTCTTLIIIGGSTARTFYEVVCGESCNSKPMTTVEWYLVFTCV  224

Query  1004  AIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDR  825
             A+ +S   PNLNS+A ISL+G++TA+ YCT +W  SV++G  P GV Y+P +   S +++
Sbjct  225   AVVLSQ-LPNLNSIAGISLIGAVTAVGYCTSIWMASVAQGTLP-GVNYNPVRGGNS-VEK  281

Query  824   FRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAI  645
                + NA  +I+ AFRGHN+ILEIQ T+P++ K P    M  GV  +Y LIA C FP+AI
Sbjct  282   ILGVFNAFGIIAFAFRGHNLILEIQATMPSSEKHPSHVPMWKGVKIAYTLIAACLFPVAI  341

Query  644   AGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLD  465
              GYWAYG L+P   + GG+L A  KFH HDIS+ ++G     +++ CLC++QIY +P+ D
Sbjct  342   GGYWAYGQLIP---ENGGMLTALYKFHSHDISRFVLGLTSFFVVVNCLCSFQIYGMPIFD  398

Query  464   NWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAY  285
             + E  Y +  KM   CP W+R  +++  G L++ + VA PFL SLAG IG + +P+T AY
Sbjct  399   DMESKYTT--KMNKPCPWWLRSSIRIFSGFLSFFIGVATPFLASLAGLIGGVALPVTLAY  456

Query  284   PCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             PCFMW+ IKKP+ Y+++WC+N  LG  G+ +  +L  A+++ ++  G+  +FF+P
Sbjct  457   PCFMWLEIKKPKKYSVMWCLNWFLGTFGIGLSGILIAASIYVIVRTGVKVSFFDP  511



>emb|CBI37768.3| unnamed protein product [Vitis vinifera]
Length=521

 Score =   449 bits (1154),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 228/465 (49%), Positives = 311/465 (67%), Gaps = 13/465 (3%)
 Frame = -1

Query  1499  IAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGI-GLQALLLPVAFTS  1323
             I P+      A +     P D+ LPITESRNGN +    H LSSGI G+QAL+LPVAFT 
Sbjct  65    ITPLGSPIRKALRFTKLDPQDAWLPITESRNGNIYYAAFHTLSSGIIGIQALVLPVAFTV  124

Query  1322  LGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAFGGKMGKLAAIFP  1146
             LGW WG ICL+  F+WQLYT++LLV LHES  TG RFSRY+ L    FG KMG + AIFP
Sbjct  125   LGWTWGTICLTAAFIWQLYTLYLLVHLHESPETGMRFSRYLQLFNATFGEKMGNIFAIFP  184

Query  1145  TMYLSGGSCVMLIINGGGSLQLFYKTMCGG---DPKGLTGAEWFLLFVCIAIFISLFFPN  975
              MYLSGG+CV LII GG +++ FY T+CGG    P   T AEW+L+F C A+ +S   PN
Sbjct  185   IMYLSGGTCVALIIMGGSTMKQFYLTVCGGAACSPNPPTTAEWYLIFTCAAVVLSQL-PN  243

Query  974   LNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAV  795
             LNS+A +SL+G++TA+ YCT++W +SV++GR   GV+Y+P   S+S++ R  D+ NAL +
Sbjct  244   LNSIAGVSLIGAITAVTYCTMIWVVSVAEGRV-SGVSYNPVS-SSSEIGRIFDVLNALGI  301

Query  794   ISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLM  615
             I+ AFRGHN+ILEIQ T+P++ K P    M  GV  SY +IALC +PL I GYW YG L+
Sbjct  302   IAFAFRGHNLILEIQATMPSDEKHPSHVPMWKGVKVSYTIIALCLYPLTIGGYWTYGQLI  361

Query  614   PTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKK  435
             P+    GG+L A  ++H HD S+ ++G   + +II  +  +QIY +P  D+ E  Y  +K
Sbjct  362   PS---DGGVLAALFQYHGHDTSQVILGLTSLFVIINAVSAFQIYGMPTFDDIESKYTMRK  418

Query  434   KMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKK  255
             K    CPKW+R  ++ LFG   YL++VA PF+  L G +G   +P+T AYPCF+W+  KK
Sbjct  419   KK--PCPKWLRALIRALFGFGCYLMAVALPFVSKLTGLLGGFALPITLAYPCFLWLKTKK  476

Query  254   PRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             P+ Y+  W +N GLG  GM +  ++  A+++ LI  G+H +FFNP
Sbjct  477   PKMYSPSWLINWGLGTSGMGLSVIVIVASIYVLIDTGIHVSFFNP  521



>ref|XP_006364520.1| PREDICTED: lysine histidine transporter-like 8-like [Solanum 
tuberosum]
Length=563

 Score =   450 bits (1157),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 229/477 (48%), Positives = 325/477 (68%), Gaps = 12/477 (3%)
 Frame = -1

Query  1538  VRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIG  1359
             V+  R    T   I P+      A ++    P D+ LPITESRNGN F    H L SGIG
Sbjct  94    VKTPRSRGLTPRFITPLGSPLRKALKMTRLDPQDAWLPITESRNGNAFYAAFHTLCSGIG  153

Query  1358  LQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAF  1182
             +QAL+LPVAFT LGW WGII L++ FVWQLYT++L+V LHE+  TG R+SRY+ LA   F
Sbjct  154   IQALVLPVAFTILGWAWGIIGLTVAFVWQLYTLYLMVHLHENHETGLRYSRYLQLACATF  213

Query  1181  GGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG---DPKGLTGAEWFLLFV  1011
             G K+GKL++ FP  YLS G+C  LII GG + +L Y+T+CG    +PK LT  EW+L+F 
Sbjct  214   GEKLGKLSSAFPLGYLSAGTCCALIIIGGSTAKLLYETLCGATCSNPKPLTVVEWYLVFT  273

Query  1010  CIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKL  831
             C+A+ ++   PNLNS+A ISL+G+LTA+ YCT LWT+SV++GR P  V+Y+P +   S++
Sbjct  274   CVAVVLAQL-PNLNSIAGISLIGALTAVGYCTALWTVSVAEGRLPN-VSYEPVR-KGSQV  330

Query  830   DRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPL  651
             ++  D+ NA  +I+ AFRGHN+ILEIQ T+P++ K P +  M  GV  +Y+LIA+C FPL
Sbjct  331   NKIFDLLNAFGIIAFAFRGHNLILEIQATMPSSEKHPSQVPMWRGVQFAYLLIAMCLFPL  390

Query  650   AIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPV  471
             A+ GYWAYG+L+P +   G +L A   FH  D+S+S++  I + +II  + ++Q+Y +P+
Sbjct  391   AVGGYWAYGHLIPAN---GSVLTALFAFHSQDVSRSVLALISIFVIINAVSSFQLYGMPM  447

Query  470   LDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTF  291
              D+ E  Y ++ K   +CP W+R   + +FG + + ++VA PFLGS  G IG I +P+TF
Sbjct  448   FDDMESAYTTRCKK--ACPWWLRSIFRAIFGFVCFFIAVALPFLGSFTGLIGGIALPITF  505

Query  290   AYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             A+PCFMW+ +KKP+ Y+L W VN GLG LGM +  +L  A L+ +I  G+  +FFNP
Sbjct  506   AHPCFMWLKVKKPKKYSLSWWVNWGLGLLGMALSGILIAAGLYVVIDTGVKISFFNP  562



>gb|KDP47161.1| hypothetical protein JCGZ_00052 [Jatropha curcas]
Length=536

 Score =   448 bits (1153),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 234/494 (47%), Positives = 326/494 (66%), Gaps = 15/494 (3%)
 Frame = -1

Query  1589  DRIEVIKVGRMEDGAV-EVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITES  1413
             DRI+     R    A  ++   RI   T   I P+         +    P D+ LPITES
Sbjct  53    DRIQPASANRTPGTATPKISTPRIR--TPRFITPLGSPLRKVLHLTKLDPEDAWLPITES  110

Query  1412  RNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES  1233
             RNGN +    H L SGIG+QAL+LPVAFT+LGW WGII L+L F+WQLYT+++LV LHES
Sbjct  111   RNGNAYYAAFHCLCSGIGIQALILPVAFTTLGWAWGIIDLTLTFIWQLYTLYILVQLHES  170

Query  1232  T-TGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG  1056
             T  G R+SRY+ LA   FG K+ K  A+FP MYLS G+C  LII GG + +LF++T+CG 
Sbjct  171   TGEGIRYSRYMQLANATFGEKLSKWLAMFPLMYLSAGTCTALIIVGGSTSRLFFQTVCGE  230

Query  1055  --DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGR  882
               + + LT  EW+L+F C A+ +S   PNLNS+A +SL+G++TA+ YCTI+W +SV++GR
Sbjct  231   TCNARTLTTVEWYLVFTCAAVVLSQL-PNLNSIAGVSLIGAITAVGYCTIIWAVSVAEGR  289

Query  881   PPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMC  702
              P GV+YDP + + S ++R  DI NAL +I+ AFRGHN+ILEIQ T+P++ K P R  M 
Sbjct  290   MP-GVSYDPIR-APSDIERLFDILNALGIIAFAFRGHNLILEIQATMPSSEKHPSRVPMW  347

Query  701   TGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYM  522
              GV  +Y LIA+C FPLAI GYWAYG ++P    +GG+L A   FH  D S+ ++G   +
Sbjct  348   KGVKFAYALIAMCLFPLAIGGYWAYGQMIP----EGGMLTALFAFHGTDTSRFILGLTSL  403

Query  521   IIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPF  342
              +II  + ++QIY +P+ D+ E +Y   K+M   C  W+R   + LFG L + ++VA PF
Sbjct  404   FVIINAVSSFQIYGMPMFDDMESLY--TKRMKKPCSWWLRAIFRALFGYLCFFIAVAIPF  461

Query  341   LGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLW  162
             LGS+AG IG I +P+T AYPCFMW+ +KKP+ Y+ +W +N GLG  GM +  +   A ++
Sbjct  462   LGSVAGLIGGIALPVTLAYPCFMWLKMKKPKVYSPMWFLNWGLGIFGMTLSGLQVAAGVY  521

Query  161   NLIADGLHANFFNP  120
              +I  G+ A+FF P
Sbjct  522   VVIKTGIKASFFKP  535



>ref|XP_002282126.1| PREDICTED: lysine histidine transporter-like 8 [Vitis vinifera]
 ref|XP_010646039.1| PREDICTED: lysine histidine transporter-like 8 [Vitis vinifera]
 ref|XP_010646040.1| PREDICTED: lysine histidine transporter-like 8 [Vitis vinifera]
Length=562

 Score =   449 bits (1155),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 228/465 (49%), Positives = 311/465 (67%), Gaps = 13/465 (3%)
 Frame = -1

Query  1499  IAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGI-GLQALLLPVAFTS  1323
             I P+      A +     P D+ LPITESRNGN +    H LSSGI G+QAL+LPVAFT 
Sbjct  106   ITPLGSPIRKALRFTKLDPQDAWLPITESRNGNIYYAAFHTLSSGIIGIQALVLPVAFTV  165

Query  1322  LGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAFGGKMGKLAAIFP  1146
             LGW WG ICL+  F+WQLYT++LLV LHES  TG RFSRY+ L    FG KMG + AIFP
Sbjct  166   LGWTWGTICLTAAFIWQLYTLYLLVHLHESPETGMRFSRYLQLFNATFGEKMGNIFAIFP  225

Query  1145  TMYLSGGSCVMLIINGGGSLQLFYKTMCGG---DPKGLTGAEWFLLFVCIAIFISLFFPN  975
              MYLSGG+CV LII GG +++ FY T+CGG    P   T AEW+L+F C A+ +S   PN
Sbjct  226   IMYLSGGTCVALIIMGGSTMKQFYLTVCGGAACSPNPPTTAEWYLIFTCAAVVLSQL-PN  284

Query  974   LNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAV  795
             LNS+A +SL+G++TA+ YCT++W +SV++GR   GV+Y+P   S+S++ R  D+ NAL +
Sbjct  285   LNSIAGVSLIGAITAVTYCTMIWVVSVAEGRV-SGVSYNPVS-SSSEIGRIFDVLNALGI  342

Query  794   ISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLM  615
             I+ AFRGHN+ILEIQ T+P++ K P    M  GV  SY +IALC +PL I GYW YG L+
Sbjct  343   IAFAFRGHNLILEIQATMPSDEKHPSHVPMWKGVKVSYTIIALCLYPLTIGGYWTYGQLI  402

Query  614   PTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKK  435
             P+    GG+L A  ++H HD S+ ++G   + +II  +  +QIY +P  D+ E  Y  +K
Sbjct  403   PS---DGGVLAALFQYHGHDTSQVILGLTSLFVIINAVSAFQIYGMPTFDDIESKYTMRK  459

Query  434   KMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKK  255
             K    CPKW+R  ++ LFG   YL++VA PF+  L G +G   +P+T AYPCF+W+  KK
Sbjct  460   KK--PCPKWLRALIRALFGFGCYLMAVALPFVSKLTGLLGGFALPITLAYPCFLWLKTKK  517

Query  254   PRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             P+ Y+  W +N GLG  GM +  ++  A+++ LI  G+H +FFNP
Sbjct  518   PKMYSPSWLINWGLGTSGMGLSVIVIVASIYVLIDTGIHVSFFNP  562



>ref|XP_003612282.1| Lysine histidine transporter-like protein [Medicago truncatula]
 gb|AES95240.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=534

 Score =   447 bits (1150),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 228/475 (48%), Positives = 317/475 (67%), Gaps = 12/475 (3%)
 Frame = -1

Query  1535  RVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGL  1356
             R  R+ S T   I P+      A ++    P D+ LPITESRNGN +    H L SGIG+
Sbjct  68    RTPRM-SLTPRFITPLGSPMRKALRLTKLDPQDAWLPITESRNGNKYYAAFHTLCSGIGI  126

Query  1355  QALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFG  1179
             QAL+LPVAFT LGW WGI+ L++ F+WQLYT+WLLV LHES   G R+SRY+ L    FG
Sbjct  127   QALVLPVAFTILGWTWGILSLTIAFIWQLYTLWLLVHLHESVENGIRYSRYLQLCFATFG  186

Query  1178  GKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCI  1005
              K+GKL A+FP +YLS G+C  LII GG + + FY+ +CG   +PK +T  EW+L+F C 
Sbjct  187   EKLGKLLALFPILYLSAGTCTTLIIIGGSTARTFYQVVCGDHCNPKPMTTVEWYLVFTCA  246

Query  1004  AIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDR  825
             A+ +S   PNLNS+A ISL+G++TA+ YCT +W  SV++G  P GV Y+P  +  +K++ 
Sbjct  247   AVVLSQL-PNLNSIAGISLIGAVTAVGYCTSIWITSVAQGTLP-GVNYNP-VMGENKVEN  303

Query  824   FRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAI  645
                + NAL +I+ AFRGHN+ILEIQ T+P++ K P    M  GV ASY LIA C FPLAI
Sbjct  304   AFSVLNALGIIAFAFRGHNLILEIQATMPSSEKHPSHVPMWKGVKASYTLIAACLFPLAI  363

Query  644   AGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLD  465
              GYWAYG L+P +   GG+L A  +FH  D+SK ++G     +++  LC++QIY +P  D
Sbjct  364   GGYWAYGQLIPAN---GGMLTALYQFHSQDVSKFVLGMTSFFVVVNGLCSFQIYGMPAFD  420

Query  464   NWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAY  285
             + E +Y ++ K    CP W+R+  +V FG L + + VA PFL SLAG IG I +P+T AY
Sbjct  421   DMESVYTTRWKK--PCPWWLRVIFRVFFGFLCFFIGVAIPFLSSLAGLIGGIALPVTLAY  478

Query  284   PCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             PCFMW+ +KKP+ Y+ +W +N  LG  G+ +  +L TA+++ +I  G++ +FFNP
Sbjct  479   PCFMWLKVKKPKKYSFMWYLNWFLGTFGVALSVILVTASIYVIIDTGVNVSFFNP  533



>ref|XP_007017969.1| Transmembrane amino acid transporter family protein [Theobroma 
cacao]
 gb|EOY15194.1| Transmembrane amino acid transporter family protein [Theobroma 
cacao]
Length=516

 Score =   446 bits (1148),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 227/481 (47%), Positives = 316/481 (66%), Gaps = 10/481 (2%)
 Frame = -1

Query  1556  EDGAVEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHM  1377
              DG    R ++        ++P+      A Q+    P D+ LPITESRNGN +    H 
Sbjct  43    SDGDAANRTQKSSHQAPNFLSPLGTPLRKAIQLTKLDPQDAWLPITESRNGNAYYAAFHT  102

Query  1376  LSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVH  1200
             L SGIG+QAL+LPVAFT LGW WGII L + F+WQLYT+W+LV LHES  TG R+SRY+ 
Sbjct  103   LCSGIGIQALVLPVAFTILGWTWGIISLIVAFIWQLYTLWILVKLHESAETGMRYSRYLQ  162

Query  1199  LATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG-DPKGLTGAEWF  1023
             L +  FG KMGKL A+FP MYLSGG+CV LII GG +++LF++ +CG    K LT  EW+
Sbjct  163   LFSATFGEKMGKLFALFPIMYLSGGTCVALIIVGGSTMKLFFQIVCGHCSAKPLTTVEWY  222

Query  1022  LLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLS  843
             L+F C A+ +S   PNLNS+A +SL+G++TAI YCT +W +SV++GR   GV+YDP +  
Sbjct  223   LVFTCAAVVLSQL-PNLNSIAGVSLVGAVTAIGYCTTMWMISVTEGRL-DGVSYDPIK-E  279

Query  842   TSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALC  663
                +     + NAL +I+ AFRGHN+ LEIQ T+P++ K P +  M  GV  +Y++IALC
Sbjct  280   EDNMAMIFSVLNALGIIAFAFRGHNLTLEIQATMPSSEKKPSKIPMWRGVKVAYLIIALC  339

Query  662   HFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIY  483
              FPLA+ GYWAYG+ +P +   GG+L A  ++H  D S++ +    + +II  + ++QIY
Sbjct  340   LFPLAVGGYWAYGHKIPAN---GGMLTAIYQYHGRDTSQAALALTSLFVIINAVSSFQIY  396

Query  482   ALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITM  303
              +P+ D+ E  Y  +K     CP W+R   + +FG   + V+VA PFLGSLAG IG I +
Sbjct  397   GMPMFDDMESKYTKRKHK--PCPWWLRAVFRAMFGYGCFFVAVAIPFLGSLAGLIGGIAV  454

Query  302   PLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFN  123
             P+TFAYPCFMW+ IKKP  Y+++W VN GLG  G ++  VL  A ++ +I  G+  +FF 
Sbjct  455   PVTFAYPCFMWLRIKKPEKYSVMWWVNWGLGLSGTVLSVVLIAAGVYVVIDTGIEVSFFK  514

Query  122   P  120
             P
Sbjct  515   P  515



>ref|XP_006652643.1| PREDICTED: lysine histidine transporter-like 8-like [Oryza brachyantha]
Length=511

 Score =   446 bits (1147),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 222/445 (50%), Positives = 301/445 (68%), Gaps = 12/445 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESR+GN +    H LSSGIG QAL+LPVAF+ LGW W  +CL+  F WQLY
Sbjct  72    PRDAWLPITESRSGNAYYAAFHSLSSGIGFQALVLPVAFSFLGWTWATVCLTAAFAWQLY  131

Query  1265  TIWLLVDLHESTTG-TRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGS  1089
             T+WLLV LHE   G  R+SRY+HLAT  FG + GK+ A+ P MYLS G+C  LII GG S
Sbjct  132   TLWLLVKLHEPVAGGIRYSRYMHLATTVFGERWGKILALLPVMYLSAGNCTALIIVGGSS  191

Query  1088  LQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCT  915
             ++L +   CG     + LT  EW+++F+C A+ +S   PNLNS+A +SL+G+  A+AYCT
Sbjct  192   MKLLFNIACGQACLARPLTTVEWYVVFMCAAVLLSQL-PNLNSIAGVSLVGAAAAVAYCT  250

Query  914   ILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPT  735
             ++W +SV+KGR   GV+YDP + +T +++    I N L +I+ AFRGHN++LEIQ T+P+
Sbjct  251   MIWVVSVAKGRV-AGVSYDPVK-ATGEVEGAIGILNGLGIIAFAFRGHNLVLEIQATMPS  308

Query  734   NTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD  555
               K P    M  GV A+Y++IALC +P+AI G+WAYG+ +P +    GIL+A  KFH  D
Sbjct  309   TLKHPSHVPMWKGVKAAYVIIALCLYPIAIGGFWAYGDQIPPN----GILSALYKFHSRD  364

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
             +S+ ++G   +++I+ CL TYQIYA+PV DN E  Y+ KK     CP W+R G +V FG 
Sbjct  365   VSQVVLGVATLLVIVNCLTTYQIYAMPVYDNMETGYVHKKNR--PCPWWLRSGFRVFFGA  422

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             +  L++VA PFL  LAG +G I++P+T AYPCFMW+AI +P   T +W  N  LG LGM 
Sbjct  423   VNLLIAVALPFLSELAGLLGGISLPVTLAYPCFMWVAIMRPAKGTAMWYTNWALGSLGMG  482

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  VL    LW L+  GLH  FF P
Sbjct  483   LSFVLIVGNLWGLVEKGLHVQFFKP  507



>gb|KCW68047.1| hypothetical protein EUGRSUZ_F01730 [Eucalyptus grandis]
Length=493

 Score =   444 bits (1143),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/454 (48%), Positives = 308/454 (68%), Gaps = 27/454 (6%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E   Q     P D  LPITESRNGN +    H LSSGIG+QALLLP+AF+ LGW WGI+C
Sbjct  64    EEVGQFTKLDPHDDWLPITESRNGNVYYAAFHTLSSGIGVQALLLPLAFSVLGWAWGIVC  123

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             LS +FVWQLYT+WLLV LHES  GTR+SRY+ L+  AF                 GG+CV
Sbjct  124   LSAVFVWQLYTLWLLVQLHESEDGTRYSRYLRLSMAAF-----------------GGTCV  166

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GGGS+++ ++ +CGG  D    +  EW+L+F+C AI ++   PNLNS+A +SL+G
Sbjct  167   ALIVIGGGSMKIIFEILCGGTCDIDPPSTVEWYLVFICCAIILAQ-LPNLNSIAGVSLIG  225

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI YCT++W LS++KGR P GV+Y+P + + S+L R   + NA+ +++  FRGHN++
Sbjct  226   AITAIGYCTLIWALSITKGR-PAGVSYEPVK-TGSELARICSVLNAVGIVAFVFRGHNVV  283

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQGT+P++ + P R+ M  G+  +Y++IALC FPLAI GYWAYGN +PT+    GILN
Sbjct  284   LEIQGTMPSSRQKPSRQPMWKGIKFAYVVIALCLFPLAIGGYWAYGNSIPTNE---GILN  340

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A  ++H+ D SK ++    ++++I  L ++QIYA+PV DN E  Y   K     CP+W+R
Sbjct  341   ALYEYHLRDASKVILCLASVLVVINSLSSFQIYAMPVFDNLESRYTYSKH--KPCPRWLR  398

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
               L++ FG L + +S+A PFL SLAG +G I +P+T AYPC MWI IKKP  Y+ +WC+N
Sbjct  399   TALRIFFGCLAFFISIALPFLQSLAGLVGGIALPITLAYPCLMWILIKKPAKYSAMWCIN  458

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG  GM++  ++  A +W+++  G+  +FF P
Sbjct  459   GVLGVSGMVLSVLIVGAAIWSIVTMGVEVHFFKP  492



>gb|KEH36283.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=510

 Score =   445 bits (1144),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 218/460 (47%), Positives = 313/460 (68%), Gaps = 13/460 (3%)
 Frame = -1

Query  1484  IDN--EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWV  1311
             I+N  E       F   D  LPIT  R GN +    H+L SGIG QAL+LP+AFT+LGW 
Sbjct  59    IENILEEVGHFTKFDQQDDWLPITACRKGNAYYAAFHLLCSGIGFQALVLPLAFTTLGWT  118

Query  1310  WGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLS  1131
             WGI+CL + F WQLYT+WLL+ LHES TG R SRY+ LA  AFG K+GK+  +FP  YLS
Sbjct  119   WGILCLCVAFTWQLYTLWLLIQLHESDTGIRHSRYLKLAMAAFGEKLGKILVLFPVQYLS  178

Query  1130  GGSCVMLIINGGGSLQLFYKTMCGGDP---KGLTGAEWFLLFVCIAIFISLFFPNLNSLA  960
             GG+CV LI+ GGG++++ ++ +C         L   EW+L+F   AI ++   PNLNS+A
Sbjct  179   GGTCVTLIMIGGGTMKILFQMVCEDSSCSLYQLKTIEWYLVFTVAAILLAQ-LPNLNSIA  237

Query  959   WISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAF  780
              +SL+G++TA+ YC+++W +SV +GR    V+Y+PP+   S+  R   + NAL +I+ AF
Sbjct  238   GVSLIGAITAVGYCSLIWIVSVYQGR-LDNVSYEPPR-RQSQATRIFSVWNALGIIAFAF  295

Query  779   RGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYK  600
             RGHN++LEIQGT+ +++K P R  M  GV+ +Y++IA C FPLAI GYWAYGNLMP++  
Sbjct  296   RGHNLVLEIQGTIRSDSKNPSRLAMWKGVMFAYLVIASCLFPLAIGGYWAYGNLMPSN--  353

Query  599   KGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMS  420
              GG+L+A +K+H HD SK ++    ++++I  L ++QIYA+P+ DN E  Y SK      
Sbjct  354   -GGMLSALKKYHEHDTSKFIIALTSLLVVINGLSSFQIYAMPIFDNLEFRYTSKWN--KP  410

Query  419   CPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYT  240
             CP+W+R+  + LFG LT+ +S+A PFL SLAG IG + +P+T AYPCFMWI IKKP+ ++
Sbjct  411   CPRWLRIVFRSLFGCLTFFISIALPFLPSLAGLIGGVALPITLAYPCFMWILIKKPKKHS  470

Query  239   LVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               W +N  LG +GM++  ++    +W ++A G+  +FFNP
Sbjct  471   TTWYLNWTLGAVGMILSVLIVIGAIWGIVALGIQIHFFNP  510



>ref|XP_011088674.1| PREDICTED: lysine histidine transporter-like 8 [Sesamum indicum]
Length=547

 Score =   446 bits (1146),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 226/484 (47%), Positives = 323/484 (67%), Gaps = 13/484 (3%)
 Frame = -1

Query  1559  MEDGAVEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSH  1380
             +  G    +  RI   T   I P+      A ++    P D+ LPITESRNGN +    H
Sbjct  72    LTPGGTNRKTPRIIR-TPRFITPLGSPLRKAIKLTKLDPQDAWLPITESRNGNAYYAAYH  130

Query  1379  MLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYV  1203
              L SGIG+QAL+LPVAFT LGW WGII L+L F+WQLYT++LLV LHES   G R+SRY+
Sbjct  131   TLCSGIGIQALVLPVAFTILGWTWGIIGLTLAFIWQLYTLYLLVQLHESPENGVRYSRYM  190

Query  1202  HLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG---DPKGLTGA  1032
              LA+  FG K+ K    FP MYLSGG+CV LI+ GG + ++FY+T+CG    +PK LT  
Sbjct  191   QLASATFGEKLSKFLVAFPIMYLSGGTCVALIVIGGSTSKMFYQTLCGATCSNPKPLTNV  250

Query  1031  EWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPP  852
             EW+L+F C A+ +S   PNLNS+A +SL+G LTA+ YCT +W +SVS+GR P  V+Y+P 
Sbjct  251   EWYLVFTCAAVVLSQL-PNLNSIAGVSLIGGLTAVGYCTAMWIVSVSEGRLPN-VSYNPV  308

Query  851   QLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILI  672
             + ST ++ R  D+ NAL +I+ AFRGHN+ILEIQ T+P++ K P    M  GV  +Y+++
Sbjct  309   RAST-EIARIFDVLNALGIIAFAFRGHNLILEIQATMPSSEKHPSSIPMWRGVKGAYLIV  367

Query  671   ALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTY  492
             A+C FP+AI GYWAYG+++P +   GG+L A   FH  D+++ ++G I   +I+  L ++
Sbjct  368   AMCLFPIAIGGYWAYGHMIPAN---GGMLAALYGFHSRDVARGVIGLISFFVIVNALSSF  424

Query  491   QIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGS  312
             QIY +P+ D+ E  Y   ++   +CP W+R+ ++ +FG   + V+VA PFLGS+AG +G 
Sbjct  425   QIYGMPMFDDMESNY--TRRFKKACPWWLRVIIRAMFGYGCFFVAVAIPFLGSVAGLVGG  482

Query  311   ITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHAN  132
             +++P+T AYPCFMW+ +KKP+ Y   W VN GLG LGM +  +L  A ++ +I  G+  +
Sbjct  483   LSLPVTLAYPCFMWLKMKKPKMYGASWWVNWGLGVLGMGLSGILIAAGIYVVIETGIQVS  542

Query  131   FFNP  120
             FF P
Sbjct  543   FFKP  546



>emb|CAN68028.1| hypothetical protein VITISV_011224 [Vitis vinifera]
Length=560

 Score =   446 bits (1146),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 227/465 (49%), Positives = 309/465 (66%), Gaps = 13/465 (3%)
 Frame = -1

Query  1499  IAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGI-GLQALLLPVAFTS  1323
             I P+      A +     P D+ LPITESRNGN +    H LSSGI G+QAL+LPVAFT 
Sbjct  104   ITPLGSPIRKALRFTKLDPQDAWLPITESRNGNIYYAAFHTLSSGIIGIQALVLPVAFTV  163

Query  1322  LGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAFGGKMGKLAAIFP  1146
             LGW WG ICL+  F+WQLYT++LLV LHES  TG RFSRY+ L    FG KMG + AIFP
Sbjct  164   LGWTWGTICLTAAFIWQLYTLYLLVHLHESPETGMRFSRYLQLFNATFGEKMGNIFAIFP  223

Query  1145  TMYLSGGSCVMLIINGGGSLQLFYKTMCGG---DPKGLTGAEWFLLFVCIAIFISLFFPN  975
              MYLSGG+CV LII GG +++ FY T+CGG    P   T AEW+L+F C A+ +S   PN
Sbjct  224   IMYLSGGTCVALIIMGGSTMKQFYLTVCGGAACSPNPPTTAEWYLIFTCAAVVLSQL-PN  282

Query  974   LNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAV  795
             LNS+A +SL+G++TA+ YCT++W +SV++GR   GV+Y+P   S+S++ R  D+ NAL +
Sbjct  283   LNSIAGVSLIGAITAVTYCTMIWIVSVAEGRX-SGVSYNPVS-SSSEIGRIFDVLNALGI  340

Query  794   ISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLM  615
             I+ AFRGHN+ILEIQ T+P++ K P    M  GV  SY +IALC +PL I GYW YG L+
Sbjct  341   IAFAFRGHNLILEIQATMPSDEKHPSHVPMWKGVKVSYTIIALCLYPLTIGGYWTYGQLI  400

Query  614   PTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKK  435
             P+    GG+L A  ++H  D S+ ++G   + +II     +QIY +P  D+ E  Y  +K
Sbjct  401   PS---DGGVLAALFQYHGQDTSQVILGLTSLFVIINAXSAFQIYGMPTFDDIESKYTMRK  457

Query  434   KMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKK  255
             K    CPKW+R  ++ LFG   YL++VA PF+  L G +G   +P+T AYPCF+W+  KK
Sbjct  458   KK--PCPKWLRALIRALFGFGCYLMAVALPFVSKLTGLLGGFALPITLAYPCFLWLKTKK  515

Query  254   PRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             P+ Y+  W +N GLG  GM +  ++  A+++ LI  G+H +FFNP
Sbjct  516   PKMYSPSWLINWGLGTSGMGLSVIVIVASIYVLIDTGIHVSFFNP  560



>gb|EYU38009.1| hypothetical protein MIMGU_mgv11b003533mg [Erythranthe guttata]
Length=533

 Score =   444 bits (1142),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 226/467 (48%), Positives = 319/467 (68%), Gaps = 11/467 (2%)
 Frame = -1

Query  1511  TSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVA  1332
             T   I P+      A ++    P D+ LPITESRNGN F    H L SGIG+QAL+LPVA
Sbjct  74    TPRFITPLGSPLRKAIKLTRLDPQDAWLPITESRNGNAFYAAYHTLCSGIGIQALILPVA  133

Query  1331  FTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAFGGKMGKLAA  1155
             FT LGW WG+I LSL F+WQLYT++LLV LHES   G R+SRY+ LA+  FG ++ K  A
Sbjct  134   FTILGWTWGLIGLSLAFIWQLYTLYLLVQLHESPENGIRYSRYMQLASATFGERLSKFLA  193

Query  1154  IFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFF  981
              FP MYLSGG+CV LI+ GG + ++F++T+CG     K LT  EW+L+F C A+ +S   
Sbjct  194   AFPIMYLSGGTCVALIVIGGSTSKMFFQTVCGAPCTSKPLTNVEWYLVFTCAAVLLSQL-  252

Query  980   PNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANAL  801
             PNLNS+A +SL+G+LTA+ YCT +W +SVS+GR P  V+Y+P +  T ++ R  D+ NAL
Sbjct  253   PNLNSIAGVSLVGALTAVGYCTAIWAVSVSEGRLPN-VSYNPVRKGT-EIARIFDVLNAL  310

Query  800   AVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGN  621
              +I+ AFRGHN+ILEIQ T+P++ K P    M  GV A+Y+++A+C FPLAI GYWAYG+
Sbjct  311   GIIAFAFRGHNLILEIQATMPSSEKNPSSVPMWRGVKAAYLVVAMCLFPLAIGGYWAYGH  370

Query  620   LMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLS  441
             ++P +   GG+L A   FH  D+S+S++G I + +II  + ++Q+Y +P+ D  E  Y  
Sbjct  371   VIPAN---GGMLTALYAFHSRDVSRSVLGMISIFVIINAVSSFQLYGMPMYDMMESHY--  425

Query  440   KKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAI  261
              +K    CP W+R  ++ +FG   + V+VA PFLGS+AG IG I++P+T AYPCFMW+ +
Sbjct  426   TRKFKKPCPWWLRAVIRAMFGFGCFFVAVAIPFLGSVAGLIGGISLPVTLAYPCFMWLKM  485

Query  260   KKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             KKP+ Y+ +W +N GLG +GM +  +L  A L+ +I  G+  +FF P
Sbjct  486   KKPKIYSPMWWLNWGLGLMGMGLSGILIAAGLYVVIDTGIQVSFFKP  532



>gb|KCW56546.1| hypothetical protein EUGRSUZ_I02282 [Eucalyptus grandis]
Length=945

 Score =   456 bits (1174),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 234/455 (51%), Positives = 321/455 (71%), Gaps = 13/455 (3%)
 Frame = -1

Query  1469  AAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLS  1290
             A ++    P D+ LPITESRNGN +    H L SGIG QAL+LPVAFT LGW WGII L+
Sbjct  498   ALRLTKLDPQDAWLPITESRNGNEYYAAFHTLCSGIGFQALVLPVAFTILGWTWGIIGLT  557

Query  1289  LLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVM  1113
             L F+WQLYT+WLLV LHES  TG R++RY+ L T AFG ++GKL  +FPTMYLSGG+CV 
Sbjct  558   LAFIWQLYTLWLLVQLHESPETGMRYNRYIQLCTAAFGERLGKLLGLFPTMYLSGGTCVA  617

Query  1112  LIINGGGSLQLFYKTMCGGD----PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLL  945
             L++ GG + +LFY+ +CG         LT  EW+L+F C A+ +S   PNLNS+A +SL+
Sbjct  618   LVMIGGSTSRLFYQIVCGTAACAIKTPLTTVEWYLVFTCGAVVLSQL-PNLNSIAGVSLI  676

Query  944   GSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNI  765
             G++TAI YCT +W +SV++GR P GV+YDP + + S+      + NAL +I+ AFRGHN+
Sbjct  677   GAMTAIGYCTSIWAVSVAEGRLP-GVSYDPVK-TGSRFHHVNSVLNALGIIAFAFRGHNL  734

Query  764   ILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGIL  585
             +LEIQ T+P++ K+P    M  GV  SY LIA+C FPLAI GYWAYG+L+PT+   GG+L
Sbjct  735   VLEIQATMPSSEKLPAHVPMWKGVRVSYTLIAICLFPLAIGGYWAYGHLIPTN---GGML  791

Query  584   NAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWV  405
              A  +FH  ++S+S++G I + +II  L ++QIY +P+ DN E  Y S+KK    CP W+
Sbjct  792   TALYQFHYRNVSRSVLGMISLFVIINALSSFQIYGMPIFDNMESKYTSRKKR--PCPWWL  849

Query  404   RMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCV  225
             R  ++ +FG   + V+VA PFLGSLAG IG + +P+T AYPCFMW+ +KKP+ Y+L+W +
Sbjct  850   RSLIRAMFGFGFFFVAVAIPFLGSLAGLIGGVALPVTLAYPCFMWLKMKKPKIYSLMWWL  909

Query  224   NMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             N  LG LGML+  +L  A ++ +I  G+ A+FFNP
Sbjct  910   NWVLGTLGMLLSILLIEAGVYVVIDTGIEASFFNP  944



>ref|XP_008663510.1| PREDICTED: lysine histidine transporter-like 8 [Zea mays]
 gb|AFW59207.1| hypothetical protein ZEAMMB73_254837 [Zea mays]
Length=517

 Score =   442 bits (1138),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 229/460 (50%), Positives = 299/460 (65%), Gaps = 13/460 (3%)
 Frame = -1

Query  1484  IDNEPAAQVQAFA-PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVW  1308
             ++ E    V   A P D+ LP+TESR+GN +    H LSSGIG QAL+LP AF SLGW W
Sbjct  62    LEEEVGGHVTRLADPRDAWLPVTESRSGNAYYAAFHSLSSGIGFQALVLPTAFASLGWTW  121

Query  1307  GIICLSLLFVWQLYTIWLLVDLHESTTG-TRFSRYVHLATVAFGGKMGKLAAIFPTMYLS  1131
              IICL+L F WQLYT+WLLV LHE   G TR+SRY+HLAT  FG +   + A+ P  YLS
Sbjct  122   AIICLTLAFGWQLYTLWLLVRLHEPVAGATRYSRYMHLATTVFGDRWANILALLPVTYLS  181

Query  1130  GGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAW  957
              G C  LII GGGS+++ +   CGG    + LT  EW+L+FVC A+ +S   PNLNS+A 
Sbjct  182   AGICTALIIVGGGSMKMLFGIACGGSCLARPLTAVEWYLVFVCAAVVLSQL-PNLNSIAG  240

Query  956   ISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDP-PQLSTSKLDRFRDIANALAVISLAF  780
             +SL+ +  A+AYCT++W +SV++GR   GV+YDP  +     +D    + N L +I+ AF
Sbjct  241   VSLVAAAAAVAYCTMIWAVSVARGRV-AGVSYDPVHKAPDDDVDAALGVLNGLGIIAFAF  299

Query  779   RGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYK  600
             RGHN++LEIQGT+P+  K P    M  GV  +Y +IALC +P+AI G+WAYGN +P +  
Sbjct  300   RGHNVVLEIQGTMPSTLKHPSHVPMWKGVKVAYAIIALCLYPIAIGGFWAYGNQIPPN--  357

Query  599   KGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMS  420
               GIL+A  KFH  D S+ ++G   +++II CL TYQIYA+PV DN E  Y+ KK     
Sbjct  358   --GILSALYKFHSRDASRLVLGVTTLLVIINCLTTYQIYAMPVYDNMEAGYVHKKNR--P  413

Query  419   CPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYT  240
             CP W+R G +  FG +  LV+VA PFL  LAG  G I++P+T AYPCFMW+AIKKPR  T
Sbjct  414   CPWWMRSGFRAFFGAVNLLVAVALPFLSELAGLFGGISLPVTLAYPCFMWVAIKKPRKGT  473

Query  239   LVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               W VN  LG LGM +  VL    LW L+  G+   FF P
Sbjct  474   ATWNVNWALGILGMSISLVLIVGNLWGLVEKGMRVKFFKP  513



>ref|XP_009341548.1| PREDICTED: lysine histidine transporter-like 8 [Pyrus x bretschneideri]
Length=530

 Score =   443 bits (1139),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 224/469 (48%), Positives = 311/469 (66%), Gaps = 11/469 (2%)
 Frame = -1

Query  1517  SWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLP  1338
             S T   + P+      A  +    P D+ LPITESRNGN +    H L SGIG+Q+L+LP
Sbjct  69    SRTPRFMTPIGSPVRRAFHLTRLDPQDAWLPITESRNGNAYYAAFHTLCSGIGIQSLVLP  128

Query  1337  VAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAFGGKMGKL  1161
             VAF  LGW WG+IC++L F+WQLYT++LLV LHES  TG R+ RY+ L    FG K+ K 
Sbjct  129   VAFPYLGWTWGVICMTLAFIWQLYTLYLLVHLHESPETGIRYCRYIQLCNATFGEKLSKF  188

Query  1160  AAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISL  987
              A+FP +YLSGG+CV LI+ GG + + F++ +CG     K LT AEW+L+F C A+ +S 
Sbjct  189   LALFPILYLSGGTCVALIVLGGATSKSFFQIVCGATCTAKPLTPAEWYLVFTCAAVILSQ  248

Query  986   FFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIAN  807
               PNLNS+A +SL+G++TAI YCTI+W +SV KGRPP  V+YDP + S      F DI N
Sbjct  249   -LPNLNSIAGVSLVGAITAIGYCTIIWVVSVDKGRPPH-VSYDPLK-SNKNFTHFFDILN  305

Query  806   ALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAY  627
             AL +I+ AFRGHN+ILEIQ T+P+N K P R  M  GV  SY LIA+C FPLAI GYWAY
Sbjct  306   ALGMIAFAFRGHNLILEIQATMPSNEKRPSRVPMWRGVQISYTLIAMCLFPLAIGGYWAY  365

Query  626   GNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIY  447
             G ++P    +GG+  A   FH+ D S+ ++G   + ++I  LC++QIY +P+ D  E  Y
Sbjct  366   GQMIP---HQGGMFAALYGFHMRDTSRLVLGLASLFVVINALCSFQIYGMPMFDEMESQY  422

Query  446   LSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWI  267
                ++   + P W+R  ++ ++    Y ++VA PFLGS+AG +G I++P+T AYPCFMW+
Sbjct  423   --TRRFKKAAPWWLRAIMRAMYTYGCYFIAVAIPFLGSIAGLLGGISLPVTLAYPCFMWL  480

Query  266   AIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              IKKP+ Y+L W VN  LG +G+L+  +L  A ++ +I  G+  +FF P
Sbjct  481   KIKKPKKYSLSWWVNWVLGVVGILLSIMLIAAGIYVIIDTGITVSFFKP  529



>ref|XP_009590574.1| PREDICTED: lysine histidine transporter-like 8 [Nicotiana tomentosiformis]
Length=580

 Score =   444 bits (1142),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 240/496 (48%), Positives = 328/496 (66%), Gaps = 14/496 (3%)
 Frame = -1

Query  1589  DRIEVIKVGRMEDGAVE--VRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITE  1416
              R  ++ VG     A     +  R    T   I P+      A ++    P D+ LPITE
Sbjct  92    SRSPLLNVGDHATSAANRASKTPRSRGLTPRFITPLGSPLRKALKMTRLDPQDAWLPITE  151

Query  1415  SRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHE  1236
             SRNGN +    H L SGIG+QAL+LPVAFT LGW WG+I L+  FVWQLYT++L+V LHE
Sbjct  152   SRNGNAYYAAFHTLCSGIGIQALVLPVAFTILGWAWGVISLTAAFVWQLYTLYLMVQLHE  211

Query  1235  S-TTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCG  1059
             +  TG R+SRY+ LA   FG K+GKL A FP  YLS G+C  LII GG + +L Y+T+CG
Sbjct  212   NYETGIRYSRYLQLACATFGDKLGKLCAAFPIGYLSAGTCCALIIIGGSTAKLLYQTLCG  271

Query  1058  G---DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSK  888
                 +PK LT  EW+L+F C+A+ ++   PNLNS+A ISL+G+LTA+ YCT LWT+SV++
Sbjct  272   ATCSNPKPLTTVEWYLVFTCVAVVLAQL-PNLNSIAGISLVGALTAVGYCTALWTVSVAE  330

Query  887   GRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRR  708
             GR P  V+YDP +  T ++ R  D+ NAL +I+ AFRGHN+ILEIQ T+P++ K P R  
Sbjct  331   GRLPN-VSYDPVRKGT-QVARIFDLLNALGIIAFAFRGHNLILEIQATMPSSEKHPSRVP  388

Query  707   MCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAI  528
             M  GV  SY+LIA+C FPLAI GYWAYG+L+P +   G +L A   FH  D+S+S++  I
Sbjct  389   MWRGVQFSYLLIAMCLFPLAIGGYWAYGHLIPAN---GSMLTALFAFHSQDVSRSVLALI  445

Query  527   YMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAF  348
              + +II  + ++QIY +P+ D+ E  Y ++ K   +CP W+R   + +FG + + ++VA 
Sbjct  446   SIFVIINAVSSFQIYGMPMFDDMESAYTTRSKK--ACPWWLRSIFRAIFGFVCFFIAVAI  503

Query  347   PFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATAT  168
             PFLGS AG IG I +P+TFAYPCFMW+ +KKP  Y+L W VN GLG LGM +  +L  A 
Sbjct  504   PFLGSFAGLIGGIALPVTFAYPCFMWLKVKKPHKYSLSWWVNWGLGLLGMGLSGILVAAG  563

Query  167   LWNLIADGLHANFFNP  120
             L+ +I  G+  +FFNP
Sbjct  564   LYVVIDTGVKISFFNP  579



>ref|XP_003635214.1| PREDICTED: lysine histidine transporter-like 8 [Vitis vinifera]
Length=526

 Score =   442 bits (1136),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 235/475 (49%), Positives = 317/475 (67%), Gaps = 12/475 (3%)
 Frame = -1

Query  1535  RVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGL  1356
             R  R+ S T   I P+        ++    P D+ LPITESRNGN +    H L SGIG+
Sbjct  60    RTPRL-SLTPRFITPLGSPMRRVLRLTKLDPQDAWLPITESRNGNAYYAAFHTLCSGIGV  118

Query  1355  QALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFG  1179
             QAL+LPVAFT LGW WGII L+L F+WQLYT+WLLV LHEST TG R+SRY+ L    FG
Sbjct  119   QALVLPVAFTILGWTWGIINLTLAFIWQLYTLWLLVQLHESTETGMRYSRYLQLFNATFG  178

Query  1178  GKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCI  1005
              ++G L A+FP MYLSGG+CV LII GG + + FY+ +CG       LT  EW+L+F C 
Sbjct  179   ERLGNLLALFPIMYLSGGTCVALIIIGGSTSKTFYQIVCGATCTKVPLTTVEWYLVFTCA  238

Query  1004  AIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDR  825
             A+ +S   PNLNS+A +SL+G++TAI YCT +W +SV++GR P GV+Y+P +  T  ++ 
Sbjct  239   AVLLSQL-PNLNSIAGVSLIGAVTAIGYCTSIWVVSVAEGRLP-GVSYNPVKEGT-DIEH  295

Query  824   FRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAI  645
                + NAL +I+ AFRGHN+ILEIQ T+P++ K P R  M  GV  SY +IAL  FPLAI
Sbjct  296   IFSVLNALGIIAFAFRGHNLILEIQATMPSSEKHPSRVPMWKGVKFSYTIIALGLFPLAI  355

Query  644   AGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLD  465
              GYWAYG+L+P++   GGIL A   FH  D+S+ ++G   + II+  + ++QIY +P+ D
Sbjct  356   GGYWAYGHLIPSN---GGILTALYVFHSQDVSQFVLGLTSLFIIVNAVSSFQIYGMPMFD  412

Query  464   NWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAY  285
               E  Y ++  M   CP W+R   + +FG   + V+VA PFLGSLAG IG I +P+T AY
Sbjct  413   FMESKYTTR--MKKPCPWWLRSLFRAMFGYGCFFVAVAIPFLGSLAGLIGGIALPVTLAY  470

Query  284   PCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             PCFMW+ IKKP+ Y+  W +N GLG LGM + +VL  A ++ +I  G+ A FF+P
Sbjct  471   PCFMWLKIKKPKTYSPTWWLNWGLGVLGMGLSSVLIAAGIYVVIDTGIEAKFFHP  525



>ref|XP_010266965.1| PREDICTED: lysine histidine transporter-like 8 [Nelumbo nucifera]
Length=518

 Score =   442 bits (1136),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 232/492 (47%), Positives = 329/492 (67%), Gaps = 14/492 (3%)
 Frame = -1

Query  1589  DRIEVIKVGRMEDGAVEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESR  1410
              R  ++ V   E  +   R+    S T   I P+      A  +    P D+ LPITESR
Sbjct  38    SRSPLLSVETTEHKSKTPRL----SLTPRFITPLGSPIRKALHLTKLDPQDAWLPITESR  93

Query  1409  NGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST  1230
             NGN +    H L+SGIG+QAL+LPVAFT LGW WG+I L+  F+WQLYT+W+LV LHES 
Sbjct  94    NGNAYYAAFHALTSGIGIQALILPVAFTVLGWSWGVITLTSAFIWQLYTLWILVQLHESE  153

Query  1229  TGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--  1056
             +GTR+SRY+ L    FG ++GKL A+FP MYLSGG+CV LII GG +++LF++ +CG   
Sbjct  154   SGTRYSRYLQLFNATFGERLGKLLAVFPIMYLSGGTCVALIIIGGSTMKLFFQIVCGATC  213

Query  1055  DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPP  876
               K LT  EW+L+F C A+ +S   PNLNS+A +SL+G++TA+ YCT++W +SV++GR P
Sbjct  214   HAKPLTNVEWYLVFTCAAVLLSQ-LPNLNSIAGVSLIGAITAVGYCTLIWVVSVTEGRMP  272

Query  875   QGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTG  696
               V+YDP + + S++ R   I NAL +I+ AFRGHN+ILEIQ T+P++ K P R  M  G
Sbjct  273   D-VSYDPVK-AKSEIARIFGIFNALGIIAFAFRGHNLILEIQATMPSSEKHPSRVPMWRG  330

Query  695   VIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMII  516
             V A+Y LIA+C FPLAI GYWAYG+ +P     GG+L A   FH  D S++++G   +++
Sbjct  331   VKAAYALIAICLFPLAIGGYWAYGHKIP---PNGGMLTALYAFHGRDTSRAVLGLTSLLV  387

Query  515   IIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLG  336
             +I  + ++QIY +P+ D+ E  Y S+ K  +  P W+R   + +FG   + ++VA PFLG
Sbjct  388   VINAVSSFQIYGMPMFDHMESQYTSRMKKPL--PWWLRAVSRAMFGYGCFFIAVAIPFLG  445

Query  335   SLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNL  156
             SLAG IG + +P+T AYPCFMW+ IKKP  ++ +WC+N GLG LGM +  +L  A +W++
Sbjct  446   SLAGLIGGLALPVTLAYPCFMWVVIKKPMRFSKMWCLNWGLGLLGMGLSGLLVAAGVWSV  505

Query  155   IADGLHANFFNP  120
             I  G+  +FF P
Sbjct  506   IDTGIKVSFFKP  517



>emb|CDP14523.1| unnamed protein product [Coffea canephora]
Length=582

 Score =   443 bits (1139),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 219/461 (48%), Positives = 316/461 (69%), Gaps = 9/461 (2%)
 Frame = -1

Query  1499  IAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSL  1320
             I P+      A ++    P D+ LPITESRNGN +    H L SGIG+QAL+LPVAFT L
Sbjct  129   ITPLGSPLRKALRLTKLDPHDAWLPITESRNGNAYYAAFHTLCSGIGIQALVLPVAFTVL  188

Query  1319  GWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAFGGKMGKLAAIFPT  1143
             GW WG+ICL+L F+WQLYT++LLV LHE+  TG R+SRY+ LA+  FG K+ KL A FP 
Sbjct  189   GWAWGVICLTLAFIWQLYTLYLLVQLHENYETGIRYSRYMQLASATFGNKLSKLLATFPI  248

Query  1142  MYLSGGSCVMLIINGGGSLQLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSL  963
             +YLSGG+CV LI+ GG + ++ Y+T+CG   + LT  EW+L+F C A+ +S   PNLNS+
Sbjct  249   LYLSGGTCVALIVVGGSTCKMLYQTLCGCADQPLTTVEWYLVFTCGAVVLSQ-LPNLNSI  307

Query  962   AWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLA  783
             A +SL+G++TA+ YCT++W +SVSKGR P  V+Y P + + S + R  ++ NAL +I+ A
Sbjct  308   AGVSLIGAITAVGYCTLMWVVSVSKGRLPN-VSYAPVK-ANSDVARVFELLNALGIIAFA  365

Query  782   FRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSY  603
             FRGHN++LEIQ T+P++ K P R  M  GV  +Y+++A+C FPLAIAGYWAYG  +P + 
Sbjct  366   FRGHNLVLEIQATMPSSEKHPSRVPMWRGVKVAYVIVAMCLFPLAIAGYWAYGRAIPAN-  424

Query  602   KKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMM  423
               GG+L A   FH  D+++S++G +   +I+  L ++QIY +P+ D+ E  Y  + K   
Sbjct  425   --GGMLAAIYAFHSQDVARSVLGLMSFFVIVNALSSFQIYGMPMFDDMESQYTQRFK--K  480

Query  422   SCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPY  243
              CP W+R  ++ +FG   + V+VA PFL S+AG IG+I++P+T A+PCFMW+  KKP+ Y
Sbjct  481   PCPWWLRGIIRAMFGYGVFFVAVAIPFLSSMAGLIGAISLPVTLAHPCFMWLKFKKPKKY  540

Query  242   TLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               +W +N  LG  GM +  VL+ A ++ +I  G+  +FF P
Sbjct  541   GPIWWLNWTLGLAGMALSAVLSAAGVYVIIDTGIKLSFFKP  581



>ref|XP_002284826.2| PREDICTED: lysine histidine transporter-like 8 [Vitis vinifera]
Length=526

 Score =   441 bits (1134),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 226/478 (47%), Positives = 319/478 (67%), Gaps = 12/478 (3%)
 Frame = -1

Query  1541  EVRVERIGSWTSTRI-APVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSG  1365
             +V   R G+ + T    P+      A Q+  F P D+ LPITESRNGN F    H L SG
Sbjct  57    DVTTRRGGTHSLTPFFTPLGSPIRRAIQMTKFDPQDAWLPITESRNGNAFYAAFHTLCSG  116

Query  1364  IGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATV  1188
             IG+QAL+LPV+FT LGW WG+ICL++ FVWQ+YT+WLLV LH+S  TG R+SRY+H+   
Sbjct  117   IGIQALVLPVSFTILGWTWGVICLTIAFVWQMYTLWLLVKLHDSPETGVRYSRYLHICQA  176

Query  1187  AFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLF  1014
              FG K+GKL A+FP MYLSGG+CV LII GG +L+LF++ +CG   + K LT  EW+L+F
Sbjct  177   TFGNKLGKLMALFPIMYLSGGTCVALIIVGGSTLKLFFQIICGHGCNAKPLTTLEWYLVF  236

Query  1013  VCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSK  834
              C A+ +S   PNLNS+A +SL+G+ TAIAYCTI+W ++V++GR  +GV+YDP +     
Sbjct  237   TCAAVLLSQ-LPNLNSIAGVSLIGAATAIAYCTIMWLVAVTEGR-LEGVSYDPVR-PVEN  293

Query  833   LDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFP  654
             +     + NAL +I+ AFRGHN+ILEIQ T+P++ K      M  GV  +Y++IALC FP
Sbjct  294   VALIFGVLNALGIIAFAFRGHNLILEIQATMPSSEKRTTYVPMWRGVKVAYLIIALCLFP  353

Query  653   LAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALP  474
             LAI GYWAYG  +P   + GG+L A   +H  D S+ ++    +++II  + ++QIY +P
Sbjct  354   LAIGGYWAYGQKIP---ENGGMLTAIYLYHGRDTSQFVLALTSLLVIINSVSSFQIYGMP  410

Query  473   VLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLT  294
             + D+ E  Y  +K     CP W+R   + +FG   + V+VA PFLGS AG  G + +P+T
Sbjct  411   MFDDMESKYTKRKN--KPCPWWLRALFRTMFGYGCFFVAVAMPFLGSFAGLTGGVAVPVT  468

Query  293   FAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             FAYPCF+W+ IKKP+ Y+++W +N  LG  GM++  VL  A ++ +I  G+  +FF P
Sbjct  469   FAYPCFLWLKIKKPKKYSMMWVLNWVLGASGMVLSVVLIAAGVYVVIDTGIKVSFFKP  526



>ref|XP_009758919.1| PREDICTED: lysine histidine transporter-like 8 [Nicotiana sylvestris]
Length=574

 Score =   442 bits (1136),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 239/494 (48%), Positives = 327/494 (66%), Gaps = 13/494 (3%)
 Frame = -1

Query  1589  DRIEVIKVGRMEDGAVEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESR  1410
              R  ++ VG         +  R    T   I P+      A ++    P D+ LPITESR
Sbjct  89    SRSPLLNVGDHAANRTS-KTPRSRGLTPRFITPLGSPLRKALKMTRLDPQDAWLPITESR  147

Query  1409  NGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-  1233
             NGN +    H L SGIG+QAL+LPVAFT LGW WGII L++ FVWQLYT++L+V LHE+ 
Sbjct  148   NGNAYYAAFHTLCSGIGIQALVLPVAFTILGWAWGIISLTVAFVWQLYTLYLMVQLHENY  207

Query  1232  TTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG-  1056
              TG R+SRY+ LA   FG  +GKL A FP  YLS G+C  LII GG + +L Y+T+CG  
Sbjct  208   ETGIRYSRYLQLACATFGDNLGKLCAAFPIGYLSAGTCCALIIIGGSTAKLLYQTLCGAT  267

Query  1055  --DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGR  882
               +PK LT  EW+L+F C+A+ ++   PNLNS+A ISL+G+LTA+ YCT LWT+SV++GR
Sbjct  268   CSNPKPLTTVEWYLVFTCVAVVLAQL-PNLNSIAGISLVGALTAVGYCTALWTVSVAEGR  326

Query  881   PPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMC  702
              P  V+YDP +  T ++ R  D+ NAL +I+ AFRGHN+ILEIQ T+P++ K P R  M 
Sbjct  327   LPN-VSYDPVRKGT-QVARIFDLLNALGIIAFAFRGHNLILEIQATMPSSEKHPSRVPMW  384

Query  701   TGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYM  522
              GV  SY+LIA+C FPLAI GYWAYG+L+P +   G +L A   FH  D+S+S++  I +
Sbjct  385   RGVQFSYLLIAMCLFPLAICGYWAYGHLIPAN---GSMLTALFAFHSQDVSRSVLALISI  441

Query  521   IIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPF  342
              +II  + ++QIY +P+ D+ E  Y ++ K   +CP W+R   + +FG + + ++VA PF
Sbjct  442   FVIINAVSSFQIYGMPMFDDMESAYTTRSKK--ACPWWLRSIFRAIFGFVCFFIAVAIPF  499

Query  341   LGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLW  162
             LGS AG IG I +P+TFAYPCFMW+ +KKP  Y+L W VN GLG LGM +  +L  A L+
Sbjct  500   LGSFAGLIGGIALPVTFAYPCFMWLKVKKPHKYSLSWWVNWGLGLLGMGLSGILVAAGLY  559

Query  161   NLIADGLHANFFNP  120
              +I  G+  +FFNP
Sbjct  560   VVIDTGVKISFFNP  573



>ref|XP_004292279.1| PREDICTED: lysine histidine transporter-like 8-like [Fragaria 
vesca subsp. vesca]
Length=463

 Score =   437 bits (1124),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 220/447 (49%), Positives = 314/447 (70%), Gaps = 11/447 (2%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LP+TESR G  +S T H+L SG+G+QALLLPVAF +LGW WGIICLS++  W+ Y
Sbjct  23    PQDAWLPLTESRKGTIYSTTFHLLCSGLGIQALLLPVAFATLGWAWGIICLSIVCSWKFY  82

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T+ LLV LHES +G R+SRYVHLA  AFG K+G L A+FP MYLSGG+CV LII GGG +
Sbjct  83    TMSLLVRLHESDSGIRYSRYVHLAVTAFGPKLGMLLALFPAMYLSGGACVQLIIIGGGII  142

Query  1085  QLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYC  918
             +L  +T+C      DP  + G   F +F+ +AI ++ +FPNLNS+A +S++G++TAI YC
Sbjct  143   KLLVRTVCKDGATCDPNSMHGILCFFVFMFMAICVAEYFPNLNSVAGVSVIGTITAIVYC  202

Query  917   TILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLP  738
             T++W LS+ KGR    V+Y+PP +  S ++ F  + N++ +I LAFRG N+ILEIQGTLP
Sbjct  203   TMIWALSIGKGR-LNDVSYEPPAMD-STMESFSSVLNSVGIIFLAFRGQNVILEIQGTLP  260

Query  737   TNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIH  558
             +N + P  +R  +GV  S+++IALC F LA+ GY AYGN +P  +    ++ A  +FH  
Sbjct  261   SNPRHPSCKRAWSGVTISHVVIALCLFSLALGGYRAYGNKVP--FANTEVVKAVSQFHAQ  318

Query  557   DISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFG  378
              IS+ ++  + ++++I CL T+QIY + V DN+E  Y  +KK    CP+W+R+ L++  G
Sbjct  319   KISQFVLELLCILVLINCLTTFQIYGMVVFDNFEMKYTIRKK--QPCPRWLRIVLRLFVG  376

Query  377   GLTYLVSVAFPFLGSLAGFIGSIT-MPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLG  201
             G  + ++VA PFLG L+  +G++T +PLT+ YPCFMW +IKKP+P  ++WC NMGLGCLG
Sbjct  377   GFAFFLAVALPFLGRLSPLLGAVTSVPLTYVYPCFMWNSIKKPKPKGVIWCTNMGLGCLG  436

Query  200   MLMCTVLATATLWNLIADGLHANFFNP  120
             +++  +   A  W+L   GL ANFF P
Sbjct  437   VVLSVLFVVAAAWDLADKGLVANFFKP  463



>ref|XP_002528416.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF33958.1| amino acid transporter, putative [Ricinus communis]
Length=530

 Score =   439 bits (1130),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 232/500 (46%), Positives = 320/500 (64%), Gaps = 20/500 (4%)
 Frame = -1

Query  1586  RIEVIKVGRMEDGAVEVRVERIGS--------WTSTRIAPVDIDNEPAAQVQAFAPLDSC  1431
             R  ++  G     A   R  RI +         T   I P+      A  +    P D+ 
Sbjct  39    RSPLLSTGDHIQPASANRTPRISTPRISTPRIRTPRFITPLGSPIRRALHLTRLDPQDAW  98

Query  1430  LPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLL  1251
             LPITESRNGN +    H L SGIG+QAL+LPVAFT LGW WGII L+L F+WQLYT++LL
Sbjct  99    LPITESRNGNAYYAAFHCLCSGIGVQALILPVAFTMLGWAWGIIFLTLTFIWQLYTLYLL  158

Query  1250  VDLHESTT-GTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFY  1074
             V LHEST  G RFSRY+ LA   FG K+ K  A+FP MYLS G+C+ LII GG + +LF+
Sbjct  159   VQLHESTEHGIRFSRYMQLANATFGEKLSKWLALFPIMYLSAGTCITLIIIGGSTSRLFF  218

Query  1073  KTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTL  900
             +T+CG     K LT  EW+L+F C A+ +S   PNLNS+A +SL+G++TA+ YCT++W +
Sbjct  219   QTVCGATCSVKTLTTVEWYLVFTCAALVLSQ-LPNLNSIAGVSLIGAITAVGYCTLIWAV  277

Query  899   SVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVP  720
             SV++GR P GV+Y+P + S S ++R  D+ NAL +I+ AFRGHN+ILEIQ T+P++ K P
Sbjct  278   SVAEGRMP-GVSYNPVRAS-SDVERLFDVLNALGIIAFAFRGHNLILEIQATMPSSEKHP  335

Query  719   LRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSL  540
                 M  GV  +Y +IA+C FPLAI GYWAYG ++P     GG+L A   FH  D S+ +
Sbjct  336   STVPMWKGVKVAYAVIAMCLFPLAIGGYWAYGQMIP----NGGMLTALFAFHGRDTSRFI  391

Query  539   MGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLV  360
             +G   + +II  L ++QIY +P+ D+ E +Y  +KK    CP W+R   + +FG L + V
Sbjct  392   LGLTSLFVIINALSSFQIYGMPMFDDLESLYTRRKK--KPCPWWLRAIFRTIFGFLCFFV  449

Query  359   SVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVL  180
             +VA PFLGS+AG IG + +P+T AYPCFMW+ +KKP+ Y  +W +N GLG  GM +    
Sbjct  450   AVAIPFLGSVAGLIGGLALPVTLAYPCFMWLKMKKPKKYGPMWYLNWGLGIFGMALSVAQ  509

Query  179   ATATLWNLIADGLHANFFNP  120
                 ++ +I+ G   +FF P
Sbjct  510   VAGGIYVVISTGTKLSFFKP  529



>ref|XP_009351172.1| PREDICTED: lysine histidine transporter-like 8 [Pyrus x bretschneideri]
Length=530

 Score =   439 bits (1129),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 223/469 (48%), Positives = 311/469 (66%), Gaps = 11/469 (2%)
 Frame = -1

Query  1517  SWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLP  1338
             S T   + P+      A  +    P D+ LPITESRNGN +    H L SGIG+Q+L+LP
Sbjct  69    SRTPRFMTPIGSPVRRAFHLTRLDPQDAWLPITESRNGNAYYAAFHTLCSGIGIQSLVLP  128

Query  1337  VAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAFGGKMGKL  1161
             VAF  LGW WG+IC++L F+WQLYT++LLV LHES  TG R+ RY+ L    FG K+ K 
Sbjct  129   VAFPYLGWTWGVICMTLAFIWQLYTLYLLVQLHESPETGIRYCRYIQLCNATFGEKLSKF  188

Query  1160  AAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISL  987
              A+FP +YLSGG+CV LI+ GG + + F++ +CG     K LT AEW+L+F C A+ +S 
Sbjct  189   LALFPILYLSGGTCVALIVLGGATSKSFFQIVCGATCTAKPLTPAEWYLVFTCAAVILSQ  248

Query  986   FFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIAN  807
               PNLNS+A +SL+G++TAI YCTI+W +SV KGR P  V+YDP + S      F DI N
Sbjct  249   -LPNLNSIAGVSLVGAITAIGYCTIIWVVSVDKGRLPH-VSYDPLK-SNKNFIHFFDILN  305

Query  806   ALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAY  627
             AL +I+ AFRGHN+ILEIQ T+P+N K P R  M  GV  SY LIA+C FPLAI GYWAY
Sbjct  306   ALGMIAFAFRGHNLILEIQATMPSNEKHPSRVPMWRGVQISYTLIAMCLFPLAIGGYWAY  365

Query  626   GNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIY  447
             G ++P   ++GG+  A   FH+ D S+ ++G   + ++I  LC++QIY +P+ D  E  Y
Sbjct  366   GQMIP---RQGGMFAALYGFHMRDTSRLVLGLASLFVVINALCSFQIYGMPMFDEMESQY  422

Query  446   LSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWI  267
                ++   + P W+R  ++ ++    Y ++VA PFLGS+AG +G I++P+T AYPCFMW+
Sbjct  423   --TRRFKKAAPWWLRAIMRAMYTYGCYFIAVAIPFLGSIAGLLGGISLPVTLAYPCFMWL  480

Query  266   AIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              IKKP+ Y+L W VN  LG +G+L+  +L  A ++ +I  G+  +FF P
Sbjct  481   KIKKPKKYSLSWWVNWVLGTVGILLSILLIAAGVYVIIDTGITVSFFKP  529



>dbj|BAJ98238.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score =   438 bits (1126),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 225/445 (51%), Positives = 307/445 (69%), Gaps = 12/445 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPIT SR+GN +    H LSSG+G QAL+LP AF SLGW W I+CL++ FVWQLY
Sbjct  67    PRDAWLPITASRSGNAYYAAFHNLSSGVGFQALVLPAAFASLGWTWAIVCLTVAFVWQLY  126

Query  1265  TIWLLVDLHESTTG-TRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGS  1089
             T+ LLV+LHE   G TR+SRY+HLAT  FG + GK+ A+ PTMYLS G+C  LII GGGS
Sbjct  127   TLRLLVNLHEPVAGGTRYSRYMHLATTVFGERWGKILALLPTMYLSAGTCTALIIVGGGS  186

Query  1088  LQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCT  915
             +++ +   CG     +  T  EW+++FVC+A+ +S   PNLNS+A +SL+G+  A+ YCT
Sbjct  187   MKILFSIACGPACLARPPTMVEWYVVFVCVAVVLSQL-PNLNSIAGVSLVGATAAVGYCT  245

Query  914   ILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPT  735
             ++W +SV+KGR   GV+YDP + S S +DR   I N L +I+ AFRGHN++LEIQGT+P+
Sbjct  246   MIWVISVAKGRV-AGVSYDPVKPS-SDVDRTIAILNGLGIIAFAFRGHNLVLEIQGTMPS  303

Query  734   NTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD  555
               K P    M  GV  +Y+++ALC +P+A+ G+WAYGN +P +    G+L+A  KFH  D
Sbjct  304   TLKHPSHVPMWKGVKFAYVVVALCLYPVAVGGFWAYGNQIPPN----GMLSALYKFHSRD  359

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
             +S+ ++G   +++I+ CL TYQIYA+PV DN E  Y+ KK     CP W+R G +  FG 
Sbjct  360   VSRLVVGLATLLVIVNCLTTYQIYAMPVFDNMEAGYVHKKNR--PCPWWLRAGFRAFFGA  417

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             +  L++VA PFL  LAG +G I++P+T AYPCFMW+AI KP   T +WC+N  LG LGM 
Sbjct  418   VNLLIAVALPFLSELAGLLGGISLPVTLAYPCFMWLAIMKPGRGTAMWCLNWALGSLGMG  477

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  VL    LW L+A GLH +FF P
Sbjct  478   LSFVLIVGNLWGLVATGLHVHFFKP  502



>ref|XP_008392470.1| PREDICTED: lysine histidine transporter-like 8 [Malus domestica]
Length=524

 Score =   438 bits (1127),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 223/469 (48%), Positives = 311/469 (66%), Gaps = 11/469 (2%)
 Frame = -1

Query  1517  SWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLP  1338
             S T   + P+      A  +    P D+ LPITESRNGN +    H L SGIG+Q+L+LP
Sbjct  63    SRTPRFMTPIGSPVRRAFHLTRLDPQDAWLPITESRNGNAYYAAFHTLCSGIGIQSLVLP  122

Query  1337  VAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAFGGKMGKL  1161
             VAF  LGW WG+IC++L F+WQLYT++LLV LHES  TG R+ RY+ L    FG K+ K 
Sbjct  123   VAFPYLGWTWGVICMTLAFIWQLYTLYLLVQLHESPETGIRYCRYIQLCNATFGEKLSKF  182

Query  1160  AAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISL  987
              A+FP +YLSGG+CV LI+ GG + + F++ +CG     + LT AEW+L+F C A+ +S 
Sbjct  183   LALFPILYLSGGTCVALIVLGGATSKSFFQIVCGATCTARPLTPAEWYLVFTCAAVILSQ  242

Query  986   FFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIAN  807
               PNLNS+A +SL+G++TAI YCTI+W +SV KGR P  V+YDP + S   L  F DI N
Sbjct  243   -LPNLNSIAGVSLVGAITAIGYCTIIWVVSVDKGRLPH-VSYDPLK-SNKNLIHFFDILN  299

Query  806   ALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAY  627
             AL +I+ AFRGHN+ILEIQ T+P+N K P R  M  GV  SY LIA+C FPLAI GYWAY
Sbjct  300   ALGMIAFAFRGHNLILEIQATMPSNEKHPSRVPMWRGVQISYTLIAMCLFPLAIGGYWAY  359

Query  626   GNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIY  447
             G ++P    +GG+  A   FH+ D S+ ++G   + ++I  LC++QIY +P+ D  E  Y
Sbjct  360   GQMIP---HQGGMFAALYGFHMRDTSRLVLGLASLFVVINALCSFQIYGMPMFDEMESQY  416

Query  446   LSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWI  267
                ++   + P W+R  ++ ++    Y ++VA PFLGS+AG +G I++P+T AYPCFMW+
Sbjct  417   --TRRFKKAAPWWLRAIMRAMYAYGCYFLAVAVPFLGSIAGLLGGISLPVTLAYPCFMWL  474

Query  266   AIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              IKKP+ Y+L W VN  LG +G+L+  +L  A ++ +I  G+  +FF P
Sbjct  475   KIKKPKKYSLSWWVNWVLGTVGILLSILLIAAGVYVIIDTGITVSFFKP  523



>ref|XP_006342108.1| PREDICTED: lysine histidine transporter-like 8-like [Solanum 
tuberosum]
Length=509

 Score =   437 bits (1125),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 229/441 (52%), Positives = 309/441 (70%), Gaps = 11/441 (2%)
 Frame = -1

Query  1439  DSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTI  1260
             D+ LPITESR+GN +    H L SGIG+QALLLP+AF +LGW+WGII LSL+F+WQLYT+
Sbjct  76    DAWLPITESRSGNAYYAAFHTLCSGIGVQALLLPLAFITLGWIWGIISLSLVFMWQLYTL  135

Query  1259  WLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQL  1080
             WLL+ LHE   G R SRY+ L+  AFG K+GK+ A+FPTMYLSGG+CV LI+ GG ++++
Sbjct  136   WLLIQLHEFAPGMRNSRYLGLSMAAFGEKLGKILALFPTMYLSGGTCVTLIMIGGSTMKI  195

Query  1079  FYKTMCGGDPK--GLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             F++T+C  D     L+  EW+++F   AI ++   PNLNS+A ISL+GS++A+ YCT+ W
Sbjct  196   FFQTVCASDSHITTLSTIEWYIVFTVSAIVLAQ-LPNLNSIAGISLVGSISAVTYCTLTW  254

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTK  726
              +SV K R P+GV+++  + +TS +     I NAL +I  AFRGHN++LEIQGT+P++ K
Sbjct  255   VISVVKER-PEGVSFEHVE-NTSDVATICAIFNALGMIVFAFRGHNLVLEIQGTMPSSLK  312

Query  725   VPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISK  546
              P    M  GV  SY +IALC FPLAI GYWAYGNLMP     GGIL+A +K+H  D SK
Sbjct  313   NPSHVPMWKGVKFSYSIIALCLFPLAIGGYWAYGNLMP----NGGILSALDKYHGEDTSK  368

Query  545   SLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTY  366
              ++G   +++ I CL ++QIYA+PV DNWE  Y +KKK    CP W+R GL+V FG LT+
Sbjct  369   VILGTTSLLVAIHCLTSFQIYAMPVFDNWECKYTTKKK--KPCPWWLRTGLRVFFGCLTF  426

Query  365   LVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCT  186
              +SVA PFL SLAG IG I + +T AYPC MWI IKKP  Y+  W +N  LG LG+++  
Sbjct  427   FISVALPFLPSLAGLIGGIALTVTLAYPCLMWIMIKKPNRYSPSWFINWSLGLLGLVLSV  486

Query  185   VLATATLWNLIADGLHANFFN  123
             +L    +W +   G+  +FF 
Sbjct  487   LLVFGAIWTIATQGMDVHFFK  507



>ref|XP_008221159.1| PREDICTED: lysine histidine transporter-like 8 [Prunus mume]
Length=589

 Score =   440 bits (1132),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 220/457 (48%), Positives = 315/457 (69%), Gaps = 15/457 (3%)
 Frame = -1

Query  1469  AAQVQAFAPL----DSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGI  1302
             A Q+  F P     D+ LPITESRNGN +    H L SGIG+ AL+LPV+FT LGW WG+
Sbjct  140   AIQLTKFDPRSQDHDAWLPITESRNGNAYYAAFHTLCSGIGIPALVLPVSFTILGWTWGV  199

Query  1301  ICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGG  1125
             I L+L F+WQLYT+WLLV LHEST TG R+SRY+ L +  FG KM K+ A+FP  YLSGG
Sbjct  200   ISLTLAFIWQLYTLWLLVKLHESTKTGMRYSRYLQLFSATFGDKMAKIFAVFPIYYLSGG  259

Query  1124  SCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWIS  951
             +C  LII GG S++LFY+ +CG D   K LT  EW+L+F C A+ +S   PNLNS+A +S
Sbjct  260   TCCALIIVGGSSMKLFYEIVCGHDCTSKPLTAVEWYLVFTCAAVLLSQL-PNLNSIAGVS  318

Query  950   LLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGH  771
             L+G++TAI YCTI+W ++V++GR   GV+YDP + +T+    F  + NAL +IS AF+GH
Sbjct  319   LVGAITAIGYCTIMWLVAVTEGRL-DGVSYDPIRENTNTAMVF-SVLNALGIISFAFKGH  376

Query  770   NIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGG  591
             N+ LEIQ T+P++ K P    M  GV  +Y++IA+C FPLAI GYWAYG+ +P +   GG
Sbjct  377   NLTLEIQATMPSSEKKPSHVPMWRGVKVAYLIIAMCLFPLAIGGYWAYGHKIPPN---GG  433

Query  590   ILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPK  411
             ++ A  ++H  D S+ ++G   + I++  + ++QI+ +P+ D+ E  Y+  K+M   CP 
Sbjct  434   MMTAIYEYHGRDTSQWVLGLTSLFIVMNAVSSFQIFGMPMFDDMESKYI--KRMRKPCPW  491

Query  410   WVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVW  231
             W+R   + +FG   + ++VA PFLGS AG IG I++P+TFAYPCF+W+ +KKP+ Y+ +W
Sbjct  492   WIRSISRAMFGYGCFFIAVAIPFLGSFAGLIGGISIPITFAYPCFLWLKVKKPKKYSFMW  551

Query  230   CVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             C+N GLG LG ++  +L  A ++ +I  G+  +FF P
Sbjct  552   CLNWGLGLLGTVLSIILIAAGIYVVIDTGIQVSFFKP  588



>ref|XP_007041698.1| Transmembrane amino acid transporter family protein [Theobroma 
cacao]
 gb|EOX97529.1| Transmembrane amino acid transporter family protein [Theobroma 
cacao]
Length=524

 Score =   437 bits (1123),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 230/467 (49%), Positives = 312/467 (67%), Gaps = 11/467 (2%)
 Frame = -1

Query  1511  TSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVA  1332
             T   I P+      A Q+    P D+ LPITESRNGN +    H L SGIG+QAL+LPVA
Sbjct  65    TPRFITPLGSPIRRALQLTRLDPHDAWLPITESRNGNAYYAAFHTLCSGIGVQALVLPVA  124

Query  1331  FTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAA  1155
             FT LGW WGII L++ F+WQLYT++LLV LHEST TG R+SRY+ L +  FG K+GK  A
Sbjct  125   FTILGWTWGIINLTVAFIWQLYTLYLLVQLHESTETGMRYSRYLQLCSATFGEKLGKWLA  184

Query  1154  IFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFF  981
             +FP MYLSGG+CV LII GG + ++F+  +CGG  + +  T  EW+L+F   A+ +S   
Sbjct  185   LFPIMYLSGGTCVALIIIGGSTSKMFFDIVCGGTCNAQPPTTVEWYLIFTSAAVLLSQ-L  243

Query  980   PNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANAL  801
             PNLNS+A +SL+G++TAI YCT +W +SV +GR P GV+Y+P + ST  + R  D+ NAL
Sbjct  244   PNLNSIAGVSLIGAITAIGYCTFIWVISVVEGRLP-GVSYNPVKGSTDVI-RIFDVLNAL  301

Query  800   AVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGN  621
              +I+ AFRGHN+ILEIQ T+P++ K P R  M  GV  SY L+ALC FPLAI GYWAYG 
Sbjct  302   GIIAFAFRGHNLILEIQATMPSDEKHPSRAPMWKGVKVSYTLVALCLFPLAIGGYWAYGQ  361

Query  620   LMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLS  441
             L+P   K+GG+L A   FH  D S+ ++G   + +II  + ++QIY +P  D+ E  Y+ 
Sbjct  362   LIP---KEGGMLTALYAFHGQDTSQFILGLTSLFVIINAVSSFQIYGMPTFDDMESQYV-  417

Query  440   KKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAI  261
              ++M    P W+R   + +FG   + V+VA PFLGSLAG IG I +P+T AYPCFMW+ I
Sbjct  418   -RRMKKPLPWWLRAIFRAMFGYGCFFVAVAIPFLGSLAGLIGGIALPVTLAYPCFMWLKI  476

Query  260   KKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             KKP+ +   W +N  LG +GM +  VL  A ++ +I  G+  +FF P
Sbjct  477   KKPKVFGPSWWLNWMLGVIGMALSGVLIAAGIYVIIDTGVEVSFFKP  523



>ref|XP_003517148.1| PREDICTED: uncharacterized LOC100500076 [Glycine max]
 gb|KHN35985.1| Lysine histidine transporter-like 8 [Glycine soja]
Length=542

 Score =   437 bits (1125),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 220/472 (47%), Positives = 310/472 (66%), Gaps = 11/472 (2%)
 Frame = -1

Query  1526  RIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQAL  1347
             RI + T   I P+      A +     P D+ LPITESRNGN +    H L SGIG+QAL
Sbjct  78    RISNLTPKFITPLGSPMRKALRFTKLDPQDAWLPITESRNGNKYYAAFHTLCSGIGIQAL  137

Query  1346  LLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKM  1170
             +LPVAFT LGW WGII ++L F+WQLYT+WLLV+LHES   G R+ RY+ L    FG K+
Sbjct  138   VLPVAFTILGWTWGIITMTLAFIWQLYTLWLLVNLHESVEQGVRYCRYLQLCGATFGEKL  197

Query  1169  GKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIF  996
             GK+ A+FP +YLS G+C  LII GG + + FY+ +CG     K +T  EW+L+F C+A+ 
Sbjct  198   GKILALFPILYLSAGTCTTLIIIGGSTARTFYQVVCGETCTAKPMTTVEWYLVFTCVAVV  257

Query  995   ISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRD  816
             +S   PNLNS+A +SL+G++TA+ YCT +W  SV++G  P  V+Y+P +   S  D F  
Sbjct  258   LSQL-PNLNSIAGVSLIGAVTAVGYCTAIWVTSVARGALPD-VSYNPVRTGNSVEDAF-S  314

Query  815   IANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGY  636
             + NAL +I+ AFRGHN+ILEIQ T+P++ K P    M  GV  SY +IA C FP+AI GY
Sbjct  315   VLNALGIIAFAFRGHNLILEIQSTMPSSEKHPSHVPMWKGVKVSYTIIAACLFPMAIGGY  374

Query  635   WAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWE  456
             WAYG L+P +   GG+L A  +FH  D+S+ ++G     +++  LC++QIY +P  D+ E
Sbjct  375   WAYGQLIPAN---GGMLTALYQFHSRDVSRFVLGLTSFFVVVNGLCSFQIYGMPAFDDME  431

Query  455   RIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCF  276
               Y ++  M   CP W+R  ++V FG L + + VA PFL  +AG IG + +P+TFAYPCF
Sbjct  432   SGYTTR--MKKPCPWWLRAFIRVFFGFLCFFIGVAVPFLSQMAGLIGGVALPVTFAYPCF  489

Query  275   MWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             MW+  KKP+ Y+ +W +N  LG LG+ +  +L  A+L+ +I  G++ +FFNP
Sbjct  490   MWLKTKKPKKYSAMWWLNWFLGTLGVALSAILVAASLYVIIDTGVNVSFFNP  541



>ref|XP_008447895.1| PREDICTED: lysine histidine transporter-like 8 [Cucumis melo]
Length=513

 Score =   436 bits (1121),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 227/493 (46%), Positives = 323/493 (66%), Gaps = 20/493 (4%)
 Frame = -1

Query  1589  DRIEVIKVGRMEDGAVEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESR  1410
             DRIE +     +  +   R           I P+      A  +    P D+ LPITESR
Sbjct  37    DRIEAVATKTPQSSSPRPRFN---------ITPIGSPIRRALNLTRLDPHDAWLPITESR  87

Query  1409  NGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST  1230
             NGN F    H L SGIG+QAL+LPVAFT LGW  GII L++ F+WQLYT++L+V LHEST
Sbjct  88    NGNAFYAAFHTLCSGIGIQALVLPVAFTILGWAGGIISLTVAFIWQLYTLYLMVQLHEST  147

Query  1229  -TGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD  1053
              TG R+SRY+HL + +FG  + +L A FP +YLS G+CV LII GG + + F++ +CG +
Sbjct  148   ETGLRYSRYLHLFSASFGNGLSRLLAFFPILYLSAGTCVALIIIGGSTSKTFFQIVCGTN  207

Query  1052  --PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRP  879
               P  LT  EW+L+F C A+ ++   PNLNS+A +SL+G++TA+ YCT++W +SV KGR 
Sbjct  208   CNPNYLTPIEWYLVFTCAAVLLAQL-PNLNSIAGVSLIGAITAVGYCTLIWAISVVKGRL  266

Query  878   PQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCT  699
             P GV+YDP +   ++L+R     NAL +++ AFRGHN+ILEIQGT+P++ K P R  M  
Sbjct  267   P-GVSYDPIK-PPAQLERAFAALNALGIVAFAFRGHNLILEIQGTMPSSEKHPSRVPMWR  324

Query  698   GVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMI  519
             GV  +Y+L+A C FPLAI GYW YG  +P++   GG+L A   +H  D S+ L+G   ++
Sbjct  325   GVKFAYLLVAACLFPLAIGGYWVYGVRIPSN---GGMLTALYAYHSRDTSQFLLGLTSLL  381

Query  518   IIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFL  339
             +II  + ++QIY +P+ D+ E  Y  +KK   +CP W+R+ L+ +F  + + V++A PFL
Sbjct  382   VIINAVSSFQIYGMPMFDSIEACYTKRKKQ--ACPWWLRVILRTVFSFICFFVAIAIPFL  439

Query  338   GSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWN  159
              SLAG IG I +P+TFAYPCFMW+ +KKP+ Y +VW VN  LG LGM +   +  A ++ 
Sbjct  440   SSLAGLIGGIALPVTFAYPCFMWLKMKKPKKYGIVWWVNWVLGVLGMGLSFAMIAAGIYV  499

Query  158   LIADGLHANFFNP  120
             +I  G+ A+FF P
Sbjct  500   VINTGIQASFFKP  512



>emb|CBI38472.3| unnamed protein product [Vitis vinifera]
Length=759

 Score =   443 bits (1140),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 235/475 (49%), Positives = 317/475 (67%), Gaps = 12/475 (3%)
 Frame = -1

Query  1535  RVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGL  1356
             R  R+ S T   I P+        ++    P D+ LPITESRNGN +    H L SGIG+
Sbjct  293   RTPRL-SLTPRFITPLGSPMRRVLRLTKLDPQDAWLPITESRNGNAYYAAFHTLCSGIGV  351

Query  1355  QALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFG  1179
             QAL+LPVAFT LGW WGII L+L F+WQLYT+WLLV LHEST TG R+SRY+ L    FG
Sbjct  352   QALVLPVAFTILGWTWGIINLTLAFIWQLYTLWLLVQLHESTETGMRYSRYLQLFNATFG  411

Query  1178  GKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCI  1005
              ++G L A+FP MYLSGG+CV LII GG + + FY+ +CG       LT  EW+L+F C 
Sbjct  412   ERLGNLLALFPIMYLSGGTCVALIIIGGSTSKTFYQIVCGATCTKVPLTTVEWYLVFTCA  471

Query  1004  AIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDR  825
             A+ +S   PNLNS+A +SL+G++TAI YCT +W +SV++GR P GV+Y+P +  T  ++ 
Sbjct  472   AVLLSQL-PNLNSIAGVSLIGAVTAIGYCTSIWVVSVAEGRLP-GVSYNPVKEGTD-IEH  528

Query  824   FRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAI  645
                + NAL +I+ AFRGHN+ILEIQ T+P++ K P R  M  GV  SY +IAL  FPLAI
Sbjct  529   IFSVLNALGIIAFAFRGHNLILEIQATMPSSEKHPSRVPMWKGVKFSYTIIALGLFPLAI  588

Query  644   AGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLD  465
              GYWAYG+L+P++   GGIL A   FH  D+S+ ++G   + II+  + ++QIY +P+ D
Sbjct  589   GGYWAYGHLIPSN---GGILTALYVFHSQDVSQFVLGLTSLFIIVNAVSSFQIYGMPMFD  645

Query  464   NWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAY  285
               E  Y ++  M   CP W+R   + +FG   + V+VA PFLGSLAG IG I +P+T AY
Sbjct  646   FMESKYTTR--MKKPCPWWLRSLFRAMFGYGCFFVAVAIPFLGSLAGLIGGIALPVTLAY  703

Query  284   PCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             PCFMW+ IKKP+ Y+  W +N GLG LGM + +VL  A ++ +I  G+ A FF+P
Sbjct  704   PCFMWLKIKKPKTYSPTWWLNWGLGVLGMGLSSVLIAAGIYVVIDTGIEAKFFHP  758



>ref|XP_007157963.1| hypothetical protein PHAVU_002G113000g [Phaseolus vulgaris]
 gb|ESW29957.1| hypothetical protein PHAVU_002G113000g [Phaseolus vulgaris]
Length=535

 Score =   436 bits (1121),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 224/472 (47%), Positives = 308/472 (65%), Gaps = 11/472 (2%)
 Frame = -1

Query  1526  RIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQAL  1347
             RI + T   I P+      A +     P D+ LPITESRNGN +    H L SGIG+QAL
Sbjct  71    RISNLTPRFITPLGSPVRKALRFTKLDPQDAWLPITESRNGNQYYAAFHTLCSGIGIQAL  130

Query  1346  LLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTT-GTRFSRYVHLATVAFGGKM  1170
             +LPVA T LGW WGII L+L F+WQLYT+WLLV+LHES   G R+ RY+ L    FG K+
Sbjct  131   VLPVALTVLGWTWGIISLTLAFIWQLYTLWLLVNLHESVEHGVRYCRYLQLCGATFGEKV  190

Query  1169  GKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIF  996
             GKL A+FP +YLS G+C  LII GG + + FY+ +CG     K +T  EW+L+F C A+ 
Sbjct  191   GKLLALFPILYLSAGTCTTLIIIGGSTARTFYEVVCGDSCTAKPMTTVEWYLVFTCAAVV  250

Query  995   ISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRD  816
             +S   PNLNS+A ISL+G++TA+ YCT +W  SV++G    GV YDP +   S  + F  
Sbjct  251   LSQL-PNLNSIAGISLIGAVTAVGYCTSIWITSVAEGAL-DGVNYDPIRGENSVENAF-G  307

Query  815   IANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGY  636
             + NAL +I+ AFRGHN+ILEIQ T+P++ K P    M  GV  SY LIA C FPL I GY
Sbjct  308   VLNALGIIAFAFRGHNLILEIQSTMPSSEKHPSHVPMWKGVKVSYTLIAACLFPLTIGGY  367

Query  635   WAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWE  456
             WAYG L+P++   GG+L A  +FH HD+S+ ++G     +++  LC++QIY +P  D+ E
Sbjct  368   WAYGQLIPSN---GGMLTALYQFHSHDVSRFVLGLTSFFVVVNALCSFQIYGMPAFDDME  424

Query  455   RIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCF  276
               Y ++  M   CP W+R  +++ FG + + + VA PFL  LAG IG + +P+TFAYPCF
Sbjct  425   SQYTTR--MKKPCPWWLRALIRLFFGFMCFFIGVAVPFLSQLAGLIGGVALPVTFAYPCF  482

Query  275   MWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             MW+  KKP+ Y+ +W +N  LG LG+ +  VL  A+L+ +I  G++ +FFNP
Sbjct  483   MWLKTKKPKKYSAMWGLNWFLGTLGVCLSVVLIAASLYVIIDTGVNVSFFNP  534



>ref|XP_008337953.1| PREDICTED: lysine histidine transporter-like 8 [Malus domestica]
Length=546

 Score =   436 bits (1121),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 231/476 (49%), Positives = 322/476 (68%), Gaps = 12/476 (3%)
 Frame = -1

Query  1538  VRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIG  1359
             +R  R+ S T   I P+      A ++    P D+ LPITESRNGN +    H L SGIG
Sbjct  79    IRTPRM-SLTPRFITPIGSPVRKALKMTRLDPEDAWLPITESRNGNKYYAAFHTLCSGIG  137

Query  1358  LQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAF  1182
             +QAL+LPVAFT LGW WGIICL+L F+WQ YT+W+LV LHE+  TG R+SRY+ L ++ +
Sbjct  138   IQALVLPVAFTILGWAWGIICLTLAFIWQSYTLWILVHLHENVETGVRYSRYIQLFSLTY  197

Query  1181  GGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVC  1008
             G ++     +FP MYLSGG+CV LI+ GGG+ +LF++T+CG     K LT  EW+L+F C
Sbjct  198   GDRIANWLGMFPIMYLSGGTCVALIVIGGGTSKLFFQTLCGAACSSKPLTTVEWYLVFTC  257

Query  1007  IAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLD  828
              A+ +SL   NLNS+A +SL+G+LTA+ YCT +W +SVS+GR P GV+YDP + S + ++
Sbjct  258   AAVLLSLLP-NLNSIAGVSLIGALTAVGYCTAIWVISVSEGRLP-GVSYDPIE-SATNVE  314

Query  827   RFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLA  648
             R   + NAL +I+ AFRGHN+ILEIQ T+P++ K P    M  GV  SY +IA C FPLA
Sbjct  315   RVFSVLNALGIIAFAFRGHNLILEIQATMPSSEKHPSHVPMWRGVKVSYAIIAACLFPLA  374

Query  647   IAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVL  468
             I GYWAYG+L+P +   GG+L A  +FH  D+S+S++  I + ++I  LC++QIY +P+ 
Sbjct  375   IGGYWAYGHLIPAN---GGMLPAVFQFHSRDVSQSVLALISLFVVINALCSFQIYGMPMF  431

Query  467   DNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFA  288
             D+ E  Y S+KK  +  P W+R   + +FG   + V+VA PFLGS+AG +G I +P+T A
Sbjct  432   DHMESQYTSRKKAPL--PWWLRCIARAMFGFGVFFVAVAIPFLGSVAGLVGGIALPVTLA  489

Query  287   YPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             YPCFMWI I KP+ Y+ +W +N  LG LGM +  VL  A ++ +I  G+   FF P
Sbjct  490   YPCFMWIKINKPKKYSPMWWLNWSLGILGMALSLVLMAAGIYVVIQTGIQVKFFKP  545



>ref|XP_004512243.1| PREDICTED: lysine histidine transporter-like 8-like [Cicer arietinum]
Length=534

 Score =   436 bits (1120),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 224/475 (47%), Positives = 312/475 (66%), Gaps = 12/475 (3%)
 Frame = -1

Query  1535  RVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGL  1356
             R  R+ S T   I P+      A ++    P D+ LPITESRNGN +    H L SGIG+
Sbjct  68    RTPRM-SLTPRFITPLGSPMRKALRLTKLDPQDAWLPITESRNGNKYYAAFHTLCSGIGI  126

Query  1355  QALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFG  1179
             QAL+LPVAFT LGW WGII L++ F+WQLYT+WLLV LHES   G R+SRY+ L    FG
Sbjct  127   QALVLPVAFTILGWTWGIISLTIGFIWQLYTLWLLVHLHESVENGIRYSRYLQLCFATFG  186

Query  1178  GKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCI  1005
              K+G+L A+FP +YLS G+C  LII GG + + FY+ +CG     K +T  EW+L+F C 
Sbjct  187   EKLGRLVALFPILYLSAGTCTTLIIIGGSTARTFYQVVCGDSCTAKPMTTVEWYLVFTCG  246

Query  1004  AIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDR  825
             A+ +S   PNLNS+A ISL+G++TA+ YCT +W  SV++G  P GV Y+P +   S  + 
Sbjct  247   AVVLSQL-PNLNSIAGISLIGAVTAVGYCTSIWVASVAQGALP-GVNYNPVKGENSVENA  304

Query  824   FRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAI  645
             F  + NAL +I+ AFRGHN+ILEIQ T+P++ K P    M  GV  SY +IA C FPLAI
Sbjct  305   F-SVLNALGIIAFAFRGHNLILEIQATMPSSEKHPSHVPMWKGVKVSYTIIAACIFPLAI  363

Query  644   AGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLD  465
              GYWAYG L+P +   GG+L A  +FH HD+S+ ++G     +++  LC++QIY +P  D
Sbjct  364   GGYWAYGQLIPAN---GGMLTALYQFHSHDVSRFVLGLTSFFVVVNGLCSFQIYGMPAFD  420

Query  464   NWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAY  285
             + E  Y   K+M   CP W+R   +VLFG + + + VA PFL SLAG IG + +P+T AY
Sbjct  421   DMESQY--TKRMKKPCPWWLRSIFRVLFGFICFFIGVAIPFLSSLAGLIGGVALPVTLAY  478

Query  284   PCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             PCFMW+ IKKP+ Y+++W +N  LG  G+ +  +L   +++ +I  G++ +FF+P
Sbjct  479   PCFMWLKIKKPKKYSVMWYLNWFLGTFGIGLSAILIAGSIYVIIDTGVNVSFFDP  533



>ref|XP_008241984.1| PREDICTED: lysine histidine transporter-like 8 [Prunus mume]
Length=541

 Score =   436 bits (1120),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 230/494 (47%), Positives = 327/494 (66%), Gaps = 11/494 (2%)
 Frame = -1

Query  1595  ERDRIEVIKVGRMEDGAVEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITE  1416
             ++   E   V +     + +R  R+ S T   I P+      A ++    P D+ LPITE
Sbjct  56    QQPGAEGAVVAKAPKTPLAIRTPRM-SLTPRFITPLGSPVRKALKMTRLDPQDAWLPITE  114

Query  1415  SRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHE  1236
             SRNGN +    H L SGIG+QAL+LPVAFT LGW WG+I L+L F+WQLYT+WLLV LHE
Sbjct  115   SRNGNKYYAAFHTLCSGIGIQALVLPVAFTVLGWAWGVILLTLGFIWQLYTLWLLVHLHE  174

Query  1235  ST-TGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCG  1059
             +  TG R+SRY+ L ++ +G K+     +FP MYLSGG+CV LI+ GG + +LFY+T+C 
Sbjct  175   NVETGMRYSRYMQLFSLTYGDKIANWLGLFPIMYLSGGTCVALIVIGGSTSKLFYETVCP  234

Query  1058  G-DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGR  882
                 K LT  EW+L+F C+A+ +SL  PNLNS+A +SL+G++TAI YCT++W  SV++GR
Sbjct  235   TCTSKPLTTVEWYLVFTCVAVVLSL-LPNLNSIAGVSLIGAITAIGYCTLIWVTSVAEGR  293

Query  881   PPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMC  702
              P GV+YDP +  T ++ R   + NA+ +I+ AFRGHN+ILEIQ T+P++ K P    M 
Sbjct  294   LP-GVSYDPIRAGT-QIARVFGVLNAIGIIAFAFRGHNLILEIQATMPSSEKHPSHVPMW  351

Query  701   TGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYM  522
              GV  SY LIA+C FPLAI GYWAYG+L+P +   GG+L A  ++H  D+S+S++G   +
Sbjct  352   RGVKVSYTLIAVCLFPLAIGGYWAYGHLIPAN---GGMLPALFQYHSKDVSQSILGLTSL  408

Query  521   IIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPF  342
              ++I   C++QIY +P+ D+ E  Y S  +M    P W+R   + +FG   +  +VA PF
Sbjct  409   FVVINAACSFQIYGMPMFDDTESKYTS--RMKKPVPWWLRCISRAMFGFGVFFFAVAIPF  466

Query  341   LGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLW  162
             LGS+AG IG I++P+TFAYPCFMWI I KP+ Y+ +WC+N  LG LGM++   +  A ++
Sbjct  467   LGSVAGLIGGISLPVTFAYPCFMWIKIHKPKKYSPMWCLNYSLGVLGMILSGFMIAAGVY  526

Query  161   NLIADGLHANFFNP  120
              +I  G+   FF P
Sbjct  527   VVIDTGIKVQFFKP  540



>ref|XP_004144930.1| PREDICTED: lysine histidine transporter-like 8-like [Cucumis 
sativus]
 ref|XP_004153576.1| PREDICTED: lysine histidine transporter-like 8-like [Cucumis 
sativus]
 gb|KGN43298.1| hypothetical protein Csa_7G018800 [Cucumis sativus]
Length=513

 Score =   433 bits (1114),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 226/493 (46%), Positives = 321/493 (65%), Gaps = 20/493 (4%)
 Frame = -1

Query  1589  DRIEVIKVGRMEDGAVEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESR  1410
             DRIE       +  +   R           I P+      A  +    P D+ LPITESR
Sbjct  37    DRIEAAACKTPKSSSPRPRFN---------ITPIGSPIRRALNLTRLDPHDAWLPITESR  87

Query  1409  NGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST  1230
             NGN F    H L SGIG+QAL+LPVAFT LGW  GII L++ F+WQLYT++L+V LHEST
Sbjct  88    NGNAFYAAFHTLCSGIGIQALVLPVAFTILGWAGGIISLTVAFIWQLYTLYLMVQLHEST  147

Query  1229  -TGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD  1053
              TG R+SRY+HL + +FG  + +L A FP +YLS G+CV LII GG + + F++ +CG +
Sbjct  148   ETGLRYSRYLHLFSASFGNGLSRLLAFFPILYLSAGTCVALIIIGGSTSKTFFQIVCGTN  207

Query  1052  --PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRP  879
               P  LT  EW+L+F C+A+ ++   PNLNS+A +SL+G++TA+ YCT++W +S+ KGR 
Sbjct  208   CNPNSLTPIEWYLVFTCVAVLLAQL-PNLNSIAGVSLIGAITAVGYCTLIWVISLVKGRL  266

Query  878   PQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCT  699
             P  V+YDP +  T +L+R     NAL +++ AFRGHN+ILEIQGT+P++ K P R  M  
Sbjct  267   PH-VSYDPIKPPT-QLERAFAALNALGIVAFAFRGHNLILEIQGTMPSSEKHPSRVPMWR  324

Query  698   GVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMI  519
             GV  +Y+++A C FPLAI GYW YG  +P++   GG+L A   +H  D S+ L+G   ++
Sbjct  325   GVKFAYLVVAACLFPLAIGGYWIYGVRIPSN---GGMLTALYAYHSRDTSQFLIGLTSLL  381

Query  518   IIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFL  339
             +II  + T+QIY +P+ D+ E  Y  +KK   +CP W+R+ L+  F  + + V++A PFL
Sbjct  382   VIINAVTTFQIYGMPMFDSIEACYTKRKKQ--ACPWWLRIILRTAFSFICFFVAIAIPFL  439

Query  338   GSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWN  159
             GSLAG IG I +P+TFAYPCFMW+ +KKP+ Y +VW VN  LG  GM +   +  A ++ 
Sbjct  440   GSLAGLIGGIALPVTFAYPCFMWLKMKKPKKYGIVWLVNWVLGVSGMGLSFAMIAAGIYV  499

Query  158   LIADGLHANFFNP  120
             +I  G+ A+FF P
Sbjct  500   VINTGIQASFFKP  512



>ref|XP_009337090.1| PREDICTED: lysine histidine transporter-like 8 [Pyrus x bretschneideri]
Length=546

 Score =   434 bits (1116),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 231/476 (49%), Positives = 320/476 (67%), Gaps = 12/476 (3%)
 Frame = -1

Query  1538  VRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIG  1359
             +R  R  S T   I P+      A ++    P D+ LPITESRNGN +    H L SGIG
Sbjct  79    IRTPRT-SLTPRFITPIGSPVRKALKMTRLDPEDAWLPITESRNGNKYYAAFHTLCSGIG  137

Query  1358  LQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAF  1182
             +QAL+LPVAFT LGW WGIICL+L F+WQ YT+W+LV LHE+  TG R+SRY+ L ++ +
Sbjct  138   IQALVLPVAFTILGWAWGIICLTLAFIWQSYTLWILVHLHENVETGVRYSRYMQLFSLTY  197

Query  1181  GGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVC  1008
             G ++     +FP MYLSGG+CV LI+ GG + +LF++T+CG     K LT  EW+L+F C
Sbjct  198   GDRIANWLGMFPIMYLSGGTCVALIVIGGATSKLFFQTLCGAACSSKPLTTVEWYLVFTC  257

Query  1007  IAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLD  828
              A+ +SL   NLNS+A +SL+G+LTA+ YCT +W +SVS+GR P GV+YDP + S + ++
Sbjct  258   AAVLLSLLP-NLNSIAGVSLIGALTAVGYCTAIWVISVSEGRLP-GVSYDPIE-SATNVE  314

Query  827   RFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLA  648
             R   + NAL +I+ AFRGHN+ILEIQ T+P++ K P    M  GV  SY +IA C FPLA
Sbjct  315   RVFSVLNALGIIAFAFRGHNLILEIQATMPSSEKHPSHVPMWRGVKVSYAIIAACLFPLA  374

Query  647   IAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVL  468
             I GYWAYG+L+P +   GG+L A  +FH  D+S+S++  I + ++I  LC++QIY +P+ 
Sbjct  375   IGGYWAYGHLIPAN---GGMLPAVFQFHSRDVSQSVLALISLFVVINALCSFQIYGMPMF  431

Query  467   DNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFA  288
             D+ E  Y S+KK  +  P W+R   + +FG   + V+VA PFLGS+AG +G I +P+T A
Sbjct  432   DHMESQYTSRKKAPL--PWWLRCIARAMFGFGVFFVAVAIPFLGSVAGLVGGIALPVTLA  489

Query  287   YPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             YPCFMWI I KP+ Y+ +W +N  LG LGM +  VL  A L+ +I  G+   FF P
Sbjct  490   YPCFMWIKINKPKKYSPMWWLNWSLGILGMALSLVLMAAGLYVVIQTGIQVKFFKP  545



>ref|XP_004287749.1| PREDICTED: lysine histidine transporter-like 8-like [Fragaria 
vesca subsp. vesca]
Length=551

 Score =   434 bits (1116),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 225/476 (47%), Positives = 320/476 (67%), Gaps = 12/476 (3%)
 Frame = -1

Query  1538  VRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIG  1359
             +R  R+ S T   + P+      A +     P D+ LPITESRNGN +    H L SGIG
Sbjct  85    IRTPRM-SLTPRFLTPLGSPVRKALKATRLDPEDAWLPITESRNGNKYYAAFHTLCSGIG  143

Query  1358  LQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAF  1182
             +QAL+LPVAFT LGW WGIICL++ F+WQLYT++LL+ LHE+  TG R+SRY+ L    F
Sbjct  144   IQALVLPVAFTILGWTWGIICLTVTFIWQLYTLYLLIHLHENIETGVRYSRYMQLFGFTF  203

Query  1181  GGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVC  1008
             G +   L  +FP MYLSGG+CV LI+ GG + +LF++ +CG     K LT  EWFL+F C
Sbjct  204   GERTANLLGLFPIMYLSGGNCVALIVIGGSTSKLFFQIVCGATCTAKPLTTVEWFLVFTC  263

Query  1007  IAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLD  828
              A+ +SL  PNLNS+A +SL+G++TA+AYCT++W +SV++GR P GV+YDP +   S++ 
Sbjct  264   CAVMLSL-LPNLNSIAGVSLIGAMTAVAYCTMMWVVSVTEGRLP-GVSYDPVR-RGSEVA  320

Query  827   RFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLA  648
             R  D+ N+L +I+ AFRGHN+ILEIQ T+P++ K P    M  GV  SY LIA C FP+A
Sbjct  321   RVFDVLNSLGIIAFAFRGHNLILEIQATMPSSEKHPSHVPMWRGVKVSYTLIACCLFPIA  380

Query  647   IAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVL  468
             I GYWAYG+L+P +   GG+L A  +FH  D+S+ ++G + + +++  + ++QIY +P+ 
Sbjct  381   IGGYWAYGHLIPAN---GGMLAAIYEFHSKDVSQFILGLMSLFVVVNAMSSFQIYGMPMF  437

Query  467   DNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFA  288
             D+ E  Y S+KK  +  P W+R   + +FG   + ++VA PFLGS+AG IG I +P+T  
Sbjct  438   DHMESKYTSRKKQPL--PWWLRCISRAMFGFGCFFIAVAIPFLGSVAGLIGGIALPVTLV  495

Query  287   YPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             YPC+MW+ IKKP+ Y + W VN  LG LGM +  +L  A L+ +I  G+  +FF P
Sbjct  496   YPCWMWLKIKKPKKYGVSWWVNWVLGVLGMGLTGLLIAAGLYVVIDTGIKVSFFKP  551



>ref|XP_004161041.1| PREDICTED: LOW QUALITY PROTEIN: lysine histidine transporter-like 
8-like [Cucumis sativus]
Length=513

 Score =   432 bits (1112),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 226/493 (46%), Positives = 321/493 (65%), Gaps = 20/493 (4%)
 Frame = -1

Query  1589  DRIEVIKVGRMEDGAVEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESR  1410
             DRIE       +  +   R           I P+      A  +    P D+ LPITESR
Sbjct  37    DRIEAAACKTPKSSSPRPRFN---------ITPIGSPIRRALNLTRLDPHDAWLPITESR  87

Query  1409  NGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST  1230
             NGN F    H L SGIG+QAL+LPVAFT LGW  GII L++ F+WQLYT++L+V LHEST
Sbjct  88    NGNAFYAAFHTLCSGIGIQALVLPVAFTILGWAGGIISLTVAFIWQLYTLYLMVQLHEST  147

Query  1229  -TGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD  1053
              TG R+SRY+HL + +FG  + +L A FP +YLS G+CV LII GG + + F++ +CG +
Sbjct  148   ETGLRYSRYLHLFSASFGNGLSRLLAFFPILYLSAGTCVALIIIGGSTSKTFFQIVCGTN  207

Query  1052  --PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRP  879
               P  LT  EW+L+F C+A+ ++   PNLNS+A +SL+G++TA+ YCT++W +S+ KGR 
Sbjct  208   CNPNSLTPIEWYLVFTCVAVLLAQL-PNLNSIAGVSLIGAITAVGYCTLIWVISLVKGRL  266

Query  878   PQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCT  699
             P  V+YDP +  T +L+R     NAL +++ AFRGHN+ILEIQGT+P++ K P R  M  
Sbjct  267   PH-VSYDPIKPPT-QLERAFAALNALGIVAFAFRGHNLILEIQGTMPSSEKHPSRVPMWR  324

Query  698   GVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMI  519
             GV  +Y+++A C FPLAI GYW YG  +P++   GG+L A   +H  D S+ L+G   ++
Sbjct  325   GVKFAYLVVAACLFPLAIGGYWIYGVRIPSN---GGMLTALYAYHSRDTSQFLIGLTSLL  381

Query  518   IIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFL  339
             +II  + T+QIY +P+ D+ E  Y  +KK   +CP W+R+ L+  F  +   V++A PFL
Sbjct  382   VIINAVTTFQIYGMPMFDSIEACYTKRKKQ--ACPWWLRIILRTAFSFICXFVAIAIPFL  439

Query  338   GSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWN  159
             GSLAG IG I +P+TFAYPCFMW+ +KKP+ Y +VW VN  LG +GM +   +  A ++ 
Sbjct  440   GSLAGLIGGIALPVTFAYPCFMWLKMKKPKKYGIVWLVNWVLGVVGMGLSFAMIAAGIYV  499

Query  158   LIADGLHANFFNP  120
             +I  G+ A+FF P
Sbjct  500   VINTGIQASFFKP  512



>ref|XP_010690282.1| PREDICTED: lysine histidine transporter-like 7 [Beta vulgaris 
subsp. vulgaris]
Length=541

 Score =   433 bits (1113),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 225/447 (50%), Positives = 302/447 (68%), Gaps = 15/447 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P+++ LPITESR GN +    H+LSSG+G+Q+L LP+AFT+LGW WGI   S+ F+WQLY
Sbjct  103   PIEAWLPITESRKGNLYFCIFHLLSSGLGIQSLALPLAFTTLGWFWGITWFSMAFIWQLY  162

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             TIWLL  LHES+TG R SRY+ LA  AFG K+GKL A+FP MYLSGG+CV L+I GGG++
Sbjct  163   TIWLLTQLHESSTGYRCSRYLQLAMAAFGPKLGKLLALFPVMYLSGGTCVTLLIAGGGTM  222

Query  1085  QLFYKTMC-GGD---PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYC  918
             Q  Y  +C  GD   P   T  EW+L+FVC+AI I+   PNLNS+AW+SL+ ++TA+ YC
Sbjct  223   QHLYHILCQNGDICHPNSPTTIEWYLVFVCLAIAIAQ-LPNLNSVAWVSLISAITAMVYC  281

Query  917   TILWTLSVSKGRPPQGVTYDPPQLSTS-KLDRFRDIANALAVISLAFRGHNIILEIQGTL  741
             T++W LS+S      G TY  P      ++  F+D+  A+ V++ +FRGHN++LEIQGTL
Sbjct  282   TLIWILSISNDG-HTGYTYRHPAKGLELEMRSFKDVLLAIGVVAFSFRGHNLVLEIQGTL  340

Query  740   PTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHI  561
             P NTK P  +RM  GV  SY LIA+C  PLAI+ Y AYGNL+  + K         KFH 
Sbjct  341   PANTKDPTNKRMWKGVKISYALIAICLLPLAISRYSAYGNLISNAGKWN------TKFHG  394

Query  560   HDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLF  381
                S   +  IY  +II  LC++Q+YA+ V DN+E  Y++ KK    C  W+R GL++ F
Sbjct  395   KHGSDLKLAIIYFFLIINSLCSFQVYAMLVFDNFELRYVTIKK--KPCTWWLRAGLRIFF  452

Query  380   GGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLG  201
             G L + ++VA PFL  LA  IG I +P+TFAYPCFMWI+IKKP  +  +W +N+ LG LG
Sbjct  453   GALVFFIAVAAPFLPLLAPLIGGIALPVTFAYPCFMWISIKKPCKFGAMWFLNLVLGSLG  512

Query  200   MLMCTVLATATLWNLIADGLHANFFNP  120
             +L+  +L  A + NL+  GL  NFF+P
Sbjct  513   ILLSVLLIIAAISNLVTKGLSTNFFHP  539



>ref|XP_007202042.1| hypothetical protein PRUPE_ppa005408mg [Prunus persica]
 gb|EMJ03241.1| hypothetical protein PRUPE_ppa005408mg [Prunus persica]
Length=462

 Score =   430 bits (1105),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 227/468 (49%), Positives = 314/468 (67%), Gaps = 10/468 (2%)
 Frame = -1

Query  1517  SWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLP  1338
             S T   I P+      A ++    P D+ LPITESRNGN +    H L SGIG+QAL+LP
Sbjct  2     SLTPRFITPLGSPVRKALKMTRLDPQDAWLPITESRNGNKYYAAFHTLCSGIGIQALVLP  61

Query  1337  VAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKL  1161
             VAFT LGW WGII L+L F+WQLYT+WLLV LHE+  TG R+SRY+ L ++ +G K+   
Sbjct  62    VAFTVLGWAWGIILLTLGFIWQLYTLWLLVHLHENVETGMRYSRYMQLFSLTYGDKIANW  121

Query  1160  AAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG-DPKGLTGAEWFLLFVCIAIFISLF  984
               +FP MYLSGG+CV LI+ GG + +LFY+ +C     K LT  EW+L+F C A+ +SL 
Sbjct  122   LGLFPIMYLSGGTCVALIVIGGSTSKLFYEIVCPTCTSKPLTTVEWYLVFTCAAVVLSL-  180

Query  983   FPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANA  804
              PNLNS+A +SL+G++TAI YCT++W  SV++GR P GV+YDP +  T ++ R   + NA
Sbjct  181   LPNLNSIAGVSLIGAITAIGYCTLIWVTSVAEGRLP-GVSYDPIRADT-QIARVFGVLNA  238

Query  803   LAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYG  624
             + +I+ AFRGHN+ILEIQ T+P++ K P    M  GV  SY LIA+C FPLAI GYWAYG
Sbjct  239   IGIIAFAFRGHNLILEIQATMPSSEKHPSHVPMWRGVKVSYTLIAVCLFPLAIGGYWAYG  298

Query  623   NLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYL  444
             +L+P     GG+L A  ++H  D+S+S++G   + ++I   C++QIY +P+ D+ E  Y 
Sbjct  299   HLIPAD---GGMLPALYEYHSKDVSQSILGLTSLFVVINAACSFQIYGMPMFDDTESKYT  355

Query  443   SKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIA  264
             S+ K     P W+R   + +FG   +  +VA PFLGS+AG IG I++P+TFAYPCFMWI 
Sbjct  356   SRMK--KPVPWWLRCISRAMFGFGVFFFAVAIPFLGSVAGLIGGISLPVTFAYPCFMWIK  413

Query  263   IKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             I KP+ Y+ +WC+N  LG LGM++   +  A L+ +I  G+   FF P
Sbjct  414   IHKPKKYSPMWCLNYSLGVLGMILSGFMIAAGLYVVIDTGIKVQFFKP  461



>gb|KCW68049.1| hypothetical protein EUGRSUZ_F01732 [Eucalyptus grandis]
Length=502

 Score =   431 bits (1107),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 216/461 (47%), Positives = 309/461 (67%), Gaps = 11/461 (2%)
 Frame = -1

Query  1493  PVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGW  1314
             P+      A Q+    P D+ LPITESRNGN +    H L SGIG+QAL+LPV+FT LGW
Sbjct  49    PLGSPIRKAIQMTKLDPQDAWLPITESRNGNAYYAAFHTLCSGIGIQALVLPVSFTILGW  108

Query  1313  VWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAAIFPTMY  1137
              WGII L++ F+WQLYT+W+LV LHES  TG R+SRY+HL +  FG KMG + A FP MY
Sbjct  109   TWGIISLTIAFIWQLYTLWVLVKLHESAETGMRYSRYLHLFSATFGDKMGNIFAAFPIMY  168

Query  1136  LSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSL  963
             LSGG+CV LII GG + +LF++ +CG     K +T  EW+L+F C A+ ++   PNLNS+
Sbjct  169   LSGGTCVALIIVGGSTSKLFFQILCGEGCTAKPMTSVEWYLVFTCAAVILAQ-LPNLNSI  227

Query  962   AWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLA  783
             A +SL+GS+TAI +CTI+W +SV+ GR   GV+YDP +     +     + NA  +I+ A
Sbjct  228   AGVSLIGSITAICFCTIMWLVSVTSGR-LDGVSYDPIK-EEPNMAYIFSVLNAFGIIAFA  285

Query  782   FRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSY  603
             FRGHN+ LEIQGT+P++ K P    M  GV  +Y+++ALC FPL I GYWAYG+ +P+S 
Sbjct  286   FRGHNLTLEIQGTMPSDEKKPSHVPMWRGVKVAYLIVALCLFPLTIGGYWAYGHKIPSS-  344

Query  602   KKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMM  423
               GG+L A  +FH  D S++++    + +I+  + ++QIYA+P+ D+ E  Y    +M  
Sbjct  345   --GGMLTAIYQFHGRDTSQAVLALTSLFVIVNAVSSFQIYAMPMFDDMESKY--TGRMNR  400

Query  422   SCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPY  243
              CP W+R   +V+F    + V+VA PFLGSL+G IG + +P+TFAYPCF+W+ IKKP+  
Sbjct  401   PCPWWLRALFRVMFTYGCFFVAVAIPFLGSLSGLIGGVAVPITFAYPCFLWLKIKKPKKQ  460

Query  242   TLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             + +W +N GLG  G+++  +L  A ++ +I  G+  +FF P
Sbjct  461   SFMWYLNWGLGVSGIVLSVILIAAGVYVVIDTGIKVSFFKP  501



>ref|XP_008382465.1| PREDICTED: lysine histidine transporter-like 8 [Malus domestica]
Length=532

 Score =   431 bits (1109),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 222/469 (47%), Positives = 308/469 (66%), Gaps = 11/469 (2%)
 Frame = -1

Query  1517  SWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLP  1338
             S T   + P+      A  +    P D+ LPITESRNGN +    H L SGIG+Q+L+LP
Sbjct  71    SRTPRFMTPIGSPIRRALHLTRLDPQDAWLPITESRNGNAYYAAFHTLCSGIGIQSLVLP  130

Query  1337  VAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAFGGKMGKL  1161
             VAFT LGW WG+IC++L F+WQLYT++LLV LHES  TG RF RY+ L    FG K+ K 
Sbjct  131   VAFTYLGWTWGVICMTLAFIWQLYTLYLLVQLHESPKTGIRFCRYIQLCNATFGEKISKF  190

Query  1160  AAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISL  987
              A+FP +YLSGG+CV LI+ GG + + F++ +CG     K LT AEW+L+F C A  +S 
Sbjct  191   LALFPILYLSGGTCVALIVLGGATSKSFFQIVCGATCTAKPLTPAEWYLVFTCAAAILSQ  250

Query  986   FFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIAN  807
               PNLNS+A +SL+G++TAI YCTI+W +SV KGR P  V+YDP + S  K   F D+ N
Sbjct  251   -LPNLNSIAGVSLVGAITAIGYCTIIWVVSVDKGRLPN-VSYDPLK-SNKKFIHFFDVLN  307

Query  806   ALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAY  627
             AL +I+ AFRGHN+ILEIQ T+P+  K P R  M  GV+ SY LIA+C FPLAI GYWAY
Sbjct  308   ALGMIAFAFRGHNLILEIQSTMPSXEKHPSRVPMWRGVLISYTLIAMCLFPLAIGGYWAY  367

Query  626   GNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIY  447
             G  +P    +GG+  A   FH+ D S+ ++G   + +++  L ++QIY +P+ D  E  Y
Sbjct  368   GQXIP---HQGGMFAALFGFHMRDTSRLVLGLASLFVVVNALSSFQIYGMPMFDEMESHY  424

Query  446   LSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWI  267
                ++   + P W+R  ++ +F    Y ++VA PFLGS+AG +G I++P+T AYPCFMW+
Sbjct  425   --TRRFKKAAPWWLRAIMRAMFTYGCYFIAVAIPFLGSIAGLLGGISLPVTLAYPCFMWL  482

Query  266   AIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              +KKP+ Y L W VN  LG +G+L+  +L  A ++ +I  G+  +FF P
Sbjct  483   KMKKPKKYGLSWWVNWVLGVVGILLSILLIAAGVYVVIDTGITVSFFKP  531



>ref|XP_007224148.1| hypothetical protein PRUPE_ppa016264mg, partial [Prunus persica]
 gb|EMJ25347.1| hypothetical protein PRUPE_ppa016264mg, partial [Prunus persica]
Length=565

 Score =   432 bits (1112),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 217/451 (48%), Positives = 311/451 (69%), Gaps = 15/451 (3%)
 Frame = -1

Query  1469  AAQVQAFAPL----DSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGI  1302
             A Q+  F P     D+ LPITESRNGN +    H L SGIG+ AL+LPV+FT LGW WG+
Sbjct  123   AIQLTKFDPRSQDHDAWLPITESRNGNAYYAAFHTLCSGIGIPALVLPVSFTILGWAWGV  182

Query  1301  ICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGG  1125
             I L+L F+WQLYT+WLLV LHEST TG R+SRY+ L +  FG KM K+ A+FP  YLSGG
Sbjct  183   ISLTLAFIWQLYTLWLLVKLHESTKTGMRYSRYLQLFSATFGDKMAKIFAVFPIYYLSGG  242

Query  1124  SCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWIS  951
             +C  LII GG S++LFY+ +CG D   K LT  EW+L+F C A+ +S   PNLNS+A +S
Sbjct  243   TCCALIIVGGSSMKLFYEIVCGHDCTSKPLTAVEWYLVFTCAAVLLSQL-PNLNSIAGVS  301

Query  950   LLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGH  771
             L+G++TAI YCTI+W ++V++GR   GV+YDP + +T+    F  + NAL +IS AF+GH
Sbjct  302   LVGAITAIGYCTIMWLVAVTEGRL-DGVSYDPIRENTNTAMVF-SVLNALGIISFAFKGH  359

Query  770   NIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGG  591
             N+ LEIQ T+P++ K P    M  GV  +Y++IA+C FPLAI GYWAYG+ +P +   GG
Sbjct  360   NLTLEIQATMPSSEKKPSHVPMWRGVKVAYLMIAMCLFPLAIGGYWAYGHKIPPN---GG  416

Query  590   ILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPK  411
             ++ A  ++H  D S+ ++G   + I++  + ++QI+ +P+ D+ E  Y+  K+M   CP 
Sbjct  417   MMTAIYEYHGRDTSQWVLGLTSLFIVMNAVSSFQIFGMPMFDDMESKYI--KRMRKPCPW  474

Query  410   WVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVW  231
             W+R   + +FG   + ++VA PFLGS AG IG I++P+TFAYPCF+W+ +KKP+ Y+ +W
Sbjct  475   WIRSISRAMFGYGCFFIAVAIPFLGSFAGLIGGISIPITFAYPCFLWLKVKKPKKYSFMW  534

Query  230   CVNMGLGCLGMLMCTVLATATLWNLIADGLH  138
             C+N GLG LG ++  +L  A ++ +I  G+ 
Sbjct  535   CLNWGLGLLGTVLSIILIAAGIYVVIDTGIQ  565



>ref|XP_010061146.1| PREDICTED: lysine histidine transporter-like 8 [Eucalyptus grandis]
Length=524

 Score =   431 bits (1108),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 216/461 (47%), Positives = 309/461 (67%), Gaps = 11/461 (2%)
 Frame = -1

Query  1493  PVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGW  1314
             P+      A Q+    P D+ LPITESRNGN +    H L SGIG+QAL+LPV+FT LGW
Sbjct  71    PLGSPIRKAIQMTKLDPQDAWLPITESRNGNAYYAAFHTLCSGIGIQALVLPVSFTILGW  130

Query  1313  VWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAAIFPTMY  1137
              WGII L++ F+WQLYT+W+LV LHES  TG R+SRY+HL +  FG KMG + A FP MY
Sbjct  131   TWGIISLTIAFIWQLYTLWVLVKLHESAETGMRYSRYLHLFSATFGDKMGNIFAAFPIMY  190

Query  1136  LSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSL  963
             LSGG+CV LII GG + +LF++ +CG     K +T  EW+L+F C A+ ++   PNLNS+
Sbjct  191   LSGGTCVALIIVGGSTSKLFFQILCGEGCTAKPMTSVEWYLVFTCAAVILAQ-LPNLNSI  249

Query  962   AWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLA  783
             A +SL+GS+TAI +CTI+W +SV+ GR   GV+YDP +     +     + NA  +I+ A
Sbjct  250   AGVSLIGSITAICFCTIMWLVSVTSGR-LDGVSYDPIK-EEPNMAYIFSVLNAFGIIAFA  307

Query  782   FRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSY  603
             FRGHN+ LEIQGT+P++ K P    M  GV  +Y+++ALC FPL I GYWAYG+ +P+S 
Sbjct  308   FRGHNLTLEIQGTMPSDEKKPSHVPMWRGVKVAYLIVALCLFPLTIGGYWAYGHKIPSS-  366

Query  602   KKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMM  423
               GG+L A  +FH  D S++++    + +I+  + ++QIYA+P+ D+ E  Y    +M  
Sbjct  367   --GGMLTAIYQFHGRDTSQAVLALTSLFVIVNAVSSFQIYAMPMFDDMESKY--TGRMNR  422

Query  422   SCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPY  243
              CP W+R   +V+F    + V+VA PFLGSL+G IG + +P+TFAYPCF+W+ IKKP+  
Sbjct  423   PCPWWLRALFRVMFTYGCFFVAVAIPFLGSLSGLIGGVAVPITFAYPCFLWLKIKKPKKQ  482

Query  242   TLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             + +W +N GLG  G+++  +L  A ++ +I  G+  +FF P
Sbjct  483   SFMWYLNWGLGVSGIVLSVILIAAGVYVVIDTGIKVSFFKP  523



>ref|XP_004231077.1| PREDICTED: lysine histidine transporter-like 8 [Solanum lycopersicum]
Length=566

 Score =   431 bits (1109),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 229/477 (48%), Positives = 323/477 (68%), Gaps = 12/477 (3%)
 Frame = -1

Query  1538  VRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIG  1359
             V+  R    T   I P+      A ++    P D+ LPITESRNGN F    H L SGIG
Sbjct  97    VKTPRSRGLTPRFITPLGSPLRKALKMTILDPQDAWLPITESRNGNAFYAAFHTLCSGIG  156

Query  1358  LQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTT-GTRFSRYVHLATVAF  1182
             +QAL+LPVAFT LGW WGII L++ FVWQLYT++L+V LHE+   G R+SRY+ LA   F
Sbjct  157   IQALVLPVAFTILGWAWGIIVLTVAFVWQLYTLYLMVQLHENHELGLRYSRYLQLACATF  216

Query  1181  GGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG---DPKGLTGAEWFLLFV  1011
             G  +GKL++ FP  YLS G+C  LII GG + +L Y+T+CG    +PK LT  EW+L+F 
Sbjct  217   GENLGKLSSAFPLGYLSAGTCCALIIIGGSTAKLLYETLCGATCSNPKPLTVVEWYLVFT  276

Query  1010  CIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKL  831
             C+A+ ++   PNLNS+A ISL+G+LTA+ YCT LWT+SV++GR P  V+Y+P +   S++
Sbjct  277   CVAVVLAQL-PNLNSIAGISLVGALTAVGYCTALWTVSVAEGRLPN-VSYEPVR-KGSQV  333

Query  830   DRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPL  651
             ++  D+ NA  +I+ AFRGHN+ILEIQ T+P++ K P R  M  GV  +Y+LIA+C FPL
Sbjct  334   NKIFDLLNAFGIIAFAFRGHNLILEIQATMPSSEKHPSRVPMWRGVQFAYLLIAMCLFPL  393

Query  650   AIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPV  471
             AI GYWAYG+L+P +   G +L A   FH  D+S+S++  I + +II  + ++Q+Y +P+
Sbjct  394   AIGGYWAYGHLIPAN---GSVLTALFAFHSQDVSRSVLALISIFVIINAVSSFQLYGMPM  450

Query  470   LDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTF  291
              D+ E  Y ++ K   +CP W+R   + +FG + + ++VA PFLGS  G IG I +P+TF
Sbjct  451   FDDMESAYTTRCKK--ACPWWLRSIFRAIFGFVCFFIAVALPFLGSFTGLIGGIALPITF  508

Query  290   AYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             A+PCFMW+ +KKP+ Y+L W VN GLG LGM +  +L  A L+ +I  G+  +FFNP
Sbjct  509   AHPCFMWLKVKKPKKYSLSWWVNWGLGLLGMGLSGILIAAGLYVVIDTGVKISFFNP  565



>ref|XP_003537670.1| PREDICTED: lysine histidine transporter-like 8-like [Glycine 
max]
 gb|KHN41848.1| Lysine histidine transporter-like 8 [Glycine soja]
Length=543

 Score =   429 bits (1104),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 216/472 (46%), Positives = 311/472 (66%), Gaps = 11/472 (2%)
 Frame = -1

Query  1526  RIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQAL  1347
             RI + T   + P+      A +     P D+ LPITESRNGN +    H L SGIG+QAL
Sbjct  79    RISNLTPKFLTPLGSPVRKALRFTKLDPQDAWLPITESRNGNKYYAAFHTLCSGIGIQAL  138

Query  1346  LLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKM  1170
             +LPVAFT LGW WGII ++L F+WQLYT+WLLV+LHES   G R+ RY+ L    FG K+
Sbjct  139   VLPVAFTFLGWTWGIISMTLAFIWQLYTLWLLVNLHESVEQGVRYCRYLQLCGATFGEKL  198

Query  1169  GKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIF  996
             GK+ A+FP +YLS G+C  LII GG + + FY+ +CG     K +T  EW+L+F C+A+ 
Sbjct  199   GKILALFPILYLSAGTCTTLIIIGGSTARTFYQVVCGETCTAKPMTTVEWYLVFTCVAVV  258

Query  995   ISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRD  816
             +S   PNLNS+A +SL+G++TA+ YCT +W  SV++G   + V+Y+P +  +S  + F  
Sbjct  259   LSQL-PNLNSIAGVSLIGAVTAVGYCTAIWVTSVARGAL-KDVSYNPVRTGSSIENAF-G  315

Query  815   IANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGY  636
             + NAL +I+ AFRGHN+ILEIQ T+P++ K P    M  GV  SY +IA C FP+AI GY
Sbjct  316   VLNALGIIAFAFRGHNLILEIQSTMPSSEKHPSHVPMWKGVKVSYTIIAACLFPMAIGGY  375

Query  635   WAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWE  456
             WAYG L+P +   GG+L A  ++H  D+S+ ++G     +++  LC++QIY +P  D+ E
Sbjct  376   WAYGQLIPAN---GGMLTALYQYHSRDVSRFVLGLTSFFVVVNGLCSFQIYGMPAFDDME  432

Query  455   RIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCF  276
               Y ++  M   CP W+R  ++V FG L + + VA PFL  LAG IG + +P+TFAYPCF
Sbjct  433   SGYTAR--MKKPCPWWLRAFIRVFFGFLCFFIGVAVPFLSQLAGLIGGVALPVTFAYPCF  490

Query  275   MWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             MW+  KKP+  +L+W +N  LG LG+ +  +L  A+L+ ++  G++ +FFNP
Sbjct  491   MWLKTKKPKKLSLMWWLNWFLGTLGVALSAILVAASLYVIVDTGVNVSFFNP  542



>ref|XP_010066318.1| PREDICTED: lysine histidine transporter-like 8 [Eucalyptus grandis]
 gb|KCW64172.1| hypothetical protein EUGRSUZ_G01819 [Eucalyptus grandis]
Length=540

 Score =   428 bits (1101),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 224/469 (48%), Positives = 312/469 (67%), Gaps = 11/469 (2%)
 Frame = -1

Query  1517  SWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLP  1338
             S T   I P+      A  +    P D+ LPITESRNGN +    H L SGIG+QAL+LP
Sbjct  79    SLTPRFITPLGSPIRRALHLTKLDPQDAWLPITESRNGNAYYAAFHTLCSGIGIQALILP  138

Query  1337  VAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKL  1161
             VAFT LGW WGIICL+L F+WQLYT++LLV LHES  TG R+SRY+ LA  AFG ++   
Sbjct  139   VAFTVLGWTWGIICLTLAFIWQLYTLYLLVQLHESAETGMRYSRYMQLAGAAFGERLANW  198

Query  1160  AAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISL  987
              A+FP MYL+GG+CV LII GG + ++F+  +CGG      LT  EW+L+F C A+ +S 
Sbjct  199   LALFPFMYLAGGTCVSLIIIGGSTCEMFFGILCGGTCGAHHLTPVEWYLVFTCAAVLLSQ  258

Query  986   FFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIAN  807
               PNLNS+A +SL+G++TA+ YCT++W +SV++GR P  V+Y+  + +T ++ R  D+ N
Sbjct  259   -LPNLNSIAGVSLIGAITAVGYCTMMWIISVTEGRMPN-VSYNSVRANT-QIARVFDLLN  315

Query  806   ALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAY  627
             AL +I+ AFRGHN+ILEIQ T+P++ K P R  M  G   +Y +IA C +PLAIAGYWAY
Sbjct  316   ALGIIAFAFRGHNLILEIQATMPSSEKHPSRVPMWRGTKVAYAIIAACLYPLAIAGYWAY  375

Query  626   GNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIY  447
             G ++P     GG+L A   FH +DI +S++G + + +II  L ++QIY +P+ D+ E  +
Sbjct  376   GQMIP---PNGGMLTAIYAFHRNDIKQSVLGLVILFVIINALSSFQIYGMPMFDDMESRF  432

Query  446   LSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWI  267
             + K K  +  P W R   + +FG   + V+VA PFLGS+AG IG I +P+T AYPCFMW+
Sbjct  433   IVKFKKPL--PWWGRAISRAMFGYGCFFVAVAIPFLGSVAGLIGGIALPVTLAYPCFMWL  490

Query  266   AIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              +K+P+ Y L W VN  LG LGM +  +L    L+ +I  G+  +FF P
Sbjct  491   KMKRPKMYGLSWWVNWVLGTLGMALSGLLIAGGLYVVIDTGIKVSFFKP  539



>ref|XP_010690280.1| PREDICTED: lysine histidine transporter-like 8 [Beta vulgaris 
subsp. vulgaris]
Length=566

 Score =   429 bits (1102),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 231/463 (50%), Positives = 315/463 (68%), Gaps = 11/463 (2%)
 Frame = -1

Query  1499  IAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSL  1320
             + P+      A  +    P D+ LPITESRNGN F    H L SGIG+QAL+LPVAFT L
Sbjct  111   LTPLASPLRKAISMTKLDPQDAWLPITESRNGNAFYAAFHTLCSGIGIQALVLPVAFTIL  170

Query  1319  GWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAAIFPT  1143
             GW WGIICL+L FVWQLYT++LLV LHEST TG R+SRY  L   AFG K GKL A+FP 
Sbjct  171   GWTWGIICLTLFFVWQLYTLYLLVQLHESTETGVRYSRYFTLCIAAFGEKSGKLMAMFPY  230

Query  1142  MYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLN  969
             MYLS G+CV+LI   G + ++ ++ +CG D   K LT  EW+L+F C A+ +S   PN+N
Sbjct  231   MYLSAGTCVLLISIAGATCKILFQILCGPDCTAKPLTLTEWYLVFTCAAVVLSQ-LPNMN  289

Query  968   SLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVIS  789
             S+A +SL+G++TA+ Y TI+W +SV+K  P  GV+Y+P + S+   + F  I NAL +I+
Sbjct  290   SIAGVSLVGAITAVGYITIIWAVSVAK-HPLPGVSYNPIRYSSDIKNVF-SILNALGIIA  347

Query  788   LAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPT  609
              AFRGHN+ILEIQ T+P++ K P R  M  GV +SY+LIA+C +PLAI GYWAYGN +P 
Sbjct  348   FAFRGHNLILEIQATMPSSEKHPSRVPMWKGVQSSYLLIAMCLYPLAIGGYWAYGNSIP-  406

Query  608   SYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKM  429
               + GG+L A  +FH  D S+ ++G   +I+II  L ++QIY +P+ D+ E  Y  +KK 
Sbjct  407   --QDGGMLTALYQFHGRDTSRFILGLTSVIVIINALSSFQIYGMPMFDDIESKYTMRKK-  463

Query  428   MMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPR  249
                CP W+R   + L G L +  +VAFPF+ S AG IG I +PLT AYPCFMW+ +KKP+
Sbjct  464   -KPCPWWLRALFRALCGFLCFFFAVAFPFVASFAGLIGGIALPLTLAYPCFMWVVMKKPK  522

Query  248   PYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              Y  +WC+N GLG LGM++  ++  A ++ +IA+G+  +FF P
Sbjct  523   VYGPMWCLNWGLGVLGMILSVLMIAAGIYVVIANGVEFHFFKP  565



>ref|XP_009344805.1| PREDICTED: lysine histidine transporter-like 8 [Pyrus x bretschneideri]
Length=545

 Score =   427 bits (1099),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 224/463 (48%), Positives = 316/463 (68%), Gaps = 11/463 (2%)
 Frame = -1

Query  1499  IAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSL  1320
             + P+      A ++    P D+ LPITESRNGN +    H L SGIG+QAL+LPVAFT L
Sbjct  90    MTPIGSPVRKALKMTRLDPQDAWLPITESRNGNQYYAAFHTLCSGIGIQALVLPVAFTIL  149

Query  1319  GWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAAIFPT  1143
             GW WGIICL+L F+WQ YT+W+LV LHE+  TG R+SRY+ L ++ +G K+     +FP 
Sbjct  150   GWSWGIICLTLAFIWQSYTLWILVHLHENVETGVRYSRYMQLFSLTYGDKIANWLGMFPI  209

Query  1142  MYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLN  969
             MYLSGG+CV LI+ GG + +LF++T+CG     K LT  EW+L+F C A+ +SL   NLN
Sbjct  210   MYLSGGTCVALIVIGGATSKLFFQTLCGAACTSKPLTTVEWYLVFTCAAVLLSLLP-NLN  268

Query  968   SLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVIS  789
             S+A +SL+G++TA+ YCT +W +SVSKGR P GV+YDP + + + +DR   + NAL +I+
Sbjct  269   SIAGVSLIGAITAVGYCTAIWVVSVSKGRLP-GVSYDPIR-APNDVDRVFSVLNALGIIA  326

Query  788   LAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPT  609
              AFRGHN+ILEIQ T+P++ K P    M  GV  SY +IA C FPLAI GYWAYG+L+P 
Sbjct  327   FAFRGHNLILEIQATMPSSEKHPSHVPMWRGVKVSYSIIAACLFPLAIGGYWAYGHLIPA  386

Query  608   SYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKM  429
             +   GG+L A  +FH  D+S+S++  I + +++  LC++QIY +P+ D+ E  Y S+KK 
Sbjct  387   N---GGMLPAVFQFHSQDVSQSVLAFISLFVVMNALCSFQIYGMPMFDHMESQYTSRKKA  443

Query  428   MMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPR  249
              +  P W+R   + +FG   + V+VA PFLGS+AG +G I++P+T AYPCFMWI I KP+
Sbjct  444   PL--PWWLRCIARAMFGFGVFFVAVAIPFLGSVAGLVGGISLPVTLAYPCFMWIKINKPK  501

Query  248   PYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              Y+ +W +N  LG LG+ +  VL  A ++ +I  G+   FF P
Sbjct  502   KYSPMWWLNWSLGILGIALSLVLIAAGIYVVIQTGIEVQFFKP  544



>ref|XP_004290038.1| PREDICTED: lysine histidine transporter-like 8-like [Fragaria 
vesca subsp. vesca]
Length=530

 Score =   427 bits (1097),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 220/486 (45%), Positives = 317/486 (65%), Gaps = 11/486 (2%)
 Frame = -1

Query  1568  VGRMEDGAVEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSI  1389
             V ++E  A   +     S T   + P+      A ++    P D+ LPITESRNGN +  
Sbjct  52    VDQIEIKAKTPKSLTPRSRTPRFMTPIGSPVRRALKLTRLDPEDAWLPITESRNGNAYYA  111

Query  1388  TSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFS  1212
               H L SGIG+QAL++PVAFT LGW WGIIC++ +F+WQLYT++LLV LHES+ TG R+ 
Sbjct  112   AFHTLCSGIGIQALIIPVAFTILGWTWGIICMTAVFLWQLYTLFLLVQLHESSETGLRYC  171

Query  1211  RYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLT  1038
             RY+ L    FG K+ K  A+FP +YLSGG+CV LI+ GG + ++F++ +CG     K LT
Sbjct  172   RYIQLCNACFGEKLSKFLALFPILYLSGGTCVALIVLGGATCKMFFQIVCGPTCTVKSLT  231

Query  1037  GAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYD  858
              AEW+L+F C A+ +S   PNLNS+A +SL+G++TA+ YCT++W +SV KGR P  V+Y+
Sbjct  232   PAEWYLVFTCAAVILSQ-LPNLNSIAGVSLVGAITAVGYCTLIWVVSVDKGRLPH-VSYN  289

Query  857   PPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYI  678
             P + +  +  +F D+ NAL +I+  FRGHN+ILEIQ T+P++ K P R  M  GV  SY 
Sbjct  290   PLK-AHKEFIQFFDVLNALGMIAFGFRGHNLILEIQATMPSSEKHPSRVPMWRGVQVSYT  348

Query  677   LIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLC  498
             LIALC FPLAI GYWAYG ++P   ++GG+  A   FH  D S++++G   + +I+  L 
Sbjct  349   LIALCIFPLAIGGYWAYGQMIP---EQGGMFAALFTFHSTDTSQTVLGLASLFVIVNALS  405

Query  497   TYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFI  318
             ++QIY +P+ D  E  Y   ++   + P W+R  ++ +F    Y V+VA PFLGSLAG I
Sbjct  406   SFQIYGMPMFDEMESHY--TRRFKQAAPWWLRAIMRAMFTYGCYFVAVAIPFLGSLAGLI  463

Query  317   GSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLH  138
             G I +P+T AYPCFMW+ +KKP+ Y+  W +N  LG +GM +  +L  +  + +I  G+ 
Sbjct  464   GGIALPVTLAYPCFMWLIMKKPKKYSPSWWINWVLGVVGMCLSVLLIVSGTYVVIDTGIK  523

Query  137   ANFFNP  120
              +FF P
Sbjct  524   VSFFKP  529



>ref|XP_008393604.1| PREDICTED: lysine histidine transporter-like 8 [Malus domestica]
Length=545

 Score =   426 bits (1096),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 225/463 (49%), Positives = 316/463 (68%), Gaps = 11/463 (2%)
 Frame = -1

Query  1499  IAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSL  1320
             + P+      A ++    P D+ LPITESRNGN +    H L SGIG+QAL+LPVAFT L
Sbjct  90    MTPIGSPVRKALKMTRLDPQDAWLPITESRNGNQYYAAFHTLCSGIGIQALVLPVAFTIL  149

Query  1319  GWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAAIFPT  1143
             GW WGIICL+L F+WQ YT+W+LV LHE+  TG R+SRY+ L ++ +G K+     +FP 
Sbjct  150   GWSWGIICLTLAFIWQSYTLWILVHLHENVETGVRYSRYMQLFSLTYGDKIANWLGMFPI  209

Query  1142  MYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLN  969
             MYLSGG+CV LI+ GGG+ +LF++T+CG     K LT  EWFL+F C A+ +SL   NLN
Sbjct  210   MYLSGGTCVALIVIGGGTSKLFFQTLCGAACTSKPLTTVEWFLVFTCAAVLLSLLP-NLN  268

Query  968   SLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVIS  789
             S+A +SL+G++TA+ YCT +W +SVS+GR P GV+YDP + + + +D    + NAL +I+
Sbjct  269   SIAGVSLIGAITAVGYCTAIWVVSVSEGRLP-GVSYDPIR-APNDVDGVFSVLNALGIIA  326

Query  788   LAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPT  609
              AFRGHN+ILEIQ T+P++ K P    M  GV  SY +IA C FPLAI GYWAYG+L+P 
Sbjct  327   FAFRGHNLILEIQATMPSSEKHPSHVPMWRGVKVSYSIIAACLFPLAIGGYWAYGHLIPA  386

Query  608   SYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKM  429
             +   GG+L A  +FH  D+S+S++  I + ++I  LC++QIY +P+ D+ E  Y S+KK 
Sbjct  387   N---GGMLPAVFQFHSRDVSQSVLAFISLFVVINALCSFQIYGMPMFDHMESQYTSRKKA  443

Query  428   MMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPR  249
              +  P W+R   + +FG   + V+VA PFLGS+AG +G I++P+T AYPCFMWI I KP+
Sbjct  444   PL--PWWLRCISRAMFGFGVFFVAVAIPFLGSVAGLVGGISLPVTLAYPCFMWIKINKPK  501

Query  248   PYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              Y+ +W +N  LG LG+ +  VL  A ++ +I  G+   FF P
Sbjct  502   KYSPMWWLNWSLGILGIALSLVLIAAGIYVVIQTGIKVQFFKP  544



>ref|XP_004291248.1| PREDICTED: lysine histidine transporter-like 8-like [Fragaria 
vesca subsp. vesca]
Length=547

 Score =   426 bits (1095),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 219/478 (46%), Positives = 314/478 (66%), Gaps = 12/478 (3%)
 Frame = -1

Query  1544  VEVRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSG  1365
             V +RV    S+T     P+      A Q+  F P D+ LPITESRNGN +    H L SG
Sbjct  78    VNIRVTP-RSYTPNFFTPLGSPIRRAIQLTKFDPQDAWLPITESRNGNAYYAAFHSLCSG  136

Query  1364  IGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATV  1188
             IG+ AL+LPV+FT LGW WGII L++ F+WQLYT+WLLV LHES  TG R+SRY+ L + 
Sbjct  137   IGIPALVLPVSFTVLGWTWGIISLTVAFIWQLYTLWLLVKLHESKETGMRYSRYLQLFSS  196

Query  1187  AFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLF  1014
              FG KM  + A+FP  YLSGG+C  LII GG S++LFY+ +CG +   K LT  EW+L+F
Sbjct  197   TFGDKMKNIFAVFPIYYLSGGTCCALIIVGGSSMKLFYEILCGHECTSKPLTTVEWYLVF  256

Query  1013  VCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSK  834
              C A+ +S   PNLNS+A +SL+G++TAI YCTI+W ++V++GR   GV+YDP + +++ 
Sbjct  257   TCAAVVLSQ-LPNLNSIAGVSLIGAITAIGYCTIMWLVAVTEGR-LDGVSYDPKKENSNT  314

Query  833   LDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFP  654
                F  I N+L +I+ AF+GHN+ LEIQ T+P++ K P    M  GV  +Y +IALC FP
Sbjct  315   AMIF-SILNSLGIIAFAFKGHNLTLEIQATMPSSDKKPSHVPMWRGVKIAYFIIALCLFP  373

Query  653   LAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALP  474
             LAI GYWAYG+L+P     GG+L A  ++H  D SK ++    + +++  + ++QI+ +P
Sbjct  374   LAIGGYWAYGHLIP---PNGGMLTAIYQYHGRDTSKFILALTSLFVVVNAVSSFQIFGMP  430

Query  473   VLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLT  294
             + D+ E  Y++  +    CP W+R   + +FG   + ++VA PFLGS AG IG I +P+T
Sbjct  431   MFDDMESKYIT--RFNKPCPWWLRSISRAMFGFGCFFIAVAIPFLGSFAGLIGGIAIPIT  488

Query  293   FAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             FAYPCF+W+ IKKP  ++ +W +N  LG LG  +  +L  A ++ +I  G+  +FF P
Sbjct  489   FAYPCFLWLKIKKPEKFSFMWLLNWTLGLLGTALSVILIAAGIYVVIDTGIQVSFFKP  546



>ref|XP_006422497.1| hypothetical protein CICLE_v10028167mg [Citrus clementina]
 gb|ESR35737.1| hypothetical protein CICLE_v10028167mg [Citrus clementina]
Length=536

 Score =   425 bits (1092),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 220/468 (47%), Positives = 313/468 (67%), Gaps = 13/468 (3%)
 Frame = -1

Query  1511  TSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVA  1332
             T   I P+      A ++    P D+ LPITESRNGN +    H L +GIG+QAL+LPVA
Sbjct  77    TPRFITPLGSPIRKALKLTRLDPQDAWLPITESRNGNAYYAAFHTLCAGIGIQALVLPVA  136

Query  1331  FTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAA  1155
             F  LGW WGII L+L F+WQLYT+++LV LHE+  TG R+SRY+ L  V FG K+ K  A
Sbjct  137   FPILGWAWGIIFLTLTFIWQLYTLYILVQLHENVETGMRYSRYLQLCGVTFGEKLAKWLA  196

Query  1154  IFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFF  981
               P + LS G+CV LII GG S++ FY+  CG     + LT  EW+L+F C A+ +S   
Sbjct  197   FLPLLQLSAGTCVALIIVGGTSMKTFYQITCGATCTSQPLTTVEWYLVFTCAAVVLSQL-  255

Query  980   PNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANAL  801
             PNLNS+A +SL+G++TA+ YCTI+W +SV+KGR P GV+Y+P Q     + R  D+ NAL
Sbjct  256   PNLNSIAGVSLVGAITAVGYCTIIWVVSVAKGRLP-GVSYNPVQTDKEGIVRAVDVLNAL  314

Query  800   AVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGN  621
              +++ AFRGHN+ LEIQ T+P++ K P    M  GV  +Y++IA C FP+AI GYWAYG 
Sbjct  315   GIVAFAFRGHNLSLEIQATMPSSEKHPSTVPMWKGVKFAYLIIATCLFPIAIGGYWAYGQ  374

Query  620   LMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLS  441
             L+P+    GG+L A   FH  D S+ ++G   + +II+ + ++QIY +P+ D+ E +Y+ 
Sbjct  375   LIPS----GGMLVALIAFHATDTSRFILGLTSLFVIISAVSSFQIYGMPMFDDLESLYVR  430

Query  440   KKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAI  261
             +KK    CP W+R  ++ ++G   + ++VA PFLGSLAG IG I +P+T AYPCFMW+ +
Sbjct  431   RKKK--PCPWWLRPLIRAIYGFFMFFIAVAIPFLGSLAGLIGGIALPVTLAYPCFMWLKV  488

Query  260   KKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIAD-GLHANFFNP  120
             KKP+ Y  +W +N  LG LG+++ +VL TA+   +IAD G+  +FF+P
Sbjct  489   KKPKAYGPIWWLNWVLGVLGIIL-SVLVTASGIYVIADTGIKVSFFDP  535



>gb|KDO68234.1| hypothetical protein CISIN_1g009363mg [Citrus sinensis]
Length=536

 Score =   425 bits (1092),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 220/468 (47%), Positives = 313/468 (67%), Gaps = 13/468 (3%)
 Frame = -1

Query  1511  TSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVA  1332
             T   I P+      A ++    P D+ LPITESRNGN +    H L +GIG+QAL+LPVA
Sbjct  77    TPRFITPLGSPIRKALKLTRLDPQDAWLPITESRNGNAYYAAFHTLCAGIGIQALVLPVA  136

Query  1331  FTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAA  1155
             F  LGW WGII L+L F+WQLYT+++LV LHE+  TG R+SRY+ L  V FG K+ K  A
Sbjct  137   FPILGWAWGIIFLTLTFIWQLYTLYILVQLHENVETGMRYSRYLQLCGVTFGEKLAKWLA  196

Query  1154  IFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFF  981
               P + LS G+CV LII GG S++ FY+  CG     + LT  EW+L+F C A+ +S   
Sbjct  197   FLPLLQLSAGTCVALIIVGGTSMKTFYQITCGATCTSQPLTTVEWYLVFTCAAVVLSQL-  255

Query  980   PNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANAL  801
             PNLNS+A +SL+G++TA+ YCTI+W +SV+KGR P GV+Y+P Q     + R  D+ NAL
Sbjct  256   PNLNSIAGVSLVGAITAVGYCTIIWVVSVAKGRLP-GVSYNPVQTDKEGIVRAVDVLNAL  314

Query  800   AVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGN  621
              +++ AFRGHN+ LEIQ T+P++ K P    M  GV  +Y++IA C FP+AI GYWAYG 
Sbjct  315   GIVAFAFRGHNLSLEIQATMPSSEKHPSTVPMWKGVKFAYLIIATCLFPIAIGGYWAYGQ  374

Query  620   LMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLS  441
             L+P+    GG+L A   FH  D S+ ++G   + +II+ + ++QIY +P+ D+ E +Y+ 
Sbjct  375   LIPS----GGMLVALIAFHATDTSRFILGLTSLFVIISAVSSFQIYGMPMFDDLESLYVR  430

Query  440   KKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAI  261
             +KK    CP W+R  ++ ++G   + ++VA PFLGSLAG IG I +P+T AYPCFMW+ +
Sbjct  431   RKKK--PCPWWLRPLIRAIYGFFMFFIAVAIPFLGSLAGLIGGIALPVTLAYPCFMWLKV  488

Query  260   KKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIAD-GLHANFFNP  120
             KKP+ Y  +W +N  LG LG+++ +VL TA+   +IAD G+  +FF+P
Sbjct  489   KKPKAYGPIWWLNWVLGVLGIIL-SVLVTASGIYVIADTGIKVSFFDP  535



>ref|XP_006486661.1| PREDICTED: lysine histidine transporter-like 8-like [Citrus sinensis]
Length=536

 Score =   425 bits (1092),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 220/468 (47%), Positives = 313/468 (67%), Gaps = 13/468 (3%)
 Frame = -1

Query  1511  TSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVA  1332
             T   I P+      A ++    P D+ LPITESRNGN +    H L +GIG+QAL+LPVA
Sbjct  77    TPRFITPLGSPIRKALKLTRLDPQDAWLPITESRNGNAYYAAFHTLCAGIGIQALVLPVA  136

Query  1331  FTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAA  1155
             F  LGW WGII L+L F+WQLYT+++LV LHE+  TG R+SRY+ L  V FG K+ K  A
Sbjct  137   FPILGWAWGIIFLTLTFIWQLYTLYILVQLHENVETGMRYSRYLQLCGVTFGEKLAKWLA  196

Query  1154  IFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFF  981
               P + LS G+CV LII GG S++ FY+  CG     + LT  EW+L+F C A+ +S   
Sbjct  197   FLPLLQLSAGTCVALIIVGGTSMKTFYQITCGATCTSQPLTTVEWYLVFTCAAVVLSQL-  255

Query  980   PNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANAL  801
             PNLNS+A +SL+G++TA+ YCTI+W +SV+KGR P GV+Y+P Q     + R  D+ NAL
Sbjct  256   PNLNSIAGVSLVGAITAVGYCTIIWVVSVAKGRLP-GVSYNPVQTDKEGIVRAVDVLNAL  314

Query  800   AVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGN  621
              +++ AFRGHN+ LEIQ T+P++ K P    M  GV  +Y++IA C FP+AI GYWAYG 
Sbjct  315   GIVAFAFRGHNLSLEIQATMPSSEKHPSTVPMWKGVKFAYLIIATCLFPIAIGGYWAYGQ  374

Query  620   LMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLS  441
             L+P+    GG+L A   FH  D S+ ++G   + +II+ + ++QIY +P+ D+ E +Y+ 
Sbjct  375   LIPS----GGMLVALIAFHATDTSRFILGLTSLFVIISAVSSFQIYGMPMFDDLESLYVR  430

Query  440   KKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAI  261
             +KK    CP W+R  ++ ++G   + ++VA PFLGSLAG IG I +P+T AYPCFMW+ +
Sbjct  431   RKKK--PCPWWLRPLIRAIYGFFMFFIAVAIPFLGSLAGLIGGIALPVTLAYPCFMWLKV  488

Query  260   KKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIAD-GLHANFFNP  120
             KKP+ Y  +W +N  LG LG+++ +VL TA+   +IAD G+  +FF+P
Sbjct  489   KKPKAYGPIWWLNWVLGVLGIIL-SVLVTASGIYVIADTGIKVSFFDP  535



>ref|XP_010113266.1| hypothetical protein L484_026595 [Morus notabilis]
 gb|EXC35273.1| hypothetical protein L484_026595 [Morus notabilis]
Length=533

 Score =   423 bits (1087),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 219/475 (46%), Positives = 313/475 (66%), Gaps = 12/475 (3%)
 Frame = -1

Query  1538  VRVERIGSWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIG  1359
             VR  R+ S T   I P+      A +     P D+ LPITESRNGN +    H L SGIG
Sbjct  68    VRTPRM-SLTPRFITPLGSPIRKALRATKLDPQDAWLPITESRNGNKYYAAFHTLCSGIG  126

Query  1358  LQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAF  1182
             +QAL+LP AFT+LGW WG+ICL+L F+WQLYT+W+LV LHES  TG R+SRY+ L ++ F
Sbjct  127   IQALVLPYAFTTLGWSWGVICLTLAFIWQLYTLWILVQLHESVETGVRYSRYLQLFSLTF  186

Query  1181  GGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD-PKGLTGAEWFLLFVCI  1005
             G K+ KL A FP MYLS G+C  LII G  + +   + +CG +  + LT  EW+L+  C 
Sbjct  187   GEKLTKLLATFPIMYLSAGTCSTLIIIGASTARNLTQIICGTECSRELTTVEWYLVVTCA  246

Query  1004  AIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDR  825
             A+ +S   PNLNS+A +SL+G++TA+ YCTI+W +SV KGR P GV+Y+ P +  + ++ 
Sbjct  247   AVVLSQ-LPNLNSIAGVSLIGAITAVGYCTIIWVVSVDKGRLP-GVSYN-PVMGGNDVEH  303

Query  824   FRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAI  645
                + NAL +I+ AFRGHN+ILEIQ T+P+N K P    M  GV  SY LI+ C FP+AI
Sbjct  304   MFKVFNALGLIAFAFRGHNLILEIQATMPSNEKHPSHVPMWKGVQGSYTLISACLFPIAI  363

Query  644   AGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLD  465
              GYWAYG+++P+     G+L A   FH  D+S+ ++G   + +I+  L ++QIY +P+ D
Sbjct  364   GGYWAYGHMIPSD----GMLTALFMFHSQDVSEFVLGTTCVFVIVNALSSFQIYGMPMFD  419

Query  464   NWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAY  285
             + E  +  + K  +  P W+R   +V+FG + + V+VA PFL SLAG IG I++P+T A+
Sbjct  420   DIESQFTRRFKKPL--PWWLRAVNRVVFGFICFFVAVAIPFLSSLAGLIGGISLPITLAF  477

Query  284   PCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             PCFMW+ IKKP+ Y   W +N  LG LGM++  +L  ++++ +I  G+  +FFNP
Sbjct  478   PCFMWLKIKKPKMYGPNWWINGALGVLGMVLSVILVASSIYVIIDTGIEISFFNP  532



>gb|KDO85038.1| hypothetical protein CISIN_1g043392mg [Citrus sinensis]
Length=496

 Score =   421 bits (1081),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 213/462 (46%), Positives = 299/462 (65%), Gaps = 33/462 (7%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E   Q     P D+ LPITESRNGN +    H LSSGIG+QAL+LP+AFT+LGW WGIIC
Sbjct  55    EEVGQFTKLDPQDAWLPITESRNGNAYYSAFHTLSSGIGVQALVLPLAFTTLGWTWGIIC  114

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L L+F+WQLYT+WLL+ LHES +GTR+SRY+ L+  AF                 GG+CV
Sbjct  115   LLLVFIWQLYTLWLLIQLHESESGTRYSRYLRLSMAAF-----------------GGTCV  157

Query  1115  MLIINGGGSLQLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISL  948
             +L++ GGG+L+ F++ +CG     +   LT  EW+L+F+C A+ ++   PNLNS+A +SL
Sbjct  158   ILVMIGGGTLKTFFEIVCGASETCNVTRLTTVEWYLVFICAAVVLAQ-LPNLNSIAGVSL  216

Query  947   LGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHN  768
             +G++TA++YCTI+W +SV K R P GV+Y+P +   S +     I N+L +I+ AFRGHN
Sbjct  217   IGAITAVSYCTIIWVVSVIKDR-PVGVSYEPVK-EISDVATIFSILNSLGIIAFAFRGHN  274

Query  767   IILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYK----  600
             ++LE+QGT+P+  K P R  M  GV  +Y++IA+C FPLAI GY AYGNL    Y     
Sbjct  275   LVLEVQGTMPSTAKKPSRIPMWRGVKFAYLIIAMCLFPLAIGGYSAYGNLANDIYDAYCQ  334

Query  599   ---KGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKM  429
                  G+ +A  K+H HD SK L+G   + ++I+ L ++QI+A+PV DN E  Y SK   
Sbjct  335   MPGNEGMFDALHKYHNHDTSKVLLGLTSLFVVISSLSSFQIFAMPVFDNLEFKYTSKYN-  393

Query  428   MMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPR  249
                CP W+R G++V FG + + +S A PFL +LA  IG I +P+T AYPCFMWI I+KP 
Sbjct  394   -KPCPWWLRSGIRVFFGSVEFFISAALPFLRNLAALIGGIALPITLAYPCFMWIHIRKPT  452

Query  248   PYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFN  123
              Y+ +W +N  LG LGM++  +      W+L   G+  +FF 
Sbjct  453   TYSAIWGLNWALGILGMVLSILAVIGATWSLATMGIEFHFFK  494



>ref|XP_008236106.1| PREDICTED: lysine histidine transporter-like 8 [Prunus mume]
Length=538

 Score =   422 bits (1085),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 216/469 (46%), Positives = 309/469 (66%), Gaps = 11/469 (2%)
 Frame = -1

Query  1517  SWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLP  1338
             S T   + P+      A ++    P D+ LPITESRNGN +    H L SGIG+QAL+LP
Sbjct  77    SRTPRFMTPIGSPVRRALKLTRLDPQDAWLPITESRNGNAYYAAFHTLCSGIGIQALILP  136

Query  1337  VAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKL  1161
             VAF +LGW WGIIC++L F+WQLYT++LLV LHES  TG R+ RY+ L   +FG K+ + 
Sbjct  137   VAFITLGWTWGIICMTLAFIWQLYTLYLLVQLHESAETGLRYCRYIQLCNASFGEKLAQF  196

Query  1160  AAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISL  987
              A+FP +YLSGG+CV LI+ GG + ++F++ +CG     K LT AEW+L+F  +A  +S 
Sbjct  197   LALFPILYLSGGTCVALIVLGGSTAKMFFEIVCGHTCTVKSLTPAEWYLVFTVVASILSQ  256

Query  986   FFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIAN  807
               PNLNS+A +SL+G+++AI Y T++W +S+ KG+ P  V+YDP + +  +   F D+ N
Sbjct  257   -LPNLNSIAGVSLVGAISAIGYSTLIWVVSLDKGKLPD-VSYDPVK-ADKQYIHFFDVLN  313

Query  806   ALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAY  627
             AL +I+ AFRGHN+ILEIQ T+P++ K P R  M  GV  SY LIA+C FPLAI GYWAY
Sbjct  314   ALGMIAFAFRGHNLILEIQATMPSSEKHPSRVPMWRGVQISYTLIAMCIFPLAIVGYWAY  373

Query  626   GNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIY  447
             G  +P    +GG+ +A   FH  D S+ ++G   + +I+  L ++QIY +P+ D  E  Y
Sbjct  374   GQKIPA---QGGMFSALFTFHALDTSQFILGLASLFVIVNALSSFQIYGMPMFDEMESQY  430

Query  446   LSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWI  267
               + K     P W+R  ++ +F    Y ++VA PFLGS+AG +G I++P+T AYPCFMWI
Sbjct  431   TRRSK--KPAPWWLRAIVRCMFTYGCYFMAVAIPFLGSVAGLLGGISLPVTLAYPCFMWI  488

Query  266   AIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              +KKP+ Y + W VN  LG +GM++  +L  A L+ +I  G+  +FF P
Sbjct  489   KMKKPKKYGISWGVNWVLGVVGMILSVMLTAAGLYVVIDTGIKVSFFKP  537



>ref|XP_007199782.1| hypothetical protein PRUPE_ppa003929mg [Prunus persica]
 gb|EMJ00981.1| hypothetical protein PRUPE_ppa003929mg [Prunus persica]
Length=539

 Score =   421 bits (1083),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 217/469 (46%), Positives = 308/469 (66%), Gaps = 11/469 (2%)
 Frame = -1

Query  1517  SWTSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLP  1338
             S T   + P+      A ++    P D+ LPITESRNGN +    H L SGIG+QAL+LP
Sbjct  78    SRTPRFMTPIGSPVRRALKLTRLDPQDAWLPITESRNGNAYYAAFHTLCSGIGIQALILP  137

Query  1337  VAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKL  1161
             VAF +LGW WGIIC++L F+WQLYT++LLV LHES  TG R+ RY+ L   +FG K+ + 
Sbjct  138   VAFITLGWTWGIICMTLAFIWQLYTLYLLVQLHESAETGLRYCRYIQLCNASFGEKLAQF  197

Query  1160  AAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISL  987
              A+FP +YLSGG+CV LI+ GG + ++F++ +CG     K LT AEW+L+F  +A  +S 
Sbjct  198   LALFPILYLSGGTCVALIVLGGSTAKMFFQIVCGPTCTVKSLTPAEWYLVFTVVASILSQ  257

Query  986   FFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIAN  807
               PNLNS+A +SL+G+++AI Y T++W +S+ KG+ P  V+YDP + +  +   F D+ N
Sbjct  258   -LPNLNSIAGVSLVGAISAIGYSTLIWVVSLDKGKLPN-VSYDPVK-ADKQYIHFFDVLN  314

Query  806   ALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAY  627
             AL +I+ AFRGHN+ILEIQ T+P++ K P R  M  GV  SY LIA+C FPLAI GYWAY
Sbjct  315   ALGMIAFAFRGHNLILEIQATMPSSEKHPSRVPMWRGVQISYTLIAMCIFPLAIVGYWAY  374

Query  626   GNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIY  447
             G  +P    +GG+  A   FH  D SK ++G   + +I+  L ++QIY +P+ D  E  Y
Sbjct  375   GQKIPA---QGGMFAALFGFHASDTSKFILGLASLFVIVNALSSFQIYGMPMFDEMESHY  431

Query  446   LSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWI  267
                ++     P W+R  ++ +F    Y ++VA PFLGS+AG +G I++P+T AYPCFMWI
Sbjct  432   --TRRFKKPAPWWLRAIVRCMFTYGCYFMAVAIPFLGSVAGLLGGISLPVTLAYPCFMWI  489

Query  266   AIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              +KKP+ Y L W VN  LG +GM++  +L  A L+ +I  G+  +FF P
Sbjct  490   KMKKPKKYGLSWGVNWVLGVVGMILSVMLIAAGLYVVIDTGIKVSFFKP  538



>gb|KHN05480.1| Lysine histidine transporter-like 8 [Glycine soja]
Length=418

 Score =   416 bits (1069),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 218/430 (51%), Positives = 293/430 (68%), Gaps = 33/430 (8%)
 Frame = -1

Query  1346  LLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMG  1167
             +LPVAF +LGW WG +CLSL FVWQLY I+LLV LHE   G R SRY+ LA  AFG K+G
Sbjct  1     MLPVAFATLGWAWGTVCLSLAFVWQLYAIFLLVQLHEYVPGIRHSRYLFLAMAAFGKKLG  60

Query  1166  KLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD------PKGLTGAEWFLLFVCI  1005
             K+ A+FP MYLSGG+CVMLII GGG+++  +KT+C  D         L+GAEWFL+F C+
Sbjct  61    KVGALFPVMYLSGGTCVMLIITGGGTMKQLFKTLCENDNGKTCNAHALSGAEWFLVFTCV  120

Query  1004  AIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPP-QLSTSKLD  828
             AI I+   PNLNS+A +SL+G++T+I YCT+ W LSV KG+ P  V+Y        + + 
Sbjct  121   AILIAQ-LPNLNSMAMVSLVGAVTSITYCTLFWVLSVKKGK-PNNVSYSSSLSQEHTPVA  178

Query  827   RFRDIANALAVISLAFRGHNIILEI---------QGTLPTN----TKVPLRRRMCTGVIA  687
             +  D+ NA+ +I LAFRGHN++LEI         QGTLP+N    +K+P+RR    GV  
Sbjct  179   KISDVLNAIGIIVLAFRGHNVLLEIQAMFWMLVLQGTLPSNLEQTSKIPMRR----GVSM  234

Query  686   SYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIA  507
             SY+LI++C FPLAIAG+WAYGN        GG+L +F +FH   I+K  MGAIY+++II 
Sbjct  235   SYVLISMCVFPLAIAGFWAYGN----QINDGGLLYSFPEFHKRQITKFSMGAIYVLVIIH  290

Query  506   CLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLA  327
             CL ++QIYA+PV DN E  Y S K     C   VR  +++ FGGLT+ +SV FPFL  L+
Sbjct  291   CLTSFQIYAMPVFDNLEIRYTSIKN--QRCSPLVRTCIRLFFGGLTFFISVTFPFLPRLS  348

Query  326   GFIGSITM-PLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIA  150
               +GS+T+ P+T+AYPCFMW+++KKPRP  ++ C N+ LG +GML+  +L  A +  L  
Sbjct  349   TLLGSMTLVPITYAYPCFMWLSLKKPRPRGIICCFNVALGSVGMLLSALLVAAAIRTLAL  408

Query  149   DGLHANFFNP  120
             +GL ANFF P
Sbjct  409   NGLDANFFRP  418



>ref|XP_008777663.1| PREDICTED: lysine histidine transporter-like 8 [Phoenix dactylifera]
 ref|XP_008777664.1| PREDICTED: lysine histidine transporter-like 8 [Phoenix dactylifera]
Length=536

 Score =   419 bits (1076),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/454 (45%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++GIG QAL+LPVAF  LGW WGII 
Sbjct  91    EEVGHLTRLNPQDAWLPITESRNGNAHYAAFHNLNAGIGFQALVLPVAFAFLGWSWGIIS  150

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L + + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  151   LIIAYFWQLYTLWILVKLHEAVPGRRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  210

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       L+  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  211   ALILIGGETMKLFFQIVCGPLCSSNPLSTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  269

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y ++ W LSVS+ RPP  ++Y P +  +     F  I NAL +I+ AFRGHN+ 
Sbjct  270   AVTAITYTSMAWVLSVSQERPPS-ISYQPLRSQSFTASVF-SILNALGIIAFAFRGHNLA  327

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y+LIA+C FP+AI G+WAYGNLMP     GG+LN
Sbjct  328   LEIQATMPSTFKHPAHVPMWRGAKVAYLLIAMCLFPIAIGGFWAYGNLMPA----GGMLN  383

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI++ L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  384   ALYAFHSHDIARGLLATTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  441

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL S+AG +G +T+P+TFAYPCFMW+ IKKP+ ++  W +N
Sbjct  442   SGFRVFYGFISFFIGVALPFLSSIAGLLGGLTLPVTFAYPCFMWVLIKKPQRFSFNWYLN  501

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG +G+      +   +W+++  GL   FF P
Sbjct  502   WCLGTMGIAFSLAFSIGGVWSMVNSGLKLKFFKP  535



>gb|KDO68236.1| hypothetical protein CISIN_1g046376mg [Citrus sinensis]
Length=414

 Score =   414 bits (1064),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 214/454 (47%), Positives = 279/454 (61%), Gaps = 48/454 (11%)
 Frame = -1

Query  1463  QVQAFAP--LDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLS  1290
             +VQ   P  LD  LP+T SRNGN FS   H++SSGIG+QAL LPV F +LGW WGIICL 
Sbjct  3     EVQKLQPNSLDDWLPLTASRNGNTFSTVFHIVSSGIGIQALFLPVGFATLGWTWGIICLL  62

Query  1289  LLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVML  1110
               F WQ+YTIWLLV L E   GTR+SRY+ +A  AFG K+ K   +FP  YLSGG+C+ML
Sbjct  63    TAFAWQIYTIWLLVHLAEPVPGTRYSRYMQVAKAAFGPKLAKSLCVFPVWYLSGGTCIML  122

Query  1109  IINGGGSLQLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
             II  G  L+  YK MCGG    + K L G  W LLF+CIAI +S   PNLNS+   S  G
Sbjct  123   IITAGADLETLYKIMCGGIATCEAKSLPGVVWCLLFICIAIVVSQLLPNLNSVLKFSKTG  182

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TA+ Y T+LW L++ K                                     GHN++
Sbjct  183   TVTAVVYVTLLWALTIRK-------------------------------------GHNLV  205

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQGTLP++   P  ++M   V  SY+ I +C FPLA+ GYWAYGN +     K G+L+
Sbjct  206   LEIQGTLPSSKFNPSSQKMWRAVKISYMTIGMCSFPLALTGYWAYGNKVTA---KEGLLS  262

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
              F + H HD S+  MG+IY++ II CLC +QIYA+P  D+ E  Y+ KK+    CP+ VR
Sbjct  263   VFSQVHGHDTSRGAMGSIYLLQIINCLCQFQIYAMPAFDSLEFRYIFKKQ--QQCPRRVR  320

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
                +  F GL  L+SVAFPF  SLA F+G +T+P  F+YPC M+  IKKP     +W +N
Sbjct  321   AAYRFFFTGLISLLSVAFPFFPSLAPFMGGLTLPFKFSYPCLMYNLIKKPDQSGTLWWLN  380

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +GLGC G+++  +L  AT WNL+  G+HANFF+P
Sbjct  381   LGLGCFGIILSVMLVVATFWNLVTKGVHANFFSP  414



>ref|XP_006422495.1| hypothetical protein CICLE_v10029785mg, partial [Citrus clementina]
 gb|ESR35735.1| hypothetical protein CICLE_v10029785mg, partial [Citrus clementina]
Length=426

 Score =   412 bits (1060),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 213/454 (47%), Positives = 279/454 (61%), Gaps = 48/454 (11%)
 Frame = -1

Query  1463  QVQAFAP--LDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLS  1290
             +VQ   P  LD  LP+T SRNGN FS   H+++SGIG+QAL LPV F +LGW WGIICL 
Sbjct  15    EVQKLQPNSLDDWLPLTASRNGNTFSTVFHIVTSGIGIQALFLPVGFATLGWTWGIICLL  74

Query  1289  LLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVML  1110
               F WQ+YTIWLLV L E   GTR+SRY+H+A  AFG K+ K   +FP  YLSGG+C+ML
Sbjct  75    TAFAWQIYTIWLLVHLAEPVPGTRYSRYMHVAKAAFGPKLAKSLCVFPVWYLSGGTCIML  134

Query  1109  IINGGGSLQLFYKTMCGG----DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
             II  G  L+  YK MCGG    + K L G  W LLF+CIAI +S   PNLNS+   S  G
Sbjct  135   IITAGADLETLYKIMCGGIATCEAKSLPGVVWCLLFICIAIVVSQLLPNLNSVLKFSKTG  194

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TA+ Y T+LW L++ K                                     GHN++
Sbjct  195   TVTAVVYVTLLWALTIRK-------------------------------------GHNLV  217

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQGTLP++   P  ++M   V  SY+ I +C FPLA+ GYWAYGN +     K G+L+
Sbjct  218   LEIQGTLPSSKFNPSSQKMWRAVKISYMTIGMCSFPLALTGYWAYGNKVTA---KEGLLS  274

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
              F + H HD S+  MG+IY++ II CLC +QIYA+P  D+ E  Y+ KK+    CP+ V 
Sbjct  275   VFSQVHGHDTSRGAMGSIYLLQIINCLCQFQIYAMPAFDSLEFRYIFKKQ--QQCPRRVL  332

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
                +  F GL  L+SVAFPF  SLA F+G +T+P  F+YPC M+  IKKP     +W +N
Sbjct  333   AAYRFFFTGLISLLSVAFPFFPSLAPFMGGLTLPFKFSYPCLMYNLIKKPDQSGTLWWLN  392

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +GLGC G+++  +L  AT WNL+  G+HANFF+P
Sbjct  393   LGLGCFGIILSVMLVVATFWNLVTKGVHANFFSP  426



>ref|XP_009394281.1| PREDICTED: lysine histidine transporter-like 8 [Musa acuminata 
subsp. malaccensis]
Length=541

 Score =   412 bits (1058),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 215/454 (47%), Positives = 297/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++GIG QALLLPVAF  LGW WG+I 
Sbjct  96    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGIGFQALLLPVAFAFLGWSWGMIA  155

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  156   LTIAYFWQLYTLWILVKLHEAVPGRRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  215

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       L+  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  216   ALILIGGETMKLFFQIVCGSLCSSNPLSTVEWYLVFTILCIVLSQ-LPNLNSIAGLSLIG  274

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T+ W LSVS+ RPP  ++Y  P  STS       I NAL +I+ AFRGHN+ 
Sbjct  275   AVTAITYATMAWVLSVSQERPPS-ISYQ-PLASTSFGATAFSILNALGIIAFAFRGHNLA  332

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y+LIALC FP+AI G+WAYGNLMP     GGILN
Sbjct  333   LEIQATMPSTFKHPAHVPMWRGAKVAYLLIALCLFPIAIGGFWAYGNLMPA----GGILN  388

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  389   ALYAFHSHDIPRGLLATTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  446

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMWI IKKP+ ++  W +N
Sbjct  447   SGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWIGIKKPQRFSFSWYLN  506

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG +GM     L+   +W+++  GL   FF P
Sbjct  507   WSLGIIGMAFSLALSAGGVWSMVNSGLKLKFFKP  540



>ref|XP_010548852.1| PREDICTED: lysine histidine transporter-like 7, partial [Tarenaya 
hassleriana]
Length=429

 Score =   407 bits (1046),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 220/440 (50%), Positives = 294/440 (67%), Gaps = 15/440 (3%)
 Frame = -1

Query  1430  LPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLL  1251
             LPITESRNGN ++ T H+L SG+  QALLLP AF +LGW WGII LS+ F+WQ+YT WLL
Sbjct  2     LPITESRNGNVYTATFHLLCSGVSFQALLLPAAFAALGWAWGIISLSVGFIWQMYTAWLL  61

Query  1250  VDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYK  1071
             V LHES  GTRFSR++ LA  AFG K+GKL  IFP MYLSGG+CV+LII GG S+Q  Y 
Sbjct  62    VHLHESVPGTRFSRFLRLAITAFGEKIGKLVGIFPVMYLSGGACVILIITGGKSMQQLYG  121

Query  1070  TMCGGDPKG--LTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLS  897
              + G D     LT   WFL+F CIA+  +  FPNLNSL  +SL+G + A+ +CT++W L 
Sbjct  122   ILSGDDDDSEPLTSVHWFLIFACIAVSFAQ-FPNLNSLFGLSLIGGVMAMGFCTMIWVLP  180

Query  896   V-SKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVP  720
             V ++GR   GV+YD    S      F  + NA+  I+LAFRGHN+ILEIQGTLP+N+K P
Sbjct  181   VDARGRSRNGVSYDTTDTS------FSSVFNAVGFIALAFRGHNLILEIQGTLPSNSKKP  234

Query  719   LRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSL  540
               + M   V+ S +LIA+C FPL+IA YWAYGN +PT+   GG +  + KF+  D SK  
Sbjct  235   SSKTMWRAVMVSQVLIAMCMFPLSIATYWAYGNTIPTA---GGTIGKYLKFYGQDYSKHA  291

Query  539   MGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLV  360
                I++  I++CLC+Y I A+P  DN E +Y ++++    C  + R  L+VLFG +   V
Sbjct  292   SCFIHITFILSCLCSYPITAMPACDNLEFVYTTRRR--KPCTLFARTMLRVLFGSVYLFV  349

Query  359   SVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVL  180
             +V+ PFL +LA  IG+I + LTF YPCFMWIAIK+P   +++W +N+ +G  G+++  +L
Sbjct  350   AVSLPFLPNLAVLIGAIPLSLTFTYPCFMWIAIKRPSKTSMMWYLNVLIGFSGVVLSILL  409

Query  179   ATATLWNLIADGLHANFFNP  120
                    L   GL ANFF P
Sbjct  410   VVTAAMRLADKGLRANFFKP  429



>ref|XP_010089927.1| hypothetical protein L484_014437 [Morus notabilis]
 gb|EXB38623.1| hypothetical protein L484_014437 [Morus notabilis]
Length=521

 Score =   410 bits (1054),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 212/454 (47%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  76    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  135

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  136   LTIAYCWQLYTLWVLVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  195

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  196   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  254

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++YDP  L +S    F  + NAL +I+ AFRGHN+ 
Sbjct  255   AVTAITYSTMVWVLSVSQQRPP-AISYDPISLPSSTASVF-SVLNALGIIAFAFRGHNLA  312

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IALC FP+ I G+WAYGNLMP+    GGILN
Sbjct  313   LEIQATMPSTFKHPAHVPMWRGAKVAYFFIALCLFPITIGGFWAYGNLMPS----GGILN  368

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  369   ALYAFHIHDIPRGLLAMTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  426

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  427   SGFRVFYGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFN  486

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  487   WILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKP  520



>ref|XP_003593467.1| Lysine/histidine transporter [Medicago truncatula]
 gb|AES63718.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=520

 Score =   409 bits (1052),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 298/454 (66%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN    T H L++G+G QAL+LPVAF  LGW WGII 
Sbjct  75    EDVGHLTKLNPQDAWLPITESRNGNAHYSTFHNLNAGVGFQALVLPVAFAYLGWSWGIIS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTVAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  ++I +S   PNLNS+A +SL+G
Sbjct  195   ALILVGGETMKLFFQIVCGPTCTSNPLTTVEWYLVFTSLSIVLSQ-LPNLNSIAGLSLIG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L+      F  + NAL +++ +FRGHN++
Sbjct  254   AVTAITYSTMVWVLSVSQQRPPS-ISYEPLSLAKPSSSLFLAL-NALGIVAFSFRGHNLV  311

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P R  M  G   +Y  IA+C FP+AI G+WAYGN MP     GGIL 
Sbjct  312   LEIQATMPSTFKHPARVPMWKGAKVAYFFIAMCLFPMAIGGFWAYGNQMP----NGGILT  367

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDIS+ ++   +++++ +CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  368   ALYAFHSHDISRGILALAFLLVVFSCLSSFQIYSMPAFDSFEAGYTSRTN--RPCSIWVR  425

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  Y+  W  N
Sbjct  426   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKQPTKYSFSWYFN  485

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ DGL   FF P
Sbjct  486   WILGWLGVAFSLAFSIGGIWSMVNDGLKLKFFKP  519



>ref|NP_001168064.1| hypothetical protein [Zea mays]
 gb|ACN26981.1| unknown [Zea mays]
 tpg|DAA54881.1| TPA: hypothetical protein ZEAMMB73_506091 [Zea mays]
Length=508

 Score =   409 bits (1050),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 211/454 (46%), Positives = 297/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LP+TESR GN      H L++G+G QALLLP+AF  LGW WGII 
Sbjct  63    EDVGHLTRLDPRDAWLPVTESRGGNARYAAFHSLNAGLGFQALLLPLAFPDLGWSWGIIS  122

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG KMG   A+FPT+YLS G+  
Sbjct  123   LTIAYFWQLYTLWILVKLHEAVPGRRYNRYVELAQAAFGEKMGMWLALFPTIYLSAGTAT  182

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG    P  +T  EW+L+F  +A+ +S   PNLNS+A +SL+G
Sbjct  183   ALILVGGETMKLFFQIVCGPLCSPNPITTVEWYLVFTSLAVILSQ-LPNLNSIAGLSLIG  241

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
               TAI YCT+ W LSVS+ RPP  V+YDP   ++  L  F  I NAL +I+ AFRGHN+ 
Sbjct  242   GATAIMYCTMSWVLSVSQPRPPT-VSYDPVTSNSFGLSLF-SILNALGIIAFAFRGHNLA  299

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y+LIA+C FP+A+ GYWAYGN++P     GG+L 
Sbjct  300   LEIQATMPSTFKHPAHVPMWRGAKVAYLLIAMCLFPVAVGGYWAYGNMVP----PGGMLA  355

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDIS+ ++    +++++ CL ++QIY++PV D++E  Y  +      C  WVR
Sbjct  356   ALYAFHSHDISQGVLATTCLLVVLNCLSSFQIYSMPVFDSFEAYYTGRTN--RPCSAWVR  413

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G L+  +SVA PFL SLAG +G +T+P+TFAYPCFMWI +KKP  ++  W +N
Sbjct  414   SGFRVFYGFLSLFISVALPFLSSLAGLLGGLTLPVTFAYPCFMWICVKKPERFSFSWYLN  473

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG       +   +W+++ +G+   FF P
Sbjct  474   WGLGLLGTAFSLAFSLGGVWSIVNNGMKLKFFKP  507



>gb|EPS73072.1| hypothetical protein M569_01683 [Genlisea aurea]
Length=508

 Score =   409 bits (1050),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 213/455 (47%), Positives = 294/455 (65%), Gaps = 12/455 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QALLLPVAF+ LGW WG+I 
Sbjct  61    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALLLPVAFSFLGWSWGLIS  120

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L + + WQLYT+W+LV LHE+  G R++RYV LA  AFG K+G   A+FPT+YLS G+  
Sbjct  121   LIIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGEKLGLWLALFPTIYLSAGTAT  180

Query  1115  MLIINGGGSLQLFYKTMCG---GDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLL  945
              LI+ GG +++LF++T+CG        LT  EW+L+F  + I +S   PNLNS+A +SL+
Sbjct  181   ALILFGGETMKLFFQTICGSSCSSSNPLTTVEWYLVFTSLCIILSQ-LPNLNSIAGLSLV  239

Query  944   GSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNI  765
             G++TA+ Y T++WTLSVS+ RPP  ++YDP   S S       + NAL +++ AFRGHN+
Sbjct  240   GAVTAVIYSTMMWTLSVSRKRPPS-ISYDPIS-SPSSTASLLSVLNALGIMAFAFRGHNL  297

Query  764   ILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGIL  585
             +LEIQ T+P+  + P R  M  G   +Y LIA C FP+AI GYWAYGNLMP     GGIL
Sbjct  298   VLEIQATMPSTLQKPARVPMWRGAKVAYTLIAACLFPVAIGGYWAYGNLMPA----GGIL  353

Query  584   NAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWV  405
             NA   FH  DI   L+   +++++  CL ++QIY++PV D++E  Y S+      C  WV
Sbjct  354   NAVFAFHSRDIPTGLLSFTFILVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--KPCSVWV  411

Query  404   RMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCV  225
             R G +VL+G +   V VA PFL  LAG +G +T+P+TFAYPCFMW+ IK+P+ Y+  W  
Sbjct  412   RSGFRVLYGFINLFVGVALPFLSGLAGLLGGLTLPVTFAYPCFMWVVIKRPKRYSFNWYF  471

Query  224   NMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             N  LG LG+      +   +W+L+  G+   FF P
Sbjct  472   NWILGWLGVAFSLSFSIGGVWSLVNSGIKLKFFKP  506



>gb|KFK30149.1| hypothetical protein AALP_AA7G223300 [Arabis alpina]
Length=454

 Score =   407 bits (1045),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/442 (46%), Positives = 294/442 (67%), Gaps = 12/442 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P+D  LPITESR GN ++ T H+L SGIGLQ +LLP AF +LGWVWG+I L++ FVW++Y
Sbjct  25    PVDEWLPITESRKGNVYTATFHLLCSGIGLQVILLPAAFAALGWVWGMIILTVGFVWKIY  84

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T+WLL+ LHE+  GTRFSRY+ LA  +FG K+GKL  +FP MYLSGG+  +L+I GG ++
Sbjct  85    TMWLLIHLHEAVHGTRFSRYLRLAIASFGLKLGKLLGVFPIMYLSGGASSLLVITGGKAI  144

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             Q   + M   D   L+  E F++F C A+ +S  FPNLNSL  +SL+G + A+AYCT++W
Sbjct  145   QQLLQIMSEDDTMPLSAVECFVIFSCFAVVMSQ-FPNLNSLFGVSLIGGVMAVAYCTVIW  203

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTK  726
              L V+       V+Y      T++   F +I NA+  I+LAFRG+N++LEIQGTLP+++K
Sbjct  204   ILPVTSDLQRSSVSY------TTRDTSFDNIFNAIGWIALAFRGNNLVLEIQGTLPSDSK  257

Query  725   VPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISK  546
              P  + M   ++ S+  IA+C FPL+I  YWAYG+ +P +   GG + ++ K +  D SK
Sbjct  258   NPSSKIMWKAIVVSHAFIAICMFPLSIVVYWAYGDKIPAT---GGPMGSYLKLYEQDYSK  314

Query  545   SLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTY  366
              +   I++  I  CLC+Y I  +P  DN E +Y +K++    C   VRM L+V  G + +
Sbjct  315   RVACFIHLTFIFNCLCSYPISLMPACDNIEMVYTTKRQ--KPCSFSVRMMLRVFLGLVCF  372

Query  365   LVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCT  186
              V+V FPFL  LA  +G+I +P+TF+YPCFMWI+IKKPR  + +W +N+ +GCLG  +  
Sbjct  373   FVAVTFPFLPYLAVLVGAIALPVTFSYPCFMWISIKKPRRNSPMWYLNVLVGCLGASLSV  432

Query  185   VLATATLWNLIADGLHANFFNP  120
             +L  A+   L   GLHANF+ P
Sbjct  433   LLVVASALRLADKGLHANFYKP  454



>ref|XP_011083786.1| PREDICTED: lysine histidine transporter-like 8 [Sesamum indicum]
 ref|XP_011083788.1| PREDICTED: lysine histidine transporter-like 8 [Sesamum indicum]
Length=522

 Score =   408 bits (1049),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 213/454 (47%), Positives = 297/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF+ LGW WGII 
Sbjct  77    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFSFLGWSWGIIS  136

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L + + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  137   LFIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  196

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  197   ALILVGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  255

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L T     F  + NAL +I+ AFRGHN++
Sbjct  256   AVTAITYSTMVWVLSVSQQRPPS-LSYEPLSLPTLTASVF-SVLNALGIIAFAFRGHNLV  313

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y+ IA+C FP+AI GYWAYGNLMP+    GGILN
Sbjct  314   LEIQATMPSTFKKPAHVPMWRGAKVAYVFIAMCLFPVAIGGYWAYGNLMPS----GGILN  369

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  370   ALFAFHSHDIPRGLLAMPFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  427

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G ++ L+ VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  428   SGFRVFYGFVSLLIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPIKYSFNWYFN  487

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  488   WILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP  521



>ref|XP_011046307.1| PREDICTED: lysine histidine transporter-like 8 [Populus euphratica]
Length=527

 Score =   408 bits (1049),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 210/467 (45%), Positives = 306/467 (66%), Gaps = 11/467 (2%)
 Frame = -1

Query  1511  TSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVA  1332
             T   I P+      A ++    P D+ LPITESRNGN +    H L SGIG QAL+LPVA
Sbjct  68    TPRFITPIGSPIRRALKLTRLDPEDAWLPITESRNGNAWYAAFHCLCSGIGFQALVLPVA  127

Query  1331  FTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAA  1155
             FT LGW WGII L++ F WQLYT++LLV LHE+T TG R+SRY+ + +  FG K  K   
Sbjct  128   FTVLGWAWGIIALTVAFAWQLYTLYLLVQLHENTETGVRYSRYLQIMSANFGEKKAKWLG  187

Query  1154  IFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFF  981
             +FP +YLS G+CV L I GG + +LF++T+CG     K LT  EW+L+F   A+ +S   
Sbjct  188   LFPILYLSIGTCVALNIIGGSTSKLFFQTVCGQSCTVKTLTPVEWYLVFASAAVLLSQ-L  246

Query  980   PNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANAL  801
             PNLNS+A +SL+GS+TA+ YCTI+W +SV+K R P G++Y P +    ++DR  ++ NAL
Sbjct  247   PNLNSIAGVSLIGSITAVMYCTIMWMVSVNKDRLP-GISYKPVR-GPKEVDRLFEVLNAL  304

Query  800   AVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGN  621
              +++ AFRGHN+ILEIQ T+P++ K P R  M  G  A+Y +IA C FPLAI G+WAYG 
Sbjct  305   GIVAFAFRGHNLILEIQATMPSSEKHPSRVPMWRGAKAAYTVIAACIFPLAIGGFWAYGQ  364

Query  620   LMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLS  441
              +P   K GG+ +AF  +   D S+ +MG + ++II+  L ++QIYA+P+ D  E I+  
Sbjct  365   RIP---KNGGLQSAFYAYRRGDTSQFIMGLVSLLIIVNALSSFQIYAMPMFDELESIF--  419

Query  440   KKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAI  261
              K+M   C  W+R+ L+  FG   + ++VA P +GS+ G +G I++P+T AYPCFMW+ +
Sbjct  420   TKRMKRPCQWWLRVILRAFFGYGVFFLAVAIPSIGSVGGLVGGISLPVTLAYPCFMWLKM  479

Query  260   KKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +KP+ Y+ +W +N GLG +G+++   L  A ++ +  +     +F P
Sbjct  480   RKPKKYSKMWYLNWGLGIIGLILSVSLMAAGVYVIKENDSKFQWFKP  526



>ref|XP_002306216.2| hypothetical protein POPTR_0004s18790g [Populus trichocarpa]
 gb|EEE86727.2| hypothetical protein POPTR_0004s18790g [Populus trichocarpa]
Length=527

 Score =   408 bits (1048),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 210/467 (45%), Positives = 305/467 (65%), Gaps = 11/467 (2%)
 Frame = -1

Query  1511  TSTRIAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVA  1332
             T   I P+      A ++    P D+ LPITESRNGN +    H L SGIG QAL+LPVA
Sbjct  68    TPRFITPIGSPIRRALKLTRLDPEDAWLPITESRNGNAWYAAFHCLCSGIGFQALVLPVA  127

Query  1331  FTSLGWVWGIICLSLLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAA  1155
             FT LGW WGII L++ F WQLYT++LLV LHE+T TG R+SRY+ + +  FG K  K   
Sbjct  128   FTVLGWAWGIIALTVAFAWQLYTLYLLVQLHENTETGVRYSRYLQIMSANFGEKKAKWLG  187

Query  1154  IFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFF  981
             +FP +YLS G+CV L I GG + +LF++T+CG     K LT  EW+L+F   A+ +S   
Sbjct  188   LFPILYLSIGTCVALNIIGGSTSKLFFQTVCGQSCTVKTLTPVEWYLVFASAAVLLSQ-L  246

Query  980   PNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANAL  801
             PNLNS+A +SL+GS+TA+ YCTI+W +SV+K R P G++Y P +    ++DR  ++ NAL
Sbjct  247   PNLNSIAGVSLIGSITAVMYCTIMWMVSVNKDRLP-GISYKPVR-GPKEVDRLFEVLNAL  304

Query  800   AVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGN  621
              +++ AFRGHN+ILEIQ T+P++ K P R  M  G  A+Y +IA C FPLAI G+WAYG 
Sbjct  305   GIVAFAFRGHNLILEIQATMPSSEKHPSRVPMWRGAKAAYTVIAACIFPLAIGGFWAYGQ  364

Query  620   LMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLS  441
              +P   K GG+ +AF  +   D S+ +MG + ++II+  L ++QIYA+P+ D  E I+  
Sbjct  365   RIP---KNGGLQSAFYAYRRRDTSQFIMGLVSLLIIVNALSSFQIYAMPMFDELESIF--  419

Query  440   KKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAI  261
              K+M   C  W+R+ L+  FG   + ++VA P +GS+ G +G I++P+T AYPCFMW+ +
Sbjct  420   TKRMKRPCQWWLRVILRAFFGYGVFFLAVAIPSIGSVGGLVGGISLPVTLAYPCFMWLKM  479

Query  260   KKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +KP  Y+ +W +N GLG +G+++   L  A ++ +  +     +F P
Sbjct  480   RKPNKYSKMWYLNWGLGIIGLILSVCLMAAGVYVIKENDNKFQWFKP  526



>ref|XP_010539056.1| PREDICTED: lysine histidine transporter-like 8 [Tarenaya hassleriana]
Length=520

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 298/454 (66%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QALLLPVAF  LGW WGI+ 
Sbjct  75    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALLLPVAFAFLGWSWGILA  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  195   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L ++    F  + NAL +++ AFRGHN++
Sbjct  254   AVTAITYSTMVWVLSVSQPRPPS-ISYEPLSLPSASASLF-SVLNALGIVAFAFRGHNLV  311

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +YI IALC FP+AI G+WAYGNLMP+    GG+L 
Sbjct  312   LEIQATMPSTFKHPAHVPMWKGAKVAYIFIALCLFPIAIGGFWAYGNLMPS----GGMLT  367

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  368   ALYAFHIHDIPRGLLAMAFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--RPCSIWVR  425

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW  IK+P  Y+  W  +
Sbjct  426   SGFRVFYGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWALIKRPAKYSFNWYFH  485

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG+      +   +W+++ +GL   FF P
Sbjct  486   WGLGWLGVGFSLAFSIGGIWSMVTNGLKLKFFKP  519



>ref|XP_007017386.1| Transmembrane amino acid transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY14611.1| Transmembrane amino acid transporter family protein isoform 1 
[Theobroma cacao]
Length=520

 Score =   407 bits (1046),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 298/454 (66%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  75    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  195   ALILIGGETMKLFFQIVCGPICSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L +S    F  + NAL +++ AFRGHN++
Sbjct  254   AVTAITYSTMVWVLSVSQQRPPT-ISYEPLSLPSSA-AAFFSVMNALGIVAFAFRGHNLV  311

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI GYWAYGNLMP+    GGIL+
Sbjct  312   LEIQATMPSTFKHPAHVPMWRGAKVAYFFIAMCLFPVAIGGYWAYGNLMPS----GGILS  367

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  368   ALYAFHSHDIPRGLLALTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  425

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  Y+  W  N
Sbjct  426   SGFRVFYGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKRPTKYSFNWYFN  485

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ +GL   FF P
Sbjct  486   WILGWLGIAFSLAFSIGGVWSMVNNGLKLKFFKP  519



>ref|XP_004512239.1| PREDICTED: lysine histidine transporter-like 8-like [Cicer arietinum]
Length=504

 Score =   405 bits (1042),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 214/483 (44%), Positives = 309/483 (64%), Gaps = 18/483 (4%)
 Frame = -1

Query  1556  EDGAVEVRVERIGSWTSTR-IAPVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSH  1380
             ED   + +     S T  R I P+      A ++    P D+ LPITESRNGN +    H
Sbjct  35    EDSPHQRKTPIRISLTPPRFITPLGTPIRNALRLTKLDPQDAWLPITESRNGNKYYAAFH  94

Query  1379  MLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHES-TTGTRFSRYV  1203
              L SGIG+QAL+LPVAFT LGW WGII L++ F+WQLYT+WLLV LHES   G R+SRY+
Sbjct  95    TLCSGIGIQALVLPVAFTILGWTWGIISLTIGFIWQLYTLWLLVHLHESKEEGLRYSRYL  154

Query  1202  HLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGGD--PKGLTGAE  1029
              L    FG        I P +YL       LII GG + + FY+ +CG     K +T  E
Sbjct  155   QLCFATFG------TIISPFIYLVRNWGNSLIIIGGSTARTFYEVVCGESCTSKPMTTVE  208

Query  1028  WFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQ  849
             W+L+F C+A+ +S   PNLNS+A ISL+G++TA+ YCT +W +SVS+G  P GV+Y+P +
Sbjct  209   WYLVFTCVAVVLSQ-LPNLNSIAGISLIGAVTAVGYCTSIWVVSVSQGTLP-GVSYNPVR  266

Query  848   LSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIA  669
                + + +  D+ NAL +++ AFRGHN+ILEIQ T+P++ K P    M  GV  +Y LIA
Sbjct  267   -GGNMVQKTLDLLNALGIVAFAFRGHNLILEIQATMPSSEKHPSHVPMWKGVKIAYTLIA  325

Query  668   LCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQ  489
              C FP+A+ GYWAYG L+P   + GG+L A  KFH HD+S+ ++G     +++ CLC++Q
Sbjct  326   ACLFPVALGGYWAYGQLIP---ENGGMLTALYKFHSHDVSRFVLGLTSFFVVVNCLCSFQ  382

Query  488   IYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSI  309
             IY +P+ D+ E  +   +KM   CP W+R  L++  G L++ + VA PFL SLAG IG +
Sbjct  383   IYGMPIFDDLESKF--TQKMNKPCPWWLRSSLRIFSGFLSFFIGVATPFLASLAGLIGGV  440

Query  308   TMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANF  129
              +P+TFAYPCFMW+ +K P+ ++++W +N  LG  G+ +  +L  A+L+ ++  G+  +F
Sbjct  441   ALPVTFAYPCFMWLKLKNPKKFSVMWFLNWFLGTFGIGLSGMLIGASLYVVVDKGIKVSF  500

Query  128   FNP  120
             F+P
Sbjct  501   FDP  503



>ref|XP_009365648.1| PREDICTED: lysine histidine transporter-like 8 [Pyrus x bretschneideri]
Length=522

 Score =   406 bits (1043),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 209/454 (46%), Positives = 297/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF+ LGW WG + 
Sbjct  76    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFSFLGWSWGTLS  135

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  136   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  195

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  196   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  254

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L TS    F  + NAL +++ AFRGHN++
Sbjct  255   AVTAITYSTMVWVLSVSQTRPPT-ISYEPISLPTSSASVF-AVLNALGIVAFAFRGHNLV  312

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GGILN
Sbjct  313   LEIQATMPSTFKNPAHVPMWRGAKVAYFFIAMCLFPVAIGGFWAYGNLMPS----GGILN  368

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  369   ALYGFHSHDIPRGLLAMCFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSVWVR  426

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +VL+G + + + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  427   SGFRVLYGFINFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFH  486

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  487   WILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKP  520



>ref|XP_002443190.1| hypothetical protein SORBIDRAFT_08g014900 [Sorghum bicolor]
 gb|EES17028.1| hypothetical protein SORBIDRAFT_08g014900 [Sorghum bicolor]
Length=513

 Score =   405 bits (1042),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LP+TESR GN      H L++G+G QALLLP+AF  LGW WGII 
Sbjct  67    EDVGHLTRLDPRDAWLPVTESRGGNGRYAAFHSLNAGLGFQALLLPLAFPGLGWSWGIIS  126

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG K+G   ++FPT+YLS G+  
Sbjct  127   LTIAYFWQLYTLWILVKLHEAVPGRRYNRYVELAQAAFGEKLGMWLSLFPTIYLSAGTAT  186

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG    P  +T  EW+L+F  +A+ +S   PNLNS+A +SL+G
Sbjct  187   ALILVGGETMKLFFQIVCGPLCSPNPITTVEWYLVFTSLAVILSQ-LPNLNSIAGLSLIG  245

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
               TAI YCT+ W LSVS+ RPP  V+YDP   ++  +  F  + NAL +I+ AFRGHN+ 
Sbjct  246   GATAIMYCTMSWVLSVSQPRPPT-VSYDPVTSNSFGISLFSTL-NALGIIAFAFRGHNLA  303

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y+LIA+C FP+A+ GYWAYGN+MP     GG+L 
Sbjct  304   LEIQATMPSTFKHPAHVPMWRGAKVAYLLIAMCLFPVAVGGYWAYGNMMP----PGGMLT  359

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+    +++++ CL ++QIY++PV D++E  Y  +      C  WVR
Sbjct  360   ALYAFHSHDIPRGLLATTCLLVVLNCLSSFQIYSMPVFDSFEAYYTGRTN--RPCSAWVR  417

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G L+  +SVA PFL SLAG +G +T+P+TFAYPCFMWI +KKP  ++  W +N
Sbjct  418   SGFRVFYGFLSLFISVALPFLSSLAGLLGGLTLPVTFAYPCFMWIRVKKPERFSFSWYLN  477

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG       +   +W+++ +G+   FF P
Sbjct  478   WGLGLLGTAFSLAFSLGGIWSIVNNGMKLKFFKP  511



>ref|XP_003576214.1| PREDICTED: lysine histidine transporter-like 8 [Brachypodium 
distachyon]
Length=506

 Score =   405 bits (1040),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 209/454 (46%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESR+GN      H L++G+G QALLLP+AF  LGW WGII 
Sbjct  61    EEVGHLTRLNPQDAWLPITESRSGNARYAAFHSLNAGLGFQALLLPLAFPCLGWSWGIIS  120

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG K+G   A+FPT+YLS G+  
Sbjct  121   LTVAYFWQLYTLWILVKLHEAVPGRRYNRYVELAQAAFGEKLGVWLALFPTIYLSAGTAT  180

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LFY+ +CG    P  ++  EW+L+F  ++I +S   PNLNS+A ISL+G
Sbjct  181   ALILVGGETMKLFYQIVCGPLCSPSPISTVEWYLVFTSLSIILSQ-LPNLNSIAGISLIG  239

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
               TAI YCT+ W LSVS+ RPP  ++Y+P + ++     F  + NAL +I+ AFRGHN+ 
Sbjct  240   GATAIMYCTMSWVLSVSQQRPP-AISYEPVKYTSFGSSLFATL-NALGIIAFAFRGHNLA  297

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y+LIA+C FP+AI GYWAYGN++P     GG+L 
Sbjct  298   LEIQATMPSTFKHPAHVSMWRGAKVAYLLIAMCIFPVAIGGYWAYGNMVP----PGGMLT  353

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI ++L+ A +++++  CL ++QIY++PV D++E  Y  +      C  WVR
Sbjct  354   AIYVFHSHDIPRALLAATFLLVVFNCLSSFQIYSMPVFDSFEAFYTGRTN--RPCSVWVR  411

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G ++  + VA PFL SLAG +G +T+P+TFAYPCFMWI IKKP  ++  W +N
Sbjct  412   SGFRVFYGFISLFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWICIKKPERFSFSWYLN  471

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GL  LG       +   +W++I  G+   FF P
Sbjct  472   WGLALLGTAFSVASSVGGVWSIINTGMKLKFFKP  505



>ref|XP_002510286.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF52473.1| amino acid transporter, putative [Ricinus communis]
Length=521

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  75    EEMGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  195   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L +     F  + NAL +++ AFRGHN++
Sbjct  254   AITAITYSTMVWVLSVSQERPPS-ISYEPLSLPSFTASVFSAL-NALGIVAFAFRGHNLV  311

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMPT    GGILN
Sbjct  312   LEIQATMPSTFKHPAHVPMWKGAKVAYFFIAMCLFPVAIGGFWAYGNLMPT----GGILN  367

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  368   ALYGFHSHDIPRGLLAMTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  425

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  Y+  W  N
Sbjct  426   SGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKRPSKYSFNWYFN  485

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  486   WILGWLGIAFSLAFSIGGVWSMVNSGLRLKFFKP  519



>ref|XP_009592898.1| PREDICTED: lysine histidine transporter-like 8 [Nicotiana tomentosiformis]
Length=524

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++GIG QAL+LPVAF+ LGW WGII 
Sbjct  79    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGIGFQALVLPVAFSFLGWSWGIIS  138

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  139   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  198

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  199   ALILVGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  257

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T+ W LSVS+ RPP  ++Y+P  L +     F  + NA+ +I+  FRGHN++
Sbjct  258   AVTAITYATMAWVLSVSQPRPPS-ISYEPISLPSYTASLF-SVLNAMGIIAFTFRGHNLV  315

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GG+L+
Sbjct  316   LEIQATMPSTFKHPAHVPMWKGAKVAYFFIAMCLFPIAIGGFWAYGNLMPS----GGMLS  371

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  372   ALYAFHIHDIPRGLLAMTFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--RPCSIWVR  429

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G ++ FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  430   SGFRIFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFN  489

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ +GL   FF P
Sbjct  490   WILGWLGVAFSLAFSIGGIWSMVNNGLKLRFFKP  523



>ref|XP_011030741.1| PREDICTED: lysine histidine transporter-like 8 [Populus euphratica]
Length=521

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 295/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  75    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGLWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  195   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L +     F  + NAL +++ AFRGHN+ 
Sbjct  254   AITAITYSTMVWVLSVSQQRPPT-ISYEPLSLPSFSASVF-SVMNALGIVAFAFRGHNLA  311

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             +EIQ T+P+  K P    M  G   +Y  IALC FP+AI G+WAYGNLMP+    GGILN
Sbjct  312   MEIQATMPSTFKHPAHVPMWKGAKVAYFFIALCLFPVAIGGFWAYGNLMPS----GGILN  367

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y ++      C  WVR
Sbjct  368   ALYGFHSHDIPRGLLAMTFLLVVFNCLSSFQIYSMPVFDSFEASYTTRTN--RPCSIWVR  425

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  426   SGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPSKYSFNWYFN  485

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  486   WILGWLGIAFSVAFSIGGVWSMVNSGLKLKFFKP  519



>ref|XP_009145029.1| PREDICTED: lysine histidine transporter-like 8 [Brassica rapa]
 emb|CDY23659.1| BnaA05g17700D [Brassica napus]
Length=518

 Score =   405 bits (1040),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 210/459 (46%), Positives = 302/459 (66%), Gaps = 21/459 (5%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  73    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ ++WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  133   LTIAYIWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  192

Query  1115  MLIINGGGSLQLFYKTMCG----GDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISL  948
              LI+ GG +++LF++ +CG     +P  LT  EW+L+F  + I +S   PNLNS+A +SL
Sbjct  193   ALILIGGETMKLFFQIVCGPLCASNP--LTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSL  249

Query  947   LGSLTAIAYCTILWTLSVSKGRPPQGVTYDP---PQLSTSKLDRFRDIANALAVISLAFR  777
             +G++TAI Y T++W LSVS+ R P  ++Y+P   P LS S       + NAL +++ AFR
Sbjct  250   IGAVTAITYSTMVWVLSVSQPR-PVTISYEPLSMPSLSGSVF----SVLNALGIVAFAFR  304

Query  776   GHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKK  597
             GHN++LEIQ T+P+  K P    M  G   SY  IALC FP++I G+WAYGNLMP+    
Sbjct  305   GHNLVLEIQSTMPSTFKHPAHVPMWRGAKVSYFFIALCIFPISIGGFWAYGNLMPS----  360

Query  596   GGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSC  417
             GG+L A  +FHIHDI + L+   +++++ +CL ++QIY++P  D++E  Y S+      C
Sbjct  361   GGMLAALYEFHIHDIPRGLLATAFLLVVFSCLSSFQIYSMPAFDSFEAGYTSRTN--KPC  418

Query  416   PKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTL  237
               WVR G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+ 
Sbjct  419   SIWVRSGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPAKYSF  478

Query  236   VWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              W  + GLG LG+      +   +W+++  GL   FF+P
Sbjct  479   NWYFHWGLGWLGVAFSLAFSIGGIWSMVTQGLKLKFFSP  517



>ref|XP_004141237.1| PREDICTED: lysine histidine transporter-like 8-like [Cucumis 
sativus]
 ref|XP_008452487.1| PREDICTED: lysine histidine transporter-like 8 [Cucumis melo]
 gb|KGN55153.1| hypothetical protein Csa_4G638420 [Cucumis sativus]
Length=520

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 295/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++GIG QAL+LPVAF  LGW WGI+ 
Sbjct  75    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGIGFQALVLPVAFAFLGWSWGILS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAEAAFGERLGVWLAVFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  195   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  + ++    F  + NAL +++ AFRGHN++
Sbjct  254   AVTAITYSTMVWVLSVSQQRPPT-ISYEPLSMPSASSSVF-SVMNALGIVAFAFRGHNLV  311

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA C FP+AI GYWAYGNLMP+    GG+LN
Sbjct  312   LEIQSTMPSTFKHPAHVPMWRGAKVAYFFIAACLFPVAIGGYWAYGNLMPS----GGMLN  367

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  368   AIYAFHSHDIPRGLLAITFLLVVFNCLSSFQIYSMPVFDSFEASYTSRTN--RPCSIWVR  425

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G + + + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  ++  W  +
Sbjct  426   SGFRVFYGFVNFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKFSFNWYFH  485

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+L+  GL   FF P
Sbjct  486   WTLGWLGIAFSLAFSIGGIWSLVNSGLKLKFFKP  519



>ref|NP_175198.1| Lysine histidine transporter-like 8 [Arabidopsis thaliana]
 sp|Q9SX98.1|LHTL8_ARATH RecName: Full=Lysine histidine transporter-like 8; AltName: Full=Amino 
acid transporter-like protein 1 [Arabidopsis thaliana]
 gb|AAD46019.1|AC007519_4 Similar to gb|U39782 lysine and histidine specific transporter 
from Arabidopsis thaliana. EST gb|Z17527 comes from this gene 
[Arabidopsis thaliana]
 gb|AAL38886.1| putative lysine and histidine specific transporter protein [Arabidopsis 
thaliana]
 gb|AAM51351.1| putative lysine and histidine specific transporter protein [Arabidopsis 
thaliana]
 gb|AEE32199.1| Lysine histidine transporter-like 8 [Arabidopsis thaliana]
Length=519

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 299/454 (66%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  73    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  133   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  192

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  193   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  251

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ R P  ++Y+P  + ++    F  + NAL +I+ AFRGHN++
Sbjct  252   AVTAITYSTMVWVLSVSQPR-PATISYEPLSMPSTSGSLF-AVLNALGIIAFAFRGHNLV  309

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   SY LIALC FP++I G+WAYGNLMP+    GG+L 
Sbjct  310   LEIQSTMPSTFKHPAHVPMWRGAKISYFLIALCIFPISIGGFWAYGNLMPS----GGMLA  365

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++ +CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  366   ALYAFHIHDIPRGLLATAFLLVVFSCLSSFQIYSMPAFDSFEAGYTSRTN--KPCSIWVR  423

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  424   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPAKYSFNWYFH  483

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG+      +   +W+++ +GL   FF P
Sbjct  484   WGLGWLGVAFSLAFSIGGIWSMVTNGLKLKFFKP  517



>emb|CDY25678.1| BnaC05g25570D [Brassica napus]
Length=518

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 209/459 (46%), Positives = 301/459 (66%), Gaps = 21/459 (5%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  73    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ ++WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  133   LTIAYIWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  192

Query  1115  MLIINGGGSLQLFYKTMCG----GDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISL  948
              LI+ GG +++LF++ +CG     +P  LT  EW+L+F  + I +S   PNLNS+A +SL
Sbjct  193   ALILIGGETMKLFFQIVCGPLCASNP--LTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSL  249

Query  947   LGSLTAIAYCTILWTLSVSKGRPPQGVTYDP---PQLSTSKLDRFRDIANALAVISLAFR  777
             +G++TAI Y T++W LSVS+ R P  ++Y+P   P LS S       + NAL +++ AFR
Sbjct  250   IGAVTAITYSTMVWVLSVSQPR-PATISYEPLSMPSLSGSVF----SVLNALGIVAFAFR  304

Query  776   GHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKK  597
             GHN++LEIQ T+P+  K P    M  G   SY  IALC FP++I G+WAYGN MP+    
Sbjct  305   GHNLVLEIQSTMPSTFKHPAHVPMWRGAKVSYFFIALCIFPISIGGFWAYGNFMPS----  360

Query  596   GGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSC  417
             GG+L A  +FHIHDI + L+   +++++ +CL ++QIY++P  D++E  Y S+      C
Sbjct  361   GGMLAALYEFHIHDIPRGLLATAFLLVVFSCLSSFQIYSMPAFDSFEAGYTSRTN--KPC  418

Query  416   PKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTL  237
               WVR G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+ 
Sbjct  419   SIWVRSGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSF  478

Query  236   VWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              W  + GLG LG+      +   +W+++  GL   FF+P
Sbjct  479   NWYFHWGLGWLGVAFSLAFSIGGIWSMVTQGLKLKFFSP  517



>ref|XP_009788292.1| PREDICTED: lysine histidine transporter-like 8 [Nicotiana sylvestris]
Length=524

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 206/454 (45%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++GIG QAL+LPVAF+ LGW WG+I 
Sbjct  79    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGIGFQALVLPVAFSFLGWSWGVIS  138

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  139   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  198

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  199   ALILVGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  257

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T+ W LSVS+ RPP  ++Y+P  L +     F  + NA+ +I+  FRGHN++
Sbjct  258   AVTAITYATMAWVLSVSQPRPPS-ISYEPISLPSYTASLF-SVLNAMGIIAFTFRGHNLV  315

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GG+L+
Sbjct  316   LEIQATMPSTFKHPAHVPMWKGAKVAYFFIAMCLFPIAIGGFWAYGNLMPS----GGMLS  371

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  372   ALYAFHIHDIPRGLLAMTFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--RPCSIWVR  429

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G ++ FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  430   SGFRIFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFN  489

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ +GL   FF P
Sbjct  490   WILGWLGVAFSLAFSIGGIWSMVNNGLKLRFFKP  523



>ref|XP_010061791.1| PREDICTED: lysine histidine transporter-like 8 [Eucalyptus grandis]
 gb|KCW68789.1| hypothetical protein EUGRSUZ_F02389 [Eucalyptus grandis]
Length=527

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 293/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QALLLPVAF  LGW WGI+ 
Sbjct  82    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALLLPVAFAFLGWSWGILS  141

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG K+G   A+FPT+YLS G+  
Sbjct  142   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGEKLGLWLAVFPTVYLSAGTAT  201

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  202   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  260

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI YCT++W LSVS+ RPP  + Y+P  L +     F  + NAL +++ AFRGHN++
Sbjct  261   AVTAITYCTMVWVLSVSQERPPT-ILYEPLSLPSFNASVF-SVMNALGIVAFAFRGHNLV  318

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGN MP    + GILN
Sbjct  319   LEIQATMPSTFKHPAHVPMWKGAKVAYFFIAMCLFPVAIGGFWAYGNQMP----QEGILN  374

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A  +FH  DI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  375   ALYRFHSRDIPRGLLAMTFLLVVFNCLSSFQIYSMPVFDSFEASYTSRTN--RPCSIWVR  432

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G + + + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  433   SGFRVFYGFVNFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFN  492

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  493   WILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP  526



>ref|XP_010461567.1| PREDICTED: lysine histidine transporter-like 8 [Camelina sativa]
Length=519

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 299/454 (66%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN +    H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  73    EDVGHLTKLNPQDAWLPITESRNGNAYYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  133   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  192

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  193   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  251

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ R P  ++Y+P  + ++    F  + NAL +I+ AFRGHN++
Sbjct  252   AVTAITYSTMVWVLSVSQPR-PATISYEPLSMPSTSGSLF-AVLNALGIIAFAFRGHNLV  309

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   SY  IALC FP++I G+WAYGNLMP+    GG+L 
Sbjct  310   LEIQSTMPSTFKHPAHVPMWRGAKISYFFIALCIFPISIGGFWAYGNLMPS----GGMLA  365

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++ +CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  366   ALYAFHIHDIPRGLLATAFLLVVFSCLSSFQIYSMPAFDSFEAGYTSRTN--KPCSIWVR  423

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  424   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPAKYSFNWYFH  483

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG+      +   +W+++ +GL   FF P
Sbjct  484   WGLGWLGVAFSLAFSIGGIWSMVTNGLKLKFFKP  517



>ref|XP_006473395.1| PREDICTED: lysine histidine transporter-like 8-like [Citrus sinensis]
 gb|KDO84368.1| hypothetical protein CISIN_1g009772mg [Citrus sinensis]
Length=526

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 206/454 (45%), Positives = 297/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QALLLPVAF  LGW WGI+ 
Sbjct  81    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALLLPVAFAFLGWSWGILS  140

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  141   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  200

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG ++++F++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  201   TLILLGGETMKMFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  259

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TA+ Y T++W LSVS+ RPP  ++Y+P   ++     F  + NAL +I+ AFRGHN+ 
Sbjct  260   AITAVTYSTMVWVLSVSQPRPPN-ISYEPLSSASPAATVF-SVMNALGIIAFAFRGHNLA  317

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             +EIQ T+P+  K P    M  G   +Y+ IA+C FP+AI G+WAYGNLMP+    GG+L 
Sbjct  318   MEIQATMPSTFKHPAHVPMWRGAKVAYLFIAMCLFPVAIGGFWAYGNLMPS----GGMLR  373

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A  +FH HDIS+ L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  374   ALFQFHSHDISRGLLAVTFLLVVFNCLSSFQIYSMPVFDSFEASYTSRTN--RPCSIWVR  431

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  432   SGFRVFYGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFN  491

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   LW+++  GL   FF P
Sbjct  492   WILGWLGVAFSLAFSIGGLWSIVNSGLKLKFFKP  525



>ref|XP_008377380.1| PREDICTED: lysine histidine transporter-like 8 [Malus domestica]
Length=522

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 297/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF+ LGW WG + 
Sbjct  76    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFSFLGWSWGTLS  135

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  136   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  195

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  196   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  254

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L T+    F  + NAL +++ AFRGHN++
Sbjct  255   AVTAITYSTMVWVLSVSQTRPPT-ISYEPISLPTASASVF-AVLNALGIVAFAFRGHNLV  312

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GGILN
Sbjct  313   LEIQATMPSTFKHPAHVPMWRGAKVAYFFIAMCLFPVAIGGFWAYGNLMPS----GGILN  368

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  369   ALYGFHSHDIPRGLLAMCFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  426

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +VL+G + + + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  427   SGFRVLYGFINFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFH  486

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  487   WILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKP  520



>ref|XP_006375013.1| amino acid transporter family protein [Populus trichocarpa]
 gb|ERP52810.1| amino acid transporter family protein [Populus trichocarpa]
Length=521

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 295/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  75    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGLWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  195   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L +     F  + NAL +++ AFRGHN+ 
Sbjct  254   AITAITYSTMVWVLSVSQQRPPT-ISYEPLSLPSFSASVF-SVMNALGIVAFAFRGHNLA  311

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             +EIQ T+P+  K P    M  G   +Y  IALC FP+AI G+WAYGNLMP+    GGILN
Sbjct  312   MEIQATMPSTFKHPAHVPMWKGAKVAYFFIALCLFPVAIGGFWAYGNLMPS----GGILN  367

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y ++      C  WVR
Sbjct  368   ALYGFHSHDIPRGLLAMTFLLVVFNCLSSFQIYSMPVFDSFEASYTTRTN--RPCSIWVR  425

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  426   SGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPSKYSFNWYFN  485

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  486   WILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKP  519



>ref|XP_004238196.1| PREDICTED: lysine histidine transporter-like 8 [Solanum lycopersicum]
Length=525

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++GIG QAL+LPVAF+ LGW WGII 
Sbjct  80    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGIGFQALVLPVAFSFLGWSWGIIS  139

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  140   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  199

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  200   ALILVGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  258

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T+ W LSVS+ RPP  ++Y+P  L +     F  + NA+ +I+  FRGHN++
Sbjct  259   AVTAITYATMAWVLSVSQPRPPS-ISYEPISLPSYSASLF-SVLNAMGIIAFTFRGHNLV  316

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IALC FP+AI G+WAYG+LMP+    GG+L+
Sbjct  317   LEIQSTMPSTFKHPAHVPMWKGAKVAYFFIALCLFPIAIGGFWAYGSLMPS----GGMLS  372

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  373   ALYAFHIHDIPRGLLAMTFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--KPCSIWVR  430

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G ++ FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  431   SGFRIFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFN  490

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ +GL   FF P
Sbjct  491   WILGWLGVAFSLAFSIGGIWSMVTNGLKLRFFKP  524



>ref|XP_008378495.1| PREDICTED: lysine histidine transporter-like 8 [Malus domestica]
Length=522

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF+ LGW WG + 
Sbjct  76    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFSFLGWSWGTLS  135

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  136   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  195

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  196   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  254

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L +S    F  + NAL +++ AFRGHN++
Sbjct  255   AVTAITYSTMVWVLSVSQPRPPT-ISYEPISLPSSSASVF-AVLNALGIVAFAFRGHNLV  312

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GGILN
Sbjct  313   LEIQATMPSTFKHPAHVPMWRGAKVAYFFIAMCLFPVAIGGFWAYGNLMPS----GGILN  368

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  369   ALYGFHSHDIPRGLLAMCFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  426

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G + + + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  427   SGFRVFYGFINFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFH  486

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   LW+++  GL   FF P
Sbjct  487   WILGWLGIAFSLAFSIGGLWSMVNSGLKLKFFKP  520



>ref|XP_010908449.1| PREDICTED: lysine histidine transporter-like 8 [Elaeis guineensis]
Length=528

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 297/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++GIG QAL+LPVAF  LGW WGII 
Sbjct  83    EEVGHLTRLNPQDAWLPITESRNGNAHYAAFHNLNAGIGFQALVLPVAFAFLGWSWGIIS  142

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L + + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  143   LIIAYFWQLYTLWILVKLHEAVPGRRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  202

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       L+  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  203   ALILIGGETMKLFFQIVCGPLCSSNPLSTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  261

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y ++ W LSVS+ RPP  ++Y P +  +     F  I NAL +I+ AFRGHN+ 
Sbjct  262   AVTAITYTSMAWVLSVSQERPPS-ISYQPLRSQSFTASVF-SILNALGIIAFAFRGHNLA  319

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y+LIA+C FP+AI G+WAYGNLMP     GG+LN
Sbjct  320   LEIQATMPSTFKHPAHVPMWRGAKVAYLLIAMCLFPIAIGGFWAYGNLMPA----GGMLN  375

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI++ L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  376   ALYAFHSHDIARGLLATTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  433

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP+ ++  W +N
Sbjct  434   SGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPQRFSFNWYLN  493

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG +G+      +   +W+++  GL   FF P
Sbjct  494   WGLGMMGIAFSLAFSIGGVWSMVNSGLKLKFFKP  527



>ref|XP_004291933.1| PREDICTED: lysine histidine transporter-like 8-like [Fragaria 
vesca subsp. vesca]
Length=521

 Score =   404 bits (1039),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 209/454 (46%), Positives = 298/454 (66%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF+ LGW WG + 
Sbjct  75    EEMGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFSFLGWSWGTLS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  195   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  + +     F  + NAL +I+ AFRGHN++
Sbjct  254   AVTAITYSTMVWVLSVSQPRPPT-MSYEPLPMPSFSASLFAAL-NALGIIAFAFRGHNLV  311

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y+LIALC FP+AI G+WAYGNLMP+    GGILN
Sbjct  312   LEIQATMPSTFKHPAHVPMWKGAKVAYVLIALCVFPVAIGGFWAYGNLMPS----GGILN  367

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  368   ALYGFHSHDIPRGLLAMCFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  425

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  426   SGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFN  485

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  486   WILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP  519



>ref|XP_006354939.1| PREDICTED: lysine histidine transporter-like 8-like [Solanum 
tuberosum]
Length=525

 Score =   404 bits (1039),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++GIG QAL+LPVAF+ LGW WGII 
Sbjct  80    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGIGFQALVLPVAFSYLGWSWGIIS  139

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  140   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  199

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  200   ALILVGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  258

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T+ W LSVS+ RPP  ++Y+P  L +     F  + NA+ +I+  FRGHN++
Sbjct  259   AVTAITYATMAWVLSVSQPRPPS-ISYEPISLPSYSASLF-SVLNAMGIIAFTFRGHNLV  316

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IALC FP+AI G+WAYG+LMP+    GG+L+
Sbjct  317   LEIQSTMPSTFKHPAHVPMWKGAKVAYFFIALCLFPIAIGGFWAYGSLMPS----GGMLS  372

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  373   ALYAFHIHDIPRGLLAMTFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--KPCSIWVR  430

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G ++ FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  431   SGFRIFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFN  490

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ +GL   FF P
Sbjct  491   WILGWLGVAFSLAFSIGGIWSMVNNGLKLRFFKP  524



>ref|XP_007222812.1| hypothetical protein PRUPE_ppa004223mg [Prunus persica]
 gb|EMJ24011.1| hypothetical protein PRUPE_ppa004223mg [Prunus persica]
Length=522

 Score =   404 bits (1038),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 297/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF+ LGW WG + 
Sbjct  76    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFSFLGWSWGTLS  135

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  136   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  195

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  196   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  254

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L +S    F  + NAL +++ AFRGHN++
Sbjct  255   AVTAITYSTMVWVLSVSQPRPPT-ISYEPITLPSSSASVF-AVLNALGIVAFAFRGHNLV  312

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GGILN
Sbjct  313   LEIQATMPSTFKHPAHVPMWKGAKVAYFFIAMCLFPVAIGGFWAYGNLMPS----GGILN  368

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  369   ALYGFHSHDIPRGLLAMCFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  426

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G + + + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  427   SGFRVFYGFINFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFH  486

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG++     +   +W+++  GL   FF P
Sbjct  487   WILGWLGIVFSLAFSIGGVWSMVNSGLKLKFFKP  520



>gb|KHN08575.1| Lysine histidine transporter-like 8 [Glycine soja]
Length=458

 Score =   401 bits (1031),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 294/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL LPVAF  LGW WGI+ 
Sbjct  13    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALFLPVAFAYLGWSWGILS  72

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  73    LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  132

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  ++I +S   PNLNS+A +SL+G
Sbjct  133   ALILIGGETMKLFFQIVCGPTCTSNPLTTVEWYLVFTSLSIVLSQ-LPNLNSIAGLSLIG  191

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  LS      F  + NAL +I+ +FRGHN+ 
Sbjct  192   AVTAITYSTMVWVLSVSQQRPPS-ISYEPLSLSQPSASVFLAM-NALGIIAFSFRGHNLA  249

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P R  M  G   +Y  IA+C FP+AI G+WAYGN MP     GGIL 
Sbjct  250   LEIQSTMPSTFKHPARVPMWKGAKVAYFFIAMCLFPIAIGGFWAYGNQMP----PGGILT  305

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDIS+ ++   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  306   ALYAFHSHDISRGILALAFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--RPCSIWVR  363

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  Y+  W  N
Sbjct  364   SGFRVFYGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKQPPKYSFNWYFN  423

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ DGL   FF P
Sbjct  424   WILGWLGVGFSLAFSIGGIWSIVNDGLKFKFFKP  457



>ref|XP_002894065.1| amino acid transporter family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70324.1| amino acid transporter family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   404 bits (1037),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 298/454 (66%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  73    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  133   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  192

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  193   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  251

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ R P  ++Y+P  + ++    F  + NAL +I+ AFRGHN++
Sbjct  252   AVTAITYSTMVWVLSVSQPR-PATISYEPLSMPSTSGSLF-AVLNALGIIAFAFRGHNLV  309

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   SY  IALC FP++I G+WAYGNLMP+    GG+L 
Sbjct  310   LEIQSTMPSTFKHPAHVPMWRGAKISYFFIALCIFPISIGGFWAYGNLMPS----GGMLA  365

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++ +CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  366   ALYAFHIHDIPRGLLATAFLLVVFSCLSSFQIYSMPAFDSFEAGYTSRTN--KPCSIWVR  423

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  424   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPAKYSFNWYFH  483

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG+      +   +W+++ +GL   FF P
Sbjct  484   WGLGWLGVAFSLAFSIGGIWSMVTNGLKLKFFKP  517



>ref|XP_006303973.1| hypothetical protein CARUB_v10008863mg [Capsella rubella]
 gb|EOA36871.1| hypothetical protein CARUB_v10008863mg [Capsella rubella]
Length=519

 Score =   403 bits (1036),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 298/454 (66%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  73    EDVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  133   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  192

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  193   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  251

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ R P  ++Y+P  + ++    F  + NAL +I+ AFRGHN++
Sbjct  252   AVTAITYSTMVWVLSVSQTR-PATISYEPLSMPSTSGSLF-AVLNALGIIAFAFRGHNLV  309

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   SY  IALC FP++I G+WAYGNLMP+    GG+L 
Sbjct  310   LEIQSTMPSTFKHPAHVPMWRGAKISYFFIALCIFPISIGGFWAYGNLMPS----GGMLA  365

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++ +CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  366   ALYAFHIHDIPRGLLATAFLLVVFSCLSSFQIYSMPAFDSFEAGYTSRTN--KPCSIWVR  423

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  424   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPAKYSFNWYFH  483

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG+      +   +W+++ +GL   FF P
Sbjct  484   WGLGWLGVAFSLAFSIGGIWSMVTNGLKLKFFKP  517



>ref|XP_007148227.1| hypothetical protein PHAVU_006G190600g [Phaseolus vulgaris]
 ref|XP_007148228.1| hypothetical protein PHAVU_006G190600g [Phaseolus vulgaris]
 ref|XP_007148229.1| hypothetical protein PHAVU_006G190600g [Phaseolus vulgaris]
 gb|ESW20221.1| hypothetical protein PHAVU_006G190600g [Phaseolus vulgaris]
 gb|ESW20222.1| hypothetical protein PHAVU_006G190600g [Phaseolus vulgaris]
 gb|ESW20223.1| hypothetical protein PHAVU_006G190600g [Phaseolus vulgaris]
Length=517

 Score =   403 bits (1036),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 295/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  72    EEMGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAYLGWSWGILS  131

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  132   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  191

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  ++I +S   PNLNS+A +SL+G
Sbjct  192   ALILIGGETMKLFFQIVCGPTCTSNPLTTVEWYLVFTSLSIVLSQ-LPNLNSIAGLSLIG  250

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  LS      F  + NAL +I+ +FRGHN+ 
Sbjct  251   AVTAITYSTMVWILSVSQQRPPS-ISYEPLSLSQPSASVFLAM-NALGIIAFSFRGHNLA  308

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P R  M  G   +Y  IA+C FP+AI G+WAYGN MP     GGIL 
Sbjct  309   LEIQSTMPSTFKHPARVPMWKGAKVAYFFIAMCLFPIAIGGFWAYGNQMP----PGGILT  364

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDIS+ ++   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  365   ALYAFHSHDISRGILALAFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--RPCSIWVR  422

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  Y+  W  N
Sbjct  423   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKQPPKYSFSWYFN  482

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ DGL   FF P
Sbjct  483   WILGWLGVGFSLAFSIGGIWSIVNDGLKLKFFKP  516



>ref|XP_010500291.1| PREDICTED: lysine histidine transporter-like 8 [Camelina sativa]
 ref|XP_010479167.1| PREDICTED: lysine histidine transporter-like 8 [Camelina sativa]
Length=519

 Score =   403 bits (1036),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 298/454 (66%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  73    EDVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  133   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  192

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  193   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  251

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ R P  ++Y+P  + ++    F  + NAL +I+ AFRGHN++
Sbjct  252   AVTAITYSTMVWVLSVSQPR-PATISYEPLSMPSTSGSLF-AVLNALGIIAFAFRGHNLV  309

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   SY  IALC FP++I G+WAYGNLMP+    GG+L 
Sbjct  310   LEIQSTMPSTFKHPAHVPMWRGAKISYFFIALCIFPISIGGFWAYGNLMPS----GGMLA  365

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++ +CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  366   ALYAFHIHDIPRGLLATAFLLVVFSCLSSFQIYSMPAFDSFEAGYTSRTN--KPCSIWVR  423

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  424   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPAKYSFNWYFH  483

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG+      +   +W+++ +GL   FF P
Sbjct  484   WGLGWLGVAFSLAFSIGGIWSMVTNGLKLKFFKP  517



>ref|XP_006434873.1| hypothetical protein CICLE_v10000841mg [Citrus clementina]
 gb|ESR48113.1| hypothetical protein CICLE_v10000841mg [Citrus clementina]
Length=526

 Score =   404 bits (1037),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 205/454 (45%), Positives = 297/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QALLLPVAF  LGW WGI+ 
Sbjct  81    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALLLPVAFAFLGWSWGILS  140

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  141   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  200

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG ++++F++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  201   TLILLGGETMKMFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  259

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TA+ Y T++W LSVS+ RPP  ++Y+P   ++     F  + NAL +I+ AFRGHN+ 
Sbjct  260   AITAVTYSTMVWVLSVSQPRPPN-ISYEPLSSASPAATVF-SVMNALGIIAFAFRGHNLA  317

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             +EIQ T+P+  K P    M  G   +Y+ IA+C FP+AI G+WAYGNLMP+    GG+L 
Sbjct  318   MEIQATMPSTFKHPAHVPMWRGAKVAYLFIAMCLFPVAIGGFWAYGNLMPS----GGMLR  373

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A  +FH HDIS+ L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  374   ALFQFHSHDISRGLLAVTFLLVVFNCLSSFQIYSMPVFDSFEASYTSRTN--RPCSIWVR  431

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  432   SGFRVFYGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFN  491

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  492   WILGWLGVAFSLAFSIGGIWSIVNSGLKLKFFKP  525



>dbj|BAA82706.1| amino acid transporter-like protein 1 [Arabidopsis thaliana]
Length=519

 Score =   403 bits (1036),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 299/454 (66%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  73    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  133   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  192

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   P+LNS+A +SL+G
Sbjct  193   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPDLNSIAGLSLIG  251

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ R P  ++Y+P  + ++    F  + NAL +I+ AFRGHN++
Sbjct  252   AVTAITYSTMVWVLSVSQPR-PATISYEPLSMPSTSGSLF-AVLNALGIIAFAFRGHNLV  309

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   SY LIALC FP++I G+WAYGNLMP+    GG+L 
Sbjct  310   LEIQSTMPSTFKHPAHVPMWRGAKISYFLIALCIFPISIGGFWAYGNLMPS----GGMLA  365

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++ +CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  366   ALYAFHIHDIPRGLLATAFLLVVFSCLSSFQIYSMPAFDSFEAGYTSRTN--KPCSIWVR  423

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  424   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPAKYSFNWYFH  483

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG+      +   +W+++ +GL   FF P
Sbjct  484   WGLGWLGVAFSLAFSIGGIWSMVTNGLKLKFFKP  517



>gb|EYU45070.1| hypothetical protein MIMGU_mgv1a004478mg [Erythranthe guttata]
Length=525

 Score =   403 bits (1036),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 209/454 (46%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QALLLPVAF+ LGW WGII 
Sbjct  79    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALLLPVAFSFLGWSWGIIA  138

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+ +LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  139   LTIAYFWQLYTLRILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  198

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  199   ALILVGGETMKLFFQIVCGPHCSSNPLTSVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  257

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  + TS    F  + NAL +++ AFRGHN++
Sbjct  258   AVTAITYSTMVWVLSVSQQRPPT-LSYEPISMPTSTASVF-TVLNALGIVAFAFRGHNLV  315

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y+ IA+C FP+AI GYWAYGNLMP+    GGILN
Sbjct  316   LEIQATMPSTFKKPAHVPMWRGAKVAYVFIAMCVFPVAIGGYWAYGNLMPS----GGILN  371

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH  DI + L+   +++++  CL ++QIY++PV D++E  Y  +      CP WVR
Sbjct  372   ALFGFHSRDIPRGLLAVTFLLVVFNCLSSFQIYSMPVFDSFEAGYTGRTN--RPCPIWVR  429

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G ++  + VA PFL SLAG +G +T+P+TFAYPCFMW  IKKP  Y+  W ++
Sbjct  430   SGFRVFYGFISLFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWALIKKPVKYSFDWYLS  489

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  490   WVLGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP  523



>ref|XP_008220718.1| PREDICTED: lysine histidine transporter-like 8 [Prunus mume]
Length=522

 Score =   403 bits (1035),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF+ LGW WG + 
Sbjct  76    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFSFLGWSWGTLS  135

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  136   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  195

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  196   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  254

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L +S    F  + NAL +++ AFRGHN++
Sbjct  255   AVTAITYSTMVWVLSVSQPRPPT-ISYEPITLPSSSASVF-AVLNALGIVAFAFRGHNLV  312

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GGILN
Sbjct  313   LEIQATMPSTFKHPAHVPMWKGAKVAYFFIAMCLFPVAIGGFWAYGNLMPS----GGILN  368

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  369   ALYGFHSHDIPRGLLAMCFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  426

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G + + + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  427   SGFRVFYGFINFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFH  486

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  487   WILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKP  520



>ref|XP_010690281.1| PREDICTED: lysine histidine transporter-like 8 [Beta vulgaris 
subsp. vulgaris]
Length=475

 Score =   401 bits (1031),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 216/480 (45%), Positives = 305/480 (64%), Gaps = 24/480 (5%)
 Frame = -1

Query  1511  TSTRIAP-----------VDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSG  1365
             TS RI P           VD++N      +     D+ LPITESR GN +S   H++SS 
Sbjct  3     TSNRITPIEWEELPAQKNVDLENNSIEMQKESDSTDAWLPITESREGNVWSCIFHLVSSR  62

Query  1364  IGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVA  1185
             +G QAL LPVAF +LGWVWG+I LSL FVWQLYT WLLV LHES++G R+SR++ LA+ A
Sbjct  63    LGTQALFLPVAFATLGWVWGVIYLSLGFVWQLYTGWLLVHLHESSSGVRYSRFLQLASTA  122

Query  1184  FGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTMCGG---DPKGLTGAEWFLLF  1014
             FG K+ K    FP +YLSGG+C +L++ GG +L+L Y  +C      PK L  + WFL+F
Sbjct  123   FGPKLAKWLCTFPVLYLSGGTCTILVVTGGSTLKLLYDVICSQLSHCPKNLDTSIWFLIF  182

Query  1013  VCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLST-S  837
             V IA  +S   P+LNSL W+S LGS+ ++    ILW  S++KG   +  +Y+P       
Sbjct  183   VLIASLLSQ-HPSLNSLRWVSFLGSIVSLLIFAILWITSIAKGS-IKDASYNPTYEDLGD  240

Query  836   KLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHF  657
             KL  F     A+ +I+L+FRGHN+ILEIQGTLP+N+K P    M   +  SY+L+ALC F
Sbjct  241   KLTSFISTIFAMELIALSFRGHNLILEIQGTLPSNSKHPSHITMWKALQFSYLLVALCIF  300

Query  656   PLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYAL  477
             PLAIAGYWAYG+ M     + G+L A  +FH    S +++G I +++ +  LC+Y +YA+
Sbjct  301   PLAIAGYWAYGDKM----TRTGMLYALREFHKDKGSTTILGLILVLLSVHQLCSYPVYAM  356

Query  476   PVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFG-GLTYLVSVAFPFLGSLAGFIGSITMP  300
             P  DN+E  Y+  KK    CP W+R   ++ +   + + +++A PFL SLA   G+I M 
Sbjct  357   PTYDNFELRYVMAKK--KQCPVWMRRTFRLFYCFAVNFFLAMALPFLPSLAPITGAIAMV  414

Query  299   LTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             LTF+YPC M++ IKKP+ +  ++ +N GLGCLG+++  +    ++W L  +GL ANFFNP
Sbjct  415   LTFSYPCIMYVCIKKPKVWEPMFLLNWGLGCLGVVLSVIYFIVSIWVLSREGLTANFFNP  474



>ref|XP_006393548.1| hypothetical protein EUTSA_v10011394mg [Eutrema salsugineum]
 gb|ESQ30834.1| hypothetical protein EUTSA_v10011394mg [Eutrema salsugineum]
Length=518

 Score =   402 bits (1034),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 205/454 (45%), Positives = 297/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  73    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ ++WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  133   LTIAYIWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  192

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  193   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  251

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ R P  ++Y+P  + +     F  + NAL +++ AFRGHN++
Sbjct  252   AVTAITYSTMVWVLSVSQPR-PATISYEPLSMPSVSGSLF-SVLNALGIVAFAFRGHNLV  309

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IALC FP++I G+WAYGNLMP    +GG+L 
Sbjct  310   LEIQSTMPSTFKHPAHVPMWRGAKVAYFFIALCIFPISIGGFWAYGNLMP----QGGMLA  365

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  366   ALYAFHIHDIPRGLLATAFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--KPCSIWVR  423

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  424   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPAKYSFNWYFH  483

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG+      +   +W+++  GL   FF+P
Sbjct  484   WGLGWLGVAFSLAFSIGGIWSMVTQGLKLKFFSP  517



>gb|KDP38411.1| hypothetical protein JCGZ_04336 [Jatropha curcas]
Length=521

 Score =   402 bits (1034),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 209/454 (46%), Positives = 294/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  75    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  195   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y P  L +     F  + NAL +I+ AFRGHN+ 
Sbjct  254   AITAITYSTMVWVLSVSQQRPPS-ISYQPLSLPSFGASIF-SVMNALGIIAFAFRGHNLA  311

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GGILN
Sbjct  312   LEIQATMPSTFKHPAHVPMWKGAKVAYFFIAMCLFPVAIGGFWAYGNLMPS----GGILN  367

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  368   ALYGFHSHDIPRGLLALTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  425

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  426   SGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPIKYSFNWYFN  485

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  486   WILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKP  519



>ref|XP_002284114.1| PREDICTED: lysine histidine transporter-like 8 [Vitis vinifera]
 emb|CBI19587.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   402 bits (1033),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 208/457 (46%), Positives = 296/457 (65%), Gaps = 17/457 (4%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  69    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  128

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  129   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  188

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  189   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  247

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDP---PQLSTSKLDRFRDIANALAVISLAFRGH  771
             ++TAI Y T++W LSVS+ RPP  ++Y P   P  S S       + NAL +++ AFRGH
Sbjct  248   AVTAITYSTMVWVLSVSQQRPPP-ISYQPLSSPSFSASVF----SVMNALGIVAFAFRGH  302

Query  770   NIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGG  591
             N+ +EIQ T+P+  K P    M  G   +Y+LIA+C FP+AI G+WAYGNLMP+    GG
Sbjct  303   NLAMEIQATMPSTFKHPAHVPMWRGAKVAYVLIAMCIFPVAIGGFWAYGNLMPS----GG  358

Query  590   ILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPK  411
             ILNA   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  
Sbjct  359   ILNALYGFHSHDIPRGLLAMTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSI  416

Query  410   WVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVW  231
             WVR G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  ++  W
Sbjct  417   WVRSGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKFSFNW  476

Query  230   CVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               N  LG LG+      +   +W+++  GL   FF P
Sbjct  477   YFNWILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKP  513



>gb|KHG25598.1| Lysine histidine transporter-like 8 [Gossypium arboreum]
Length=518

 Score =   402 bits (1033),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 205/454 (45%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  73    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  133   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  192

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  193   ALILIGGETMKLFFQVVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  251

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L +S    F  + NAL +++ AFRGHN++
Sbjct  252   AITAITYSTMVWVLSVSQQRPPT-ISYEPLSLPSSSAALF-SVMNALGIVAFAFRGHNLV  309

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   ++  IA+C FP+AI G+WAYGNLMP+    GGILN
Sbjct  310   LEIQATMPSTFKNPAHVPMWRGAKVAFFFIAMCLFPVAIGGFWAYGNLMPS----GGILN  365

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH H I + L+   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  366   ALYAFHSHSIPRGLLALTFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--RPCSIWVR  423

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  Y+  W  N
Sbjct  424   SGFRVFYGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKRPPKYSFNWYFN  483

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ +GL   FF P
Sbjct  484   WILGWLGVAFSLAFSIGGIWSIVNNGLKLKFFKP  517



>ref|XP_003545851.1| PREDICTED: lysine histidine transporter-like 8-like isoform X1 
[Glycine max]
 ref|XP_006597400.1| PREDICTED: lysine histidine transporter-like 8-like isoform X2 
[Glycine max]
Length=516

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 206/454 (45%), Positives = 295/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  71    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAYLGWSWGILS  130

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  131   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  190

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  ++I +S   PNLNS+A +SL+G
Sbjct  191   ALILIGGETMKLFFQIVCGPTCTSNPLTTVEWYLVFTSLSIVLSQ-LPNLNSIAGLSLIG  249

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L+      F  + NAL +I+ +FRGHN+ 
Sbjct  250   AVTAITYSTMVWVLSVSQQRPPS-ISYEPLSLAQPSASVFLAM-NALGIIAFSFRGHNLA  307

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P R  M  G   +Y  IA+C FP+AI G+WAYGN MP     GGIL 
Sbjct  308   LEIQSTMPSTFKHPARVPMWKGAKVAYFFIAMCLFPIAIGGFWAYGNQMP----PGGILT  363

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDIS+ ++   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  364   ALYAFHSHDISRGILALAFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--RPCSIWVR  421

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  Y+  W  N
Sbjct  422   SGFRVFYGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKQPPKYSFNWYFN  481

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ DGL   FF P
Sbjct  482   WILGWLGVAFSLAFSIGGIWSIVNDGLKLKFFKP  515



>gb|AEP14525.1| lysine/histidine transporter [Phytolacca acinosa]
Length=521

 Score =   402 bits (1032),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 206/454 (45%), Positives = 295/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF+ LGW WGI+ 
Sbjct  76    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALILPVAFSFLGWGWGILS  135

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L + + WQLYT+W+LV LHE+  G R++RYV LA  AFG K+G   A+FPT+YLS G+  
Sbjct  136   LIIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGEKLGVWLALFPTVYLSAGTAT  195

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  196   ALILVGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  254

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPPQ ++Y P    ++    F  + NAL +I+ AFRGHN++
Sbjct  255   AVTAITYSTMVWVLSVSQSRPPQ-MSYQPISFPSAAASLF-SVLNALGIIAFAFRGHNLV  312

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI GYWAYGNLMP+    GG+L 
Sbjct  313   LEIQATMPSTFKHPAHVPMWKGAKVAYFFIAMCLFPIAIGGYWAYGNLMPS----GGMLT  368

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++  CL ++QIY++PV D++E  Y  +      C  WVR
Sbjct  369   ALYAFHIHDIPRGLLAMAFLLVVFNCLSSFQIYSMPVYDSFEASYTCRTN--RPCSVWVR  426

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V++G +  L+ VAFPFL SLAG +G +T+P+TFAYPCFMW+ +K+P  ++  W  +
Sbjct  427   SGFRVIYGFINLLIGVAFPFLSSLAGLLGGLTLPVTFAYPCFMWVLLKQPPKHSFNWYFH  486

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG +G+          +W+++  GL   FF P
Sbjct  487   WTLGWIGIAFSLAFTIGGIWSIVTSGLKLKFFKP  520



>ref|XP_003543081.1| PREDICTED: lysine histidine transporter-like 8-like [Glycine 
max]
Length=516

 Score =   402 bits (1032),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 294/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL LPVAF  LGW WGI+ 
Sbjct  71    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALFLPVAFAYLGWSWGILS  130

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  131   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  190

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  ++I +S   PNLNS+A +SL+G
Sbjct  191   ALILIGGETMKLFFQIVCGPTCTSNPLTTVEWYLVFTSLSIVLSQ-LPNLNSIAGLSLIG  249

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  LS      F  + NAL +I+ +FRGHN+ 
Sbjct  250   AVTAITYSTMVWVLSVSQQRPPS-ISYEPLSLSQPSASVFLAM-NALGIIAFSFRGHNLA  307

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P R  M  G   +Y  IA+C FP+AI G+WAYGN MP     GGIL 
Sbjct  308   LEIQSTMPSTFKHPARVPMWKGAKVAYFFIAMCLFPIAIGGFWAYGNQMP----PGGILT  363

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDIS+ ++   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  364   ALYAFHSHDISRGILALAFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--RPCSIWVR  421

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  Y+  W  N
Sbjct  422   SGFRVFYGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKQPPKYSFNWYFN  481

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ DGL   FF P
Sbjct  482   WILGWLGVGFSLAFSIGGIWSIVNDGLKFKFFKP  515



>ref|XP_010255084.1| PREDICTED: lysine histidine transporter-like 8 isoform X1 [Nelumbo 
nucifera]
Length=520

 Score =   402 bits (1032),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 209/457 (46%), Positives = 294/457 (64%), Gaps = 17/457 (4%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGII 
Sbjct  75    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGIIS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  195   ALILTGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDP---PQLSTSKLDRFRDIANALAVISLAFRGH  771
             ++TAI Y T++W LSVS+ R P  ++Y P   P  S S       I NAL +I+ AFRGH
Sbjct  254   AVTAITYSTMVWVLSVSQPR-PSSISYQPLASPSFSASVF----SIMNALGIIAFAFRGH  308

Query  770   NIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGG  591
             N+ LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GG
Sbjct  309   NLALEIQATMPSTFKHPAHVPMWRGAKVAYFFIAMCLFPVAIGGFWAYGNLMPS----GG  364

Query  590   ILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPK  411
             IL A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y  +      C  
Sbjct  365   ILGALYAFHNHDIPRGLLATTFLLVVFNCLSSFQIYSMPVFDSFEAGYTGRTN--RPCSI  422

Query  410   WVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVW  231
             WVR G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP+ ++  W
Sbjct  423   WVRSGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPQKFSFNW  482

Query  230   CVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               N  LG LG+     L+   +W+++ +GL   FF P
Sbjct  483   YFNWTLGWLGIAFSLALSIGGVWSIVNNGLKFKFFKP  519



>ref|XP_009411314.1| PREDICTED: lysine histidine transporter-like 8 [Musa acuminata 
subsp. malaccensis]
Length=547

 Score =   402 bits (1034),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 295/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++GIG QALLLPVAF  LGW WGI+ 
Sbjct  102   EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGIGFQALLLPVAFAFLGWSWGIVA  161

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ ++WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  162   LTIAYIWQLYTLWILVKLHEAMPGRRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  221

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG ++++F++ +CG       L+  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  222   ALILIGGETMKMFFQIVCGPLCSSNPLSTVEWYLVFTILCIVLSQ-LPNLNSIAGLSLIG  280

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T+ W LSVS+ RPP  ++Y P    +     F  I NAL +I+ AFRGHN+ 
Sbjct  281   AVTAITYATMAWLLSVSQERPPS-ISYQPMASPSFGAAAF-SILNALGIIAFAFRGHNLA  338

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y+LIA+C FP+AI G+WAYG+LMP     GG+LN
Sbjct  339   LEIQATMPSTFKHPAHVPMWRGAKVAYLLIAMCLFPIAIGGFWAYGDLMPA----GGMLN  394

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  395   ALYAFHSHDIPRGLLATTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSVWVR  452

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMWI IKKP  ++  W +N
Sbjct  453   SGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWIRIKKPERFSFNWYLN  512

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG +G+      +   +W+++  GL   FF P
Sbjct  513   WSLGIMGIAFSLAFSMGGVWSMVNSGLKLKFFKP  546



>ref|XP_004485720.1| PREDICTED: lysine histidine transporter-like 8-like [Cicer arietinum]
Length=520

 Score =   401 bits (1030),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 300/454 (66%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN    T H L++G+G QAL+LPVAF  LGW WGII 
Sbjct  75    EEVGHLTKLNPQDAWLPITESRNGNAHYSTFHNLNAGVGFQALVLPVAFAYLGWSWGIIS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTVAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  ++I +S   PNLNS+A +SL+G
Sbjct  195   ALILIGGETMKLFFQIVCGPTCTSNPLTTVEWYLVFTSLSIVLSQ-LPNLNSIAGLSLVG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L++     F  + NAL +++ +FRGHN++
Sbjct  254   AVTAITYSTMVWVLSVSQQRPPS-ISYEPLSLASPSSSLFLAL-NALGIVAFSFRGHNLV  311

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P R  M  G   +Y  IA+C FP+AI G+WAYGN MP+    GGIL 
Sbjct  312   LEIQATMPSTFKHPARVPMWKGAKVAYFFIAMCLFPIAIGGFWAYGNQMPS----GGILT  367

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDIS+ ++   +++++ +CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  368   ALYAFHSHDISRGILALTFLLVVFSCLSSFQIYSMPAFDSFEAGYTSRTN--RPCSIWVR  425

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  Y+  W  N
Sbjct  426   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKQPTKYSFSWYFN  485

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ DGL   FF P
Sbjct  486   WILGWLGVAFSLAFSIGGIWSMVNDGLKLKFFKP  519



>ref|XP_004160601.1| PREDICTED: LOW QUALITY PROTEIN: lysine histidine transporter-like 
8-like [Cucumis sativus]
Length=520

 Score =   401 bits (1030),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 206/454 (45%), Positives = 293/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++GIG QAL+LPVAF  LGW WGI+ 
Sbjct  75    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGIGFQALVLPVAFAFLGWSWGILS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAEAAFGERLGVWLAVFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF+  +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  195   ALILIGGETMKLFFXIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  + ++    F  + NAL +++ AFRGHN++
Sbjct  254   AVTAITYSTMVWVLSVSQQRPPT-ISYEPLSMPSASSSVF-SVMNALGIVAFAFRGHNLV  311

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA C FP+AI GYWAYGNLMP+    GG+LN
Sbjct  312   LEIQSTMPSTFKHPAHVPMWRGAKVAYFFIAACLFPVAIGGYWAYGNLMPS----GGMLN  367

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  368   AIYAFHSHDIPRGLLAITFLLVVFNCLSSFQIYSMPVFDSFEASYTSRTN--RPCSIWVR  425

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G + + + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK P  ++  W  +
Sbjct  426   SGFRVFYGFVNFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKXPTKFSFNWYFH  485

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+L+  GL   FF P
Sbjct  486   WTLGWLGIAFSLAFSIGGIWSLVNSGLKLKFFKP  519



>ref|XP_010683959.1| PREDICTED: lysine histidine transporter-like 8 [Beta vulgaris 
subsp. vulgaris]
Length=527

 Score =   401 bits (1031),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 205/454 (45%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL LPVAF+ LGW WGI  
Sbjct  82    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALFLPVAFSFLGWGWGIFS  141

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG K+G   A+FPT+YLS G+  
Sbjct  142   LTIAYFWQLYTLWVLVQLHEAVPGKRYNRYVELAQAAFGEKLGIWLALFPTVYLSAGTAT  201

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  202   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  260

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T+ W LSVS+ RPPQ ++Y+P  L ++    F  + NAL +++ AFRGHN++
Sbjct  261   AVTAITYSTMFWVLSVSQERPPQ-ISYEPISLPSATASLFSAL-NALGIVAFAFRGHNLV  318

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI GYWAYGNLMP+    GG+L 
Sbjct  319   LEIQATMPSTFKHPAHVPMWKGAKVAYFFIAMCLFPMAIGGYWAYGNLMPS----GGMLT  374

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH H+I++ L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  375   AIYAFHSHNIARGLLAMAFLLVVFNCLSSFQIYSMPVFDSFEASYTSRTN--RPCSVWVR  432

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
                +V +G ++ L+ VA PFL SLAG +G +T+P+TFAYPCFMW+ +K+P  ++  W  N
Sbjct  433   SSFRVFYGFISLLIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLLKQPPKHSCSWYFN  492

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG +G+      +   +W++I +GL   FF P
Sbjct  493   WILGWMGIAFSLAFSMGGIWSIITNGLKLKFFKP  526



>gb|KFK29080.1| hypothetical protein AALP_AA7G086300 [Arabis alpina]
Length=518

 Score =   400 bits (1029),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 204/454 (45%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  73    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  133   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  192

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       L+  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  193   ALILIGGETMKLFFQIVCGPLCTSNPLSTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  251

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ R P  ++Y+P  + ++    F  + NAL +++ AFRGHN+ 
Sbjct  252   AVTAITYSTMVWVLSVSQPR-PATISYEPLSMPSASGSLF-SVLNALGIVAFAFRGHNLA  309

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IALC FP++I G+WAYGNLMP+    GG+L 
Sbjct  310   LEIQSTMPSTFKHPAHVPMWRGAKVAYFFIALCIFPISIGGFWAYGNLMPS----GGMLA  365

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FHIHDI + L+   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  366   ALYAFHIHDIPRGLLATAFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--KPCSIWVR  423

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  424   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPSKYSFNWYFH  483

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG+      +   +W+++ +GL   FF P
Sbjct  484   WGLGWLGVAFSLAFSIGGIWSMVTNGLKLKFFKP  517



>ref|XP_009364081.1| PREDICTED: lysine histidine transporter-like 8 [Pyrus x bretschneideri]
Length=522

 Score =   400 bits (1029),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 206/454 (45%), Positives = 295/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF+ LGW WG + 
Sbjct  76    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFSFLGWSWGTLS  135

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS  +  
Sbjct  136   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSARTAT  195

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  196   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  254

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P  L +S    F  + NAL +++ AFRGHN++
Sbjct  255   AVTAITYSTMVWVLSVSQPRPPT-ISYEPISLPSSSASVF-AVLNALGIVAFAFRGHNLV  312

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GGILN
Sbjct  313   LEIQATMPSTFKHPAHVPMWRGAKVAYFFIAMCLFPVAIGGFWAYGNLMPS----GGILN  368

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  369   ALYGFHSHDIPRGLLAMCFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  426

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G + + + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  +
Sbjct  427   SGFRVFYGFINFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFH  486

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  487   WILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKP  520



>ref|XP_010263781.1| PREDICTED: lysine histidine transporter-like 8 [Nelumbo nucifera]
Length=520

 Score =   400 bits (1029),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 207/457 (45%), Positives = 294/457 (64%), Gaps = 17/457 (4%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGII 
Sbjct  75    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGIIS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       L+  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  195   ALILIGGETMKLFFQIVCGPFCSSNPLSTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  253

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDP---PQLSTSKLDRFRDIANALAVISLAFRGH  771
             ++TAI Y T++W LSVS+ RPP  ++Y P   P  S S       I NAL +++ AFRGH
Sbjct  254   AVTAITYSTMVWVLSVSQPRPPT-ISYQPLSSPSFSASVF----SIMNALGIVAFAFRGH  308

Query  770   NIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGG  591
             N+ +EIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GG
Sbjct  309   NLAMEIQATMPSTFKHPAHVPMWRGAKVAYFFIAMCLFPVAIGGFWAYGNLMPS----GG  364

Query  590   ILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPK  411
             IL A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  
Sbjct  365   ILGALYAFHNHDIPRGLLATTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSI  422

Query  410   WVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVW  231
             WVR G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP+ ++  W
Sbjct  423   WVRSGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPKKFSFNW  482

Query  230   CVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               N  LG LG+      +   +W+++  GL   FF P
Sbjct  483   YFNWILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKP  519



>ref|XP_006856239.1| hypothetical protein AMTR_s00059p00214190 [Amborella trichopoda]
 gb|ERN17706.1| hypothetical protein AMTR_s00059p00214190 [Amborella trichopoda]
Length=547

 Score =   400 bits (1028),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 207/457 (45%), Positives = 297/457 (65%), Gaps = 17/457 (4%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN +    H L++GIG QAL+LPVAFT LGW WGII 
Sbjct  102   EDIGHLTKLNPQDAWLPITESRNGNAYYAAFHNLNAGIGFQALILPVAFTFLGWSWGIIS  161

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L + + WQLYT+W+LV LHE+  G R++RYV LA  AFG K+G   A+FPT+YLS G+  
Sbjct  162   LVIAYCWQLYTLWVLVRLHEAVPGKRYNRYVELAQAAFGEKLGVWLALFPTVYLSAGTAT  221

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG   +   L+  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  222   ALILIGGETMKLFFQIVCGPNCESNPLSTIEWYLVFTTLCIVLSQ-LPNLNSIAGLSLVG  280

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDP---PQLSTSKLDRFRDIANALAVISLAFRGH  771
             ++TAI Y T+ W LSVS+ RPP  ++Y P   P  S + L     + N+L +I+  FRGH
Sbjct  281   AITAITYSTMSWVLSVSQPRPPS-ISYQPLRSPSFSVTAL----SLLNSLGIIAFTFRGH  335

Query  770   NIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGG  591
             N+ LEIQ T+P+  K P    M  G   +Y+LIA+C FP+AI G+WAYGN MP     GG
Sbjct  336   NLALEIQATMPSTLKHPAHTPMWKGAKVAYLLIAMCLFPIAIGGFWAYGNSMPA----GG  391

Query  590   ILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPK  411
             +LNA   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  
Sbjct  392   MLNALYGFHSHDIPRGLLAVTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSI  449

Query  410   WVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVW  231
             WVR G ++ +G +++ + +A PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  ++  W
Sbjct  450   WVRSGFRIFYGFISFFIGIALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKRPTRFSFSW  509

Query  230   CVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              +N  LG LG+     L+   +W+++  GL   FF P
Sbjct  510   YLNWTLGILGIAFSMALSAGGVWSMVNSGLKLKFFKP  546



>emb|CDP07603.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   398 bits (1022),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 291/454 (64%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G G QAL+LPVAF+ LGW WGII 
Sbjct  78    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGFGFQALVLPVAFSFLGWSWGIIS  137

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  138   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGDRLGVWLALFPTVYLSAGTAT  197

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  198   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  256

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T+ W LSVS+ RPP  ++Y P  L  S         NAL +I+ AFRGHN++
Sbjct  257   AVTAIIYSTMAWILSVSQQRPPL-ISYQPISLP-SPSATLSSFLNALGIIAFAFRGHNLV  314

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GGILN
Sbjct  315   LEIQATMPSTFKHPAHVPMWKGAKFAYCFIAMCLFPVAIGGFWAYGNLMPS----GGILN  370

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  371   ALYAFHSHDIPRGLLAMTFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--RPCSIWVR  428

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  Y+  W  +
Sbjct  429   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKRPTKYSFNWYFH  488

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  489   WTLGWLGVAFSLAFSIGGIWSIVNSGLKLKFFKP  522



>gb|KHG19466.1| Lysine histidine transporter-like 8 [Gossypium arboreum]
Length=519

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 296/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  74    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILA  133

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  134   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  193

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  194   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  252

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RPP  ++Y+P    +S    F  + NAL +++ AFRGHN++
Sbjct  253   AVTAITYSTMVWVLSVSQERPPT-ISYEPLSFPSSA-AAFFSVMNALGIVAFAFRGHNLV  310

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GGILN
Sbjct  311   LEIQATMPSTFKHPAHVPMWIGAKVAYFFIAMCLFPVAIGGFWAYGNLMPS----GGILN  366

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  367   ALYGFHSHDIPRGLLALAFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVR  424

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G + + + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  Y+  W  N
Sbjct  425   SGFRVFYGFVNFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKRPTKYSFNWYFN  484

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++ DGL   FF P
Sbjct  485   WILGWLGIAFSLAFSIGGIWSIVNDGLKLKFFKP  518



>gb|KCW68788.1| hypothetical protein EUGRSUZ_F02389 [Eucalyptus grandis]
Length=524

 Score =   396 bits (1017),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 205/454 (45%), Positives = 290/454 (64%), Gaps = 14/454 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QALLLPVAF  LGW WGI+ 
Sbjct  82    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALLLPVAFAFLGWSWGILS  141

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG K+G   A+FPT+YLS G+  
Sbjct  142   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGEKLGLWLAVFPTVYLSAGTAT  201

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  202   ALILIGGETMKLFFQIVCGPLCSSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLVG  260

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI YCT++W LSVS+ RPP  + Y+P  L +     F  + NAL +++ AFRGHN++
Sbjct  261   AVTAITYCTMVWVLSVSQERPPT-ILYEPLSLPSFNASVF-SVMNALGIVAFAFRGHNLV  318

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGN       +  ILN
Sbjct  319   LEIQATMPSTFKHPAHVPMWKGAKVAYFFIAMCLFPVAIGGFWAYGN-------QVRILN  371

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A  +FH  DI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR
Sbjct  372   ALYRFHSRDIPRGLLAMTFLLVVFNCLSSFQIYSMPVFDSFEASYTSRTN--RPCSIWVR  429

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G + + + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP  Y+  W  N
Sbjct  430   SGFRVFYGFVNFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPTKYSFNWYFN  489

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               LG LG+      +   +W+++  GL   FF P
Sbjct  490   WILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP  523



>gb|AAO41951.1| putative amino acid permease [Arabidopsis thaliana]
 gb|ABG48493.1| At4g35180 [Arabidopsis thaliana]
Length=456

 Score =   393 bits (1010),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 210/459 (46%), Positives = 291/459 (63%), Gaps = 12/459 (3%)
 Frame = -1

Query  1493  PVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGW  1314
             P  I  E         P++  LPITESR GN ++ T H+L SGIGLQ +LLP AF +LGW
Sbjct  9     PQPISGEKNGGDGGRIPVEEWLPITESRKGNVYTATFHLLCSGIGLQVILLPAAFAALGW  68

Query  1313  VWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYL  1134
             VWG I L++ FVW+LYT WLLV LHE+  G R SRYV LA  +FG K+GKL  IFP MYL
Sbjct  69    VWGTIILTVGFVWKLYTTWLLVQLHEAVPGIRISRYVRLAIASFGVKLGKLLGIFPVMYL  128

Query  1133  SGGSCVMLIINGGGSLQLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWI  954
             SGG+C +L+I GG S+Q   + M   +   LT  + FL+F CIA+ +S  FPNLNSL  +
Sbjct  129   SGGACTILVITGGKSIQQLLQIMSDDNTAPLTSVQCFLVFSCIAMIMSQ-FPNLNSLFGV  187

Query  953   SLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDR-FRDIANALAVISLAFR  777
             SL+G+   IAYCT++W L V+       V+     +S + +D+ F  I NA+ +I+L +R
Sbjct  188   SLIGAFMGIAYCTVIWILPVASDSQRTQVS-----VSYATMDKSFVHIFNAIGLIALVYR  242

Query  776   GHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKK  597
             G+N++LEIQGTLP+++K P  + M   V+ S+ L+A+C FPL  A YWAYG+ +P +   
Sbjct  243   GNNLVLEIQGTLPSDSKNPSCKTMWRAVMISHALVAICMFPLTFAVYWAYGDKIPAT---  299

Query  596   GGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSC  417
             GG +  + K +  + SK     I++  I +CLC+Y I  +P  DN E +Y++KKK   S 
Sbjct  300   GGPVGNYLKLYTQEHSKRAACFIHLTFIFSCLCSYPINLMPACDNIEMVYITKKKKPASI  359

Query  416   PKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTL  237
                VRM L+V    + + ++V FPFL  LA  IG+I + +TF YPCFMWI+IKKP+  + 
Sbjct  360   --IVRMMLRVFLSLVCFTIAVGFPFLPYLAVLIGAIALLVTFTYPCFMWISIKKPQRKSP  417

Query  236   VWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +W  N+ +GCLG  +  +L  A+   L   GLHANFF P
Sbjct  418   MWLFNVLVGCLGASLSVLLLVASAMRLAQKGLHANFFRP  456



>ref|XP_002312929.1| hypothetical protein POPTR_0009s14290g [Populus trichocarpa]
 gb|EEE86884.1| hypothetical protein POPTR_0009s14290g [Populus trichocarpa]
Length=515

 Score =   394 bits (1013),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 207/453 (46%), Positives = 298/453 (66%), Gaps = 11/453 (2%)
 Frame = -1

Query  1469  AAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLS  1290
             A Q+    P D+ LPITESRNGN +    H L SGIG QAL+LPV+FT LGW WGII L+
Sbjct  70    ALQLTKLDPQDAWLPITESRNGNAWYAAFHCLCSGIGFQALVLPVSFTVLGWAWGIIALT  129

Query  1289  LLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVM  1113
             + F WQLYT +LLV LHE+T TG R+SRY+ + +  FG K  K   +FP +YLS G+CV 
Sbjct  130   VAFAWQLYTFYLLVQLHENTETGIRYSRYLQIMSANFGEKKAKWLGLFPILYLSIGTCVA  189

Query  1112  LIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGS  939
             L I GG + +LF++T+CG     K LT  EW+L+F   A+ +S   PNLNS+A +SL+GS
Sbjct  190   LNIIGGSTSKLFFQTVCGQSCTVKTLTPVEWYLVFASAAVLLSQ-LPNLNSIAGVSLIGS  248

Query  938   LTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIIL  759
             +TA+ YCTI+W +SV+K R P G+TY P +    ++DR  ++ N+L +I+ AFRGHN++L
Sbjct  249   ITAVVYCTIMWMVSVNKDRLP-GITYKPVR-GPKEVDRLFEVLNSLGIIAFAFRGHNLVL  306

Query  758   EIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNA  579
             EIQ T+P++ K P R  M  G  A+Y +IA C FPLAI G+WAYG  +P   K GG+ +A
Sbjct  307   EIQATMPSSEKHPSRVPMWKGAKAAYAVIAACLFPLAIGGFWAYGQRIP---KNGGLQSA  363

Query  578   FEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRM  399
             F  +  +D S+ +MG + ++III  L ++QIYA+P+ D  E I+   K+M   C  W+R+
Sbjct  364   FYAYRRNDTSEFIMGLVSLLIIINALSSFQIYAMPMFDELESIF--TKRMKKPCQWWLRI  421

Query  398   GLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNM  219
              L+  FG   + ++VA P +GS+ G +G I++P+T AYPCFMW+ +KKP+ Y  +W +N 
Sbjct  422   ILRAFFGYGVFFLAVAIPSIGSVGGLVGGISLPVTLAYPCFMWLRMKKPKKYGKMWYLNW  481

Query  218   GLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              LG  G+++      A ++ +  +     +F P
Sbjct  482   SLGITGLILSVSFMAAGVYVIKENDSKFEWFKP  514



>gb|EEC69290.1| hypothetical protein OsI_38347 [Oryza sativa Indica Group]
Length=508

 Score =   394 bits (1012),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 216/454 (48%), Positives = 297/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESR+GN      H L++G+G QALLLP+AF +LGW WGII 
Sbjct  62    EEVGHLTRLNPQDAWLPITESRSGNARYAAFHTLNAGLGFQALLLPLAFPALGWSWGIIS  121

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG K+G   ++FPT+YLS GS  
Sbjct  122   LTVAYFWQLYTLWILVKLHEAVPGRRYNRYVELAQAAFGEKLGMWLSLFPTIYLSAGSAT  181

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LFY+ +CG    P  ++  EW+L+F  +AI +S   PNLNS+A +SL+G
Sbjct  182   ALILVGGETMKLFYQIVCGPICSPSPISTIEWYLVFTSLAIVLSQ-LPNLNSIAGVSLIG  240

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
               TAI YCT+ W LSVS+ RPP  V+Y+ PQ  TS         NAL +I+ AFRGHN+ 
Sbjct  241   GTTAITYCTMSWVLSVSQPRPPT-VSYE-PQAYTSLGSSLFSTLNALGIIAFAFRGHNLA  298

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y LIA+C FP+AI GYWAYGN++P    +GG+L 
Sbjct  299   LEIQATMPSTFKHPAHVTMWRGAKVAYALIAMCLFPVAIGGYWAYGNMVP----QGGMLT  354

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+ A +++++  CL ++QIY++PV D++E  Y  +      C  WVR
Sbjct  355   ALYAFHSHDIPRGLLAATFLLVVFNCLSSFQIYSMPVFDSFEAAYTGRTN--RPCSVWVR  412

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G L+  +SVA PFL SLAG +G +T+P+TFAYPCFMWI IKKP  ++  W +N
Sbjct  413   SGFRVFYGFLSLFISVALPFLSSLAGLLGGLTLPVTFAYPCFMWICIKKPERFSSGWYLN  472

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG      L    +W++I+ G+   FF P
Sbjct  473   WGLGLLGTAFSLSLCVGGVWSIISSGMKFKFFKP  506



>ref|NP_567977.2| LYS/HIS transporter 7 [Arabidopsis thaliana]
 sp|Q84WE9.2|LHTL7_ARATH RecName: Full=Lysine histidine transporter-like 7 [Arabidopsis 
thaliana]
 gb|AEE86477.1| LYS/HIS transporter 7 [Arabidopsis thaliana]
Length=478

 Score =   393 bits (1009),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 210/459 (46%), Positives = 291/459 (63%), Gaps = 12/459 (3%)
 Frame = -1

Query  1493  PVDIDNEPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGW  1314
             P  I  E         P++  LPITESR GN ++ T H+L SGIGLQ +LLP AF +LGW
Sbjct  31    PQPISGEKNGGDGGRIPVEEWLPITESRKGNVYTATFHLLCSGIGLQVILLPAAFAALGW  90

Query  1313  VWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYL  1134
             VWG I L++ FVW+LYT WLLV LHE+  G R SRYV LA  +FG K+GKL  IFP MYL
Sbjct  91    VWGTIILTVGFVWKLYTTWLLVQLHEAVPGIRISRYVRLAIASFGVKLGKLLGIFPVMYL  150

Query  1133  SGGSCVMLIINGGGSLQLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWI  954
             SGG+C +L+I GG S+Q   + M   +   LT  + FL+F CIA+ +S  FPNLNSL  +
Sbjct  151   SGGACTILVITGGKSIQQLLQIMSDDNTAPLTSVQCFLVFSCIAMIMSQ-FPNLNSLFGV  209

Query  953   SLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDR-FRDIANALAVISLAFR  777
             SL+G+   IAYCT++W L V+       V+     +S + +D+ F  I NA+ +I+L +R
Sbjct  210   SLIGAFMGIAYCTVIWILPVASDSQRTQVS-----VSYATMDKSFVHIFNAIGLIALVYR  264

Query  776   GHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKK  597
             G+N++LEIQGTLP+++K P  + M   V+ S+ L+A+C FPL  A YWAYG+ +P +   
Sbjct  265   GNNLVLEIQGTLPSDSKNPSCKTMWRAVMISHALVAICMFPLTFAVYWAYGDKIPAT---  321

Query  596   GGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSC  417
             GG +  + K +  + SK     I++  I +CLC+Y I  +P  DN E +Y++KKK   S 
Sbjct  322   GGPVGNYLKLYTQEHSKRAACFIHLTFIFSCLCSYPINLMPACDNIEMVYITKKKKPASI  381

Query  416   PKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTL  237
                VRM L+V    + + ++V FPFL  LA  IG+I + +TF YPCFMWI+IKKP+  + 
Sbjct  382   --IVRMMLRVFLSLVCFTIAVGFPFLPYLAVLIGAIALLVTFTYPCFMWISIKKPQRKSP  439

Query  236   VWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +W  N+ +GCLG  +  +L  A+   L   GLHANFF P
Sbjct  440   MWLFNVLVGCLGASLSVLLLVASAMRLAQKGLHANFFRP  478



>ref|XP_006283663.1| hypothetical protein CARUB_v10004720mg [Capsella rubella]
 gb|EOA16561.1| hypothetical protein CARUB_v10004720mg [Capsella rubella]
Length=477

 Score =   392 bits (1007),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 211/459 (46%), Positives = 292/459 (64%), Gaps = 17/459 (4%)
 Frame = -1

Query  1481  DNEPAAQVQAFA-----PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLG  1317
             D EP + V+        P++  LPITESR GN ++ T H+L SGIGLQ +LLP AF +LG
Sbjct  31    DPEPISGVKTGGDGGRIPVEEWLPITESRKGNVYTATFHLLCSGIGLQVILLPAAFAALG  90

Query  1316  WVWGIICLSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMY  1137
             WVWG I L++ FVW+LYT WLLV LHE+  G R SR+V LA  +FG K+GKL AIFP MY
Sbjct  91    WVWGTIILTVGFVWKLYTTWLLVHLHEAVPGIRISRFVRLAIASFGVKLGKLLAIFPVMY  150

Query  1136  LSGGSCVMLIINGGGSLQLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAW  957
             LSGG+C +L+I GG S+Q   + M   +   LT  + FL+F CIAI +S  FPNLNSL  
Sbjct  151   LSGGACTILVITGGKSIQQLLQIMSEDNTAPLTSVQCFLVFSCIAIVMSQ-FPNLNSLFG  209

Query  956   ISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFR  777
             +S++G++  + YCT++W L V+       V Y     +TS    F  I NA+ +I+L FR
Sbjct  210   VSVIGAIMGVTYCTVIWILPVTSDAQKTQVRY-----ATSD-KSFVHIFNAIGLIALVFR  263

Query  776   GHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKK  597
             G+N++LEIQGTLP+++K P    M   V+ S  LIA+C FPL++  YWAYG+ +P +   
Sbjct  264   GNNLVLEIQGTLPSDSKNPSSTTMWRAVMMSQTLIAICMFPLSVVVYWAYGDKIPAT---  320

Query  596   GGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSC  417
             GG +  + K +  + SK     I++  I +CLC+Y I  +P  DN E +Y +KK+   S 
Sbjct  321   GGPVGNYLKLYTQEHSKQAACFIHLTFIFSCLCSYPINLMPACDNAEMVYTTKKQKPASI  380

Query  416   PKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTL  237
                VRM L+V  G + + ++V FPFL  LA  IG+I + +TF YP FMWI+IKKP+  + 
Sbjct  381   --IVRMMLRVFLGMVCFSIAVVFPFLPYLAVLIGAIALLVTFTYPSFMWISIKKPQRKSP  438

Query  236   VWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +W  N+ +GCLG  +  +L  A+  +L   GLHANFFNP
Sbjct  439   MWLFNVLMGCLGASLSVLLLVASAMHLAQKGLHANFFNP  477



>gb|AAM65081.1| amino acid permease-like protein [Arabidopsis thaliana]
Length=456

 Score =   391 bits (1004),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 206/443 (47%), Positives = 287/443 (65%), Gaps = 12/443 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P++  LPITESR GN ++ T H+L SGIGLQ +LLP AF +LGWVWG I L++ FVW+LY
Sbjct  25    PVEEWLPITESRKGNVYTATFHLLCSGIGLQVILLPAAFAALGWVWGTIILTVGFVWKLY  84

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHE+  G R SRYV LA  +FG K+GKL  IFP MYLSGG+C +L+I GG S+
Sbjct  85    TTWLLVQLHEAVPGIRISRYVRLAIASFGVKLGKLLGIFPVMYLSGGACTILVITGGKSI  144

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             Q   + M   +   LT  + FL+F CIA+ +S  FPNLNSL  +SL+G+   IAYCT++W
Sbjct  145   QQLLQIMSDDNTAPLTSVQCFLVFSCIAMIMSQ-FPNLNSLFGVSLIGAFMGIAYCTVIW  203

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDR-FRDIANALAVISLAFRGHNIILEIQGTLPTNT  729
              L V+       V+     +S + +D+ F  I NA+ +I+L +RG+N++LEIQGTLP+++
Sbjct  204   ILPVASDSQRTQVS-----VSYATMDKSFVHIFNAIGLIALVYRGNNLVLEIQGTLPSDS  258

Query  728   KVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDIS  549
             K P  + M   V+ S+ L+A+C FPL    YWAYG+ +P +   GG +  + K +  + S
Sbjct  259   KNPSCKTMWRAVMISHALVAICMFPLTFVVYWAYGDKIPAT---GGPVGNYLKLYTQEHS  315

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K     I++  I +CLC+Y I  +P  DN E +Y++KKK   S    VRM L+V    + 
Sbjct  316   KRAACFIHLTFIFSCLCSYPINLMPACDNIEMVYITKKKKPASI--IVRMMLRVFLSLVC  373

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + ++V FPFL  LA  IG+I + +TF YPCFMWI+IKKP+  + +W  N+ +GCLG  + 
Sbjct  374   FTIAVGFPFLPYLAVLIGAIALLVTFTYPCFMWISIKKPQRKSPMWLFNVLVGCLGASLS  433

Query  188   TVLATATLWNLIADGLHANFFNP  120
              +L  A+   L   GLHANFF P
Sbjct  434   VLLLVASAMRLAQKGLHANFFRP  456



>ref|NP_001066783.1| Os12g0485600 [Oryza sativa Japonica Group]
 gb|ABA98527.1| LILLIM08, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29802.1| Os12g0485600 [Oryza sativa Japonica Group]
 gb|EEE53215.1| hypothetical protein OsJ_36108 [Oryza sativa Japonica Group]
Length=508

 Score =   392 bits (1008),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 215/454 (47%), Positives = 297/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESR+GN      H L++G+G QALLLP+AF +LGW WGII 
Sbjct  62    EEVGHLTRLNPQDAWLPITESRSGNARYAAFHTLNAGLGFQALLLPLAFPALGWSWGIIS  121

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG K+G   ++FPT+YLS GS  
Sbjct  122   LTVAYFWQLYTLWILVKLHEAVPGRRYNRYVELAQAAFGEKLGMWLSLFPTIYLSAGSAT  181

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LFY+ +CG    P  ++  EW+L+F  +AI +S   PNLNS+A +SL+G
Sbjct  182   ALILVGGETMKLFYQIVCGPICSPSPISTIEWYLVFTSLAIVLSQ-LPNLNSIAGVSLIG  240

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
               TAI YCT+ W LSVS+ +PP  V+Y+ PQ  TS         NAL +I+ AFRGHN+ 
Sbjct  241   GTTAITYCTMSWVLSVSQPQPPT-VSYE-PQAYTSLGSSLFSTLNALGIIAFAFRGHNLA  298

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y LIA+C FP+AI GYWAYGN++P    +GG+L 
Sbjct  299   LEIQATMPSTFKHPAHVPMWRGAKVAYALIAMCLFPVAIGGYWAYGNMVP----QGGMLT  354

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HDI + L+ A +++++  CL ++QIY++PV D++E  Y  +      C  WVR
Sbjct  355   ALYAFHSHDIPRGLLAATFLLVVFNCLSSFQIYSMPVFDSFEAAYTGRTN--RPCSVWVR  412

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G L+  +SVA PFL SLAG +G +T+P+TFAYPCFMWI IKKP  ++  W +N
Sbjct  413   SGFRVFYGFLSLFISVALPFLSSLAGLLGGLTLPVTFAYPCFMWICIKKPERFSSGWYLN  472

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG      L    +W++I+ G+   FF P
Sbjct  473   WGLGLLGTAFSLALCVGGVWSIISSGMKFKFFKP  506



>ref|XP_011045403.1| PREDICTED: lysine histidine transporter-like 8 [Populus euphratica]
Length=549

 Score =   394 bits (1012),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 207/453 (46%), Positives = 297/453 (66%), Gaps = 11/453 (2%)
 Frame = -1

Query  1469  AAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLS  1290
             A Q+    P D+ LPITESRNGN +    H L SGIG QAL+LPV+FT LGW WGII L+
Sbjct  104   ALQLTKLDPQDAWLPITESRNGNAWYAAFHCLCSGIGFQALVLPVSFTVLGWAWGIIALT  163

Query  1289  LLFVWQLYTIWLLVDLHEST-TGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVM  1113
             + F WQLYT +LLV LHE+T TG R+SRY+ + +  FG K  K   +FP +YLS G+CV 
Sbjct  164   VAFAWQLYTFYLLVQLHENTETGIRYSRYLQIMSANFGEKKAKWLGLFPILYLSIGTCVA  223

Query  1112  LIINGGGSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGS  939
             L I GG + +LF++T+CG     K LT  EW+L+F   A+ +S   PNLNS+A +SL+GS
Sbjct  224   LNIIGGSTSKLFFQTVCGQSCTVKTLTPVEWYLVFASAAVLLSQ-LPNLNSIAGVSLIGS  282

Query  938   LTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIIL  759
             +TA+ YCTI+W +SV+K R P G+TY P +    ++DR  ++ N+L +I+ AFRGHN++L
Sbjct  283   VTAVVYCTIMWMVSVNKDRLP-GITYKPVR-GPKEVDRLFEVLNSLGIIAFAFRGHNLVL  340

Query  758   EIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNA  579
             EIQ T+P++ K P R  M  G  A+Y +IA C FPLAI G+WAYG  +P   K GG+ +A
Sbjct  341   EIQATMPSSEKHPSRVPMWKGAKAAYAVIAACLFPLAIGGFWAYGQRIP---KNGGLQSA  397

Query  578   FEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRM  399
             F  +   D S+ +MG + ++III  L ++QIYA+P+ D  E I+   K+M   C  W+R+
Sbjct  398   FYAYRRSDTSEFIMGLVSLLIIINALSSFQIYAMPMFDELESIF--TKRMKKPCQWWLRI  455

Query  398   GLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNM  219
              L+  FG   + ++VA P +GS+ G +G I++P+T AYPCFMW+ +KKP+ Y  +W +N 
Sbjct  456   ILRAFFGYGVFFLAVAIPSIGSVGGLVGGISLPVTLAYPCFMWLRMKKPKKYGKMWYLNW  515

Query  218   GLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              LG  G+++      A ++ +  +     +F P
Sbjct  516   SLGITGLILSVSFMAAGVYVIKENDSKFEWFKP  548



>emb|CDY17820.1| BnaC08g04340D [Brassica napus]
Length=458

 Score =   389 bits (999),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 201/454 (44%), Positives = 294/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  13    EEMGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  72

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  73    LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  132

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F C+ + +S   PNLNS+A +SL+G
Sbjct  133   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTCLCVVLSQ-LPNLNSIAGLSLIG  191

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ RP   ++Y+P  + +     F  + NAL +++ AFRGHN++
Sbjct  192   AVTAITYSTMVWVLSVSQPRPAT-ISYEPLSMPSVSGSLF-SVLNALGIVAFAFRGHNLV  249

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IALC FP++I G+WAYG LMP     GG+L 
Sbjct  250   LEIQSTMPSTFKHPAHVPMWRGAKVAYFFIALCIFPISIGGFWAYGKLMP----PGGMLA  305

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A  +FHI+DI + L+   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  306   ALYEFHINDIPRGLLATAFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--KPCSVWVR  363

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP   +  W  +
Sbjct  364   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPAKCSFSWYFH  423

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG+      +   + +++  GL   FF+P
Sbjct  424   WGLGWLGVAFSLAFSIGGISSMVTQGLKLKFFSP  457



>ref|XP_002867086.1| hypothetical protein ARALYDRAFT_491132 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43345.1| hypothetical protein ARALYDRAFT_491132 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   389 bits (1000),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 287/443 (65%), Gaps = 12/443 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P++  LPITESR GN ++ T H+L SGIGLQ +LLP AF +LGWVWG I L++ FVW+LY
Sbjct  47    PVEEWLPITESRKGNVYTATFHLLCSGIGLQVILLPAAFAALGWVWGTIILTVGFVWKLY  106

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHE+  G R SRYV LA  +FG K+GKL  IFP MYLSGG+C +L+I GG SL
Sbjct  107   TTWLLVHLHEAVPGIRMSRYVRLAIHSFGAKLGKLLGIFPVMYLSGGACTILVITGGKSL  166

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             Q   + M   +   LT  + FL+F CIA+ +S  FPNLNSL  +SL+G+   +AYCT++W
Sbjct  167   QQLLQIMSEDNIAPLTSVQCFLVFSCIAMIMSQ-FPNLNSLFGVSLIGAFMGVAYCTVIW  225

Query  905   TLSVSKGRPPQGVTYDPPQLSTSKLDR-FRDIANALAVISLAFRGHNIILEIQGTLPTNT  729
              L V+       V+     +S +  D+ F  I NA+ +I+L +RG+N++LEIQGTLP+++
Sbjct  226   ILPVTSDSQKTQVS-----VSYATADKSFVHIFNAIGLIALVYRGNNLVLEIQGTLPSDS  280

Query  728   KVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDIS  549
             K P  + M   V+ S+ L+A+C FPL    YWAYG+ +P +   GG +  + K +  + S
Sbjct  281   KNPSSKTMWRAVMISHALVAICMFPLTFVVYWAYGDKIPAT---GGPVGNYLKLYTQEHS  337

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K     I++  I +CLC+Y I  +P  DN E +Y++KK+   S    VRM L+V    + 
Sbjct  338   KRAACFIHLTFIFSCLCSYPINLMPACDNIEMVYITKKQKPASIV--VRMMLRVFLSLVC  395

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + ++V FPFL  LA  IG+I + +TF YPCFMWI+IKKP+  + +W  N+ +GCLG  + 
Sbjct  396   FSIAVGFPFLPYLAVLIGAIALLVTFTYPCFMWISIKKPQRKSPMWLFNVLVGCLGASLS  455

Query  188   TVLATATLWNLIADGLHANFFNP  120
              +L  A+   L   GLHANFF+P
Sbjct  456   VLLLVASAMRLAQKGLHANFFSP  478



>ref|XP_009107414.1| PREDICTED: lysine histidine transporter-like 8 [Brassica rapa]
 emb|CDY17008.1| BnaA08g03720D [Brassica napus]
Length=518

 Score =   390 bits (1001),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 201/454 (44%), Positives = 294/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  73    EEMGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  132

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  133   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  192

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F C+ + +S   PNLNS+A +SL+G
Sbjct  193   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTCLCVVLSQ-LPNLNSIAGLSLIG  251

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++TAI Y T++W LSVS+ R P  ++Y+P  + +     F  + NAL +++ AFRGHN++
Sbjct  252   AVTAITYSTMVWVLSVSQPR-PATISYEPLSMPSVSGSLF-SVLNALGIVAFAFRGHNLV  309

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y  IALC FP++I G+WAYG LMP     GG+L 
Sbjct  310   LEIQSTMPSTFKHPAHVPMWRGAKVAYFFIALCIFPISIGGFWAYGKLMP----PGGMLA  365

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A  +FHI+DI + L+   +++++  CL ++QIY++P  D++E  Y S+      C  WVR
Sbjct  366   ALYEFHINDIPRGLLATAFLLVVFNCLSSFQIYSMPAFDSFEAGYTSRTN--KPCSVWVR  423

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V FG +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP   +  W  +
Sbjct  424   SGFRVFFGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPAKCSFSWYFH  483

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GLG LG+      +   + +++  GL   FF+P
Sbjct  484   WGLGWLGVAFSLAFSIGGISSMVTQGLKLKFFSP  517



>emb|CAN78281.1| hypothetical protein VITISV_021650 [Vitis vinifera]
Length=493

 Score =   389 bits (998),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 200/457 (44%), Positives = 281/457 (61%), Gaps = 38/457 (8%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  69    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  128

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  129   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  188

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LF++ +CG       LT  EW+L+F  + I +S   PNLNS+A +SL+G
Sbjct  189   ALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQ-LPNLNSIAGLSLIG  247

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDP---PQLSTSKLDRFRDIANALAVISLAFRGH  771
             ++TAI Y T++W LSVS+ RPP  ++Y P   P  S S       + NAL +++ AFRGH
Sbjct  248   AVTAITYSTMVWVLSVSQQRPPP-ISYQPLSSPSFSASVF----SVMNALGIVAFAFRGH  302

Query  770   NIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGG  591
             N+ +EIQ T+P+  K P    M  G   +Y+LIA+C FP+AI G+WAYGNLMP+    GG
Sbjct  303   NLAMEIQATMPSTFKHPAHVPMWRGAKVAYVLIAMCIFPVAIGGFWAYGNLMPS----GG  358

Query  590   ILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPK  411
             ILNA   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  
Sbjct  359   ILNALYGFHSHDIPRGLLAMTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSI  416

Query  410   WVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVW  231
             WVR G +V  GGL                     T+P+TFAYPCFMW+ IKKP  ++  W
Sbjct  417   WVRSGFRVSMGGL---------------------TLPVTFAYPCFMWVLIKKPTKFSFNW  455

Query  230   CVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
               N  LG LG+      +   +W+++  GL   FF P
Sbjct  456   YFNWILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKP  492



>ref|XP_004962675.1| PREDICTED: lysine histidine transporter-like 8-like [Setaria 
italica]
Length=512

 Score =   384 bits (985),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 293/454 (65%), Gaps = 11/454 (2%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LP+TESR GN      H L++G+G QALLLP+AF +LGW WGII 
Sbjct  66    EDVGHLTRLDPRDAWLPVTESRGGNARYAAFHSLNAGLGFQALLLPLAFPALGWSWGIIF  125

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG K+G   ++FPT+YLS G+  
Sbjct  126   LTIAYFWQLYTLWILVKLHEAVPGRRYNRYVELAQAAFGEKLGMWLSLFPTIYLSAGTAT  185

Query  1115  MLIINGGGSLQLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLG  942
              LI+ GG +++LFY+ +CG    P  +T  EW+L+F  +A+ +S   PNLNS+A +SL+G
Sbjct  186   ALILVGGETMKLFYQIVCGPLCSPSPITTVEWYLVFTSLAVILSQ-LPNLNSIAGLSLIG  244

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
               TAI YCT+ W LSVS+ RPP  V+YDP + STS         NAL +++ AFRGHN+ 
Sbjct  245   GATAIMYCTMSWVLSVSQPRPPT-VSYDPVR-STSFGTSLFSTLNALGIVAFAFRGHNLA  302

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQ T+P+  K P    M  G   +Y+LIA+C FP+A+ GYWAYGN+MP     GG+L 
Sbjct  303   LEIQATMPSTFKHPAHVPMWRGAKVAYLLIAMCLFPVAVGGYWAYGNMMP----PGGMLA  358

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             A   FH HD  + L+    +++++ CL ++QIY++PV D++E  Y  +      C  WVR
Sbjct  359   ALYAFHSHDTPQGLLATTCLLVVLNCLSSFQIYSMPVFDSFEAYYTGRTN--RPCSPWVR  416

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVN  222
              G +V +G L+  +SVA PFL SLAG +G +T+P+TFAYPCFMWI +KKP   +  W +N
Sbjct  417   SGFRVFYGFLSLFISVALPFLSSLAGLLGGLTLPVTFAYPCFMWIRVKKPERLSFSWYLN  476

Query  221   MGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
              GL  LG       +   +W ++++G+   FF P
Sbjct  477   WGLALLGTAFSLAFSLGGVWGIVSNGMKLKFFKP  510



>dbj|BAJ90151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   383 bits (983),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 222/504 (44%), Positives = 312/504 (62%), Gaps = 19/504 (4%)
 Frame = -1

Query  1601  ERERDRIEVIKVG-RMEDGAVEVRVERIGSWTSTRIAPVD--IDN-----EPAAQVQAFA  1446
             E E   I V   G    +G     V R G+ TS    PV   ++      E    +    
Sbjct  10    EPELVSIPVTPRGLSTPEGVSTPPVRRGGAATSGAGTPVRRVVEGLRGYLEEVGHLTRLN  69

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P D+ LPITESR+GN      H L++G+G QALLLP+AF +LGW WGII L++ + WQLY
Sbjct  70    PQDAWLPITESRSGNASYAAFHSLNAGLGFQALLLPLAFPALGWSWGIISLTVAYFWQLY  129

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T+ +LV LHE+  G R++RYV LA  AFG K+G   A+FPT+YLS G+   LI+ GG ++
Sbjct  130   TLSILVKLHEAVPGRRYNRYVELAQAAFGEKLGVWLALFPTIYLSAGTATALILVGGETM  189

Query  1085  QLFYKTMCGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTI  912
             +LFY+ +CG    P  ++  EW+L+F  +A+ +S   PNLNS+A +SL+G  TAI YCT+
Sbjct  190   KLFYQIVCGPLCTPSPISTVEWYLVFTSLAVILSQ-LPNLNSIAGLSLIGGATAIMYCTM  248

Query  911   LWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTN  732
              W LSVS+ R P  ++Y+  + STS         NAL +I+ AFRGHN+ LEIQ T+P+ 
Sbjct  249   SWVLSVSQQR-PAAISYEQVR-STSFGSSLFSTLNALGIIAFAFRGHNLSLEIQATMPST  306

Query  731   TKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDI  552
              K P    M  G  A+Y+LIA+C FP+AI GYWAYGN+MP    +GGIL A   FH HDI
Sbjct  307   FKHPAHVPMWRGAKAAYLLIAMCIFPVAIGGYWAYGNMMP----QGGILTALYIFHGHDI  362

Query  551   SKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGL  372
             S+ L+ A +++++  CL ++QIY++PV D++E  Y  +      C  WVR G ++ +G +
Sbjct  363   SRGLLAATFLLVVFNCLSSFQIYSMPVFDSFEAFYTGRTN--RPCSVWVRSGFRIFYGFI  420

Query  371   TYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLM  192
             +  + +A PFL SLAG +G +T+P+TFAYPCFMWI IKKP  ++  W VN GL  LG   
Sbjct  421   SLFIGIALPFLSSLAGLLGGLTLPVTFAYPCFMWICIKKPERFSYSWYVNWGLALLGTAF  480

Query  191   CTVLATATLWNLIADGLHANFFNP  120
                 +   +W+++  G+   FF P
Sbjct  481   SLASSVGGVWSIVNTGMKLKFFKP  504



>ref|XP_010437509.1| PREDICTED: lysine histidine transporter-like 7 isoform X1 [Camelina 
sativa]
 ref|XP_010437510.1| PREDICTED: lysine histidine transporter-like 7 isoform X2 [Camelina 
sativa]
Length=477

 Score =   380 bits (977),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 203/443 (46%), Positives = 282/443 (64%), Gaps = 13/443 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P++  LPITESR GN F+ T H+L  GIGLQ +LLP AF +LGWVWG I L++ FVW+LY
Sbjct  47    PVEDWLPITESRKGNIFTATFHLLCVGIGLQVILLPAAFAALGWVWGTIILTVGFVWKLY  106

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHE+  G R SR+V LA  +FG K+GKL AIFP MYLSGG+C +L+I GG S+
Sbjct  107   TTWLLVHLHEALPGIRISRFVRLAIASFGVKLGKLLAIFPVMYLSGGACTILVITGGKSI  166

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
                 + M   +   L   + FL+F CIA+ +S  FPNLNSL  +SL+G +  +AYCT++W
Sbjct  167   LQLLQIMSEDNTAPLNSVQCFLVFSCIAVIMSQ-FPNLNSLFGVSLIGGVMGVAYCTVIW  225

Query  905   TLSV-SKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNT  729
              L V S  +  + V Y       +  + F  I NA+ +I+L FRG+N++LEIQGTLP+++
Sbjct  226   ILPVTSDVKKTEQVRY------ATTDESFVHIFNAIGLIALVFRGNNLVLEIQGTLPSDS  279

Query  728   KVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDIS  549
             K P  + M   V+ S+ L+A+C FPL++  YWA+G+ +P S   GG +  + K +  + S
Sbjct  280   KNPSSKTMWRAVLISHALVAICMFPLSVVVYWAHGDKIPAS---GGPVGYYLKLYTQEHS  336

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K     I++  I +CLC+Y I  +P  DN E +Y  KK+   S    VRM L+V  G + 
Sbjct  337   KRAACFIHLTFIFSCLCSYPINLMPACDNAEMVYTVKKQKRASI--IVRMMLRVFLGLVC  394

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + +++ FPFL  LA  IG+I + +TF YP FMWI+IKKP   + +W  N+ +GCLG  + 
Sbjct  395   FSIAIVFPFLPYLAVLIGAIALLVTFTYPSFMWISIKKPERKSPMWLFNVLMGCLGASLS  454

Query  188   TVLATATLWNLIADGLHANFFNP  120
               L  A+   L   GLHANFFNP
Sbjct  455   FFLLLASALRLDQKGLHANFFNP  477



>ref|XP_010255085.1| PREDICTED: lysine histidine transporter-like 8 isoform X2 [Nelumbo 
nucifera]
Length=491

 Score =   378 bits (971),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 199/455 (44%), Positives = 280/455 (62%), Gaps = 42/455 (9%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGII 
Sbjct  75    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGIIS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYFWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSL  936
              LI+ GG +++LF++ +                            PNLNS+A +SL+G++
Sbjct  195   ALILTGGETMKLFFQIL----------------------------PNLNSIAGLSLIGAV  226

Query  935   TAIAYCTILWTLSVSKGRPPQGVTYDP---PQLSTSKLDRFRDIANALAVISLAFRGHNI  765
             TAI Y T++W LSVS+ RP   ++Y P   P  S S       I NAL +I+ AFRGHN+
Sbjct  227   TAITYSTMVWVLSVSQPRP-SSISYQPLASPSFSASVFS----IMNALGIIAFAFRGHNL  281

Query  764   ILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGIL  585
              LEIQ T+P+  K P    M  G   +Y  IA+C FP+AI G+WAYGNLMP+    GGIL
Sbjct  282   ALEIQATMPSTFKHPAHVPMWRGAKVAYFFIAMCLFPVAIGGFWAYGNLMPS----GGIL  337

Query  584   NAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWV  405
              A   FH HDI + L+   +++++  CL ++QIY++PV D++E  Y  +      C  WV
Sbjct  338   GALYAFHNHDIPRGLLATTFLLVVFNCLSSFQIYSMPVFDSFEAGYTGRTNR--PCSIWV  395

Query  404   RMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCV  225
             R G +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IKKP+ ++  W  
Sbjct  396   RSGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKKPQKFSFNWYF  455

Query  224   NMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             N  LG LG+     L+   +W+++ +GL   FF P
Sbjct  456   NWTLGWLGIAFSLALSIGGVWSIVNNGLKFKFFKP  490



>ref|XP_007017387.1| Transmembrane amino acid transporter family protein isoform 2 
[Theobroma cacao]
 gb|EOY14612.1| Transmembrane amino acid transporter family protein isoform 2 
[Theobroma cacao]
Length=488

 Score =   378 bits (970),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 195/452 (43%), Positives = 280/452 (62%), Gaps = 39/452 (9%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN      H L++G+G QAL+LPVAF  LGW WGI+ 
Sbjct  75    EEVGHLTKLNPQDAWLPITESRNGNAHYAAFHNLNAGVGFQALVLPVAFAFLGWSWGILS  134

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L++ + WQLYT+W+LV LHE+  G R++RYV LA  AFG ++G   A+FPT+YLS G+  
Sbjct  135   LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTAT  194

Query  1115  MLIINGGGSLQLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSL  936
              LI+ GG +++LF++ +CG                                 W+SL+G++
Sbjct  195   ALILIGGETMKLFFQIVCGP-------------------------------IWLSLVGAV  223

Query  935   TAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILE  756
             TAI Y T++W LSVS+ RPP  ++Y+P  L +S    F  + NAL +++ AFRGHN++LE
Sbjct  224   TAITYSTMVWVLSVSQQRPPT-ISYEPLSLPSSA-AAFFSVMNALGIVAFAFRGHNLVLE  281

Query  755   IQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAF  576
             IQ T+P+  K P    M  G   +Y  IA+C FP+AI GYWAYGNLMP+    GGIL+A 
Sbjct  282   IQATMPSTFKHPAHVPMWRGAKVAYFFIAMCLFPVAIGGYWAYGNLMPS----GGILSAL  337

Query  575   EKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMG  396
               FH HDI + L+   +++++  CL ++QIY++PV D++E  Y S+      C  WVR G
Sbjct  338   YAFHSHDIPRGLLALTFLLVVFNCLSSFQIYSMPVFDSFEAGYTSRTN--RPCSIWVRSG  395

Query  395   LKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMG  216
              +V +G +++ + VA PFL SLAG +G +T+P+TFAYPCFMW+ IK+P  Y+  W  N  
Sbjct  396   FRVFYGFVSFFIGVALPFLSSLAGLLGGLTLPVTFAYPCFMWVLIKRPTKYSFNWYFNWI  455

Query  215   LGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             LG LG+      +   +W+++ +GL   FF P
Sbjct  456   LGWLGIAFSLAFSIGGVWSMVNNGLKLKFFKP  487



>ref|XP_002993599.1| hypothetical protein SELMODRAFT_236771 [Selaginella moellendorffii]
 gb|EFJ05291.1| hypothetical protein SELMODRAFT_236771 [Selaginella moellendorffii]
Length=456

 Score =   376 bits (966),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 201/456 (44%), Positives = 291/456 (64%), Gaps = 16/456 (4%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P ++ LPIT SRNGN +    H L++ IG QALLLPVA T LGW WG++ 
Sbjct  13    EDIGHITKLDPQEAWLPITASRNGNAYYSAFHNLNASIGFQALLLPVALTFLGWTWGVLA  72

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L   F+WQLYT+W+L+ LHE+  G R SRYV LA  AFG K+G   AIFP + LSGG+  
Sbjct  73    LVAAFIWQLYTLWILIQLHEAVPGKRHSRYVELAQEAFGPKLGAWLAIFPVVNLSGGTAT  132

Query  1115  MLIINGGGSLQLFYKTMCGGDPKG-LTGAEWFLLFVCI-AIFISLFFPNLNSLAWISLLG  942
              LII GGG+L+LFY+T+C     G LT  EW+L+F  + AI   L  PNLNS+A +SL+G
Sbjct  133   GLIIIGGGTLELFYRTVCRDCHGGSLTTVEWYLVFTILCAILAQL--PNLNSIAGVSLVG  190

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++ A+AY T++WTLS+S+ RPP G+TYD  +   +  + F  + NAL +I+ AFRGHN++
Sbjct  191   AVMAVAYTTLVWTLSISRPRPP-GITYDTVKPDHTAGNIF-SVLNALGIIAFAFRGHNLV  248

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQGT+P++ K P +  M  G   ++ ++A C+FP+AIAGYWAYG +M  S    GIL 
Sbjct  249   LEIQGTMPSSLKHPAKSPMWRGAKVAFAIVAACYFPIAIAGYWAYGRMMLPS----GIL-  303

Query  581   AFEKFHIH-DISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWV  405
              F  + +H DI    M   ++ +++  + ++QIY++P+ D +E+ + ++K      P   
Sbjct  304   -FSMYALHPDIPSPWMAITFLFVVLNSISSFQIYSMPMFDAFEQSFTARKN--KPTPLLA  360

Query  404   RMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSIT-MPLTFAYPCFMWIAIKKPRPYTLVWC  228
             R+  ++ F    + V VA PF+ S AG +G +T +P+TF YPCFMW+ IKKP  ++  W 
Sbjct  361   RVAFRLFFTFFAFFVGVALPFISSFAGLLGGLTSVPVTFCYPCFMWLKIKKPPRFSFTWY  420

Query  227   VNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +N  LG LG++         +W+++  GL  NFFNP
Sbjct  421   LNWTLGILGIVFSITFTAGGIWSIVDSGLTLNFFNP  456



>ref|XP_002973454.1| hypothetical protein SELMODRAFT_99162 [Selaginella moellendorffii]
 gb|EFJ25828.1| hypothetical protein SELMODRAFT_99162 [Selaginella moellendorffii]
Length=507

 Score =   375 bits (964),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 201/456 (44%), Positives = 291/456 (64%), Gaps = 16/456 (4%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P ++ LPIT SRNGN +    H L++ IG QALLLPVA T LGW WG++ 
Sbjct  64    EDIGHITKLNPQEAWLPITASRNGNAYYSAFHNLNASIGFQALLLPVALTFLGWTWGVLA  123

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L   F+WQLYT+W+L+ LHE+  G R SRYV LA  AFG K+G   AIFP + LSGG+  
Sbjct  124   LVAAFIWQLYTLWILIQLHEAVPGKRHSRYVELAQEAFGPKLGAWLAIFPVVNLSGGTAT  183

Query  1115  MLIINGGGSLQLFYKTMCGGDPKG-LTGAEWFLLFVCI-AIFISLFFPNLNSLAWISLLG  942
              LII GGG+L+LFY+T+C     G LT  EW+L+F  + AI   L  PNLNS+A +SL+G
Sbjct  184   GLIIIGGGTLELFYRTVCRDCHGGSLTTVEWYLVFTILCAILAQL--PNLNSIAGVSLVG  241

Query  941   SLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNII  762
             ++ A+AY T++WTLS+S+ RPP G+TYD  +   +  + F  + NAL +I+ AFRGHN++
Sbjct  242   AVMAVAYTTLVWTLSISRPRPP-GITYDIVKPDHTAGNIF-SVLNALGIIAFAFRGHNLV  299

Query  761   LEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILN  582
             LEIQGT+P++ K P +  M  G   ++ ++A C+FP+AIAGYWAYG +M  S    GIL 
Sbjct  300   LEIQGTMPSSLKHPAKSPMWRGAKVAFAIVAACYFPIAIAGYWAYGRMMLPS----GIL-  354

Query  581   AFEKFHIH-DISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWV  405
              F  + +H DI    M   ++ +++  + ++QIY++P+ D +E+ + ++K      P   
Sbjct  355   -FSMYALHPDIPSPWMAITFLFVVLNSISSFQIYSMPMFDAFEQSFTARKN--KPTPLLA  411

Query  404   RMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSIT-MPLTFAYPCFMWIAIKKPRPYTLVWC  228
             R+  ++ F    + V VA PF+ S AG +G +T +P+TF YPCFMW+ IKKP  ++  W 
Sbjct  412   RVAFRLFFTFFAFFVGVALPFISSFAGLLGGLTSVPVTFCYPCFMWLKIKKPPRFSFTWY  471

Query  227   VNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             +N  LG LG++         +W+++  GL  NFFNP
Sbjct  472   LNWTLGILGIVFSITFTAGGIWSIVDSGLTLNFFNP  507



>ref|XP_010432316.1| PREDICTED: lysine histidine transporter-like 7 [Camelina sativa]
Length=477

 Score =   374 bits (960),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 283/443 (64%), Gaps = 13/443 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P++  LPITESR GN F+ T H+L  GIGLQ +LLP AF +LGWVWG I L++ FVW+LY
Sbjct  47    PVEDWLPITESRKGNIFTATFHLLCVGIGLQVILLPAAFAALGWVWGTIILTVGFVWKLY  106

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHE+  G R SR+V LA  +FG K+GKL AIFP MYLSGG+C +L+I GG S+
Sbjct  107   TTWLLVHLHEALPGIRISRFVRLAIASFGVKLGKLLAIFPVMYLSGGACTILVITGGKSI  166

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             Q   + M   +   L   + FL+F CIA+ +S  FPNLNSL  +SL+G +  +AYCT++W
Sbjct  167   QQLLQIMSEDNTAPLNSVQCFLVFSCIAVIMSQ-FPNLNSLFGVSLIGGVMGVAYCTVIW  225

Query  905   TLSV-SKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNT  729
              L V S     + V Y       +  + F  I NA+ +I+L FRG+N++LEIQGTLP+++
Sbjct  226   ILPVTSDVNKTEQVRY------ATTDESFVHIFNAIGLIALVFRGNNLVLEIQGTLPSDS  279

Query  728   KVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDIS  549
             K P  + M   V+ S+ L+A+C FPL++  YWA+G+ +P S   GG +  + K +  + S
Sbjct  280   KNPSSKTMWRAVLISHALVAICMFPLSVVVYWAHGDKIPAS---GGPVGNYLKLYTQEHS  336

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K     I++  I +CLC+Y I  +P  DN E +Y  KK+   S    VRM L+V  G + 
Sbjct  337   KRAACFIHLTFIFSCLCSYPINLMPACDNAEMVYTVKKQKRASI--IVRMMLRVFLGLVC  394

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + +++ FPFL  LA  IG+I + +TF YP FMWI+IKKP   + +W  N+ +GCLG  + 
Sbjct  395   FSIAIVFPFLPYLAVLIGAIALLVTFTYPSFMWISIKKPERKSPMWLFNVLMGCLGASLS  454

Query  188   TVLATATLWNLIADGLHANFFNP  120
              +L  A+   L   GLHANFFNP
Sbjct  455   FLLLLASALRLAQKGLHANFFNP  477



>ref|XP_006664563.1| PREDICTED: lysine histidine transporter-like 8-like [Oryza brachyantha]
Length=507

 Score =   375 bits (963),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 203/437 (46%), Positives = 288/437 (66%), Gaps = 11/437 (3%)
 Frame = -1

Query  1424  ITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLYTIWLLVD  1245
             ++ SR+GN      H L++G+G QALLLP+AF +LGW WGII L++ + WQLYT+W+LV 
Sbjct  78    LSTSRSGNARYAAFHTLNAGLGFQALLLPLAFPALGWSWGIISLTIAYFWQLYTLWILVK  137

Query  1244  LHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSLQLFYKTM  1065
             LHE+  G R++RYV LA  AFG K+G   ++FPT+YLS GS   LI+ GG +++LFY+ +
Sbjct  138   LHEAVPGRRYNRYVELAQAAFGEKLGVWLSLFPTIYLSAGSATALILVGGETMKLFYQIV  197

Query  1064  CGG--DPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVS  891
             CG    P  +T  EW+L+F  +AI +S   PNLNS+A +SL+G  TAI YCT+ W LSVS
Sbjct  198   CGPVCSPSPITTVEWYLVFTSLAIVLSQ-LPNLNSIAGVSLIGGATAITYCTMSWILSVS  256

Query  890   KGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRR  711
             + RP   ++Y+P   ++     F  + NAL +I+ AFRGHN+ LEIQ T+P+  K P   
Sbjct  257   QQRPTT-ISYEPVAYTSLGSSLFSTL-NALGIIAFAFRGHNLALEIQATMPSTFKHPAHV  314

Query  710   RMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGA  531
              M  G   +Y LIA+C FP+A+ GYWAYGN+MP+    GGIL A   FH HDI + L+ +
Sbjct  315   PMWRGAKVAYALIAMCLFPVAVGGYWAYGNMMPS----GGILTALYAFHSHDIPRGLLAS  370

Query  530   IYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVA  351
              +++++  CL ++QIY++PV D++E  Y  +      C  WVR G +V +G ++  +SVA
Sbjct  371   TFLLVVFNCLSSFQIYSMPVFDSFEAFYTGRTN--RPCSVWVRSGFRVFYGFISLFISVA  428

Query  350   FPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATA  171
              PFL SLAG +G +T+P+TFAYPCFMWI IKKP  ++  W +N GLG LG          
Sbjct  429   LPFLSSLAGLLGGLTLPVTFAYPCFMWICIKKPERFSSGWYLNWGLGLLGTAFSLAFCVG  488

Query  170   TLWNLIADGLHANFFNP  120
              +W++I+ G+   FF P
Sbjct  489   GVWSIISSGMKLKFFKP  505



>ref|XP_010446966.1| PREDICTED: lysine histidine transporter-like 7 [Camelina sativa]
Length=477

 Score =   374 bits (959),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 203/443 (46%), Positives = 284/443 (64%), Gaps = 13/443 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             PL+  LPITESR GN F+ T H+L  GIGLQ +LLP AF +LGWVWG I L++ FVW+LY
Sbjct  47    PLEDWLPITESRKGNIFTATFHLLCVGIGLQVILLPAAFAALGWVWGTIILTVGFVWKLY  106

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHE+  G R SR+V LA  +FG K+GKL AIFP MYLSGG+C +L+I GG S+
Sbjct  107   TTWLLVHLHEALPGIRISRFVRLAIASFGVKLGKLLAIFPVMYLSGGACTILVITGGKSI  166

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             Q   + M   +   L   + FL+F CIA+ IS  FPNLNSL  +SL+G++  +AYCT++W
Sbjct  167   QQLLQIMSEDNTAPLNSVQCFLVFSCIAVVISQ-FPNLNSLFGVSLIGAVMGVAYCTVIW  225

Query  905   TLSV-SKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNT  729
              L V S  +  + V Y       +  + F  I NA+ +I+L FRG+N++LEIQGTLP+++
Sbjct  226   ILPVTSDVKKTEQVRY------ATTDESFVHIFNAIGLIALVFRGNNLVLEIQGTLPSDS  279

Query  728   KVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDIS  549
             K P  + M   V+ S+ L+A+C FPL++  YWA+G+ +P S   GG +  + K +  + S
Sbjct  280   KNPSSKTMWRAVMISHALVAICMFPLSVVVYWAHGDKIPAS---GGPIGNYLKLYTQEHS  336

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K     I++  I +CLC+Y I  +P  DN E +Y  K++   S    VRM L++  G + 
Sbjct  337   KRAACFIHLTFIFSCLCSYPINLMPACDNAEMVYTVKRQKRASI--IVRMMLRMFLGLVC  394

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + +++ FPFL  LA  IG+I + +TF YP F WI+IKKP   + +W  N+ +GCLG  + 
Sbjct  395   FSIAIVFPFLPYLAVLIGAIALLVTFTYPSFKWISIKKPERRSPMWLFNVLMGCLGASLS  454

Query  188   TVLATATLWNLIADGLHANFFNP  120
              +L  A+   L   GLHANFFNP
Sbjct  455   ILLLLASALRLAQKGLHANFFNP  477



>ref|XP_006384599.1| hypothetical protein POPTR_0004s18780g [Populus trichocarpa]
 gb|ERP62396.1| hypothetical protein POPTR_0004s18780g [Populus trichocarpa]
Length=340

 Score =   365 bits (936),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 248/347 (71%), Gaps = 14/347 (4%)
 Frame = -1

Query  1142  MYLSGGSCVMLIINGGGSLQLFYKTMCGGDP----KGLTGAEWFLLFVCIAIFISLFFPN  975
             MYLSGGSCV+LII G G+++LF+K M  G+       L GA WFL+F C+AI ++   PN
Sbjct  1     MYLSGGSCVLLIIRGAGTMELFFKMMFRGEATIEDSPLAGAGWFLVFTCMAIALAQR-PN  59

Query  974   LNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAV  795
             LNS+A  SL+G++TAIAYCT++W L +SKGRP  GV+Y+  Q   S +    D+ NA+ +
Sbjct  60    LNSIAGFSLIGAVTAIAYCTLIWALPISKGRP-SGVSYNS-QKEESGMSEMFDVLNAIGM  117

Query  794   ISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLM  615
             I LAFRGHN++LEIQGTLP+++K P ++ M  GV  SYI+IA+C FP+AIAG+W YGN +
Sbjct  118   IVLAFRGHNLVLEIQGTLPSSSKCPSKKLMWRGVTLSYIIIAICLFPIAIAGFWTYGNKI  177

Query  614   PTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKK  435
             P++   GG+L AF + H HD SK   G +Y++++I CL ++QIYA+PV DN E  Y   K
Sbjct  178   PSN---GGMLTAFMQLHGHDTSKFAKGLVYLLVVINCLSSFQIYAMPVFDNLEFRYTCMK  234

Query  434   KMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKK  255
                  C  WVR G ++ FGGL + ++VAFPFL SLA  IG I +PLT AYPCFMWI+IKK
Sbjct  235   N--KRCSWWVRTGFRLFFGGLAFFIAVAFPFLPSLAALIGGIALPLTLAYPCFMWISIKK  292

Query  254   P--RPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             P  + + ++WC+N+GLGCLGM++  +L  A +WNL   GLHANFF+P
Sbjct  293   PHQKGHGVMWCLNLGLGCLGMVLSVLLVVAAVWNLATKGLHANFFHP  339



>gb|EMT08997.1| hypothetical protein F775_18992 [Aegilops tauschii]
Length=419

 Score =   366 bits (939),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 192/387 (50%), Positives = 265/387 (68%), Gaps = 12/387 (3%)
 Frame = -1

Query  1271  LYTIWLLVDLHESTTG-TRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGG  1095
             LYT+ LLV+LHE   G TR+SRY+HLAT  FG + GK+ A+ PTMYLS G+C  LII GG
Sbjct  38    LYTLRLLVNLHEPVAGGTRYSRYMHLATTVFGERWGKILALLPTMYLSAGTCTALIIVGG  97

Query  1094  GSLQLFYKTMCGGD--PKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAY  921
             GS+++ +   CG     +  T  EW+++FVC+A+ +S   PNLNS+A +SL+G+  A+ Y
Sbjct  98    GSMKILFSIACGPACVARPPTMVEWYVVFVCVAVVLSQL-PNLNSIAGVSLVGATAAVGY  156

Query  920   CTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTL  741
             CT++W +SV+KGR   GV+YDP + ++S +DR   + N L +I+ AFRGHN++LEIQGT+
Sbjct  157   CTMIWVISVTKGRV-AGVSYDPVK-ASSDVDRTIAVLNGLGIIAFAFRGHNLVLEIQGTM  214

Query  740   PTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHI  561
             P+  K P    M  GV  +Y+++ALC +P+AI G+WAYGN +P +    GIL+A  KFH 
Sbjct  215   PSTLKHPSHVPMWKGVKFAYLVVALCLYPVAIGGFWAYGNQIPPN----GILSALYKFHS  270

Query  560   HDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLF  381
              D+S+ ++G   +++I+ CL T+QIYA+PV DN E  Y+ KK     CP W+R G + LF
Sbjct  271   RDVSRLVIGLATLLVIVNCLTTFQIYAMPVFDNMEAGYVHKKNR--PCPWWLRAGFRALF  328

Query  380   GGLTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLG  201
             G +  L++VA PFL  LAG  G I++P+T AYPCFMW+AI KP   T +WCVN  LGCLG
Sbjct  329   GAVNLLIAVALPFLSELAGLRGGISLPVTLAYPCFMWLAIMKPGRGTAMWCVNWALGCLG  388

Query  200   MLMCTVLATATLWNLIADGLHANFFNP  120
             M +  VL    LW L+A GLH  FF P
Sbjct  389   MGLSFVLIVGNLWGLVATGLHVQFFKP  415



>emb|CDX69117.1| BnaC01g03360D [Brassica napus]
Length=478

 Score =   363 bits (933),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 200/443 (45%), Positives = 286/443 (65%), Gaps = 13/443 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             PL+  LPITESR GN F+ T H+L SG+G Q LLLP AF +LGWVWGII L++ F W+LY
Sbjct  48    PLEEWLPITESRKGNVFTATFHLLCSGLGFQVLLLPAAFAALGWVWGIIILTVGFAWKLY  107

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHE+  GTRFSRY+ LA  +FG K+GKL  IFP MYLSGG+C +L+I GG ++
Sbjct  108   TTWLLVHLHEAVHGTRFSRYLRLAIASFGVKLGKLLGIFPVMYLSGGACSILVITGGKTI  167

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +     M   D   LT  + F++F C+A+ +S  FPNLNSL  +SL+G + A+AY T +W
Sbjct  168   KQLVHIMSEDDTVPLTTLQCFVIFSCLAVVLSQ-FPNLNSLFGLSLIGGVMAVAYSTAVW  226

Query  905   TLSVSKGRPPQ-GVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTNT  729
             +L +++    Q  VTY        K   F +I NA+ +I+++ RG+N+ILEIQGTLP+++
Sbjct  227   SLPLTRDPQSQNNVTY------AIKDTSFDNIFNAIGLIAISLRGNNLILEIQGTLPSDS  280

Query  728   KVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDIS  549
             K P  + M   V+ S+++IA+C F ++I  YWAYG+ +P +   GG +  +   +  D S
Sbjct  281   KNPSSKTMWRAVVISHLIIAVCMFLVSIVVYWAYGDEIPAT---GGPIGNYLTLYEQDYS  337

Query  548   KSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGLT  369
             K     I++  I  CLC+Y I  +P  DN E +Y++K +    C  +VRM L+V  G + 
Sbjct  338   KRAACFIHITFIFNCLCSYPINLMPACDNAEMVYVTKSQ--KPCSVFVRMMLRVSLGLVC  395

Query  368   YLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMC  189
             + ++V F FL  LA  IG++ + +TF YPCFMWI+IK+P   +L+W +N+ +G LG  + 
Sbjct  396   FFIAVGFSFLPYLAVLIGAVALLVTFTYPCFMWISIKQPEMKSLMWLINVFVGSLGASLS  455

Query  188   TVLATATLWNLIADGLHANFFNP  120
              +L  A+   L   GLHANFF P
Sbjct  456   VLLVVASALFLAEKGLHANFFRP  478



>emb|CAN76056.1| hypothetical protein VITISV_009104 [Vitis vinifera]
Length=546

 Score =   366 bits (939),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 200/475 (42%), Positives = 282/475 (59%), Gaps = 35/475 (7%)
 Frame = -1

Query  1469  AAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLS  1290
             A Q+  F P D+ LPITESRNGN F    H L SGIG+QAL+LPV+FT LGW WG+ICL+
Sbjct  82    AIQMTKFDPQDAWLPITESRNGNAFYAAFHTLCSGIGIQALVLPVSFTILGWTWGVICLT  141

Query  1289  LLFVWQLYTIWLLVDLHES-TTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVM  1113
             + FVWQ+YT+WLLV LH+S  TG R+SRY+H+    FG     L+ + P   LS      
Sbjct  142   IAFVWQMYTLWLLVKLHDSPETGVRYSRYLHICQATFGKD---LSHLLPHSILSYPGIGH  198

Query  1112  LIINGGGSLQLFYKT------------------MCGGDPKGLTGAEWFL------LFVCI  1005
               +     +++  K                   M G D +G    E FL         C 
Sbjct  199   KHVKKKEKIEILTKQQTWEADGPLSNNVPLRRHMRGVDHRGWLNPEAFLPDHMRPRLQCE  258

Query  1004  AIFISLFFPNLNSLAWISLLGSLTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDR  825
             A       PNLNS+A +SL+G+ TAIAYCTI+W ++V++GR  +GV+YDP +     +  
Sbjct  259   ATHHPGMLPNLNSIAGVSLIGAATAIAYCTIMWLVAVTEGRL-EGVSYDPVR-PVENVAL  316

Query  824   FRDIANALAVISLAFRGHNIILEIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAI  645
                + NAL +I+ AFRGHN+ILEIQ T+P++ K      M  GV  +Y++IALC FPLAI
Sbjct  317   IFGVLNALGIIAFAFRGHNLILEIQATMPSSEKRTTYVPMWRGVKVAYLIIALCLFPLAI  376

Query  644   AGYWAYGNLMPTSYKKGGILNAFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLD  465
              GYWAYG  +P   + GG+L A   +H  D S+ ++    +++II  + ++QIY +P+ D
Sbjct  377   GGYWAYGQKIP---ENGGMLTAIYSYHGRDTSQFVLXLTSLLVIINSVSSFQIYGMPMFD  433

Query  464   NWERIYLSKKKMMMSCPKWVRMGLKVLFGGLTYLVSVAFPFLGSLAGFIGSITMPLTFAY  285
             + E  Y  +K     CP W+R   +  FG   + V+VA PFLGS AG  G + +P+TFAY
Sbjct  434   DMESKYTKRKNK--PCPWWLRALFRTXFGYGCFFVAVAMPFLGSFAGLTGXVAVPVTFAY  491

Query  284   PCFMWIAIKKPRPYTLVWCVNMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             PCF+W+ IKKP+ Y+++W +N  LG  GM++  VL  A ++ +I  G+  +FF P
Sbjct  492   PCFLWLKIKKPKKYSMMWVLNWVLGASGMVLSVVLIAAGVYVVIDTGIKVSFFKP  546



>ref|XP_006412138.1| hypothetical protein EUTSA_v10025079mg [Eutrema salsugineum]
 gb|ESQ53591.1| hypothetical protein EUTSA_v10025079mg [Eutrema salsugineum]
Length=479

 Score =   362 bits (930),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 202/445 (45%), Positives = 285/445 (64%), Gaps = 16/445 (4%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             P++  LPITESR GN ++ T H+L SG+G Q LLLP AF +LGWVWG+I L++ F W+LY
Sbjct  48    PVEEWLPITESRKGNIYTATFHLLCSGLGFQVLLLPAAFAALGWVWGLIILTVGFAWKLY  107

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T+WLLV LHE+  G RFSRY+ LA  +FG K+GKL  IFP MYLSGG+C +L+I GG ++
Sbjct  108   TVWLLVQLHEAVHGIRFSRYLRLAIASFGVKLGKLLGIFPVMYLSGGACSILVITGGKTI  167

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +     M   D   L+  + FL+F C+A+ +S  FPNLNSL  +SL+G+ TA+AY T +W
Sbjct  168   KQLVHIMSEDDTVPLSTVQCFLIFSCLAVVMSQ-FPNLNSLFGLSLIGAATAVAYSTAIW  226

Query  905   TLSVSK--GRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTN  732
              L ++    R    V+Y     S      F +I NA+ +I++AFRG+N++LEIQGTLP++
Sbjct  227   ILPLTSVPQRNQNSVSYATTDTS------FDNIFNAIGLIAIAFRGNNLVLEIQGTLPSD  280

Query  731   TKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMP-TSYKKGGILNAFEKFHIHD  555
             +K P  + M   V+ S++ IA+C F +AI  YWAYG+ +P T    G  LN +E+    D
Sbjct  281   SKNPSSKTMWRAVVISHVFIAICMFLVAIVVYWAYGDKIPGTGGPIGNYLNLYER----D  336

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
              SK     I++  I  CLC+Y I  +P  DN E +Y +K +    C  +VRM L+V  G 
Sbjct  337   YSKRAACFIHLTFIFNCLCSYPINLMPACDNAEMVYTTKTQ--KPCSIFVRMMLRVFLGL  394

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             + + V+V F FL  LA  IG+I + +TF YPCFMWI+IK+P+  +L+W +N+ +G  G  
Sbjct  395   VCFFVAVGFSFLPYLAVLIGAIGLLVTFTYPCFMWISIKQPQRKSLMWLLNVLVGFFGAS  454

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  +L  A+   L   GLHANFF P
Sbjct  455   LSVLLVVASALRLADKGLHANFFKP  479



>emb|CDY52643.1| BnaAnng11580D [Brassica napus]
Length=480

 Score =   362 bits (930),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 199/445 (45%), Positives = 288/445 (65%), Gaps = 15/445 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             PL+  LPITESR GN F+ T H+L SG+G Q LLLP AF +LGWVWGII L++ F W+LY
Sbjct  48    PLEEWLPITESRKGNVFTATFHLLCSGLGFQVLLLPAAFAALGWVWGIIILTVAFAWKLY  107

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHE+  GTR SRY+ LA  +FG K+GKL  IFP MYLSGG+C +L+I GG ++
Sbjct  108   TTWLLVHLHEAVHGTRLSRYLRLAIASFGVKLGKLLGIFPVMYLSGGACSILVITGGKTI  167

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +     +   D   LT  + F++F C+A+ +S  FPNLNSL  +SL+G + A+AY T +W
Sbjct  168   KQLVHILSEDDTVPLTTLQCFVIFSCLAVVLSQ-FPNLNSLFGLSLIGGVMAVAYSTAIW  226

Query  905   TLSVSK--GRPPQ-GVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPT  735
             +L +++   R  Q  V+Y      T K   F +I NA+ +I+++ RG+N+ILEIQGTLP+
Sbjct  227   SLPLTRVLQRNHQNNVSY------TIKDTSFDNIFNAIGLIAISLRGNNLILEIQGTLPS  280

Query  734   NTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD  555
             ++K P  + M   V+ S+++IA+C F ++I  YWAYG+ +P +   GG +  + K +  D
Sbjct  281   DSKNPSSKTMWRAVVISHVIIAVCMFLVSIVVYWAYGDKIPAT---GGPIGNYLKLYEQD  337

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
              SK     I++  II CLC+Y I  +P  DN E +Y++K++    C  + RM L+V  G 
Sbjct  338   YSKRAACFIHITFIINCLCSYPINLMPACDNAEMVYVTKRQ--KPCSVFARMMLRVSLGL  395

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             + + ++V F FL  LA  IG++ + +TF YPCFMWI+IK+P   +L+W +N+ +G LG  
Sbjct  396   VCFFIAVGFSFLPYLAVLIGAVALLVTFTYPCFMWISIKQPETKSLMWLINVFVGSLGAS  455

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  +L   +   L   GLHANFF P
Sbjct  456   LSVLLVVTSALFLAEKGLHANFFRP  480



>ref|XP_009105143.1| PREDICTED: lysine histidine transporter-like 7 [Brassica rapa]
Length=480

 Score =   362 bits (929),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 199/445 (45%), Positives = 288/445 (65%), Gaps = 15/445 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             PL+  LPITESR GN F+ T H+L SG+G Q LLLP AF +LGWVWGII L++ F W+LY
Sbjct  48    PLEEWLPITESRKGNVFTATFHLLCSGLGFQVLLLPAAFAALGWVWGIIILTVAFAWKLY  107

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             T WLLV LHE+  GTR SRY+ LA  +FG K+GKL  IFP MYLSGG+C +L+I GG ++
Sbjct  108   TTWLLVHLHEAVHGTRLSRYLRLAIASFGVKLGKLLGIFPVMYLSGGACSILVITGGKTI  167

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +     +   D   LT  + F++F C+A+ +S  FPNLNSL  +SL+G + A+AY T +W
Sbjct  168   KQLVHILSEDDTVPLTTLQCFVIFSCLAVVLSQ-FPNLNSLFGLSLIGGVMAVAYSTAIW  226

Query  905   TLSVSK--GRPPQ-GVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPT  735
             +L +++   R  Q  V+Y      T K   F +I NA+ +I+++ RG+N+ILEIQGTLP+
Sbjct  227   SLPLTRVLQRNHQNNVSY------TIKDTSFDNIFNAIGLIAISLRGNNLILEIQGTLPS  280

Query  734   NTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHD  555
             ++K P  + M   V+ S+++IA+C F ++I  YWAYG+ +P +   GG +  + K +  D
Sbjct  281   DSKNPSSKTMWRAVVISHVIIAVCMFLVSIVVYWAYGDKIPAT---GGPIGNYLKLYEQD  337

Query  554   ISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGG  375
              SK     I++  II CLC+Y I  +P  DN E +Y++K++    C  + RM L+V  G 
Sbjct  338   YSKRASCFIHITFIINCLCSYPINLMPACDNAEMVYVTKRQ--KPCSVFARMMLRVSLGL  395

Query  374   LTYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGML  195
             + + ++V F FL  LA  IG++ + +TF YPCFMWI+IK+P   +L+W +N+ +G LG  
Sbjct  396   VCFFIAVGFSFLPYLAVLIGAVALLVTFTYPCFMWISIKQPETKSLMWLINVFVGSLGAS  455

Query  194   MCTVLATATLWNLIADGLHANFFNP  120
             +  +L   +   L   GLHANFF P
Sbjct  456   LSVLLVVTSALFLAEKGLHANFFRP  480



>ref|XP_009138349.1| PREDICTED: lysine histidine transporter-like 7 [Brassica rapa]
Length=475

 Score =   362 bits (928),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 199/444 (45%), Positives = 283/444 (64%), Gaps = 14/444 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             PL+  LPITESR GN ++ T H+  SG+GLQ LLLP AF +LGWVWG+I L++ FVW+LY
Sbjct  44    PLEEWLPITESRKGNVYTATFHLFCSGLGLQVLLLPAAFAALGWVWGVIILTVGFVWKLY  103

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             TIWLLV LHE+  G RFSRY+ LA  +FG K+GKL  IFP MYLSGG+C +L+I GG ++
Sbjct  104   TIWLLVHLHEAVHGIRFSRYLRLAIASFGVKLGKLLGIFPVMYLSGGACSILVITGGKTI  163

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +     M       LT  + F++F C+A+ +   FPNLNSL  +SL+G + AIAYCT +W
Sbjct  164   KQLVHIMSEDGKVPLTTLQCFVIFSCLAVVMCQ-FPNLNSLFGLSLIGGVMAIAYCTAIW  222

Query  905   TLSVSK--GRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTN  732
             +L ++    R    ++Y       +K   F  I NA+ +I+++FRG+N+ILEIQGTLP++
Sbjct  223   SLPLASIPHRNQNNISY------ATKDTSFDTIFNAIGLIAISFRGNNLILEIQGTLPSD  276

Query  731   TKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDI  552
             +K P R+ M   V+ S++ IA+C F +AI  YWAYG+ +P +   GG +  + + +  D 
Sbjct  277   SKNPSRKTMWRAVVISHVFIAVCMFLVAIVVYWAYGDKIPAT---GGPIGNYLELYEQDY  333

Query  551   SKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGL  372
             SK     I++  II CLC+Y I  +P  DN E +Y +K+     C  +VRM  +V    +
Sbjct  334   SKRAACFIHITFIINCLCSYPINLMPACDNAEMVYTTKRH--KPCSVFVRMMFRVFLCLV  391

Query  371   TYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLM  192
              + V+V F FL  LA  IG+I + +TF YPCFMWI+IK+P+  +L+W  N+ +G +G   
Sbjct  392   CFFVAVGFTFLPYLAVLIGAIGLLVTFTYPCFMWISIKQPQRESLMWWFNVSVGSIGASF  451

Query  191   CTVLATATLWNLIADGLHANFFNP  120
               +   A+   L   GLHA FFNP
Sbjct  452   SVLFVVASALRLADKGLHAKFFNP  475



>emb|CDY40643.1| BnaA03g53200D [Brassica napus]
Length=475

 Score =   359 bits (922),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 198/444 (45%), Positives = 282/444 (64%), Gaps = 14/444 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             PL+  LPITESR GN ++ T H+  SG+GLQ LLLP AF +LGWVWG+I L++ F W+LY
Sbjct  44    PLEEWLPITESRKGNVYTATFHLFCSGLGLQVLLLPAAFAALGWVWGVIILTVGFAWKLY  103

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             TIWLLV LHE+  G RFSRY+ LA  +FG K+GKL  IFP MYLSGG+C +L+I GG ++
Sbjct  104   TIWLLVHLHEAVHGIRFSRYLRLAIASFGVKLGKLLGIFPVMYLSGGACSILVITGGKTI  163

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +     M       LT  + F++F C+A+ +   FPNLNSL  +SL+G + AIAYCT +W
Sbjct  164   KQLVHIMSEDGKVPLTTLQCFVIFSCLAVVMCQ-FPNLNSLFGLSLIGGVMAIAYCTAIW  222

Query  905   TLSVSK--GRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTN  732
             +L ++         ++Y       +K   F  I NA+ +I+++FRG+N+ILEIQGTLP++
Sbjct  223   SLPLASIPHTNQNNISY------ATKDTSFDTIFNAIGLIAISFRGNNLILEIQGTLPSD  276

Query  731   TKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDI  552
             +K P R+ M   V+ S++ IA+C F +AI  YWAYG+ +P +   GG +  + + +  D 
Sbjct  277   SKNPSRKTMWRAVVISHVFIAVCMFLVAIVVYWAYGDKIPAT---GGPIGNYLELYEQDY  333

Query  551   SKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGL  372
             SK     I++  II CLC+Y I  +P  DN E +Y +K+     C  +VRM  +V    +
Sbjct  334   SKRAACFIHITFIINCLCSYPINLMPACDNAEMVYTTKRH--KPCSVFVRMMFRVFLCLV  391

Query  371   TYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLM  192
              + V+V F FL  LA  IG+I + +TF YPCFMWI+IK+P+  +L+W  N+ +G +G   
Sbjct  392   CFFVAVGFTFLPYLAVLIGAIGLLVTFTYPCFMWISIKQPQRESLMWWFNVSVGSIGASF  451

Query  191   CTVLATATLWNLIADGLHANFFNP  120
               +   A+   L   GLHANFFNP
Sbjct  452   SVLFVVASALRLADKGLHANFFNP  475



>emb|CDX72525.1| BnaC07g45470D [Brassica napus]
Length=475

 Score =   358 bits (919),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 198/444 (45%), Positives = 282/444 (64%), Gaps = 14/444 (3%)
 Frame = -1

Query  1445  PLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIICLSLLFVWQLY  1266
             PL+  LPITESR GN ++ T H+  SG+GLQ LLLP AF +LGWVWG+I L++ F W+LY
Sbjct  44    PLEEWLPITESRKGNVYTATFHLFCSGLGLQVLLLPAAFAALGWVWGVIILTVGFAWKLY  103

Query  1265  TIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCVMLIINGGGSL  1086
             TIWLLV LHE+  G RFSRY+ LA  +FG K+GKL  IF  MYLSGG+C +L+I GG ++
Sbjct  104   TIWLLVHLHEAVHGIRFSRYLRLAIASFGVKLGKLLGIFLVMYLSGGACSILVITGGKTI  163

Query  1085  QLFYKTMCGGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGSLTAIAYCTILW  906
             +     M       LT  + F++F C+A+ +   FPNLNSL  +SL+G + AIAYCT +W
Sbjct  164   KQLVHIMSEDGKVPLTTLQCFVIFSCLAVVMCQ-FPNLNSLFGLSLIGGVMAIAYCTAIW  222

Query  905   TLSVSK--GRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIILEIQGTLPTN  732
             +L ++    R    ++Y       +K   F  I NA+ +I+++FRG+N+ILEIQGTLP++
Sbjct  223   SLPLASIPHRNQNNISY------ATKDTSFDTIFNAIGLIAISFRGNNLILEIQGTLPSD  276

Query  731   TKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLMPTSYKKGGILNAFEKFHIHDI  552
             +K P R+ M   V+ S++ IA+C F +AI  YWAYG+ +P +   GG +  + + +  D 
Sbjct  277   SKNPSRKTMWRAVVISHVFIAVCMFLVAIVVYWAYGDKIPAT---GGPIGNYLELYEQDY  333

Query  551   SKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVRMGLKVLFGGL  372
             SK     I++  II CLC+Y I  +P  DN E +Y +K+     C  +VRM  +V    +
Sbjct  334   SKRAACFIHITFIINCLCSYPINLMPACDNAEMVYTTKRH--KPCSVFVRMMFRVFLCLV  391

Query  371   TYLVSVAFPFLGSLAGFIGSITMPLTFAYPCFMWIAIKKPRPYTLVWCVNMGLGCLGMLM  192
              + V+V F FL  LA  IG+I + +TF YPCFMWI+IK+P+  +L+W  N+ +G +G   
Sbjct  392   CFFVAVGFTFLPYLAVLIGAIGLLVTFTYPCFMWISIKQPQRESLMWWFNVSVGSIGASF  451

Query  191   CTVLATATLWNLIADGLHANFFNP  120
               +   A+   L   GLHANFFNP
Sbjct  452   SVLFVVASALRLADKGLHANFFNP  475



>ref|XP_002973261.1| hypothetical protein SELMODRAFT_98878 [Selaginella moellendorffii]
 gb|EFJ25635.1| hypothetical protein SELMODRAFT_98878 [Selaginella moellendorffii]
Length=497

 Score =   357 bits (917),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 196/455 (43%), Positives = 278/455 (61%), Gaps = 13/455 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN +    H L++GIG Q LLLPVAF+ LGW WG++ 
Sbjct  52    EEIGHIAKLNPQDAWLPITESRNGNAYYSAFHNLNAGIGFQCLLLPVAFSFLGWFWGVLA  111

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L + F+WQLYT+W+L+ LHE   G R++RY+ LA  AFG ++G     FP + LS G+  
Sbjct  112   LVVAFLWQLYTLWILIKLHEVIPGRRYNRYIELAQAAFGERLGSWLTSFPIISLSAGTAG  171

Query  1115  MLIINGGGSLQLFYKTMC-GGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGS  939
              LI  GG +L LFY  +C     + LT  EW+L+F  +   I+   PNLNS+A +SL+G+
Sbjct  172   GLIAIGGSTLHLFYNLVCIKCHGQSLTAIEWYLVFAVLCAIIAQ-LPNLNSVAGVSLIGA  230

Query  938   LTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIIL  759
             + A+AY T++W LSV++ RPP GV+YD  +  +S    F    NAL VI+ AFRGHN+ L
Sbjct  231   VMAVAYSTMIWILSVTRDRPP-GVSYDVAKPYSSVGAAF-SFLNALGVIAFAFRGHNLAL  288

Query  758   EIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLM-PTSYKKGGILN  582
             EIQ T+P+  K P    M  G  A+Y L+A+C+FPLAI GYWAYG LM PT     GIL 
Sbjct  289   EIQATMPSTLKHPAYVPMWRGSKAAYTLVAICYFPLAIGGYWAYGKLMLPT-----GILT  343

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             +   FH  DIS + +   ++ ++++ L  +QIY++P  D  E+ Y +       CPK  R
Sbjct  344   SMFVFHRSDISPAWLATCFLFVVVSSLSNFQIYSMPTFDLVEQTYTANTN--KPCPKLHR  401

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSI-TMPLTFAYPCFMWIAIKKPRPYTLVWCV  225
                ++LF    + V +AFPF+ S  G +G + ++P+TF YPCFMW+ IKKP   +  W +
Sbjct  402   FVFRLLFVFFGFFVGIAFPFMASFGGLLGGVCSVPVTFCYPCFMWLKIKKPPKLSFSWYL  461

Query  224   NMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             N  LG L ++   V+    +W+++  GL   FF P
Sbjct  462   NWTLGILSVVFTIVVTIGGIWSIVDTGLKFQFFKP  496



>ref|XP_002993623.1| hypothetical protein SELMODRAFT_137348 [Selaginella moellendorffii]
 gb|EFJ05315.1| hypothetical protein SELMODRAFT_137348 [Selaginella moellendorffii]
Length=497

 Score =   357 bits (916),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 196/455 (43%), Positives = 278/455 (61%), Gaps = 13/455 (3%)
 Frame = -1

Query  1475  EPAAQVQAFAPLDSCLPITESRNGNFFSITSHMLSSGIGLQALLLPVAFTSLGWVWGIIC  1296
             E    +    P D+ LPITESRNGN +    H L++GIG Q LLLPVAF+ LGW WG++ 
Sbjct  52    EEIGHIAKLNPQDAWLPITESRNGNAYYSAFHNLNAGIGFQCLLLPVAFSFLGWFWGVLA  111

Query  1295  LSLLFVWQLYTIWLLVDLHESTTGTRFSRYVHLATVAFGGKMGKLAAIFPTMYLSGGSCV  1116
             L + F+WQLYT+W+L+ LHE   G R++RY+ LA  AFG ++G     FP + LS G+  
Sbjct  112   LVVAFLWQLYTLWILIKLHEVIPGRRYNRYIELAQAAFGERLGSWLTSFPIISLSAGTAG  171

Query  1115  MLIINGGGSLQLFYKTMC-GGDPKGLTGAEWFLLFVCIAIFISLFFPNLNSLAWISLLGS  939
              LI  GG +L LFY  +C     + LT  EW+L+F  +   I+   PNLNS+A +SL+G+
Sbjct  172   GLIAIGGSTLHLFYNLVCIKCHGQSLTAIEWYLVFAVLCAIIAQ-LPNLNSVAGVSLIGA  230

Query  938   LTAIAYCTILWTLSVSKGRPPQGVTYDPPQLSTSKLDRFRDIANALAVISLAFRGHNIIL  759
             + A+AY T++W LSV++ RPP GV+YD  +  +S    F    NAL VI+ AFRGHN+ L
Sbjct  231   VMAVAYSTMIWILSVTRDRPP-GVSYDVAKPYSSVGAAF-SFLNALGVIAFAFRGHNLAL  288

Query  758   EIQGTLPTNTKVPLRRRMCTGVIASYILIALCHFPLAIAGYWAYGNLM-PTSYKKGGILN  582
             EIQ T+P+  K P    M  G  A+Y L+A+C+FPLAI GYWAYG LM PT     GIL 
Sbjct  289   EIQATMPSTLKHPAYVPMWRGSKAAYTLVAICYFPLAIGGYWAYGKLMLPT-----GILT  343

Query  581   AFEKFHIHDISKSLMGAIYMIIIIACLCTYQIYALPVLDNWERIYLSKKKMMMSCPKWVR  402
             +   FH  DIS + +   ++ ++++ L  +QIY++P  D  E+ Y +       CPK  R
Sbjct  344   SMFVFHRSDISPAWLATCFLFVVVSSLSNFQIYSMPTFDLVEQTYTANTN--KPCPKLHR  401

Query  401   MGLKVLFGGLTYLVSVAFPFLGSLAGFIGSI-TMPLTFAYPCFMWIAIKKPRPYTLVWCV  225
                ++LF    + V +AFPF+ S  G +G + ++P+TF YPCFMW+ IKKP   +  W +
Sbjct  402   FVFRLLFVFFGFFVGIAFPFMASFGGLLGGVCSVPVTFCYPCFMWLKIKKPPKLSFSWYL  461

Query  224   NMGLGCLGMLMCTVLATATLWNLIADGLHANFFNP  120
             N  LG L ++   V+    +W+++  GL   FF P
Sbjct  462   NWTLGILSVVFTIVVTIGGIWSIVDTGLKFQFFKP  496



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4495759397920